F481104
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 794 | 328 | 1588 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0029400|Ga0395900_0029400_37_777 |
| Length | 246 |
| Sequence | LVLATQKLNSIAGRGTSLPRVLVASVTHSLTSLIGNHGLYAVFGLMAIDAVFPAASELVMVYAGALAAGAFTGQHVDLFGLQISSHLWGFVAMSLAGALGYLVGAIVGWAIGIYGGRPLLEGRGRWFHLSDEKLDRAERWFDRWDVYAVFIGRITPVIRSFISIPAGIFRMPFGPYIVLTAIGSAIWAFAFAGIGWAAGRSYERFHHDFGYVEYVVVAAILVLLAFWIVRRWRASRLSSRASDPAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 179 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 182 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 194 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 196 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 197 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 198 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 199 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 200 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 201 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 202 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 203 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 204 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 205 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 206 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 210 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 211 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 212 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 213 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 310 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 328 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.13 |
| Nodule | 0 |
| Rhizoplane | 13.1 |
| Rhizosphere | 85.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_0029400 | 3300037418 | Bacteria | 5637 |
| 2 | ARcpr5oldR_c001527 | 3300000041 | Bacteria | 2310 |
| 3 | ARSoilOldRDRAFT_c001198 | 3300000044 | Bacteria | 2474 |
| 4 | ARCol0yngRDRAFT_1001520 | 3300000652 | Bacteria | 1883 |
| 5 | JGI24744J21845_10024974 | 3300002077 | Bacteria | 1166 |
| 6 | JGI24742J22300_10005679 | 3300002244 | Bacteria | 2051 |
| 7 | Ga0070658_10063633 | 3300005327 | Bacteria | 3008 |
| 8 | Ga0070683_100001132 | 3300005329 | Bacteria | 20179 |
| 9 | Ga0070683_100073501 | 3300005329 | Unclassified | 3192 |
| 10 | Ga0070683_100561318 | 3300005329 | Unclassified | 1092 |
| 11 | Ga0070690_100035197 | 3300005330 | Bacteria | 3141 |
| 12 | Ga0068869_100093105 | 3300005334 | Unclassified | 2270 |
| 13 | Ga0070680_100009508 | 3300005336 | Bacteria | 7466 |
| 14 | Ga0070680_100016209 | 3300005336 | Bacteria | 5861 |
| 15 | Ga0070682_100090671 | 3300005337 | Bacteria | 1999 |
| 16 | Ga0070682_100207146 | 3300005337 | Bacteria | 1387 |
| 17 | Ga0068868_100009931 | 3300005338 | Bacteria | 6874 |
| 18 | Ga0070689_100071944 | 3300005340 | Bacteria | 2702 |
| 19 | Ga0070689_100093255 | 3300005340 | Bacteria | 2376 |
| 20 | Ga0070689_100412181 | 3300005340 | Bacteria | 1144 |
| 21 | Ga0070689_100558632 | 3300005340 | Bacteria | 987 |
| 22 | Ga0070687_100064691 | 3300005343 | Bacteria | 1944 |
| 23 | Ga0070687_100064918 | 3300005343 | Bacteria | 1941 |
| 24 | Ga0070692_10016160 | 3300005345 | Bacteria | 3547 |
| 25 | Ga0070692_10025432 | 3300005345 | Bacteria | 2917 |
| 26 | Ga0070692_10064432 | 3300005345 | Bacteria | 1938 |
| 27 | Ga0070692_10313742 | 3300005345 | Unclassified | 962 |
| 28 | Ga0070668_100055356 | 3300005347 | Bacteria | 3061 |
| 29 | Ga0070669_100112480 | 3300005353 | Bacteria | 2068 |
| 30 | Ga0070675_100021200 | 3300005354 | Bacteria | 5190 |
| 31 | Ga0070675_100025395 | 3300005354 | Bacteria | 4750 |
| 32 | Ga0070675_100054047 | 3300005354 | Unclassified | 3304 |
| 33 | Ga0070671_100030557 | 3300005355 | Bacteria | 4445 |
| 34 | Ga0070671_100133300 | 3300005355 | Bacteria | 2093 |
| 35 | Ga0070671_100558462 | 3300005355 | Bacteria | 987 |
| 36 | Ga0070671_100825270 | 3300005355 | Bacteria | 808 |
| 37 | Ga0070674_100009597 | 3300005356 | Bacteria | 5801 |
| 38 | Ga0070674_100068587 | 3300005356 | Bacteria | 2499 |
| 39 | Ga0070673_100025478 | 3300005364 | Bacteria | 4354 |
| 40 | Ga0070688_100006251 | 3300005365 | Bacteria | 6349 |
| 41 | Ga0070688_100230009 | 3300005365 | Bacteria | 1311 |
| 42 | Ga0070659_100400312 | 3300005366 | Bacteria | 1159 |
| 43 | Ga0070709_10008009 | 3300005434 | Bacteria | 5800 |
| 44 | Ga0070709_10032025 | 3300005434 | Bacteria | 3168 |
| 45 | Ga0070709_10039702 | 3300005434 | Bacteria | 2889 |
| 46 | Ga0070709_10079592 | 3300005434 | Bacteria | 2135 |
| 47 | Ga0070709_10701453 | 3300005434 | Bacteria | 787 |
| 48 | Ga0070714_100010089 | 3300005435 | Bacteria | 7453 |
| 49 | Ga0070714_100019611 | 3300005435 | Bacteria | 5513 |
| 50 | Ga0070714_100047984 | 3300005435 | Bacteria | 3630 |
| 51 | Ga0070714_100087705 | 3300005435 | Bacteria | 2721 |
| 52 | Ga0070714_100267639 | 3300005435 | Bacteria | 1584 |
| 53 | Ga0070714_100365479 | 3300005435 | Bacteria | 1357 |
| 54 | Ga0070714_100469673 | 3300005435 | Bacteria | 1197 |
| 55 | Ga0070714_100469903 | 3300005435 | Bacteria | 1196 |
| 56 | Ga0070714_100831899 | 3300005435 | Unclassified | 895 |
| 57 | Ga0070713_100010133 | 3300005436 | Bacteria | 6798 |
| 58 | Ga0070713_100035926 | 3300005436 | Bacteria | 3994 |
| 59 | Ga0070713_100053284 | 3300005436 | Bacteria | 3352 |
| 60 | Ga0070710_10017213 | 3300005437 | Bacteria | 3695 |
| 61 | Ga0070710_10178539 | 3300005437 | Bacteria | 1328 |
| 62 | Ga0070701_10008647 | 3300005438 | Bacteria | 4416 |
| 63 | Ga0070701_10371665 | 3300005438 | Bacteria | 899 |
| 64 | Ga0070711_100011916 | 3300005439 | Bacteria | 5411 |
| 65 | Ga0070705_100011381 | 3300005440 | Bacteria | 4488 |
| 66 | Ga0070700_100005322 | 3300005441 | Bacteria | 6803 |
| 67 | Ga0070694_100019402 | 3300005444 | Bacteria | 4323 |
| 68 | Ga0070694_100053548 | 3300005444 | Bacteria | 2731 |
| 69 | Ga0070708_100056153 | 3300005445 | Bacteria | 3502 |
| 70 | Ga0070708_100336344 | 3300005445 | Bacteria | 1423 |
| 71 | Ga0070708_100386059 | 3300005445 | Unclassified | 1320 |
| 72 | Ga0070708_100955836 | 3300005445 | Bacteria | 804 |
| 73 | Ga0070663_100026225 | 3300005455 | Bacteria | 3945 |
| 74 | Ga0070678_100004934 | 3300005456 | Bacteria | 7635 |
| 75 | Ga0070678_100099793 | 3300005456 | Bacteria | 2247 |
| 76 | Ga0070678_100124160 | 3300005456 | Bacteria | 2040 |
| 77 | Ga0070678_100356538 | 3300005456 | Bacteria | 1259 |
| 78 | Ga0070678_100650156 | 3300005456 | Bacteria | 946 |
| 79 | Ga0070678_100748952 | 3300005456 | Bacteria | 883 |
| 80 | Ga0070662_100187823 | 3300005457 | Unclassified | 1632 |
| 81 | Ga0070681_10140546 | 3300005458 | Bacteria | 2345 |
| 82 | Ga0070681_10482394 | 3300005458 | Bacteria | 1153 |
| 83 | Ga0068867_100007112 | 3300005459 | Bacteria | 7906 |
| 84 | Ga0070685_10031783 | 3300005466 | Bacteria | 2952 |
| 85 | Ga0070685_10035346 | 3300005466 | Bacteria | 2818 |
| 86 | Ga0070685_10230715 | 3300005466 | Bacteria | 1217 |
| 87 | Ga0070685_10263007 | 3300005466 | Bacteria | 1148 |
| 88 | Ga0070706_100010372 | 3300005467 | Bacteria | 8654 |
| 89 | Ga0070706_100029184 | 3300005467 | Bacteria | 5083 |
| 90 | Ga0070706_100618321 | 3300005467 | Unclassified | 1006 |
| 91 | Ga0070707_100000909 | 3300005468 | Bacteria | 29346 |
| 92 | Ga0070707_100087219 | 3300005468 | Bacteria | 3019 |
| 93 | Ga0070707_100204043 | 3300005468 | Bacteria | 1927 |
| 94 | Ga0070707_100252926 | 3300005468 | Bacteria | 1715 |
| 95 | Ga0070698_100013881 | 3300005471 | Bacteria | 8520 |
| 96 | Ga0070698_100016227 | 3300005471 | Bacteria | 7861 |
| 97 | Ga0070698_100019860 | 3300005471 | Bacteria | 7048 |
| 98 | Ga0070698_100084213 | 3300005471 | Bacteria | 3168 |
| 99 | Ga0070699_100010102 | 3300005518 | Bacteria | 8173 |
| 100 | Ga0070679_100027984 | 3300005530 | Bacteria | 5554 |
| 101 | Ga0070679_100900366 | 3300005530 | Unclassified | 828 |
| 102 | Ga0070684_100004414 | 3300005535 | Bacteria | 10705 |
| 103 | Ga0070684_100107423 | 3300005535 | Unclassified | 2499 |
| 104 | Ga0070684_100373728 | 3300005535 | Unclassified | 1312 |
| 105 | Ga0070684_100395442 | 3300005535 | Bacteria | 1274 |
| 106 | Ga0070697_100466601 | 3300005536 | Bacteria | 1101 |
| 107 | Ga0070697_100476492 | 3300005536 | Archaea | 1090 |
| 108 | Ga0070697_100797587 | 3300005536 | Unclassified | 835 |
| 109 | Ga0068853_100035448 | 3300005539 | Bacteria | 4238 |
| 110 | Ga0068853_100389054 | 3300005539 | Bacteria | 1303 |
| 111 | Ga0070672_100041476 | 3300005543 | Bacteria | 3538 |
| 112 | Ga0070672_100382598 | 3300005543 | Bacteria | 1204 |
| 113 | Ga0070686_100057424 | 3300005544 | Bacteria | 2500 |
| 114 | Ga0070686_100161179 | 3300005544 | Bacteria | 1580 |
| 115 | Ga0070696_100014793 | 3300005546 | Bacteria | 5236 |
| 116 | Ga0070696_100022985 | 3300005546 | Bacteria | 4239 |
| 117 | Ga0070696_100146870 | 3300005546 | Bacteria | 1728 |
| 118 | Ga0070696_100161192 | 3300005546 | Bacteria | 1652 |
| 119 | Ga0070696_100220852 | 3300005546 | Bacteria | 1422 |
| 120 | Ga0070693_100009420 | 3300005547 | Bacteria | 4855 |
| 121 | Ga0070665_100069250 | 3300005548 | Bacteria | 3536 |
| 122 | Ga0070665_100085810 | 3300005548 | Bacteria | 3154 |
| 123 | Ga0070704_100041831 | 3300005549 | Bacteria | 3165 |
| 124 | Ga0070704_100837632 | 3300005549 | Unclassified | 824 |
| 125 | Ga0068855_100417506 | 3300005563 | Unclassified | 1468 |
| 126 | Ga0068855_100507303 | 3300005563 | Bacteria | 1310 |
| 127 | Ga0068855_100521562 | 3300005563 | Unclassified | 1289 |
| 128 | Ga0070664_100581354 | 3300005564 | Bacteria | 1038 |
| 129 | Ga0068854_100017760 | 3300005578 | Bacteria | 4765 |
| 130 | Ga0068856_100119874 | 3300005614 | Bacteria | 2632 |
| 131 | Ga0068856_100125443 | 3300005614 | Bacteria | 2570 |
| 132 | Ga0068856_100208374 | 3300005614 | Bacteria | 1970 |
| 133 | Ga0068856_100503720 | 3300005614 | Bacteria | 1232 |
| 134 | Ga0068856_100589296 | 3300005614 | Bacteria | 1133 |
| 135 | Ga0068856_100592582 | 3300005614 | Bacteria | 1130 |
| 136 | Ga0070702_100044554 | 3300005615 | Bacteria | 2505 |
| 137 | Ga0068852_100007153 | 3300005616 | Bacteria | 8132 |
| 138 | Ga0068864_100042630 | 3300005618 | Bacteria | 3884 |
| 139 | Ga0068866_10001654 | 3300005718 | Bacteria | 9397 |
| 140 | Ga0068861_100304490 | 3300005719 | Bacteria | 1382 |
| 141 | Ga0068861_100407985 | 3300005719 | Bacteria | 1207 |
| 142 | Ga0068870_10185658 | 3300005840 | Unclassified | 1251 |
| 143 | Ga0068870_10348104 | 3300005840 | Bacteria | 950 |
| 144 | Ga0068863_100147006 | 3300005841 | Bacteria | 2255 |
| 145 | Ga0068863_100235457 | 3300005841 | Bacteria | 1767 |
| 146 | Ga0068860_100472446 | 3300005843 | Unclassified | 1249 |
| 147 | Ga0068862_100137440 | 3300005844 | Bacteria | 2167 |
| 148 | Ga0068862_100346752 | 3300005844 | Unclassified | 1377 |
| 149 | Ga0081455_10003628 | 3300005937 | Bacteria | 17682 |
| 150 | Ga0081455_10010129 | 3300005937 | Bacteria | 9605 |
| 151 | Ga0081455_10033361 | 3300005937 | Bacteria | 4627 |
| 152 | Ga0081538_10000181 | 3300005981 | Bacteria | 68890 |
| 153 | Ga0081539_10001630 | 3300005985 | Bacteria | 36632 |
| 154 | Ga0081539_10003156 | 3300005985 | Bacteria | 20906 |
| 155 | Ga0070717_10058803 | 3300006028 | Bacteria | 3179 |
| 156 | Ga0070717_10070824 | 3300006028 | Bacteria | 2907 |
| 157 | Ga0070717_10950314 | 3300006028 | Bacteria | 783 |
| 158 | Ga0075365_10008948 | 3300006038 | Bacteria | 5722 |
| 159 | Ga0075365_10010552 | 3300006038 | Bacteria | 5386 |
| 160 | Ga0075368_10189145 | 3300006042 | Bacteria | 869 |
| 161 | Ga0075364_10015658 | 3300006051 | Bacteria | 4706 |
| 162 | Ga0075364_10256238 | 3300006051 | Bacteria | 1189 |
| 163 | Ga0075432_10006746 | 3300006058 | Bacteria | 3912 |
| 164 | Ga0075432_10008669 | 3300006058 | Bacteria | 3470 |
| 165 | Ga0075432_10060501 | 3300006058 | Bacteria | 1347 |
| 166 | Ga0075432_10105568 | 3300006058 | Unclassified | 1045 |
| 167 | Ga0070715_10011178 | 3300006163 | Bacteria | 3225 |
| 168 | Ga0070715_10098592 | 3300006163 | Bacteria | 1359 |
| 169 | Ga0070716_100011827 | 3300006173 | Bacteria | 4404 |
| 170 | Ga0070716_100040145 | 3300006173 | Bacteria | 2602 |
| 171 | Ga0070716_100153079 | 3300006173 | Bacteria | 1486 |
| 172 | Ga0075367_10208047 | 3300006178 | Bacteria | 1223 |
| 173 | Ga0097621_100101144 | 3300006237 | Bacteria | 2425 |
| 174 | Ga0097621_100124221 | 3300006237 | Bacteria | 2191 |
| 175 | Ga0097621_100498328 | 3300006237 | Bacteria | 1103 |
| 176 | Ga0068871_100068191 | 3300006358 | Bacteria | 2920 |
| 177 | Ga0075428_100058578 | 3300006844 | Bacteria | 4217 |
| 178 | Ga0075430_100061459 | 3300006846 | Bacteria | 3156 |
| 179 | Ga0075433_10002296 | 3300006852 | Bacteria | 14564 |
| 180 | Ga0075433_10137454 | 3300006852 | Bacteria | 2172 |
| 181 | Ga0075433_10300598 | 3300006852 | Bacteria | 1421 |
| 182 | Ga0075434_100006048 | 3300006871 | Bacteria | 11066 |
| 183 | Ga0075434_100054947 | 3300006871 | Bacteria | 3957 |
| 184 | Ga0075434_100898267 | 3300006871 | Bacteria | 901 |
| 185 | Ga0075429_100069363 | 3300006880 | Bacteria | 3070 |
| 186 | Ga0068865_100031951 | 3300006881 | Bacteria | 3513 |
| 187 | Ga0068865_100033545 | 3300006881 | Bacteria | 3438 |
| 188 | Ga0068865_100195356 | 3300006881 | Unclassified | 1568 |
| 189 | Ga0075436_100004384 | 3300006914 | Bacteria | 9687 |
| 190 | Ga0075436_100004922 | 3300006914 | Bacteria | 9179 |
| 191 | Ga0075436_100047461 | 3300006914 | Bacteria | 2962 |
| 192 | Ga0075435_100033336 | 3300007076 | Bacteria | 4071 |
| 193 | Ga0075435_100216785 | 3300007076 | Bacteria | 1624 |
| 194 | Ga0075435_100576152 | 3300007076 | Bacteria | 975 |
| 195 | Ga0105240_11156343 | 3300009093 | Unclassified | 821 |
| 196 | Ga0111539_10154815 | 3300009094 | Bacteria | 2682 |
| 197 | Ga0111539_10335011 | 3300009094 | Bacteria | 1761 |
| 198 | Ga0111539_10675061 | 3300009094 | Bacteria | 1203 |
| 199 | Ga0105245_10019492 | 3300009098 | Bacteria | 5943 |
| 200 | Ga0105245_10055417 | 3300009098 | Bacteria | 3561 |
| 201 | Ga0105245_10139709 | 3300009098 | Bacteria | 2280 |
| 202 | Ga0105245_10401349 | 3300009098 | Bacteria | 1370 |
| 203 | Ga0105245_10461427 | 3300009098 | Bacteria | 1280 |
| 204 | Ga0105245_10485890 | 3300009098 | Unclassified | 1249 |
| 205 | Ga0105245_10770325 | 3300009098 | Unclassified | 999 |
| 206 | Ga0114129_10000650 | 3300009147 | Bacteria | 43475 |
| 207 | Ga0114129_10077628 | 3300009147 | Bacteria | 4619 |
| 208 | Ga0114129_10082078 | 3300009147 | Bacteria | 4480 |
| 209 | Ga0114129_11012139 | 3300009147 | Bacteria | 1046 |
| 210 | Ga0114129_11273403 | 3300009147 | Unclassified | 912 |
| 211 | Ga0114129_11376462 | 3300009147 | Bacteria | 871 |
| 212 | Ga0105243_10012417 | 3300009148 | Bacteria | 6438 |
| 213 | Ga0105243_10428012 | 3300009148 | Bacteria | 1236 |
| 214 | Ga0105241_10053613 | 3300009174 | Bacteria | 3085 |
| 215 | Ga0105241_10183289 | 3300009174 | Bacteria | 1738 |
| 216 | Ga0105242_10016433 | 3300009176 | Bacteria | 5753 |
| 217 | Ga0105242_10105058 | 3300009176 | Bacteria | 2398 |
| 218 | Ga0105242_10152278 | 3300009176 | Bacteria | 2017 |
| 219 | Ga0105242_10170134 | 3300009176 | Bacteria | 1914 |
| 220 | Ga0105242_10187720 | 3300009176 | Bacteria | 1828 |
| 221 | Ga0105242_10328456 | 3300009176 | Bacteria | 1405 |
| 222 | Ga0105242_10490226 | 3300009176 | Bacteria | 1167 |
| 223 | Ga0105248_10221410 | 3300009177 | Bacteria | 2130 |
| 224 | Ga0105248_10234821 | 3300009177 | Bacteria | 2064 |
| 225 | Ga0105248_10387784 | 3300009177 | Bacteria | 1573 |
| 226 | Ga0105248_10564577 | 3300009177 | Bacteria | 1284 |
| 227 | Ga0105248_10722298 | 3300009177 | Bacteria | 1124 |
| 228 | Ga0105248_10797037 | 3300009177 | Bacteria | 1066 |
| 229 | Ga0105237_10337772 | 3300009545 | Unclassified | 1511 |
| 230 | Ga0105238_10359305 | 3300009551 | Bacteria | 1446 |
| 231 | Ga0105238_10627084 | 3300009551 | Bacteria | 1084 |
| 232 | Ga0105249_10000965 | 3300009553 | Bacteria | 25443 |
| 233 | Ga0105249_10198048 | 3300009553 | Bacteria | 1964 |
| 234 | Ga0105249_10270196 | 3300009553 | Bacteria | 1694 |
| 235 | Ga0105239_10009394 | 3300010375 | Bacteria | 11026 |
| 236 | Ga0105239_10111517 | 3300010375 | Bacteria | 3032 |
| 237 | Ga0105246_10076032 | 3300011119 | Unclassified | 2378 |
| 238 | Ga0105246_10201405 | 3300011119 | Bacteria | 1548 |
| 239 | Ga0105246_10481381 | 3300011119 | Bacteria | 1050 |
| 240 | Ga0157374_10219891 | 3300013296 | Bacteria | 1864 |
| 241 | Ga0157374_10379687 | 3300013296 | Bacteria | 1408 |
| 242 | Ga0157374_10844756 | 3300013296 | Bacteria | 932 |
| 243 | Ga0157378_10019201 | 3300013297 | Bacteria | 6007 |
| 244 | Ga0157378_10596879 | 3300013297 | Bacteria | 1115 |
| 245 | Ga0163162_10031838 | 3300013306 | Bacteria | 5233 |
| 246 | Ga0163162_10618569 | 3300013306 | Bacteria | 1208 |
| 247 | Ga0163162_10665410 | 3300013306 | Bacteria | 1164 |
| 248 | Ga0163162_10818463 | 3300013306 | Unclassified | 1048 |
| 249 | Ga0157372_10993946 | 3300013307 | Unclassified | 972 |
| 250 | Ga0157372_11098120 | 3300013307 | Unclassified | 920 |
| 251 | Ga0157375_10040324 | 3300013308 | Bacteria | 4500 |
| 252 | Ga0157375_10049718 | 3300013308 | Bacteria | 4110 |
| 253 | Ga0157375_10080491 | 3300013308 | Bacteria | 3296 |
| 254 | Ga0157375_10107832 | 3300013308 | Bacteria | 2879 |
| 255 | Ga0157375_10393026 | 3300013308 | Bacteria | 1553 |
| 256 | Ga0157375_10629173 | 3300013308 | Bacteria | 1231 |
| 257 | Ga0157375_10693929 | 3300013308 | Bacteria | 1172 |
| 258 | Ga0157380_10015971 | 3300014326 | Bacteria | 5527 |
| 259 | Ga0157380_10039497 | 3300014326 | Bacteria | 3670 |
| 260 | Ga0157380_10100519 | 3300014326 | Bacteria | 2408 |
| 261 | Ga0182008_10072275 | 3300014497 | Bacteria | 1697 |
| 262 | Ga0182008_10092444 | 3300014497 | Unclassified | 1492 |
| 263 | Ga0182008_10120604 | 3300014497 | Bacteria | 1303 |
| 264 | Ga0157377_10000750 | 3300014745 | Bacteria | 13442 |
| 265 | Ga0157377_10040044 | 3300014745 | Bacteria | 2594 |
| 266 | Ga0157377_10303752 | 3300014745 | Bacteria | 1054 |
| 267 | Ga0157376_10010003 | 3300014969 | Bacteria | 6920 |
| 268 | Ga0157376_10116744 | 3300014969 | Bacteria | 2359 |
| 269 | Ga0157376_10164166 | 3300014969 | Bacteria | 2016 |
| 270 | Ga0163161_10059334 | 3300017792 | Bacteria | 2782 |
| 271 | Ga0207653_10010560 | 3300025885 | Bacteria | 2881 |
| 272 | Ga0207692_10003802 | 3300025898 | Bacteria | 5932 |
| 273 | Ga0207692_10148424 | 3300025898 | Bacteria | 1340 |
| 274 | Ga0207642_10003142 | 3300025899 | Bacteria | 5178 |
| 275 | Ga0207688_10060393 | 3300025901 | Bacteria | 2135 |
| 276 | Ga0207680_10155934 | 3300025903 | Bacteria | 1527 |
| 277 | Ga0207647_10056111 | 3300025904 | Bacteria | 2417 |
| 278 | Ga0207699_10031396 | 3300025906 | Unclassified | 2982 |
| 279 | Ga0207699_10056326 | 3300025906 | Bacteria | 2342 |
| 280 | Ga0207699_10081081 | 3300025906 | Bacteria | 2012 |
| 281 | Ga0207684_10326935 | 3300025910 | Bacteria | 1321 |
| 282 | Ga0207707_10042524 | 3300025912 | Bacteria | 3965 |
| 283 | Ga0207707_10095126 | 3300025912 | Bacteria | 2604 |
| 284 | Ga0207671_10079986 | 3300025914 | Bacteria | 2449 |
| 285 | Ga0207693_10001710 | 3300025915 | Bacteria | 19319 |
| 286 | Ga0207693_10135856 | 3300025915 | Bacteria | 1933 |
| 287 | Ga0207693_10165383 | 3300025915 | Bacteria | 1741 |
| 288 | Ga0207693_10584589 | 3300025915 | Unclassified | 870 |
| 289 | Ga0207693_10597460 | 3300025915 | Bacteria | 859 |
| 290 | Ga0207693_10597606 | 3300025915 | Bacteria | 859 |
| 291 | Ga0207663_10009122 | 3300025916 | Bacteria | 5230 |
| 292 | Ga0207663_10045637 | 3300025916 | Bacteria | 2696 |
| 293 | Ga0207660_10331824 | 3300025917 | Bacteria | 1216 |
| 294 | Ga0207662_10047280 | 3300025918 | Bacteria | 2548 |
| 295 | Ga0207662_10047395 | 3300025918 | Bacteria | 2545 |
| 296 | Ga0207652_10090093 | 3300025921 | Bacteria | 2694 |
| 297 | Ga0207652_10344289 | 3300025921 | Bacteria | 1346 |
| 298 | Ga0207646_10004651 | 3300025922 | Bacteria | 14812 |
| 299 | Ga0207646_10016324 | 3300025922 | Bacteria | 6970 |
| 300 | Ga0207646_10064202 | 3300025922 | Bacteria | 3277 |
| 301 | Ga0207646_10208809 | 3300025922 | Bacteria | 1763 |
| 302 | Ga0207694_10418445 | 3300025924 | Unclassified | 1116 |
| 303 | Ga0207659_10056552 | 3300025926 | Bacteria | 2810 |
| 304 | Ga0207659_10071588 | 3300025926 | Bacteria | 2532 |
| 305 | Ga0207659_10144882 | 3300025926 | Bacteria | 1848 |
| 306 | Ga0207687_10013811 | 3300025927 | Bacteria | 5275 |
| 307 | Ga0207687_10019852 | 3300025927 | Bacteria | 4456 |
| 308 | Ga0207687_10103038 | 3300025927 | Bacteria | 2104 |
| 309 | Ga0207687_10179157 | 3300025927 | Bacteria | 1641 |
| 310 | Ga0207687_10275856 | 3300025927 | Bacteria | 1346 |
| 311 | Ga0207687_10499576 | 3300025927 | Bacteria | 1015 |
| 312 | Ga0207687_10580135 | 3300025927 | Bacteria | 943 |
| 313 | Ga0207687_10810727 | 3300025927 | Unclassified | 799 |
| 314 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 315 | Ga0207700_10063413 | 3300025928 | Bacteria | 2811 |
| 316 | Ga0207700_10071577 | 3300025928 | Bacteria | 2670 |
| 317 | Ga0207700_10483131 | 3300025928 | Bacteria | 1095 |
| 318 | Ga0207664_10010013 | 3300025929 | Bacteria | 6681 |
| 319 | Ga0207664_10018136 | 3300025929 | Bacteria | 5173 |
| 320 | Ga0207664_10028774 | 3300025929 | Bacteria | 4226 |
| 321 | Ga0207664_10051940 | 3300025929 | Bacteria | 3239 |
| 322 | Ga0207664_10059700 | 3300025929 | Bacteria | 3038 |
| 323 | Ga0207664_10252999 | 3300025929 | Unclassified | 1538 |
| 324 | Ga0207664_10672616 | 3300025929 | Unclassified | 931 |
| 325 | Ga0207664_10789151 | 3300025929 | Bacteria | 854 |
| 326 | Ga0207644_10269371 | 3300025931 | Bacteria | 1364 |
| 327 | Ga0207690_10246864 | 3300025932 | Bacteria | 1377 |
| 328 | Ga0207706_10272694 | 3300025933 | Bacteria | 1476 |
| 329 | Ga0207686_10005166 | 3300025934 | Bacteria | 7017 |
| 330 | Ga0207686_10046889 | 3300025934 | Bacteria | 2668 |
| 331 | Ga0207686_10193098 | 3300025934 | Bacteria | 1453 |
| 332 | Ga0207686_10764527 | 3300025934 | Unclassified | 772 |
| 333 | Ga0207709_10005645 | 3300025935 | Bacteria | 7072 |
| 334 | Ga0207709_10231802 | 3300025935 | Bacteria | 1338 |
| 335 | Ga0207709_10527490 | 3300025935 | Bacteria | 925 |
| 336 | Ga0207670_10040358 | 3300025936 | Bacteria | 3063 |
| 337 | Ga0207669_10044297 | 3300025937 | Unclassified | 2613 |
| 338 | Ga0207669_10056848 | 3300025937 | Bacteria | 2378 |
| 339 | Ga0207704_10014139 | 3300025938 | Bacteria | 4021 |
| 340 | Ga0207704_10178414 | 3300025938 | Unclassified | 1532 |
| 341 | Ga0207665_10001701 | 3300025939 | Bacteria | 14795 |
| 342 | Ga0207665_10025099 | 3300025939 | Bacteria | 3931 |
| 343 | Ga0207665_10029853 | 3300025939 | Bacteria | 3603 |
| 344 | Ga0207665_10055886 | 3300025939 | Unclassified | 2664 |
| 345 | Ga0207665_10629570 | 3300025939 | Bacteria | 839 |
| 346 | Ga0207665_10780916 | 3300025939 | Bacteria | 754 |
| 347 | Ga0207691_10007885 | 3300025940 | Bacteria | 10260 |
| 348 | Ga0207691_10461564 | 3300025940 | Bacteria | 1080 |
| 349 | Ga0207711_10145700 | 3300025941 | Bacteria | 2134 |
| 350 | Ga0207689_10163827 | 3300025942 | Bacteria | 1832 |
| 351 | Ga0207661_10119911 | 3300025944 | Bacteria | 2238 |
| 352 | Ga0207661_10240893 | 3300025944 | Bacteria | 1605 |
| 353 | Ga0207661_10245564 | 3300025944 | Bacteria | 1590 |
| 354 | Ga0207661_10361880 | 3300025944 | Bacteria | 1310 |
| 355 | Ga0207667_10374227 | 3300025949 | Bacteria | 1451 |
| 356 | Ga0207651_10363277 | 3300025960 | Bacteria | 1223 |
| 357 | Ga0207712_10008993 | 3300025961 | Bacteria | 6318 |
| 358 | Ga0207668_10041033 | 3300025972 | Bacteria | 3126 |
| 359 | Ga0207668_10214253 | 3300025972 | Bacteria | 1542 |
| 360 | Ga0207640_10201530 | 3300025981 | Bacteria | 1508 |
| 361 | Ga0207677_10067786 | 3300026023 | Bacteria | 2501 |
| 362 | Ga0207677_10399012 | 3300026023 | Bacteria | 1166 |
| 363 | Ga0207639_10043763 | 3300026041 | Bacteria | 3363 |
| 364 | Ga0207639_10160172 | 3300026041 | Bacteria | 1895 |
| 365 | Ga0207708_10024437 | 3300026075 | Bacteria | 4570 |
| 366 | Ga0207708_10035492 | 3300026075 | Bacteria | 3794 |
| 367 | Ga0207708_10223180 | 3300026075 | Bacteria | 1510 |
| 368 | Ga0207708_10319123 | 3300026075 | Bacteria | 1267 |
| 369 | Ga0207708_10360749 | 3300026075 | Unclassified | 1194 |
| 370 | Ga0207702_10012256 | 3300026078 | Bacteria | 7135 |
| 371 | Ga0207702_10277618 | 3300026078 | Bacteria | 1583 |
| 372 | Ga0207702_10542896 | 3300026078 | Bacteria | 1136 |
| 373 | Ga0207702_11012307 | 3300026078 | Bacteria | 824 |
| 374 | Ga0207641_10408810 | 3300026088 | Bacteria | 1305 |
| 375 | Ga0207648_10000681 | 3300026089 | Bacteria | 38041 |
| 376 | Ga0207676_10028089 | 3300026095 | Bacteria | 4199 |
| 377 | Ga0207674_10079407 | 3300026116 | Bacteria | 3285 |
| 378 | Ga0207675_100139889 | 3300026118 | Bacteria | 2299 |
| 379 | Ga0207675_100195585 | 3300026118 | Bacteria | 1941 |
| 380 | Ga0207675_100406984 | 3300026118 | Unclassified | 1342 |
| 381 | Ga0207683_10000791 | 3300026121 | Bacteria | 28823 |
| 382 | Ga0207683_10017796 | 3300026121 | Bacteria | 6061 |
| 383 | Ga0207683_10167939 | 3300026121 | Bacteria | 1986 |
| 384 | Ga0207683_10401281 | 3300026121 | Bacteria | 1261 |
| 385 | Ga0207698_10372510 | 3300026142 | Bacteria | 1356 |
| 386 | Ga0207428_10001019 | 3300027907 | Bacteria | 31027 |
| 387 | Ga0207428_10003917 | 3300027907 | Bacteria | 14275 |
| 388 | Ga0268266_10112430 | 3300028379 | Bacteria | 2414 |
| 389 | Ga0268266_10172166 | 3300028379 | Bacteria | 1966 |
| 390 | Ga0268265_10051733 | 3300028380 | Bacteria | 3102 |
| 391 | Ga0268264_10243633 | 3300028381 | Bacteria | 1666 |
| 392 | Ga0268264_10262256 | 3300028381 | Bacteria | 1610 |
| 393 | Ga0268264_10709722 | 3300028381 | Bacteria | 999 |
| 394 | Ga0265336_10058042 | 3300028666 | Unclassified | 1162 |
| 395 | Ga0265338_10020387 | 3300028800 | Bacteria | 6975 |
| 396 | Ga0307408_100627510 | 3300031548 | Bacteria | 958 |
| 397 | Ga0307406_10499954 | 3300031901 | Bacteria | 986 |
| 398 | Ga0307412_10603085 | 3300031911 | Unclassified | 930 |
| 399 | Ga0307409_100541373 | 3300031995 | Bacteria | 1141 |
| 400 | Ga0307416_100037748 | 3300032002 | Bacteria | 3721 |
| 401 | Ga0307416_101316275 | 3300032002 | Bacteria | 828 |
| 402 | Ga0373930_0020049 | 3300034816 | Unclassified | 1300 |
| 403 | Ga0373948_0016308 | 3300034817 | Bacteria | 1372 |
| 404 | Ga0373928_0065876 | 3300035084 | Bacteria | 885 |
| 405 | Ga0373940_0088764 | 3300035088 | Bacteria | 923 |
| 406 | Ga0373923_0233415 | 3300035111 | Unclassified | 858 |
| 407 | Ga0373939_0013390 | 3300035114 | Bacteria | 2110 |
| 408 | Ga0373939_0041962 | 3300035114 | Bacteria | 1381 |
| 409 | Ga0373960_0016605 | 3300035121 | Bacteria | 1897 |
| 410 | Ga0373960_0156303 | 3300035121 | Unclassified | 782 |
| 411 | Ga0373943_0006172 | 3300035170 | Bacteria | 5379 |
| 412 | Ga0373943_0103371 | 3300035170 | Bacteria | 1493 |
| 413 | Ga0373962_0069972 | 3300035242 | Bacteria | 1047 |
| 414 | Ga0373931_0201021 | 3300035691 | Bacteria | 1190 |
| 415 | Ga0373935_0053786 | 3300035692 | Bacteria | 2562 |
| 416 | Ga0373927_0116773 | 3300035695 | Bacteria | 1740 |
| 417 | Ga0373933_0013384 | 3300035724 | Bacteria | 4546 |
| 418 | Ga0373947_0016652 | 3300035725 | Bacteria | 4223 |
| 419 | Ga0373937_0026524 | 3300036401 | Bacteria | 5235 |
| 420 | Ga0373925_0094741 | 3300037068 | Bacteria | 2286 |
| 421 | Ga0395899_0005999 | 3300037312 | Bacteria | 9436 |
| 422 | Ga0395899_0030800 | 3300037312 | Bacteria | 4034 |
| 423 | Ga0395899_0045590 | 3300037312 | Bacteria | 3266 |
| 424 | Ga0395899_0056773 | 3300037312 | Bacteria | 2892 |
| 425 | Ga0395899_0205733 | 3300037312 | Bacteria | 1370 |
| 426 | Ga0395900_0002741 | 3300037418 | Bacteria | 19239 |
| 427 | Ga0395900_0004817 | 3300037418 | Bacteria | 14211 |
| 428 | Ga0395900_0023127 | 3300037418 | Bacteria | 6360 |
| 429 | Ga0395900_0025542 | 3300037418 | Bacteria | 6047 |
| 430 | Ga0395900_0145180 | 3300037418 | Unclassified | 2426 |
| 431 | Ga0395900_0236926 | 3300037418 | Bacteria | 1832 |
| 432 | Ga0395900_0261642 | 3300037418 | Bacteria | 1727 |
| 433 | Ga0395900_0335860 | 3300037418 | Bacteria | 1488 |
| 434 | Ga0395900_0426317 | 3300037418 | Bacteria | 1286 |
| 435 | Ga0395900_0557324 | 3300037418 | Unclassified | 1090 |
| 436 | Ga0395898_0003147 | 3300037466 | Bacteria | 18636 |
| 437 | Ga0395898_0004326 | 3300037466 | Bacteria | 15556 |
| 438 | Ga0395898_0039374 | 3300037466 | Bacteria | 4679 |
| 439 | Ga0395898_0054665 | 3300037466 | Bacteria | 3895 |
| 440 | Ga0395898_0133290 | 3300037466 | Unclassified | 2379 |
| 441 | Ga0395898_0348161 | 3300037466 | Bacteria | 1413 |
| 442 | Ga0395898_0464029 | 3300037466 | Unclassified | 1205 |
| 443 | Ga0395898_0503590 | 3300037466 | Bacteria | 1152 |
| 444 | Ga0395898_0539684 | 3300037466 | Bacteria | 1108 |
| 445 | Ga0395898_0586197 | 3300037466 | Bacteria | 1058 |
| 446 | Ga0395905_0007344 | 3300037471 | Bacteria | 10975 |
| 447 | Ga0395905_0016351 | 3300037471 | Bacteria | 7049 |
| 448 | Ga0395905_0019309 | 3300037471 | Bacteria | 6462 |
| 449 | Ga0395905_0094917 | 3300037471 | Bacteria | 2798 |
| 450 | Ga0395905_0119025 | 3300037471 | Bacteria | 2482 |
| 451 | Ga0395905_0306752 | 3300037471 | Bacteria | 1475 |
| 452 | Ga0395901_0000679 | 3300038443 | Bacteria | 39130 |
| 453 | Ga0395901_0005496 | 3300038443 | Bacteria | 12838 |
| 454 | Ga0395901_0007953 | 3300038443 | Bacteria | 10698 |
| 455 | Ga0395901_0009487 | 3300038443 | Bacteria | 9872 |
| 456 | Ga0395901_0011081 | 3300038443 | Bacteria | 9139 |
| 457 | Ga0395901_0011784 | 3300038443 | Bacteria | 8866 |
| 458 | Ga0395901_0056235 | 3300038443 | Bacteria | 4092 |
| 459 | Ga0395901_0059352 | 3300038443 | Bacteria | 3980 |
| 460 | Ga0395901_0182247 | 3300038443 | Bacteria | 2203 |
| 461 | Ga0395901_0205150 | 3300038443 | Bacteria | 2065 |
| 462 | Ga0395901_0233985 | 3300038443 | Bacteria | 1918 |
| 463 | Ga0395901_0329096 | 3300038443 | Unclassified | 1580 |
| 464 | Ga0395901_0337246 | 3300038443 | Bacteria | 1558 |
| 465 | Ga0395901_0338928 | 3300038443 | Bacteria | 1553 |
| 466 | Ga0395901_0339093 | 3300038443 | Bacteria | 1553 |
| 467 | Ga0395901_0418172 | 3300038443 | Bacteria | 1375 |
| 468 | Ga0395901_0427918 | 3300038443 | Bacteria | 1356 |
| 469 | Ga0395901_0467353 | 3300038443 | Bacteria | 1288 |
| 470 | Ga0436360_0517229 | 3300039438 | Bacteria | 1935 |
| 471 | Ga0451798_0569168 | 3300041458 | Bacteria | 959 |
| 472 | Ga0451853_1574808 | 3300041512 | Bacteria | 2193 |
| 473 | Ga0451853_3232296 | 3300041512 | Unclassified | 1238 |
| 474 | Ga0439433_0078641 | 3300041999 | Unclassified | 800 |
| 475 | Ga0439445_0017242 | 3300042004 | Bacteria | 1784 |
| 476 | Ga0439448_0001266 | 3300042005 | Bacteria | 6463 |
| 477 | Ga0439463_039302 | 3300042016 | Bacteria | 1201 |
| 478 | Ga0450888_018496 | 3300042126 | Bacteria | 872 |
| 479 | Ga0450906_017114 | 3300042145 | Bacteria | 1309 |
| 480 | Ga0450907_015014 | 3300042146 | Bacteria | 1292 |
| 481 | Ga0439458_0003137 | 3300042157 | Bacteria | 3927 |
| 482 | Ga0439459_0055259 | 3300042438 | Bacteria | 883 |
| 483 | Ga0439464_0078479 | 3300042439 | Bacteria | 984 |
| 484 | Ga0466972_0012346 | 3300044658 | Bacteria | 4293 |
| 485 | Ga0466972_0130619 | 3300044658 | Unclassified | 1183 |
| 486 | Ga0466961_0155656 | 3300044693 | Bacteria | 1426 |
| 487 | Ga0466963_0072677 | 3300044694 | Unclassified | 2317 |
| 488 | Ga0466964_0167428 | 3300044706 | Bacteria | 1032 |
| 489 | Ga0466964_0174083 | 3300044706 | Bacteria | 1016 |
| 490 | Ga0466971_0056319 | 3300044719 | Bacteria | 1773 |
| 491 | Ga0466968_0013173 | 3300044735 | Bacteria | 3248 |
| 492 | Ga0466970_0092094 | 3300044765 | Bacteria | 1646 |
| 493 | Ga0466960_0066840 | 3300044901 | Bacteria | 1779 |
| 494 | Ga0466959_0033201 | 3300045049 | Bacteria | 3818 |
| 495 | Ga0451576_0014006 | 3300045051 | Bacteria | 8941 |
| 496 | Ga0451576_0158075 | 3300045051 | Bacteria | 2365 |
| 497 | Ga0451576_0521757 | 3300045051 | Bacteria | 1248 |
| 498 | Ga0466967_0203513 | 3300045976 | Bacteria | 1875 |
| 499 | Ga0466967_0264840 | 3300045976 | Bacteria | 1645 |
| 500 | Ga0466967_0373344 | 3300045976 | Unclassified | 1383 |
| 501 | Ga0466967_0758522 | 3300045976 | Bacteria | 962 |
| 502 | Ga0495592_0000075 | 3300046454 | Bacteria | 88214 |
| 503 | Ga0495603_0041352 | 3300046455 | Bacteria | 2756 |
| 504 | Ga0495603_0090802 | 3300046455 | Bacteria | 1786 |
| 505 | Ga0495629_0019811 | 3300046459 | Bacteria | 4801 |
| 506 | Ga0495629_0377729 | 3300046459 | Bacteria | 965 |
| 507 | Ga0495641_0053095 | 3300046461 | Bacteria | 1845 |
| 508 | Ga0495641_0103572 | 3300046461 | Bacteria | 1270 |
| 509 | Ga0495641_0210503 | 3300046461 | Bacteria | 872 |
| 510 | Ga0495651_0000344 | 3300046462 | Bacteria | 35980 |
| 511 | Ga0495651_0422900 | 3300046462 | Bacteria | 866 |
| 512 | Ga0495653_0003311 | 3300046463 | Bacteria | 12933 |
| 513 | Ga0495605_0021195 | 3300046474 | Bacteria | 3445 |
| 514 | Ga0495662_0167085 | 3300046476 | Bacteria | 1084 |
| 515 | Ga0495664_0245619 | 3300046477 | Bacteria | 1083 |
| 516 | Ga0495584_0016053 | 3300046491 | Bacteria | 3821 |
| 517 | Ga0495584_0022976 | 3300046491 | Unclassified | 3164 |
| 518 | Ga0495607_0084012 | 3300046501 | Bacteria | 1743 |
| 519 | Ga0495607_0268420 | 3300046501 | Bacteria | 814 |
| 520 | Ga0495608_0002205 | 3300046511 | Bacteria | 14066 |
| 521 | Ga0495628_0000329 | 3300046516 | Bacteria | 42884 |
| 522 | Ga0495628_0273490 | 3300046516 | Bacteria | 1256 |
| 523 | Ga0495628_0338929 | 3300046516 | Bacteria | 1107 |
| 524 | Ga0495644_0064994 | 3300046523 | Bacteria | 1371 |
| 525 | Ga0495663_0002621 | 3300046525 | Bacteria | 5362 |
| 526 | Ga0495652_0000111 | 3300046529 | Bacteria | 87928 |
| 527 | Ga0495665_0035988 | 3300046531 | Bacteria | 2643 |
| 528 | Ga0495587_0000100 | 3300046536 | Bacteria | 67315 |
| 529 | Ga0495609_0045069 | 3300046538 | Bacteria | 1977 |
| 530 | Ga0495645_0000046 | 3300046543 | Bacteria | 89390 |
| 531 | Ga0495633_0190937 | 3300046558 | Bacteria | 942 |
| 532 | Ga0495667_0015335 | 3300046559 | Bacteria | 5177 |
| 533 | Ga0495656_0001628 | 3300046615 | Bacteria | 7341 |
| 534 | Ga0495656_0060917 | 3300046615 | Unclassified | 1646 |
| 535 | Ga0495656_0068425 | 3300046615 | Bacteria | 1570 |
| 536 | Ga0495668_0085743 | 3300046616 | Bacteria | 1727 |
| 537 | Ga0495668_0091386 | 3300046616 | Unclassified | 1668 |
| 538 | Ga0495634_0040679 | 3300046642 | Bacteria | 3159 |
| 539 | Ga0495659_0075633 | 3300046664 | Bacteria | 1269 |
| 540 | Ga0495588_0025478 | 3300046674 | Bacteria | 2947 |
| 541 | Ga0495657_0071106 | 3300046675 | Bacteria | 2272 |
| 542 | Ga0495599_0000086 | 3300046678 | Bacteria | 64425 |
| 543 | Ga0495623_0000037 | 3300046679 | Bacteria | 80938 |
| 544 | Ga0495658_0091697 | 3300046683 | Bacteria | 1800 |
| 545 | Ga0495658_0104770 | 3300046683 | Bacteria | 1693 |
| 546 | Ga0495669_0254103 | 3300046684 | Bacteria | 844 |
| 547 | Ga0495613_0235740 | 3300046689 | Bacteria | 1281 |
| 548 | Ga0495613_0306681 | 3300046689 | Bacteria | 1098 |
| 549 | Ga0495624_0155047 | 3300046690 | Bacteria | 1400 |
| 550 | Ga0495624_0165703 | 3300046690 | Unclassified | 1349 |
| 551 | Ga0495624_0168400 | 3300046690 | Bacteria | 1337 |
| 552 | Ga0495624_0383198 | 3300046690 | Unclassified | 845 |
| 553 | Ga0495589_0008653 | 3300046794 | Bacteria | 5306 |
| 554 | Ga0495589_0286074 | 3300046794 | Bacteria | 766 |
| 555 | Ga0495581_0015400 | 3300047315 | Bacteria | 4439 |
| 556 | Ga0495581_0057003 | 3300047315 | Bacteria | 2255 |
| 557 | Ga0495581_0116495 | 3300047315 | Bacteria | 1554 |
| 558 | Ga0495604_0000080 | 3300047317 | Bacteria | 83113 |
| 559 | Ga0495676_0037664 | 3300047321 | Bacteria | 4023 |
| 560 | Ga0495676_0074535 | 3300047321 | Bacteria | 2598 |
| 561 | Ga0495676_0144629 | 3300047321 | Bacteria | 1700 |
| 562 | Ga0495680_0021490 | 3300047322 | Bacteria | 5400 |
| 563 | Ga0495680_0471561 | 3300047322 | Bacteria | 856 |
| 564 | Ga0495675_0000060 | 3300047444 | Bacteria | 76099 |
| 565 | Ga0495685_015384 | 3300047447 | Bacteria | 2608 |
| 566 | Ga0495602_0000075 | 3300048088 | Bacteria | 95851 |
| 567 | Ga0495614_0049487 | 3300048089 | Bacteria | 1802 |
| 568 | Ga0495614_0148637 | 3300048089 | Unclassified | 1044 |
| 569 | Ga0496100_0020322 | 3300048903 | Bacteria | 3978 |
| 570 | Ga0496100_0102823 | 3300048903 | Unclassified | 1972 |
| 571 | Ga0496100_0228288 | 3300048903 | Unclassified | 1369 |
| 572 | Ga0496101_0038921 | 3300048904 | Bacteria | 3379 |
| 573 | Ga0496101_0085358 | 3300048904 | Bacteria | 2339 |
| 574 | Ga0496101_0244224 | 3300048904 | Bacteria | 1398 |
| 575 | Ga0496101_0282691 | 3300048904 | Unclassified | 1297 |
| 576 | Ga0496101_0389747 | 3300048904 | Bacteria | 1096 |
| 577 | Ga0496102_0010906 | 3300048905 | Bacteria | 7828 |
| 578 | Ga0496102_0036020 | 3300048905 | Bacteria | 4456 |
| 579 | Ga0496102_0060395 | 3300048905 | Bacteria | 3467 |
| 580 | Ga0496102_0075546 | 3300048905 | Bacteria | 3098 |
| 581 | Ga0496102_0085362 | 3300048905 | Bacteria | 2914 |
| 582 | Ga0496102_0197985 | 3300048905 | Bacteria | 1893 |
| 583 | Ga0496102_0357230 | 3300048905 | Bacteria | 1375 |
| 584 | Ga0496103_0001259 | 3300048906 | Bacteria | 17295 |
| 585 | Ga0496103_0003656 | 3300048906 | Bacteria | 9364 |
| 586 | Ga0496103_0164374 | 3300048906 | Bacteria | 1424 |
| 587 | Ga0496103_0180638 | 3300048906 | Unclassified | 1356 |
| 588 | Ga0496103_0478293 | 3300048906 | Bacteria | 798 |
| 589 | Ga0496104_0006744 | 3300048907 | Bacteria | 10112 |
| 590 | Ga0496104_0033273 | 3300048907 | Bacteria | 4801 |
| 591 | Ga0496104_0082190 | 3300048907 | Unclassified | 3072 |
| 592 | Ga0496104_0107276 | 3300048907 | Bacteria | 2676 |
| 593 | Ga0496104_0118177 | 3300048907 | Bacteria | 2545 |
| 594 | Ga0496104_0717586 | 3300048907 | Unclassified | 907 |
| 595 | Ga0496104_0822544 | 3300048907 | Unclassified | 835 |
| 596 | Ga0496105_0000750 | 3300048908 | Bacteria | 22004 |
| 597 | Ga0496105_0010646 | 3300048908 | Bacteria | 7236 |
| 598 | Ga0496105_0057458 | 3300048908 | Bacteria | 3213 |
| 599 | Ga0496106_0002337 | 3300048909 | Bacteria | 14146 |
| 600 | Ga0496106_0079666 | 3300048909 | Bacteria | 2515 |
| 601 | Ga0496106_0098750 | 3300048909 | Bacteria | 2263 |
| 602 | Ga0496106_0142682 | 3300048909 | Unclassified | 1885 |
| 603 | Ga0496106_0179874 | 3300048909 | Bacteria | 1678 |
| 604 | Ga0496106_0271602 | 3300048909 | Unclassified | 1358 |
| 605 | Ga0496106_0274559 | 3300048909 | Bacteria | 1350 |
| 606 | Ga0496107_0024444 | 3300048910 | Bacteria | 4273 |
| 607 | Ga0496107_0270462 | 3300048910 | Bacteria | 1265 |
| 608 | Ga0496107_0315472 | 3300048910 | Unclassified | 1163 |
| 609 | Ga0496108_0004794 | 3300048911 | Bacteria | 10910 |
| 610 | Ga0496108_0010532 | 3300048911 | Bacteria | 7513 |
| 611 | Ga0496108_0010602 | 3300048911 | Bacteria | 7477 |
| 612 | Ga0496108_0014723 | 3300048911 | Bacteria | 6383 |
| 613 | Ga0496108_0021995 | 3300048911 | Bacteria | 5241 |
| 614 | Ga0496108_0102376 | 3300048911 | Bacteria | 2444 |
| 615 | Ga0496108_0430314 | 3300048911 | Bacteria | 1153 |
| 616 | Ga0496108_0555542 | 3300048911 | Bacteria | 1001 |
| 617 | Ga0496109_0003537 | 3300048912 | Bacteria | 13039 |
| 618 | Ga0496109_0013114 | 3300048912 | Bacteria | 7170 |
| 619 | Ga0496109_0015681 | 3300048912 | Bacteria | 6610 |
| 620 | Ga0496109_0028663 | 3300048912 | Bacteria | 4982 |
| 621 | Ga0496109_0166331 | 3300048912 | Bacteria | 2068 |
| 622 | Ga0496109_0174723 | 3300048912 | Bacteria | 2016 |
| 623 | Ga0496109_0178754 | 3300048912 | Unclassified | 1992 |
| 624 | Ga0496109_0241609 | 3300048912 | Bacteria | 1699 |
| 625 | Ga0496109_0410925 | 3300048912 | Unclassified | 1279 |
| 626 | Ga0496109_0415019 | 3300048912 | Unclassified | 1272 |
| 627 | Ga0496109_0609193 | 3300048912 | Bacteria | 1028 |
| 628 | Ga0496110_0000810 | 3300048913 | Bacteria | 21899 |
| 629 | Ga0496110_0002008 | 3300048913 | Bacteria | 15145 |
| 630 | Ga0496110_0014324 | 3300048913 | Bacteria | 6580 |
| 631 | Ga0496110_0024498 | 3300048913 | Bacteria | 5143 |
| 632 | Ga0496110_0047089 | 3300048913 | Bacteria | 3774 |
| 633 | Ga0496110_0063940 | 3300048913 | Bacteria | 3251 |
| 634 | Ga0496110_0082982 | 3300048913 | Bacteria | 2858 |
| 635 | Ga0496110_0091491 | 3300048913 | Bacteria | 2721 |
| 636 | Ga0496110_0154891 | 3300048913 | Bacteria | 2076 |
| 637 | Ga0496110_0206409 | 3300048913 | Bacteria | 1786 |
| 638 | Ga0496110_0362261 | 3300048913 | Bacteria | 1321 |
| 639 | Ga0496110_0362675 | 3300048913 | Unclassified | 1320 |
| 640 | Ga0496111_0001587 | 3300048914 | Bacteria | 13129 |
| 641 | Ga0496111_0001772 | 3300048914 | Bacteria | 12658 |
| 642 | Ga0496111_0004994 | 3300048914 | Bacteria | 8439 |
| 643 | Ga0496111_0119612 | 3300048914 | Bacteria | 1945 |
| 644 | Ga0496111_0137024 | 3300048914 | Unclassified | 1813 |
| 645 | Ga0496111_0154907 | 3300048914 | Bacteria | 1700 |
| 646 | Ga0496111_0216392 | 3300048914 | Bacteria | 1423 |
| 647 | Ga0496111_0540986 | 3300048914 | Unclassified | 855 |
| 648 | Ga0496111_0547190 | 3300048914 | Bacteria | 850 |
| 649 | Ga0496112_0006067 | 3300048915 | Bacteria | 10558 |
| 650 | Ga0496112_0007311 | 3300048915 | Bacteria | 9794 |
| 651 | Ga0496112_0017821 | 3300048915 | Bacteria | 6683 |
| 652 | Ga0496112_0084527 | 3300048915 | Bacteria | 3139 |
| 653 | Ga0496112_0215625 | 3300048915 | Bacteria | 1876 |
| 654 | Ga0496112_0286787 | 3300048915 | Bacteria | 1593 |
| 655 | Ga0496112_0299568 | 3300048915 | Bacteria | 1553 |
| 656 | Ga0496113_0015482 | 3300048916 | Bacteria | 5244 |
| 657 | Ga0496113_0022007 | 3300048916 | Bacteria | 4503 |
| 658 | Ga0496113_0082133 | 3300048916 | Bacteria | 2471 |
| 659 | Ga0496113_0089666 | 3300048916 | Unclassified | 2367 |
| 660 | Ga0496113_0131135 | 3300048916 | Bacteria | 1967 |
| 661 | Ga0496113_0142130 | 3300048916 | Bacteria | 1889 |
| 662 | Ga0496113_0372659 | 3300048916 | Bacteria | 1146 |
| 663 | Ga0496114_0009658 | 3300048917 | Bacteria | 7664 |
| 664 | Ga0496114_0148204 | 3300048917 | Bacteria | 2035 |
| 665 | Ga0496114_0487410 | 3300048917 | Bacteria | 1090 |
| 666 | Ga0496115_0025088 | 3300048918 | Bacteria | 4639 |
| 667 | Ga0496115_0104951 | 3300048918 | Bacteria | 2319 |
| 668 | Ga0496115_0203741 | 3300048918 | Bacteria | 1634 |
| 669 | Ga0496115_0204367 | 3300048918 | Bacteria | 1631 |
| 670 | Ga0496115_0405646 | 3300048918 | Bacteria | 1105 |
| 671 | Ga0496115_0801513 | 3300048918 | Unclassified | 733 |
| 672 | Ga0501031_0000809 | 3300049568 | Bacteria | 18820 |
| 673 | Ga0501031_0033130 | 3300049568 | Bacteria | 3369 |
| 674 | Ga0501032_0022066 | 3300049569 | Bacteria | 4420 |
| 675 | Ga0501032_0080633 | 3300049569 | Bacteria | 2165 |
| 676 | Ga0501033_0000948 | 3300049570 | Bacteria | 26325 |
| 677 | Ga0501034_0010838 | 3300049571 | Bacteria | 9468 |
| 678 | Ga0501034_0733379 | 3300049571 | Unclassified | 884 |
| 679 | Ga0501036_0003535 | 3300049572 | Bacteria | 12502 |
| 680 | Ga0501036_0266494 | 3300049572 | Bacteria | 1435 |
| 681 | Ga0501037_0040119 | 3300049573 | Bacteria | 3445 |
| 682 | Ga0501038_0001030 | 3300049574 | Bacteria | 25161 |
| 683 | Ga0501038_0034396 | 3300049574 | Bacteria | 4456 |
| 684 | Ga0501039_0002129 | 3300049575 | Bacteria | 14657 |
| 685 | Ga0501039_0234331 | 3300049575 | Unclassified | 1443 |
| 686 | Ga0501040_0008385 | 3300049576 | Bacteria | 6715 |
| 687 | Ga0501040_0050412 | 3300049576 | Bacteria | 2847 |
| 688 | Ga0501041_0001786 | 3300049577 | Bacteria | 12044 |
| 689 | Ga0501041_0014873 | 3300049577 | Bacteria | 4619 |
| 690 | Ga0501042_0010225 | 3300049578 | Bacteria | 6280 |
| 691 | Ga0501042_0275145 | 3300049578 | Bacteria | 1216 |
| 692 | Ga0501043_0005483 | 3300049579 | Bacteria | 10249 |
| 693 | Ga0501046_0002426 | 3300049580 | Bacteria | 17479 |
| 694 | Ga0501046_0010992 | 3300049580 | Bacteria | 7760 |
| 695 | Ga0501047_0091260 | 3300049581 | Bacteria | 2924 |
| 696 | Ga0501048_0015486 | 3300049582 | Bacteria | 5633 |
| 697 | Ga0501067_0021234 | 3300049583 | Bacteria | 3592 |
| 698 | Ga0501068_0001631 | 3300049584 | Bacteria | 11969 |
| 699 | Ga0501068_0017321 | 3300049584 | Bacteria | 4165 |
| 700 | Ga0501069_0014568 | 3300049585 | Bacteria | 4204 |
| 701 | Ga0501069_0025389 | 3300049585 | Bacteria | 3238 |
| 702 | Ga0501070_0002768 | 3300049586 | Bacteria | 15306 |
| 703 | Ga0501070_0009029 | 3300049586 | Bacteria | 8433 |
| 704 | Ga0501070_0033433 | 3300049586 | Bacteria | 4303 |
| 705 | Ga0501070_0258375 | 3300049586 | Unclassified | 1424 |
| 706 | Ga0501071_0000424 | 3300049587 | Bacteria | 21088 |
| 707 | Ga0501071_0270536 | 3300049587 | Bacteria | 1284 |
| 708 | Ga0501072_0008538 | 3300049588 | Bacteria | 7769 |
| 709 | Ga0501072_0011678 | 3300049588 | Bacteria | 6710 |
| 710 | Ga0501072_0012702 | 3300049588 | Bacteria | 6439 |
| 711 | Ga0501073_0000550 | 3300049589 | Bacteria | 26515 |
| 712 | Ga0501073_0015169 | 3300049589 | Bacteria | 5590 |
| 713 | Ga0501073_0118679 | 3300049589 | Bacteria | 1833 |
| 714 | Ga0501073_0283815 | 3300049589 | Bacteria | 1142 |
| 715 | Ga0501074_0000503 | 3300049590 | Bacteria | 24003 |
| 716 | Ga0501074_0024127 | 3300049590 | Bacteria | 4419 |
| 717 | Ga0501074_0074457 | 3300049590 | Bacteria | 2438 |
| 718 | Ga0501075_0003867 | 3300049591 | Bacteria | 10088 |
| 719 | Ga0501075_0020469 | 3300049591 | Bacteria | 4814 |
| 720 | Ga0501076_0021002 | 3300049592 | Bacteria | 5002 |
| 721 | Ga0501076_0231199 | 3300049592 | Bacteria | 1511 |
| 722 | Ga0501077_0000653 | 3300049593 | Bacteria | 21024 |
| 723 | Ga0501077_0005443 | 3300049593 | Bacteria | 7747 |
| 724 | Ga0501077_0264979 | 3300049593 | Bacteria | 1093 |
| 725 | Ga0501079_0007488 | 3300049741 | Bacteria | 8256 |
| 726 | Ga0501079_0011814 | 3300049741 | Bacteria | 6667 |
| 727 | Ga0501079_0043710 | 3300049741 | Bacteria | 3458 |
| 728 | Ga0501079_0122568 | 3300049741 | Bacteria | 2022 |
| 729 | Ga0501079_0194161 | 3300049741 | Bacteria | 1585 |
| 730 | Ga0501079_0438003 | 3300049741 | Bacteria | 1026 |
| 731 | Ga0501080_0001089 | 3300049742 | Bacteria | 22370 |
| 732 | Ga0501080_0079593 | 3300049742 | Bacteria | 3046 |
| 733 | Ga0501080_0496917 | 3300049742 | Bacteria | 1090 |
| 734 | Ga0501081_0001281 | 3300049743 | Bacteria | 15290 |
| 735 | Ga0501081_0028983 | 3300049743 | Bacteria | 3738 |
| 736 | Ga0501081_0048827 | 3300049743 | Bacteria | 2913 |
| 737 | Ga0501083_0000816 | 3300049744 | Bacteria | 20385 |
| 738 | Ga0501083_0055351 | 3300049744 | Bacteria | 2660 |
| 739 | Ga0501035_0058298 | 3300049822 | Bacteria | 3441 |
| 740 | Ga0501044_0019942 | 3300049823 | Bacteria | 7162 |
| 741 | Ga0501044_0312484 | 3300049823 | Bacteria | 1498 |
| 742 | Ga0501045_0000585 | 3300049824 | Bacteria | 22890 |
| 743 | Ga0501045_0038058 | 3300049824 | Bacteria | 3498 |
| 744 | nmdc:mga00v17_234618_c1 | 3300050491 | Bacteria | 1189 |
| 745 | nmdc:mga00v17_82441_c1 | 3300050491 | Bacteria | 2010 |
| 746 | nmdc:mga0yw44_79753_c1 | 3300050492 | Bacteria | 2049 |
| 747 | nmdc:mga05p37_1137319_c1 | 3300050507 | Bacteria | 814 |
| 748 | nmdc:mga05p37_1165073_c1 | 3300050507 | Unclassified | 800 |
| 749 | nmdc:mga05p37_1586_c1 | 3300050507 | Bacteria | 26419 |
| 750 | nmdc:mga05p37_305402_c1 | 3300050507 | Bacteria | 1888 |
| 751 | nmdc:mga05p37_58997_c1 | 3300050507 | Bacteria | 4726 |
| 752 | nmdc:mga05p37_8069_c1 | 3300050507 | Bacteria | 12437 |
| 753 | nmdc:mga05p37_833245_c1 | 3300050507 | Unclassified | 1004 |
| 754 | nmdc:mga09592_256900_c1 | 3300050508 | Bacteria | 1515 |
| 755 | nmdc:mga09592_379853_c1 | 3300050508 | Bacteria | 1222 |
| 756 | nmdc:mga0qj67_342168_c1 | 3300050509 | Bacteria | 1210 |
| 757 | nmdc:mga06r32_373798_c1 | 3300050510 | Bacteria | 1408 |
| 758 | nmdc:mga06r32_573739_c1 | 3300050510 | Bacteria | 1101 |
| 759 | nmdc:mga08y16_16744_c1 | 3300050511 | Bacteria | 7715 |
| 760 | nmdc:mga08y16_23951_c1 | 3300050511 | Bacteria | 5167 |
| 761 | nmdc:mga08y16_487682_c1 | 3300050511 | Bacteria | 1254 |
| 762 | nmdc:mga08y16_5425_c1 | 3300050511 | Bacteria | 13335 |
| 763 | nmdc:mga08y16_62278_c1 | 3300050511 | Bacteria | 3895 |
| 764 | nmdc:mga08y16_648192_c1 | 3300050511 | Bacteria | 1060 |
| 765 | nmdc:mga0n895_203664_c1 | 3300050512 | Bacteria | 2009 |
| 766 | nmdc:mga0n895_44020_c1 | 3300050512 | Bacteria | 4353 |
| 767 | nmdc:mga0n895_66496_c1 | 3300050512 | Bacteria | 3570 |
| 768 | nmdc:mga0n895_76656_c1 | 3300050512 | Bacteria | 3325 |
| 769 | nmdc:mga0rr50_6001_c1 | 3300050513 | Bacteria | 7332 |
| 770 | nmdc:mga0rr50_933_c2 | 3300050513 | Bacteria | 13017 |
| 771 | nmdc:mga08x19_100376_c1 | 3300050514 | Bacteria | 1920 |
| 772 | nmdc:mga08x19_2604_c1 | 3300050514 | Bacteria | 10947 |
| 773 | nmdc:mga08x19_520370_c1 | 3300050514 | Unclassified | 841 |
| 774 | nmdc:mga0a205_102197_c1 | 3300050515 | Bacteria | 2765 |
| 775 | nmdc:mga0a205_19350_c1 | 3300050515 | Bacteria | 6417 |
| 776 | nmdc:mga0a205_229584_c1 | 3300050515 | Bacteria | 1740 |
| 777 | nmdc:mga0a205_27351_c1 | 3300050515 | Bacteria | 5448 |
| 778 | Ga0495601_0000040 | 3300053077 | Bacteria | 79488 |
| 779 | Ga0495612_0000093 | 3300053078 | Bacteria | 38770 |
| 780 | Ga0495655_0190672 | 3300053083 | Bacteria | 666 |
| 781 | Ga0495595_0024200 | 3300053084 | Bacteria | 2681 |
| 782 | Ga0495619_0000615 | 3300053085 | Bacteria | 23532 |
| 783 | Ga0495619_0215129 | 3300053085 | Bacteria | 1331 |
| 784 | Ga0501084_0009831 | 3300054114 | Bacteria | 7902 |
| 785 | Ga0501084_0011396 | 3300054114 | Bacteria | 7362 |
| 786 | Ga0501084_0225287 | 3300054114 | Bacteria | 1582 |
| 787 | Ga0501082_0001714 | 3300060353 | Bacteria | 19338 |
| 788 | Ga0501082_0088408 | 3300060353 | Bacteria | 2673 |
| 789 | Ga0501082_0237311 | 3300060353 | Bacteria | 1587 |
| 790 | Ga0501082_0327887 | 3300060353 | Unclassified | 1334 |
| 791 | Ga0466962_0020062 | 3300061719 | Bacteria | 3213 |
| 792 | Ga0530510_0001637 | 3300061734 | Bacteria | 15131 |
| 793 | Ga0530510_0028276 | 3300061734 | Bacteria | 4020 |
| 794 | Ga0530510_0046822 | 3300061734 | Bacteria | 3124 |
| 795 | Ga0395900_0029400 | |||
| 796 | ARcpr5oldR_c001527 | |||
| 797 | ARSoilOldRDRAFT_c001198 | |||
| 798 | ARCol0yngRDRAFT_1001520 | |||
| 799 | JGI24744J21845_10024974 | |||
| 800 | JGI24742J22300_10005679 | |||
| 801 | Ga0070658_10063633 | |||
| 802 | Ga0070683_100001132 | |||
| 803 | Ga0070683_100073501 | |||
| 804 | Ga0070683_100561318 | |||
| 805 | Ga0070690_100035197 | |||
| 806 | Ga0068869_100093105 | |||
| 807 | Ga0070680_100009508 | |||
| 808 | Ga0070680_100016209 | |||
| 809 | Ga0070682_100090671 | |||
| 810 | Ga0070682_100207146 | |||
| 811 | Ga0068868_100009931 | |||
| 812 | Ga0070689_100071944 | |||
| 813 | Ga0070689_100093255 | |||
| 814 | Ga0070689_100412181 | |||
| 815 | Ga0070689_100558632 | |||
| 816 | Ga0070687_100064691 | |||
| 817 | Ga0070687_100064918 | |||
| 818 | Ga0070692_10016160 | |||
| 819 | Ga0070692_10025432 | |||
| 820 | Ga0070692_10064432 | |||
| 821 | Ga0070692_10313742 | |||
| 822 | Ga0070668_100055356 | |||
| 823 | Ga0070669_100112480 | |||
| 824 | Ga0070675_100021200 | |||
| 825 | Ga0070675_100025395 | |||
| 826 | Ga0070675_100054047 | |||
| 827 | Ga0070671_100030557 | |||
| 828 | Ga0070671_100133300 | |||
| 829 | Ga0070671_100558462 | |||
| 830 | Ga0070671_100825270 | |||
| 831 | Ga0070674_100009597 | |||
| 832 | Ga0070674_100068587 | |||
| 833 | Ga0070673_100025478 | |||
| 834 | Ga0070688_100006251 | |||
| 835 | Ga0070688_100230009 | |||
| 836 | Ga0070659_100400312 | |||
| 837 | Ga0070709_10008009 | |||
| 838 | Ga0070709_10032025 | |||
| 839 | Ga0070709_10039702 | |||
| 840 | Ga0070709_10079592 | |||
| 841 | Ga0070709_10701453 | |||
| 842 | Ga0070714_100010089 | |||
| 843 | Ga0070714_100019611 | |||
| 844 | Ga0070714_100047984 | |||
| 845 | Ga0070714_100087705 | |||
| 846 | Ga0070714_100267639 | |||
| 847 | Ga0070714_100365479 | |||
| 848 | Ga0070714_100469673 | |||
| 849 | Ga0070714_100469903 | |||
| 850 | Ga0070714_100831899 | |||
| 851 | Ga0070713_100010133 | |||
| 852 | Ga0070713_100035926 | |||
| 853 | Ga0070713_100053284 | |||
| 854 | Ga0070710_10017213 | |||
| 855 | Ga0070710_10178539 | |||
| 856 | Ga0070701_10008647 | |||
| 857 | Ga0070701_10371665 | |||
| 858 | Ga0070711_100011916 | |||
| 859 | Ga0070705_100011381 | |||
| 860 | Ga0070700_100005322 | |||
| 861 | Ga0070694_100019402 | |||
| 862 | Ga0070694_100053548 | |||
| 863 | Ga0070708_100056153 | |||
| 864 | Ga0070708_100336344 | |||
| 865 | Ga0070708_100386059 | |||
| 866 | Ga0070708_100955836 | |||
| 867 | Ga0070663_100026225 | |||
| 868 | Ga0070678_100004934 | |||
| 869 | Ga0070678_100099793 | |||
| 870 | Ga0070678_100124160 | |||
| 871 | Ga0070678_100356538 | |||
| 872 | Ga0070678_100650156 | |||
| 873 | Ga0070678_100748952 | |||
| 874 | Ga0070662_100187823 | |||
| 875 | Ga0070681_10140546 | |||
| 876 | Ga0070681_10482394 | |||
| 877 | Ga0068867_100007112 | |||
| 878 | Ga0070685_10031783 | |||
| 879 | Ga0070685_10035346 | |||
| 880 | Ga0070685_10230715 | |||
| 881 | Ga0070685_10263007 | |||
| 882 | Ga0070706_100010372 | |||
| 883 | Ga0070706_100029184 | |||
| 884 | Ga0070706_100618321 | |||
| 885 | Ga0070707_100000909 | |||
| 886 | Ga0070707_100087219 | |||
| 887 | Ga0070707_100204043 | |||
| 888 | Ga0070707_100252926 | |||
| 889 | Ga0070698_100013881 | |||
| 890 | Ga0070698_100016227 | |||
| 891 | Ga0070698_100019860 | |||
| 892 | Ga0070698_100084213 | |||
| 893 | Ga0070699_100010102 | |||
| 894 | Ga0070679_100027984 | |||
| 895 | Ga0070679_100900366 | |||
| 896 | Ga0070684_100004414 | |||
| 897 | Ga0070684_100107423 | |||
| 898 | Ga0070684_100373728 | |||
| 899 | Ga0070684_100395442 | |||
| 900 | Ga0070697_100466601 | |||
| 901 | Ga0070697_100476492 | |||
| 902 | Ga0070697_100797587 | |||
| 903 | Ga0068853_100035448 | |||
| 904 | Ga0068853_100389054 | |||
| 905 | Ga0070672_100041476 | |||
| 906 | Ga0070672_100382598 | |||
| 907 | Ga0070686_100057424 | |||
| 908 | Ga0070686_100161179 | |||
| 909 | Ga0070696_100014793 | |||
| 910 | Ga0070696_100022985 | |||
| 911 | Ga0070696_100146870 | |||
| 912 | Ga0070696_100161192 | |||
| 913 | Ga0070696_100220852 | |||
| 914 | Ga0070693_100009420 | |||
| 915 | Ga0070665_100069250 | |||
| 916 | Ga0070665_100085810 | |||
| 917 | Ga0070704_100041831 | |||
| 918 | Ga0070704_100837632 | |||
| 919 | Ga0068855_100417506 | |||
| 920 | Ga0068855_100507303 | |||
| 921 | Ga0068855_100521562 | |||
| 922 | Ga0070664_100581354 | |||
| 923 | Ga0068854_100017760 | |||
| 924 | Ga0068856_100119874 | |||
| 925 | Ga0068856_100125443 | |||
| 926 | Ga0068856_100208374 | |||
| 927 | Ga0068856_100503720 | |||
| 928 | Ga0068856_100589296 | |||
| 929 | Ga0068856_100592582 | |||
| 930 | Ga0070702_100044554 | |||
| 931 | Ga0068852_100007153 | |||
| 932 | Ga0068864_100042630 | |||
| 933 | Ga0068866_10001654 | |||
| 934 | Ga0068861_100304490 | |||
| 935 | Ga0068861_100407985 | |||
| 936 | Ga0068870_10185658 | |||
| 937 | Ga0068870_10348104 | |||
| 938 | Ga0068863_100147006 | |||
| 939 | Ga0068863_100235457 | |||
| 940 | Ga0068860_100472446 | |||
| 941 | Ga0068862_100137440 | |||
| 942 | Ga0068862_100346752 | |||
| 943 | Ga0081455_10003628 | |||
| 944 | Ga0081455_10010129 | |||
| 945 | Ga0081455_10033361 | |||
| 946 | Ga0081538_10000181 | |||
| 947 | Ga0081539_10001630 | |||
| 948 | Ga0081539_10003156 | |||
| 949 | Ga0070717_10058803 | |||
| 950 | Ga0070717_10070824 | |||
| 951 | Ga0070717_10950314 | |||
| 952 | Ga0075365_10008948 | |||
| 953 | Ga0075365_10010552 | |||
| 954 | Ga0075368_10189145 | |||
| 955 | Ga0075364_10015658 | |||
| 956 | Ga0075364_10256238 | |||
| 957 | Ga0075432_10006746 | |||
| 958 | Ga0075432_10008669 | |||
| 959 | Ga0075432_10060501 | |||
| 960 | Ga0075432_10105568 | |||
| 961 | Ga0070715_10011178 | |||
| 962 | Ga0070715_10098592 | |||
| 963 | Ga0070716_100011827 | |||
| 964 | Ga0070716_100040145 | |||
| 965 | Ga0070716_100153079 | |||
| 966 | Ga0075367_10208047 | |||
| 967 | Ga0097621_100101144 | |||
| 968 | Ga0097621_100124221 | |||
| 969 | Ga0097621_100498328 | |||
| 970 | Ga0068871_100068191 | |||
| 971 | Ga0075428_100058578 | |||
| 972 | Ga0075430_100061459 | |||
| 973 | Ga0075433_10002296 | |||
| 974 | Ga0075433_10137454 | |||
| 975 | Ga0075433_10300598 | |||
| 976 | Ga0075434_100006048 | |||
| 977 | Ga0075434_100054947 | |||
| 978 | Ga0075434_100898267 | |||
| 979 | Ga0075429_100069363 | |||
| 980 | Ga0068865_100031951 | |||
| 981 | Ga0068865_100033545 | |||
| 982 | Ga0068865_100195356 | |||
| 983 | Ga0075436_100004384 | |||
| 984 | Ga0075436_100004922 | |||
| 985 | Ga0075436_100047461 | |||
| 986 | Ga0075435_100033336 | |||
| 987 | Ga0075435_100216785 | |||
| 988 | Ga0075435_100576152 | |||
| 989 | Ga0105240_11156343 | |||
| 990 | Ga0111539_10154815 | |||
| 991 | Ga0111539_10335011 | |||
| 992 | Ga0111539_10675061 | |||
| 993 | Ga0105245_10019492 | |||
| 994 | Ga0105245_10055417 | |||
| 995 | Ga0105245_10139709 | |||
| 996 | Ga0105245_10401349 | |||
| 997 | Ga0105245_10461427 | |||
| 998 | Ga0105245_10485890 | |||
| 999 | Ga0105245_10770325 | |||
| 1000 | Ga0114129_10000650 | |||
| 1001 | Ga0114129_10077628 | |||
| 1002 | Ga0114129_10082078 | |||
| 1003 | Ga0114129_11012139 | |||
| 1004 | Ga0114129_11273403 | |||
| 1005 | Ga0114129_11376462 | |||
| 1006 | Ga0105243_10012417 | |||
| 1007 | Ga0105243_10428012 | |||
| 1008 | Ga0105241_10053613 | |||
| 1009 | Ga0105241_10183289 | |||
| 1010 | Ga0105242_10016433 | |||
| 1011 | Ga0105242_10105058 | |||
| 1012 | Ga0105242_10152278 | |||
| 1013 | Ga0105242_10170134 | |||
| 1014 | Ga0105242_10187720 | |||
| 1015 | Ga0105242_10328456 | |||
| 1016 | Ga0105242_10490226 | |||
| 1017 | Ga0105248_10221410 | |||
| 1018 | Ga0105248_10234821 | |||
| 1019 | Ga0105248_10387784 | |||
| 1020 | Ga0105248_10564577 | |||
| 1021 | Ga0105248_10722298 | |||
| 1022 | Ga0105248_10797037 | |||
| 1023 | Ga0105237_10337772 | |||
| 1024 | Ga0105238_10359305 | |||
| 1025 | Ga0105238_10627084 | |||
| 1026 | Ga0105249_10000965 | |||
| 1027 | Ga0105249_10198048 | |||
| 1028 | Ga0105249_10270196 | |||
| 1029 | Ga0105239_10009394 | |||
| 1030 | Ga0105239_10111517 | |||
| 1031 | Ga0105246_10076032 | |||
| 1032 | Ga0105246_10201405 | |||
| 1033 | Ga0105246_10481381 | |||
| 1034 | Ga0157374_10219891 | |||
| 1035 | Ga0157374_10379687 | |||
| 1036 | Ga0157374_10844756 | |||
| 1037 | Ga0157378_10019201 | |||
| 1038 | Ga0157378_10596879 | |||
| 1039 | Ga0163162_10031838 | |||
| 1040 | Ga0163162_10618569 | |||
| 1041 | Ga0163162_10665410 | |||
| 1042 | Ga0163162_10818463 | |||
| 1043 | Ga0157372_10993946 | |||
| 1044 | Ga0157372_11098120 | |||
| 1045 | Ga0157375_10040324 | |||
| 1046 | Ga0157375_10049718 | |||
| 1047 | Ga0157375_10080491 | |||
| 1048 | Ga0157375_10107832 | |||
| 1049 | Ga0157375_10393026 | |||
| 1050 | Ga0157375_10629173 | |||
| 1051 | Ga0157375_10693929 | |||
| 1052 | Ga0157380_10015971 | |||
| 1053 | Ga0157380_10039497 | |||
| 1054 | Ga0157380_10100519 | |||
| 1055 | Ga0182008_10072275 | |||
| 1056 | Ga0182008_10092444 | |||
| 1057 | Ga0182008_10120604 | |||
| 1058 | Ga0157377_10000750 | |||
| 1059 | Ga0157377_10040044 | |||
| 1060 | Ga0157377_10303752 | |||
| 1061 | Ga0157376_10010003 | |||
| 1062 | Ga0157376_10116744 | |||
| 1063 | Ga0157376_10164166 | |||
| 1064 | Ga0163161_10059334 | |||
| 1065 | Ga0207653_10010560 | |||
| 1066 | Ga0207692_10003802 | |||
| 1067 | Ga0207692_10148424 | |||
| 1068 | Ga0207642_10003142 | |||
| 1069 | Ga0207688_10060393 | |||
| 1070 | Ga0207680_10155934 | |||
| 1071 | Ga0207647_10056111 | |||
| 1072 | Ga0207699_10031396 | |||
| 1073 | Ga0207699_10056326 | |||
| 1074 | Ga0207699_10081081 | |||
| 1075 | Ga0207684_10326935 | |||
| 1076 | Ga0207707_10042524 | |||
| 1077 | Ga0207707_10095126 | |||
| 1078 | Ga0207671_10079986 | |||
| 1079 | Ga0207693_10001710 | |||
| 1080 | Ga0207693_10135856 | |||
| 1081 | Ga0207693_10165383 | |||
| 1082 | Ga0207693_10584589 | |||
| 1083 | Ga0207693_10597460 | |||
| 1084 | Ga0207693_10597606 | |||
| 1085 | Ga0207663_10009122 | |||
| 1086 | Ga0207663_10045637 | |||
| 1087 | Ga0207660_10331824 | |||
| 1088 | Ga0207662_10047280 | |||
| 1089 | Ga0207662_10047395 | |||
| 1090 | Ga0207652_10090093 | |||
| 1091 | Ga0207652_10344289 | |||
| 1092 | Ga0207646_10004651 | |||
| 1093 | Ga0207646_10016324 | |||
| 1094 | Ga0207646_10064202 | |||
| 1095 | Ga0207646_10208809 | |||
| 1096 | Ga0207694_10418445 | |||
| 1097 | Ga0207659_10056552 | |||
| 1098 | Ga0207659_10071588 | |||
| 1099 | Ga0207659_10144882 | |||
| 1100 | Ga0207687_10013811 | |||
| 1101 | Ga0207687_10019852 | |||
| 1102 | Ga0207687_10103038 | |||
| 1103 | Ga0207687_10179157 | |||
| 1104 | Ga0207687_10275856 | |||
| 1105 | Ga0207687_10499576 | |||
| 1106 | Ga0207687_10580135 | |||
| 1107 | Ga0207687_10810727 | |||
| 1108 | Ga0207700_10000001 | |||
| 1109 | Ga0207700_10063413 | |||
| 1110 | Ga0207700_10071577 | |||
| 1111 | Ga0207700_10483131 | |||
| 1112 | Ga0207664_10010013 | |||
| 1113 | Ga0207664_10018136 | |||
| 1114 | Ga0207664_10028774 | |||
| 1115 | Ga0207664_10051940 | |||
| 1116 | Ga0207664_10059700 | |||
| 1117 | Ga0207664_10252999 | |||
| 1118 | Ga0207664_10672616 | |||
| 1119 | Ga0207664_10789151 | |||
| 1120 | Ga0207644_10269371 | |||
| 1121 | Ga0207690_10246864 | |||
| 1122 | Ga0207706_10272694 | |||
| 1123 | Ga0207686_10005166 | |||
| 1124 | Ga0207686_10046889 | |||
| 1125 | Ga0207686_10193098 | |||
| 1126 | Ga0207686_10764527 | |||
| 1127 | Ga0207709_10005645 | |||
| 1128 | Ga0207709_10231802 | |||
| 1129 | Ga0207709_10527490 | |||
| 1130 | Ga0207670_10040358 | |||
| 1131 | Ga0207669_10044297 | |||
| 1132 | Ga0207669_10056848 | |||
| 1133 | Ga0207704_10014139 | |||
| 1134 | Ga0207704_10178414 | |||
| 1135 | Ga0207665_10001701 | |||
| 1136 | Ga0207665_10025099 | |||
| 1137 | Ga0207665_10029853 | |||
| 1138 | Ga0207665_10055886 | |||
| 1139 | Ga0207665_10629570 | |||
| 1140 | Ga0207665_10780916 | |||
| 1141 | Ga0207691_10007885 | |||
| 1142 | Ga0207691_10461564 | |||
| 1143 | Ga0207711_10145700 | |||
| 1144 | Ga0207689_10163827 | |||
| 1145 | Ga0207661_10119911 | |||
| 1146 | Ga0207661_10240893 | |||
| 1147 | Ga0207661_10245564 | |||
| 1148 | Ga0207661_10361880 | |||
| 1149 | Ga0207667_10374227 | |||
| 1150 | Ga0207651_10363277 | |||
| 1151 | Ga0207712_10008993 | |||
| 1152 | Ga0207668_10041033 | |||
| 1153 | Ga0207668_10214253 | |||
| 1154 | Ga0207640_10201530 | |||
| 1155 | Ga0207677_10067786 | |||
| 1156 | Ga0207677_10399012 | |||
| 1157 | Ga0207639_10043763 | |||
| 1158 | Ga0207639_10160172 | |||
| 1159 | Ga0207708_10024437 | |||
| 1160 | Ga0207708_10035492 | |||
| 1161 | Ga0207708_10223180 | |||
| 1162 | Ga0207708_10319123 | |||
| 1163 | Ga0207708_10360749 | |||
| 1164 | Ga0207702_10012256 | |||
| 1165 | Ga0207702_10277618 | |||
| 1166 | Ga0207702_10542896 | |||
| 1167 | Ga0207702_11012307 | |||
| 1168 | Ga0207641_10408810 | |||
| 1169 | Ga0207648_10000681 | |||
| 1170 | Ga0207676_10028089 | |||
| 1171 | Ga0207674_10079407 | |||
| 1172 | Ga0207675_100139889 | |||
| 1173 | Ga0207675_100195585 | |||
| 1174 | Ga0207675_100406984 | |||
| 1175 | Ga0207683_10000791 | |||
| 1176 | Ga0207683_10017796 | |||
| 1177 | Ga0207683_10167939 | |||
| 1178 | Ga0207683_10401281 | |||
| 1179 | Ga0207698_10372510 | |||
| 1180 | Ga0207428_10001019 | |||
| 1181 | Ga0207428_10003917 | |||
| 1182 | Ga0268266_10112430 | |||
| 1183 | Ga0268266_10172166 | |||
| 1184 | Ga0268265_10051733 | |||
| 1185 | Ga0268264_10243633 | |||
| 1186 | Ga0268264_10262256 | |||
| 1187 | Ga0268264_10709722 | |||
| 1188 | Ga0265336_10058042 | |||
| 1189 | Ga0265338_10020387 | |||
| 1190 | Ga0307408_100627510 | |||
| 1191 | Ga0307406_10499954 | |||
| 1192 | Ga0307412_10603085 | |||
| 1193 | Ga0307409_100541373 | |||
| 1194 | Ga0307416_100037748 | |||
| 1195 | Ga0307416_101316275 | |||
| 1196 | Ga0373930_0020049 | |||
| 1197 | Ga0373948_0016308 | |||
| 1198 | Ga0373928_0065876 | |||
| 1199 | Ga0373940_0088764 | |||
| 1200 | Ga0373923_0233415 | |||
| 1201 | Ga0373939_0013390 | |||
| 1202 | Ga0373939_0041962 | |||
| 1203 | Ga0373960_0016605 | |||
| 1204 | Ga0373960_0156303 | |||
| 1205 | Ga0373943_0006172 | |||
| 1206 | Ga0373943_0103371 | |||
| 1207 | Ga0373962_0069972 | |||
| 1208 | Ga0373931_0201021 | |||
| 1209 | Ga0373935_0053786 | |||
| 1210 | Ga0373927_0116773 | |||
| 1211 | Ga0373933_0013384 | |||
| 1212 | Ga0373947_0016652 | |||
| 1213 | Ga0373937_0026524 | |||
| 1214 | Ga0373925_0094741 | |||
| 1215 | Ga0395899_0005999 | |||
| 1216 | Ga0395899_0030800 | |||
| 1217 | Ga0395899_0045590 | |||
| 1218 | Ga0395899_0056773 | |||
| 1219 | Ga0395899_0205733 | |||
| 1220 | Ga0395900_0002741 | |||
| 1221 | Ga0395900_0004817 | |||
| 1222 | Ga0395900_0023127 | |||
| 1223 | Ga0395900_0025542 | |||
| 1224 | Ga0395900_0145180 | |||
| 1225 | Ga0395900_0236926 | |||
| 1226 | Ga0395900_0261642 | |||
| 1227 | Ga0395900_0335860 | |||
| 1228 | Ga0395900_0426317 | |||
| 1229 | Ga0395900_0557324 | |||
| 1230 | Ga0395898_0003147 | |||
| 1231 | Ga0395898_0004326 | |||
| 1232 | Ga0395898_0039374 | |||
| 1233 | Ga0395898_0054665 | |||
| 1234 | Ga0395898_0133290 | |||
| 1235 | Ga0395898_0348161 | |||
| 1236 | Ga0395898_0464029 | |||
| 1237 | Ga0395898_0503590 | |||
| 1238 | Ga0395898_0539684 | |||
| 1239 | Ga0395898_0586197 | |||
| 1240 | Ga0395905_0007344 | |||
| 1241 | Ga0395905_0016351 | |||
| 1242 | Ga0395905_0019309 | |||
| 1243 | Ga0395905_0094917 | |||
| 1244 | Ga0395905_0119025 | |||
| 1245 | Ga0395905_0306752 | |||
| 1246 | Ga0395901_0000679 | |||
| 1247 | Ga0395901_0005496 | |||
| 1248 | Ga0395901_0007953 | |||
| 1249 | Ga0395901_0009487 | |||
| 1250 | Ga0395901_0011081 | |||
| 1251 | Ga0395901_0011784 | |||
| 1252 | Ga0395901_0056235 | |||
| 1253 | Ga0395901_0059352 | |||
| 1254 | Ga0395901_0182247 | |||
| 1255 | Ga0395901_0205150 | |||
| 1256 | Ga0395901_0233985 | |||
| 1257 | Ga0395901_0329096 | |||
| 1258 | Ga0395901_0337246 | |||
| 1259 | Ga0395901_0338928 | |||
| 1260 | Ga0395901_0339093 | |||
| 1261 | Ga0395901_0418172 | |||
| 1262 | Ga0395901_0427918 | |||
| 1263 | Ga0395901_0467353 | |||
| 1264 | Ga0436360_0517229 | |||
| 1265 | Ga0451798_0569168 | |||
| 1266 | Ga0451853_1574808 | |||
| 1267 | Ga0451853_3232296 | |||
| 1268 | Ga0439433_0078641 | |||
| 1269 | Ga0439445_0017242 | |||
| 1270 | Ga0439448_0001266 | |||
| 1271 | Ga0439463_039302 | |||
| 1272 | Ga0450888_018496 | |||
| 1273 | Ga0450906_017114 | |||
| 1274 | Ga0450907_015014 | |||
| 1275 | Ga0439458_0003137 | |||
| 1276 | Ga0439459_0055259 | |||
| 1277 | Ga0439464_0078479 | |||
| 1278 | Ga0466972_0012346 | |||
| 1279 | Ga0466972_0130619 | |||
| 1280 | Ga0466961_0155656 | |||
| 1281 | Ga0466963_0072677 | |||
| 1282 | Ga0466964_0167428 | |||
| 1283 | Ga0466964_0174083 | |||
| 1284 | Ga0466971_0056319 | |||
| 1285 | Ga0466968_0013173 | |||
| 1286 | Ga0466970_0092094 | |||
| 1287 | Ga0466960_0066840 | |||
| 1288 | Ga0466959_0033201 | |||
| 1289 | Ga0451576_0014006 | |||
| 1290 | Ga0451576_0158075 | |||
| 1291 | Ga0451576_0521757 | |||
| 1292 | Ga0466967_0203513 | |||
| 1293 | Ga0466967_0264840 | |||
| 1294 | Ga0466967_0373344 | |||
| 1295 | Ga0466967_0758522 | |||
| 1296 | Ga0495592_0000075 | |||
| 1297 | Ga0495603_0041352 | |||
| 1298 | Ga0495603_0090802 | |||
| 1299 | Ga0495629_0019811 | |||
| 1300 | Ga0495629_0377729 | |||
| 1301 | Ga0495641_0053095 | |||
| 1302 | Ga0495641_0103572 | |||
| 1303 | Ga0495641_0210503 | |||
| 1304 | Ga0495651_0000344 | |||
| 1305 | Ga0495651_0422900 | |||
| 1306 | Ga0495653_0003311 | |||
| 1307 | Ga0495605_0021195 | |||
| 1308 | Ga0495662_0167085 | |||
| 1309 | Ga0495664_0245619 | |||
| 1310 | Ga0495584_0016053 | |||
| 1311 | Ga0495584_0022976 | |||
| 1312 | Ga0495607_0084012 | |||
| 1313 | Ga0495607_0268420 | |||
| 1314 | Ga0495608_0002205 | |||
| 1315 | Ga0495628_0000329 | |||
| 1316 | Ga0495628_0273490 | |||
| 1317 | Ga0495628_0338929 | |||
| 1318 | Ga0495644_0064994 | |||
| 1319 | Ga0495663_0002621 | |||
| 1320 | Ga0495652_0000111 | |||
| 1321 | Ga0495665_0035988 | |||
| 1322 | Ga0495587_0000100 | |||
| 1323 | Ga0495609_0045069 | |||
| 1324 | Ga0495645_0000046 | |||
| 1325 | Ga0495633_0190937 | |||
| 1326 | Ga0495667_0015335 | |||
| 1327 | Ga0495656_0001628 | |||
| 1328 | Ga0495656_0060917 | |||
| 1329 | Ga0495656_0068425 | |||
| 1330 | Ga0495668_0085743 | |||
| 1331 | Ga0495668_0091386 | |||
| 1332 | Ga0495634_0040679 | |||
| 1333 | Ga0495659_0075633 | |||
| 1334 | Ga0495588_0025478 | |||
| 1335 | Ga0495657_0071106 | |||
| 1336 | Ga0495599_0000086 | |||
| 1337 | Ga0495623_0000037 | |||
| 1338 | Ga0495658_0091697 | |||
| 1339 | Ga0495658_0104770 | |||
| 1340 | Ga0495669_0254103 | |||
| 1341 | Ga0495613_0235740 | |||
| 1342 | Ga0495613_0306681 | |||
| 1343 | Ga0495624_0155047 | |||
| 1344 | Ga0495624_0165703 | |||
| 1345 | Ga0495624_0168400 | |||
| 1346 | Ga0495624_0383198 | |||
| 1347 | Ga0495589_0008653 | |||
| 1348 | Ga0495589_0286074 | |||
| 1349 | Ga0495581_0015400 | |||
| 1350 | Ga0495581_0057003 | |||
| 1351 | Ga0495581_0116495 | |||
| 1352 | Ga0495604_0000080 | |||
| 1353 | Ga0495676_0037664 | |||
| 1354 | Ga0495676_0074535 | |||
| 1355 | Ga0495676_0144629 | |||
| 1356 | Ga0495680_0021490 | |||
| 1357 | Ga0495680_0471561 | |||
| 1358 | Ga0495675_0000060 | |||
| 1359 | Ga0495685_015384 | |||
| 1360 | Ga0495602_0000075 | |||
| 1361 | Ga0495614_0049487 | |||
| 1362 | Ga0495614_0148637 | |||
| 1363 | Ga0496100_0020322 | |||
| 1364 | Ga0496100_0102823 | |||
| 1365 | Ga0496100_0228288 | |||
| 1366 | Ga0496101_0038921 | |||
| 1367 | Ga0496101_0085358 | |||
| 1368 | Ga0496101_0244224 | |||
| 1369 | Ga0496101_0282691 | |||
| 1370 | Ga0496101_0389747 | |||
| 1371 | Ga0496102_0010906 | |||
| 1372 | Ga0496102_0036020 | |||
| 1373 | Ga0496102_0060395 | |||
| 1374 | Ga0496102_0075546 | |||
| 1375 | Ga0496102_0085362 | |||
| 1376 | Ga0496102_0197985 | |||
| 1377 | Ga0496102_0357230 | |||
| 1378 | Ga0496103_0001259 | |||
| 1379 | Ga0496103_0003656 | |||
| 1380 | Ga0496103_0164374 | |||
| 1381 | Ga0496103_0180638 | |||
| 1382 | Ga0496103_0478293 | |||
| 1383 | Ga0496104_0006744 | |||
| 1384 | Ga0496104_0033273 | |||
| 1385 | Ga0496104_0082190 | |||
| 1386 | Ga0496104_0107276 | |||
| 1387 | Ga0496104_0118177 | |||
| 1388 | Ga0496104_0717586 | |||
| 1389 | Ga0496104_0822544 | |||
| 1390 | Ga0496105_0000750 | |||
| 1391 | Ga0496105_0010646 | |||
| 1392 | Ga0496105_0057458 | |||
| 1393 | Ga0496106_0002337 | |||
| 1394 | Ga0496106_0079666 | |||
| 1395 | Ga0496106_0098750 | |||
| 1396 | Ga0496106_0142682 | |||
| 1397 | Ga0496106_0179874 | |||
| 1398 | Ga0496106_0271602 | |||
| 1399 | Ga0496106_0274559 | |||
| 1400 | Ga0496107_0024444 | |||
| 1401 | Ga0496107_0270462 | |||
| 1402 | Ga0496107_0315472 | |||
| 1403 | Ga0496108_0004794 | |||
| 1404 | Ga0496108_0010532 | |||
| 1405 | Ga0496108_0010602 | |||
| 1406 | Ga0496108_0014723 | |||
| 1407 | Ga0496108_0021995 | |||
| 1408 | Ga0496108_0102376 | |||
| 1409 | Ga0496108_0430314 | |||
| 1410 | Ga0496108_0555542 | |||
| 1411 | Ga0496109_0003537 | |||
| 1412 | Ga0496109_0013114 | |||
| 1413 | Ga0496109_0015681 | |||
| 1414 | Ga0496109_0028663 | |||
| 1415 | Ga0496109_0166331 | |||
| 1416 | Ga0496109_0174723 | |||
| 1417 | Ga0496109_0178754 | |||
| 1418 | Ga0496109_0241609 | |||
| 1419 | Ga0496109_0410925 | |||
| 1420 | Ga0496109_0415019 | |||
| 1421 | Ga0496109_0609193 | |||
| 1422 | Ga0496110_0000810 | |||
| 1423 | Ga0496110_0002008 | |||
| 1424 | Ga0496110_0014324 | |||
| 1425 | Ga0496110_0024498 | |||
| 1426 | Ga0496110_0047089 | |||
| 1427 | Ga0496110_0063940 | |||
| 1428 | Ga0496110_0082982 | |||
| 1429 | Ga0496110_0091491 | |||
| 1430 | Ga0496110_0154891 | |||
| 1431 | Ga0496110_0206409 | |||
| 1432 | Ga0496110_0362261 | |||
| 1433 | Ga0496110_0362675 | |||
| 1434 | Ga0496111_0001587 | |||
| 1435 | Ga0496111_0001772 | |||
| 1436 | Ga0496111_0004994 | |||
| 1437 | Ga0496111_0119612 | |||
| 1438 | Ga0496111_0137024 | |||
| 1439 | Ga0496111_0154907 | |||
| 1440 | Ga0496111_0216392 | |||
| 1441 | Ga0496111_0540986 | |||
| 1442 | Ga0496111_0547190 | |||
| 1443 | Ga0496112_0006067 | |||
| 1444 | Ga0496112_0007311 | |||
| 1445 | Ga0496112_0017821 | |||
| 1446 | Ga0496112_0084527 | |||
| 1447 | Ga0496112_0215625 | |||
| 1448 | Ga0496112_0286787 | |||
| 1449 | Ga0496112_0299568 | |||
| 1450 | Ga0496113_0015482 | |||
| 1451 | Ga0496113_0022007 | |||
| 1452 | Ga0496113_0082133 | |||
| 1453 | Ga0496113_0089666 | |||
| 1454 | Ga0496113_0131135 | |||
| 1455 | Ga0496113_0142130 | |||
| 1456 | Ga0496113_0372659 | |||
| 1457 | Ga0496114_0009658 | |||
| 1458 | Ga0496114_0148204 | |||
| 1459 | Ga0496114_0487410 | |||
| 1460 | Ga0496115_0025088 | |||
| 1461 | Ga0496115_0104951 | |||
| 1462 | Ga0496115_0203741 | |||
| 1463 | Ga0496115_0204367 | |||
| 1464 | Ga0496115_0405646 | |||
| 1465 | Ga0496115_0801513 | |||
| 1466 | Ga0501031_0000809 | |||
| 1467 | Ga0501031_0033130 | |||
| 1468 | Ga0501032_0022066 | |||
| 1469 | Ga0501032_0080633 | |||
| 1470 | Ga0501033_0000948 | |||
| 1471 | Ga0501034_0010838 | |||
| 1472 | Ga0501034_0733379 | |||
| 1473 | Ga0501036_0003535 | |||
| 1474 | Ga0501036_0266494 | |||
| 1475 | Ga0501037_0040119 | |||
| 1476 | Ga0501038_0001030 | |||
| 1477 | Ga0501038_0034396 | |||
| 1478 | Ga0501039_0002129 | |||
| 1479 | Ga0501039_0234331 | |||
| 1480 | Ga0501040_0008385 | |||
| 1481 | Ga0501040_0050412 | |||
| 1482 | Ga0501041_0001786 | |||
| 1483 | Ga0501041_0014873 | |||
| 1484 | Ga0501042_0010225 | |||
| 1485 | Ga0501042_0275145 | |||
| 1486 | Ga0501043_0005483 | |||
| 1487 | Ga0501046_0002426 | |||
| 1488 | Ga0501046_0010992 | |||
| 1489 | Ga0501047_0091260 | |||
| 1490 | Ga0501048_0015486 | |||
| 1491 | Ga0501067_0021234 | |||
| 1492 | Ga0501068_0001631 | |||
| 1493 | Ga0501068_0017321 | |||
| 1494 | Ga0501069_0014568 | |||
| 1495 | Ga0501069_0025389 | |||
| 1496 | Ga0501070_0002768 | |||
| 1497 | Ga0501070_0009029 | |||
| 1498 | Ga0501070_0033433 | |||
| 1499 | Ga0501070_0258375 | |||
| 1500 | Ga0501071_0000424 | |||
| 1501 | Ga0501071_0270536 | |||
| 1502 | Ga0501072_0008538 | |||
| 1503 | Ga0501072_0011678 | |||
| 1504 | Ga0501072_0012702 | |||
| 1505 | Ga0501073_0000550 | |||
| 1506 | Ga0501073_0015169 | |||
| 1507 | Ga0501073_0118679 | |||
| 1508 | Ga0501073_0283815 | |||
| 1509 | Ga0501074_0000503 | |||
| 1510 | Ga0501074_0024127 | |||
| 1511 | Ga0501074_0074457 | |||
| 1512 | Ga0501075_0003867 | |||
| 1513 | Ga0501075_0020469 | |||
| 1514 | Ga0501076_0021002 | |||
| 1515 | Ga0501076_0231199 | |||
| 1516 | Ga0501077_0000653 | |||
| 1517 | Ga0501077_0005443 | |||
| 1518 | Ga0501077_0264979 | |||
| 1519 | Ga0501079_0007488 | |||
| 1520 | Ga0501079_0011814 | |||
| 1521 | Ga0501079_0043710 | |||
| 1522 | Ga0501079_0122568 | |||
| 1523 | Ga0501079_0194161 | |||
| 1524 | Ga0501079_0438003 | |||
| 1525 | Ga0501080_0001089 | |||
| 1526 | Ga0501080_0079593 | |||
| 1527 | Ga0501080_0496917 | |||
| 1528 | Ga0501081_0001281 | |||
| 1529 | Ga0501081_0028983 | |||
| 1530 | Ga0501081_0048827 | |||
| 1531 | Ga0501083_0000816 | |||
| 1532 | Ga0501083_0055351 | |||
| 1533 | Ga0501035_0058298 | |||
| 1534 | Ga0501044_0019942 | |||
| 1535 | Ga0501044_0312484 | |||
| 1536 | Ga0501045_0000585 | |||
| 1537 | Ga0501045_0038058 | |||
| 1538 | nmdc:mga00v17_234618_c1 | |||
| 1539 | nmdc:mga00v17_82441_c1 | |||
| 1540 | nmdc:mga0yw44_79753_c1 | |||
| 1541 | nmdc:mga05p37_1137319_c1 | |||
| 1542 | nmdc:mga05p37_1165073_c1 | |||
| 1543 | nmdc:mga05p37_1586_c1 | |||
| 1544 | nmdc:mga05p37_305402_c1 | |||
| 1545 | nmdc:mga05p37_58997_c1 | |||
| 1546 | nmdc:mga05p37_8069_c1 | |||
| 1547 | nmdc:mga05p37_833245_c1 | |||
| 1548 | nmdc:mga09592_256900_c1 | |||
| 1549 | nmdc:mga09592_379853_c1 | |||
| 1550 | nmdc:mga0qj67_342168_c1 | |||
| 1551 | nmdc:mga06r32_373798_c1 | |||
| 1552 | nmdc:mga06r32_573739_c1 | |||
| 1553 | nmdc:mga08y16_16744_c1 | |||
| 1554 | nmdc:mga08y16_23951_c1 | |||
| 1555 | nmdc:mga08y16_487682_c1 | |||
| 1556 | nmdc:mga08y16_5425_c1 | |||
| 1557 | nmdc:mga08y16_62278_c1 | |||
| 1558 | nmdc:mga08y16_648192_c1 | |||
| 1559 | nmdc:mga0n895_203664_c1 | |||
| 1560 | nmdc:mga0n895_44020_c1 | |||
| 1561 | nmdc:mga0n895_66496_c1 | |||
| 1562 | nmdc:mga0n895_76656_c1 | |||
| 1563 | nmdc:mga0rr50_6001_c1 | |||
| 1564 | nmdc:mga0rr50_933_c2 | |||
| 1565 | nmdc:mga08x19_100376_c1 | |||
| 1566 | nmdc:mga08x19_2604_c1 | |||
| 1567 | nmdc:mga08x19_520370_c1 | |||
| 1568 | nmdc:mga0a205_102197_c1 | |||
| 1569 | nmdc:mga0a205_19350_c1 | |||
| 1570 | nmdc:mga0a205_229584_c1 | |||
| 1571 | nmdc:mga0a205_27351_c1 | |||
| 1572 | Ga0495601_0000040 | |||
| 1573 | Ga0495612_0000093 | |||
| 1574 | Ga0495655_0190672 | |||
| 1575 | Ga0495595_0024200 | |||
| 1576 | Ga0495619_0000615 | |||
| 1577 | Ga0495619_0215129 | |||
| 1578 | Ga0501084_0009831 | |||
| 1579 | Ga0501084_0011396 | |||
| 1580 | Ga0501084_0225287 | |||
| 1581 | Ga0501082_0001714 | |||
| 1582 | Ga0501082_0088408 | |||
| 1583 | Ga0501082_0237311 | |||
| 1584 | Ga0501082_0327887 | |||
| 1585 | Ga0466962_0020062 | |||
| 1586 | Ga0530510_0001637 | |||
| 1587 | Ga0530510_0028276 | |||
| 1588 | Ga0530510_0046822 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5qsu-assembly4.cif.gz_D | pandda analysis group deposition -- crystal structure of human stag1 in complex with z2856434926 | 0.3013 | 7 | 190 |
| 6btx-assembly1.cif.gz_A | structure of a bacterial metal transporter | 0.272 | 72 | 214 |
| 7dhi-assembly1.cif.gz_R | cryo-em structure of the partial agonist salbutamol-bound beta2 adrenergic receptor-gs protein complex. | 0.2511 | 29 | 171 |
| 6yue-assembly1.cif.gz_A-2 | fragment of nitrate/nitrite sensor histidine kinase narq (r50s variant) | 0.2464 | 1 | 222 |
| 7a26-assembly1.cif.gz_AAA | structure of soluble smha crystal form 1 of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. | 0.2416 | 26 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ADR0_21_135_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.722 | 47 | 178 | 1.10.1760.20 |
| af_P0ADR0_21_135_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.6833 | 47 | 178 | 1.10.1760.20 |
| af_P37340_244_405_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4709 | 2 | 210 | 1.20.1250.20 |
| af_P37340_244_405_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.448 | 2 | 210 | 1.20.1250.20 |
| af_K7MLI3_277_440_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4465 | 5 | 210 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C2ZGC2-F1-model_v4 | deleted | 0.9015 | 36 | 186 |
|
| AF-A0A698C407-F1-model_v4 | deleted | 0.8896 | 7 | 178 |
|
| AF-A0A840KQK6-F1-model_v4 | deleted | 0.882 | 21 | 179 |
|
| AF-A0A4Q4IYA9-F1-model_v4 | deleted | 0.881 | 11 | 175 |
|
| AF-A0A6G8AP75-F1-model_v4 | DedA family protein | 0.8767 | 11 | 183 |
GO:0005886
|