F481059

General Info

Members Datasets Scaffolds Average Seq Length
793 349 790 146

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_11921530|Ga0157378_119215301
Length 179
Sequence MTMVPPDVRCPECRPGVAAIAGRPRAFYPDDMALKGEYEPSPAQWVRDQVELYEGSGGTQGNTLRETGLPVIVVTTLGVKSGKIRKIPLMRVEHDGEYALVASKGGAPAHPVWYYNLKDNAGPIEIQDGPEPTEFAVRELSGEERATWWDRAVAAFPPYAEYQAKTDRQIPVFLASPRH

Samples

Sample ID Description Type Environment
1 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
2 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
113 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
123 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
125 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
186 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
196 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
200 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
208 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
212 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
237 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
238 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
239 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
240 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
241 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
266 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
267 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
278 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
279 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
280 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
281 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
284 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
285 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
286 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
291 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
310 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
311 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
323 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
324 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
327 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
328 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
329 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
330 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
331 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
335 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
336 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
337 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
338 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
339 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
340 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
341 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
342 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
343 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
344 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
345 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
346 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
347 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
348 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
349 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.97
Metatranscriptomes 2.65
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.65
Nodule 0
Rhizoplane 5.8
Rhizosphere 87.26
Stem 0
Stem Tuber 0
Unclassified 4.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10130550 3300001979 Bacteria 627
2 Ga0070658_10011102 3300005327 Bacteria 7222
3 Ga0070658_10026589 3300005327 Bacteria 4643
4 Ga0070676_11131792 3300005328 Bacteria 593
5 Ga0070683_100033200 3300005329 Bacteria 4705
6 Ga0070683_100058012 3300005329 Bacteria 3597
7 Ga0070670_100782366 3300005331 Bacteria 861
8 Ga0068869_100008663 3300005334 Bacteria 6570
9 Ga0070680_100022387 3300005336 Bacteria 5034
10 Ga0070682_100006527 3300005337 Bacteria 6547
11 Ga0070682_100174812 3300005337 Bacteria 1495
12 Ga0070682_100194670 3300005337 Bacteria 1426
13 Ga0068868_100040660 3300005338 Bacteria 3619
14 Ga0068868_100116827 3300005338 Bacteria 2173
15 Ga0070660_100053561 3300005339 Bacteria 3112
16 Ga0070689_100333647 3300005340 Bacteria 1269
17 Ga0070691_10005725 3300005341 Bacteria 5666
18 Ga0070691_10101240 3300005341 Bacteria 1431
19 Ga0070687_100122072 3300005343 Bacteria 1491
20 Ga0070668_100153728 3300005347 Bacteria 1863
21 Ga0070669_101205879 3300005353 Bacteria 654
22 Ga0070671_100113797 3300005355 Bacteria 2274
23 Ga0070671_101588414 3300005355 Bacteria 580
24 Ga0070674_100072492 3300005356 Bacteria 2439
25 Ga0070659_100003309 3300005366 Bacteria 11480
26 Ga0070659_100137804 3300005366 Bacteria 1985
27 Ga0070659_100211412 3300005366 Bacteria 1599
28 Ga0070667_100172333 3300005367 Bacteria 1911
29 Ga0070667_100498144 3300005367 Bacteria 1116
30 Ga0070709_10004900 3300005434 Bacteria 7233
31 Ga0070709_10012138 3300005434 Bacteria 4816
32 Ga0070709_10015872 3300005434 Bacteria 4289
33 Ga0070709_10121606 3300005434 Bacteria 1770
34 Ga0070709_10131973 3300005434 Bacteria 1706
35 Ga0070714_100038387 3300005435 Bacteria 4025
36 Ga0070714_100070947 3300005435 Bacteria 3012
37 Ga0070714_100189514 3300005435 Bacteria 1876
38 Ga0070714_100316472 3300005435 Bacteria 1458
39 Ga0070714_100366639 3300005435 Bacteria 1355
40 Ga0070714_100406691 3300005435 Bacteria 1287
41 Ga0070714_100424497 3300005435 Bacteria 1260
42 Ga0070714_100443839 3300005435 Bacteria 1232
43 Ga0070714_100581271 3300005435 Bacteria 1074
44 Ga0070714_100736574 3300005435 Bacteria 952
45 Ga0070713_100228102 3300005436 Bacteria 1692
46 Ga0070713_100446993 3300005436 Bacteria 1213
47 Ga0070713_100705383 3300005436 Bacteria 963
48 Ga0070710_10004524 3300005437 Bacteria 6575
49 Ga0070710_10018559 3300005437 Bacteria 3580
50 Ga0070710_10028884 3300005437 Bacteria 2970
51 Ga0070710_10214185 3300005437 Bacteria 1222
52 Ga0070710_10224158 3300005437 Bacteria 1197
53 Ga0070711_100037903 3300005439 Bacteria 3237
54 Ga0070711_100038693 3300005439 Bacteria 3208
55 Ga0070711_100069160 3300005439 Bacteria 2483
56 Ga0070711_100072683 3300005439 Bacteria 2427
57 Ga0070711_100126962 3300005439 Bacteria 1894
58 Ga0070705_100009830 3300005440 Bacteria 4770
59 Ga0070705_100152954 3300005440 Bacteria 1533
60 Ga0070705_100785918 3300005440 Bacteria 756
61 Ga0070694_101044058 3300005444 Bacteria 680
62 Ga0070708_100002254 3300005445 Bacteria 14909
63 Ga0070708_100116448 3300005445 Bacteria 2461
64 Ga0070708_100379605 3300005445 Bacteria 1332
65 Ga0070708_101012003 3300005445 Bacteria 779
66 Ga0070708_101329652 3300005445 Bacteria 671
67 Ga0070663_100045037 3300005455 Bacteria 3115
68 Ga0070678_100006821 3300005456 Bacteria 6731
69 Ga0070662_100877479 3300005457 Bacteria 765
70 Ga0070681_10014657 3300005458 Bacteria 7797
71 Ga0070681_10445347 3300005458 Bacteria 1207
72 Ga0070681_10852618 3300005458 Bacteria 829
73 Ga0070681_11094482 3300005458 Bacteria 718
74 Ga0068867_100168391 3300005459 Bacteria 1733
75 Ga0070685_10012830 3300005466 Bacteria 4409
76 Ga0070685_10083761 3300005466 Bacteria 1916
77 Ga0070706_100053612 3300005467 Bacteria 3722
78 Ga0070706_100053853 3300005467 Bacteria 3714
79 Ga0070706_100194792 3300005467 Bacteria 1893
80 Ga0070706_100407939 3300005467 Bacteria 1265
81 Ga0070706_100845864 3300005467 Bacteria 846
82 Ga0070706_101046923 3300005467 Bacteria 752
83 Ga0070706_102052535 3300005467 Bacteria 517
84 Ga0070707_100031696 3300005468 Bacteria 5037
85 Ga0070707_100045570 3300005468 Bacteria 4197
86 Ga0070707_100066233 3300005468 Bacteria 3471
87 Ga0070707_100084253 3300005468 Bacteria 3071
88 Ga0070698_100107441 3300005471 Bacteria 2758
89 Ga0070698_101279140 3300005471 Bacteria 683
90 Ga0070699_100004187 3300005518 Bacteria 12764
91 Ga0070699_100112445 3300005518 Bacteria 2392
92 Ga0070679_100022981 3300005530 Bacteria 6099
93 Ga0070679_100174356 3300005530 Bacteria 2123
94 Ga0070684_100136100 3300005535 Bacteria 2219
95 Ga0070684_100167382 3300005535 Bacteria 1995
96 Ga0070697_100014160 3300005536 Bacteria 6264
97 Ga0070697_100940744 3300005536 Bacteria 767
98 Ga0068853_100043867 3300005539 Bacteria 3826
99 Ga0068853_100353189 3300005539 Bacteria 1368
100 Ga0068853_100354901 3300005539 Bacteria 1365
101 Ga0070672_100004844 3300005543 Bacteria 8845
102 Ga0070672_100174471 3300005543 Bacteria 1789
103 Ga0070695_100080131 3300005545 Bacteria 2157
104 Ga0070696_100011939 3300005546 Bacteria 5822
105 Ga0070696_100721819 3300005546 Bacteria 814
106 Ga0070693_100003246 3300005547 Bacteria 7553
107 Ga0070665_100045387 3300005548 Bacteria 4413
108 Ga0070665_100120050 3300005548 Bacteria 2631
109 Ga0070665_100128802 3300005548 Bacteria 2533
110 Ga0070704_100031218 3300005549 Bacteria 3581
111 Ga0068855_100039781 3300005563 Bacteria 5581
112 Ga0068855_100059365 3300005563 Bacteria 4475
113 Ga0068855_100152689 3300005563 Bacteria 2625
114 Ga0068855_100212575 3300005563 Bacteria 2172
115 Ga0068855_100710553 3300005563 Bacteria 1075
116 Ga0068855_100920397 3300005563 Bacteria 923
117 Ga0068855_100998174 3300005563 Bacteria 880
118 Ga0068855_101588384 3300005563 Bacteria 669
119 Ga0070664_100009586 3300005564 Bacteria 7854
120 Ga0068857_100013122 3300005577 Bacteria 7220
121 Ga0068857_100567863 3300005577 Bacteria 1070
122 Ga0068854_100104518 3300005578 Bacteria 2128
123 Ga0068854_100212710 3300005578 Bacteria 1526
124 Ga0068856_100084217 3300005614 Bacteria 3158
125 Ga0068856_100089319 3300005614 Bacteria 3064
126 Ga0068856_100229775 3300005614 Bacteria 1870
127 Ga0068856_100375624 3300005614 Bacteria 1440
128 Ga0068856_100535489 3300005614 Bacteria 1192
129 Ga0068856_100884666 3300005614 Bacteria 912
130 Ga0068852_100003105 3300005616 Bacteria 11562
131 Ga0068852_100008277 3300005616 Bacteria 7654
132 Ga0068852_100026637 3300005616 Bacteria 4703
133 Ga0068852_100151113 3300005616 Bacteria 2159
134 Ga0068859_100086190 3300005617 Bacteria 3187
135 Ga0068864_100008886 3300005618 Bacteria 8283
136 Ga0068864_100143486 3300005618 Bacteria 2156
137 Ga0068864_100449985 3300005618 Bacteria 1231
138 Ga0068864_100742933 3300005618 Bacteria 961
139 Ga0068864_101005768 3300005618 Bacteria 827
140 Ga0068861_100119740 3300005719 Bacteria 2122
141 Ga0068861_100482793 3300005719 Bacteria 1117
142 Ga0068851_10000022 3300005834 Bacteria 129607
143 Ga0068863_100011963 3300005841 Bacteria 8386
144 Ga0068863_100120547 3300005841 Bacteria 2501
145 Ga0068863_100298424 3300005841 Bacteria 1563
146 Ga0068858_100001116 3300005842 Bacteria 27809
147 Ga0068858_100011040 3300005842 Bacteria 8538
148 Ga0068858_100074709 3300005842 Bacteria 3148
149 Ga0068860_100062358 3300005843 Bacteria 3542
150 Ga0068862_100219957 3300005844 Bacteria 1719
151 Ga0070717_10009984 3300006028 Bacteria 7143
152 Ga0070717_10011792 3300006028 Bacteria 6649
153 Ga0070717_10035435 3300006028 Bacteria 4040
154 Ga0070717_10094460 3300006028 Bacteria 2529
155 Ga0070717_10097243 3300006028 Bacteria 2494
156 Ga0070717_10205772 3300006028 Bacteria 1725
157 Ga0070717_10375563 3300006028 Bacteria 1274
158 Ga0070717_10385980 3300006028 Bacteria 1256
159 Ga0070717_10470318 3300006028 Bacteria 1134
160 Ga0070717_10518274 3300006028 Bacteria 1078
161 Ga0070717_10584881 3300006028 Bacteria 1012
162 Ga0070717_10697597 3300006028 Bacteria 922
163 Ga0070717_10966726 3300006028 Bacteria 775
164 Ga0070717_11084937 3300006028 Bacteria 729
165 Ga0070717_11227964 3300006028 Bacteria 682
166 Ga0075368_10012045 3300006042 Bacteria 3158
167 Ga0075363_100166099 3300006048 Bacteria 1251
168 Ga0075364_10002703 3300006051 Bacteria 9966
169 Ga0070715_10244534 3300006163 Bacteria 935
170 Ga0070716_100013108 3300006173 Bacteria 4218
171 Ga0070716_100034829 3300006173 Bacteria 2763
172 Ga0070712_100007749 3300006175 Bacteria 6721
173 Ga0070712_100056070 3300006175 Bacteria 2762
174 Ga0070712_100199106 3300006175 Bacteria 1572
175 Ga0070712_100450425 3300006175 Bacteria 1071
176 Ga0075362_10004700 3300006177 Bacteria 4929
177 Ga0075367_10078886 3300006178 Bacteria 1989
178 Ga0075369_10075638 3300006186 Bacteria 1487
179 Ga0075366_11068811 3300006195 Bacteria 504
180 Ga0097621_100009840 3300006237 Bacteria 6961
181 Ga0097621_100062056 3300006237 Bacteria 3067
182 Ga0097621_100735107 3300006237 Bacteria 911
183 Ga0075370_10060147 3300006353 Bacteria 2164
184 Ga0068871_100006638 3300006358 Bacteria 8209
185 Ga0068871_101072043 3300006358 Bacteria 753
186 Ga0068865_101513678 3300006881 Bacteria 601
187 Ga0075436_100101712 3300006914 Bacteria 2002
188 Ga0075436_100449067 3300006914 Bacteria 938
189 Ga0075436_101087000 3300006914 Bacteria 602
190 Ga0097620_100086188 3300006931 Bacteria 3187
191 Ga0075435_100082491 3300007076 Bacteria 2643
192 Ga0075435_100282242 3300007076 Bacteria 1418
193 Ga0099795_10134317 3300007788 Bacteria 1001
194 Ga0105251_10090761 3300009011 Bacteria 1403
195 Ga0105251_10209704 3300009011 Bacteria 877
196 Ga0105240_10133676 3300009093 Bacteria 2972
197 Ga0105240_11039377 3300009093 Bacteria 874
198 Ga0105240_11476147 3300009093 Bacteria 713
199 Ga0105245_10000706 3300009098 Bacteria 30052
200 Ga0105245_10013431 3300009098 Bacteria 7135
201 Ga0105245_10090349 3300009098 Bacteria 2817
202 Ga0105245_10158321 3300009098 Bacteria 2147
203 Ga0105245_10183085 3300009098 Bacteria 2003
204 Ga0105247_10259565 3300009101 Bacteria 1191
205 Ga0105247_10801417 3300009101 Bacteria 719
206 Ga0114129_10546506 3300009147 Bacteria 1507
207 Ga0105241_10087157 3300009174 Bacteria 2457
208 Ga0105242_10135834 3300009176 Bacteria 2128
209 Ga0105248_10007015 3300009177 Bacteria 12338
210 Ga0105248_10094046 3300009177 Bacteria 3375
211 Ga0105248_10143855 3300009177 Bacteria 2691
212 Ga0105248_10640833 3300009177 Bacteria 1199
213 Ga0105248_11532264 3300009177 Bacteria 755
214 Ga0105237_10006825 3300009545 Bacteria 12584
215 Ga0105237_10056684 3300009545 Bacteria 3921
216 Ga0105237_10120034 3300009545 Bacteria 2623
217 Ga0105237_10130352 3300009545 Bacteria 2509
218 Ga0105237_10141667 3300009545 Bacteria 2398
219 Ga0105237_10562298 3300009545 Bacteria 1147
220 Ga0105238_10237359 3300009551 Bacteria 1800
221 Ga0105238_10526626 3300009551 Bacteria 1185
222 Ga0105238_10528545 3300009551 Bacteria 1182
223 Ga0105238_10631771 3300009551 Bacteria 1080
224 Ga0105249_10287426 3300009553 Bacteria 1645
225 Ga0099796_10074334 3300010159 Bacteria 1234
226 Ga0105239_11304206 3300010375 Bacteria 837
227 Ga0105239_11352481 3300010375 Bacteria 822
228 Ga0105239_11426288 3300010375 Bacteria 800
229 Ga0105239_12666950 3300010375 Bacteria 583
230 Ga0105246_10057395 3300011119 Bacteria 2693
231 Ga0105246_10389723 3300011119 Bacteria 1154
232 Ga0105246_10696032 3300011119 Bacteria 890
233 Ga0105246_11086745 3300011119 Bacteria 730
234 Ga0157342_1037701 3300012507 Bacteria 635
235 Ga0157370_10038567 3300013104 Bacteria 4621
236 Ga0157370_10104826 3300013104 Bacteria 2647
237 Ga0157370_10299654 3300013104 Bacteria 1484
238 Ga0157370_10846693 3300013104 Bacteria 831
239 Ga0157369_10036664 3300013105 Bacteria 5371
240 Ga0157369_10193971 3300013105 Bacteria 2133
241 Ga0157369_10503009 3300013105 Bacteria 1254
242 Ga0157369_10867909 3300013105 Bacteria 926
243 Ga0157369_12464517 3300013105 Bacteria 527
244 Ga0157374_10004488 3300013296 Bacteria 11721
245 Ga0157374_10015131 3300013296 Bacteria 6764
246 Ga0157378_10432756 3300013297 Bacteria 1302
247 Ga0157378_11921530 3300013297 Bacteria 641
248 Ga0163162_10104972 3300013306 Bacteria 2920
249 Ga0157372_10088181 3300013307 Bacteria 3522
250 Ga0157375_10068114 3300013308 Bacteria 3560
251 Ga0157375_10073093 3300013308 Bacteria 3447
252 Ga0163163_10041656 3300014325 Bacteria 4492
253 Ga0163163_10119713 3300014325 Bacteria 2666
254 Ga0163163_10236854 3300014325 Bacteria 1875
255 Ga0163163_10408627 3300014325 Bacteria 1416
256 Ga0157377_10003346 3300014745 Bacteria 7252
257 Ga0157377_10074609 3300014745 Bacteria 1968
258 Ga0157379_10019387 3300014968 Bacteria 6007
259 Ga0157379_10225546 3300014968 Bacteria 1698
260 Ga0157379_11343369 3300014968 Bacteria 691
261 Ga0157376_10011247 3300014969 Bacteria 6588
262 Ga0157376_10333235 3300014969 Bacteria 1447
263 Ga0197907_10450287 3300020069 Bacteria 2316
264 Ga0206356_10083308 3300020070 Bacteria 1420
265 Ga0206356_11851363 3300020070 Bacteria 697
266 Ga0206349_1237185 3300020075 Bacteria 562
267 Ga0206349_1762186 3300020075 Bacteria 2037
268 Ga0206355_1500103 3300020076 Bacteria 721
269 Ga0206351_10140329 3300020077 Bacteria 516
270 Ga0206351_10704597 3300020077 Bacteria 1268
271 Ga0206352_10807676 3300020078 Bacteria 1240
272 Ga0206352_10811948 3300020078 Bacteria 620
273 Ga0206350_10990203 3300020080 Bacteria 2282
274 Ga0206350_11205897 3300020080 Bacteria 1371
275 Ga0206354_11069328 3300020081 Bacteria 1530
276 Ga0206353_10252478 3300020082 Bacteria 1699
277 Ga0206353_10876871 3300020082 Bacteria 2563
278 Ga0154015_1348326 3300020610 Bacteria 710
279 Ga0213876_10040496 3300021384 Bacteria 2461
280 Ga0213875_10066989 3300021388 Bacteria 1677
281 Ga0213875_10266276 3300021388 Bacteria 809
282 Ga0224712_10019923 3300022467 Bacteria 2270
283 Ga0224712_10123937 3300022467 Bacteria 1122
284 Ga0224571_107138 3300022734 Bacteria 751
285 Ga0247551_103345 3300023552 Bacteria 613
286 Ga0224572_1000558 3300024225 Bacteria 4572
287 Ga0228598_1023934 3300024227 Bacteria 1202
288 Ga0207656_10000005 3300025321 Bacteria 490514
289 Ga0207692_10008528 3300025898 Bacteria 4244
290 Ga0207692_10028273 3300025898 Bacteria 2650
291 Ga0207692_10029315 3300025898 Bacteria 2614
292 Ga0207692_10030704 3300025898 Bacteria 2565
293 Ga0207692_10205468 3300025898 Bacteria 1160
294 Ga0207692_10384530 3300025898 Bacteria 872
295 Ga0207710_10035869 3300025900 Bacteria 2184
296 Ga0207710_10317826 3300025900 Bacteria 789
297 Ga0207688_11097767 3300025901 Bacteria 502
298 Ga0207680_10273134 3300025903 Bacteria 1173
299 Ga0207647_10061534 3300025904 Bacteria 2290
300 Ga0207685_10091175 3300025905 Bacteria 1283
301 Ga0207699_10001841 3300025906 Bacteria 9974
302 Ga0207699_10059915 3300025906 Bacteria 2283
303 Ga0207699_10110172 3300025906 Bacteria 1763
304 Ga0207699_10237305 3300025906 Bacteria 1251
305 Ga0207645_10350291 3300025907 Bacteria 988
306 Ga0207643_10546382 3300025908 Bacteria 743
307 Ga0207705_10021383 3300025909 Bacteria 4617
308 Ga0207705_10044976 3300025909 Bacteria 3173
309 Ga0207684_10155619 3300025910 Bacteria 1967
310 Ga0207684_10201187 3300025910 Bacteria 1718
311 Ga0207684_10678155 3300025910 Bacteria 877
312 Ga0207684_10721893 3300025910 Bacteria 846
313 Ga0207684_11047849 3300025910 Bacteria 681
314 Ga0207684_11587885 3300025910 Bacteria 530
315 Ga0207654_10094665 3300025911 Bacteria 1828
316 Ga0207707_10007656 3300025912 Bacteria 9410
317 Ga0207707_10033930 3300025912 Bacteria 4466
318 Ga0207707_10684160 3300025912 Bacteria 862
319 Ga0207695_10010059 3300025913 Bacteria 11616
320 Ga0207695_10012911 3300025913 Bacteria 9997
321 Ga0207695_10059511 3300025913 Bacteria 3960
322 Ga0207695_10098913 3300025913 Bacteria 2916
323 Ga0207671_10000016 3300025914 Bacteria 435413
324 Ga0207671_10060170 3300025914 Bacteria 2817
325 Ga0207671_10090023 3300025914 Bacteria 2310
326 Ga0207671_10129424 3300025914 Bacteria 1936
327 Ga0207671_10845988 3300025914 Bacteria 724
328 Ga0207693_10013359 3300025915 Bacteria 6620
329 Ga0207693_10193161 3300025915 Bacteria 1602
330 Ga0207693_10293885 3300025915 Bacteria 1273
331 Ga0207693_10391570 3300025915 Bacteria 1087
332 Ga0207663_10007438 3300025916 Bacteria 5679
333 Ga0207663_10007664 3300025916 Bacteria 5612
334 Ga0207663_10062027 3300025916 Bacteria 2375
335 Ga0207660_10015428 3300025917 Bacteria 5042
336 Ga0207660_10169602 3300025917 Bacteria 1689
337 Ga0207657_10006398 3300025919 Bacteria 12228
338 Ga0207657_10114578 3300025919 Bacteria 2223
339 Ga0207649_10025508 3300025920 Bacteria 3446
340 Ga0207652_10134373 3300025921 Bacteria 2208
341 Ga0207652_10140846 3300025921 Bacteria 2156
342 Ga0207652_10896704 3300025921 Bacteria 783
343 Ga0207646_10004957 3300025922 Bacteria 14225
344 Ga0207646_10039482 3300025922 Bacteria 4249
345 Ga0207646_10042936 3300025922 Bacteria 4062
346 Ga0207646_10153104 3300025922 Bacteria 2079
347 Ga0207681_11208321 3300025923 Bacteria 635
348 Ga0207694_10000057 3300025924 Bacteria 146441
349 Ga0207694_10130249 3300025924 Bacteria 2016
350 Ga0207659_10124890 3300025926 Bacteria 1977
351 Ga0207687_10403647 3300025927 Bacteria 1124
352 Ga0207687_10466516 3300025927 Bacteria 1049
353 Ga0207687_11149015 3300025927 Bacteria 667
354 Ga0207700_10002213 3300025928 Bacteria 11159
355 Ga0207700_10070942 3300025928 Bacteria 2680
356 Ga0207700_10225561 3300025928 Bacteria 1590
357 Ga0207700_10227297 3300025928 Bacteria 1585
358 Ga0207700_10459930 3300025928 Bacteria 1122
359 Ga0207700_10643291 3300025928 Bacteria 945
360 Ga0207664_10000717 3300025929 Bacteria 22557
361 Ga0207664_10003182 3300025929 Bacteria 10913
362 Ga0207664_10010632 3300025929 Bacteria 6505
363 Ga0207664_10037876 3300025929 Bacteria 3735
364 Ga0207664_10083937 3300025929 Bacteria 2597
365 Ga0207664_10135856 3300025929 Bacteria 2075
366 Ga0207664_10166146 3300025929 Bacteria 1885
367 Ga0207664_10197799 3300025929 Bacteria 1734
368 Ga0207664_10234468 3300025929 Bacteria 1596
369 Ga0207664_10400579 3300025929 Bacteria 1220
370 Ga0207664_10427549 3300025929 Bacteria 1180
371 Ga0207664_11569034 3300025929 Bacteria 580
372 Ga0207644_10069912 3300025931 Bacteria 2564
373 Ga0207644_10852022 3300025931 Bacteria 763
374 Ga0207644_11264980 3300025931 Bacteria 620
375 Ga0207690_10000329 3300025932 Bacteria 31684
376 Ga0207690_10047869 3300025932 Bacteria 2839
377 Ga0207686_10065315 3300025934 Bacteria 2320
378 Ga0207709_10790832 3300025935 Bacteria 765
379 Ga0207670_10238403 3300025936 Bacteria 1400
380 Ga0207669_10352151 3300025937 Bacteria 1138
381 Ga0207665_10005764 3300025939 Bacteria 8239
382 Ga0207665_10019137 3300025939 Bacteria 4499
383 Ga0207665_10083781 3300025939 Bacteria 2200
384 Ga0207665_10222805 3300025939 Bacteria 1383
385 Ga0207691_10029904 3300025940 Bacteria 5095
386 Ga0207691_10476711 3300025940 Bacteria 1061
387 Ga0207711_10006065 3300025941 Bacteria 10214
388 Ga0207711_10058384 3300025941 Bacteria 3320
389 Ga0207711_10069492 3300025941 Bacteria 3053
390 Ga0207711_10486200 3300025941 Bacteria 1150
391 Ga0207711_10517086 3300025941 Bacteria 1113
392 Ga0207689_10003607 3300025942 Bacteria 14137
393 Ga0207679_10223234 3300025945 Bacteria 1586
394 Ga0207679_10550714 3300025945 Bacteria 1035
395 Ga0207667_10008226 3300025949 Bacteria 12411
396 Ga0207667_10031365 3300025949 Bacteria 5737
397 Ga0207667_10198511 3300025949 Bacteria 2058
398 Ga0207667_10259833 3300025949 Bacteria 1776
399 Ga0207667_10294176 3300025949 Bacteria 1659
400 Ga0207667_11094120 3300025949 Bacteria 780
401 Ga0207712_11301431 3300025961 Bacteria 650
402 Ga0207640_10037102 3300025981 Bacteria 3064
403 Ga0207640_10165257 3300025981 Bacteria 1643
404 Ga0207658_10047398 3300025986 Bacteria 3145
405 Ga0207703_10003158 3300026035 Bacteria 13903
406 Ga0207703_10069559 3300026035 Bacteria 2903
407 Ga0207703_10163815 3300026035 Bacteria 1949
408 Ga0207639_10019021 3300026041 Bacteria 4891
409 Ga0207639_10154383 3300026041 Bacteria 1927
410 Ga0207639_10230284 3300026041 Bacteria 1606
411 Ga0207678_10012650 3300026067 Bacteria 7414
412 Ga0207708_10674797 3300026075 Bacteria 881
413 Ga0207702_10013634 3300026078 Bacteria 6751
414 Ga0207702_10202816 3300026078 Bacteria 1839
415 Ga0207702_10218380 3300026078 Bacteria 1776
416 Ga0207702_10346309 3300026078 Bacteria 1421
417 Ga0207702_10560487 3300026078 Bacteria 1118
418 Ga0207702_10796466 3300026078 Bacteria 934
419 Ga0207641_10072919 3300026088 Bacteria 2958
420 Ga0207641_10449813 3300026088 Bacteria 1245
421 Ga0207641_10779048 3300026088 Bacteria 945
422 Ga0207641_11072839 3300026088 Bacteria 803
423 Ga0207676_10294870 3300026095 Bacteria 1478
424 Ga0207676_10364381 3300026095 Bacteria 1340
425 Ga0207676_10540144 3300026095 Bacteria 1112
426 Ga0207676_11314480 3300026095 Bacteria 718
427 Ga0207674_10001953 3300026116 Bacteria 26128
428 Ga0207674_10007743 3300026116 Bacteria 12503
429 Ga0207674_10037100 3300026116 Bacteria 5072
430 Ga0207674_10783125 3300026116 Bacteria 920
431 Ga0207675_100033506 3300026118 Bacteria 4786
432 Ga0207683_10008115 3300026121 Bacteria 8977
433 Ga0207698_10002133 3300026142 Bacteria 11674
434 Ga0207698_10009907 3300026142 Bacteria 6096
435 Ga0207698_10337914 3300026142 Bacteria 1417
436 Ga0268266_10156416 3300028379 Bacteria 2059
437 Ga0268266_10251511 3300028379 Bacteria 1635
438 Ga0268265_10197181 3300028380 Bacteria 1743
439 Ga0268264_10185564 3300028381 Bacteria 1892
440 Ga0268264_10701688 3300028381 Bacteria 1005
441 Ga0307515_10645269 3300028794 Bacteria 671
442 Ga0265338_10001315 3300028800 Bacteria 40706
443 Ga0265338_10076423 3300028800 Bacteria 2837
444 Ga0265338_10276170 3300028800 Bacteria 1229
445 Ga0265338_10905438 3300028800 Bacteria 600
446 Ga0265760_10014959 3300031090 Bacteria 2223
447 Ga0265760_10056087 3300031090 Bacteria 1192
448 Ga0265325_10005629 3300031241 Bacteria 7713
449 Ga0265325_10119661 3300031241 Bacteria 1271
450 Ga0265329_10035092 3300031242 Bacteria 1619
451 Ga0265340_10290018 3300031247 Bacteria 726
452 Ga0265339_10003540 3300031249 Bacteria 10917
453 Ga0265339_10409467 3300031249 Bacteria 633
454 Ga0265331_10018260 3300031250 Bacteria 3643
455 Ga0265331_10122286 3300031250 Bacteria 1190
456 Ga0265327_10000911 3300031251 Bacteria 43377
457 Ga0265327_10061537 3300031251 Bacteria 1915
458 Ga0265316_10297347 3300031344 Bacteria 1176
459 Ga0265313_10001049 3300031595 Bacteria 26890
460 Ga0265313_10018284 3300031595 Bacteria 3942
461 Ga0265313_10077676 3300031595 Bacteria 1515
462 Ga0307514_10387275 3300031649 Bacteria 722
463 Ga0316579_10233587 3300031691 Bacteria 889
464 Ga0265314_10132054 3300031711 Bacteria 1556
465 Ga0265342_10165233 3300031712 Bacteria 1221
466 Ga0265342_10322205 3300031712 Bacteria 810
467 Ga0316576_10002554 3300031727 Bacteria 10385
468 Ga0316576_10130936 3300031727 Bacteria 1887
469 Ga0316576_10141687 3300031727 Bacteria 1810
470 Ga0316578_10000611 3300031728 Bacteria 12514
471 Ga0316578_10014573 3300031728 Bacteria 4205
472 Ga0316578_10600256 3300031728 Bacteria 645
473 Ga0307410_10387660 3300031852 Bacteria 1126
474 Ga0307410_10595530 3300031852 Bacteria 921
475 Ga0326468_10000782 3300031889 Bacteria 3194
476 Ga0307407_10641683 3300031903 Bacteria 794
477 Ga0307412_10047428 3300031911 Bacteria 2822
478 Ga0307409_100679557 3300031995 Bacteria 1027
479 Ga0307409_101225154 3300031995 Bacteria 774
480 Ga0307411_11290776 3300032005 Bacteria 665
481 Ga0316580_10078666 3300032139 Bacteria 1009
482 Ga0373930_0015946 3300034816 Bacteria 1416
483 Ga0373926_0003369 3300035083 Bacteria 5144
484 Ga0373934_0023258 3300035086 Bacteria 2394
485 Ga0373934_0142489 3300035086 Bacteria 980
486 Ga0373940_0061272 3300035088 Bacteria 1077
487 Ga0373940_0253843 3300035088 Bacteria 593
488 Ga0373944_0006402 3300035089 Bacteria 3126
489 Ga0373923_0191802 3300035111 Bacteria 942
490 Ga0373936_0007347 3300035113 Bacteria 4146
491 Ga0373936_0014354 3300035113 Bacteria 3026
492 Ga0373939_0231670 3300035114 Bacteria 711
493 Ga0373945_0000242 3300035116 Bacteria 15109
494 Ga0373945_0290335 3300035116 Bacteria 698
495 Ga0373945_0320102 3300035116 Bacteria 667
496 Ga0373956_0202532 3300035119 Bacteria 941
497 Ga0373957_0140555 3300035120 Bacteria 987
498 Ga0373943_0001329 3300035170 Bacteria 11130
499 Ga0373943_0034526 3300035170 Bacteria 2413
500 Ga0373943_0526226 3300035170 Bacteria 692
501 Ga0373943_0588944 3300035170 Bacteria 654
502 Ga0373946_0042975 3300035171 Bacteria 1860
503 Ga0373946_0131458 3300035171 Bacteria 1152
504 Ga0373946_0563858 3300035171 Bacteria 588
505 Ga0373955_0019563 3300035172 Bacteria 3387
506 Ga0373924_0042413 3300035410 Bacteria 1866
507 Ga0373924_0075716 3300035410 Bacteria 1425
508 Ga0373924_0422646 3300035410 Bacteria 596
509 Ga0373931_0298768 3300035691 Bacteria 994
510 Ga0373931_0324954 3300035691 Bacteria 957
511 Ga0373935_0085778 3300035692 Bacteria 2053
512 Ga0373935_0538236 3300035692 Bacteria 850
513 Ga0373927_0005581 3300035695 Bacteria 8650
514 Ga0373927_0071708 3300035695 Bacteria 2242
515 Ga0373927_0373956 3300035695 Bacteria 939
516 Ga0373933_0042759 3300035724 Bacteria 2678
517 Ga0373933_0281024 3300035724 Bacteria 1075
518 Ga0373933_0923331 3300035724 Bacteria 575
519 Ga0373947_0175788 3300035725 Bacteria 1391
520 Ga0373947_0242680 3300035725 Bacteria 1189
521 Ga0373947_0306942 3300035725 Bacteria 1059
522 Ga0373937_0121011 3300036401 Bacteria 2439
523 Ga0373937_0251952 3300036401 Bacteria 1664
524 Ga0373937_0327154 3300036401 Bacteria 1450
525 Ga0373937_0675868 3300036401 Bacteria 978
526 Ga0373937_0947535 3300036401 Bacteria 809
527 Ga0373937_1481550 3300036401 Bacteria 626
528 Ga0316584_0263991 3300036712 Bacteria 1255
529 Ga0316584_0341491 3300036712 Bacteria 1076
530 Ga0373925_0034413 3300037068 Bacteria 3733
531 Ga0373925_0118053 3300037068 Bacteria 2056
532 Ga0373925_0295292 3300037068 Bacteria 1307
533 Ga0373925_0341759 3300037068 Bacteria 1214
534 Ga0436364_0458942 3300037853 Bacteria 732
535 Ga0436364_0729577 3300037853 Bacteria 709
536 Ga0436364_0796359 3300037853 Bacteria 2113
537 Ga0436364_0818911 3300037853 Bacteria 4812
538 Ga0436364_1041443 3300037853 Bacteria 6640
539 Ga0436364_1197365 3300037853 Bacteria 6719
540 Ga0436364_1334594 3300037853 Bacteria 9804
541 Ga0436364_1481992 3300037853 Bacteria 665
542 Ga0436364_1557432 3300037853 Bacteria 625
543 Ga0436365_0112287 3300039437 Bacteria 28019
544 Ga0436365_1145451 3300039437 Bacteria 2300
545 Ga0436365_1189314 3300039437 Bacteria 1328
546 Ga0436361_0458380 3300039447 Bacteria 600
547 Ga0436363_0114807 3300039450 Bacteria 1049
548 Ga0436363_0328230 3300039450 Bacteria 1553
549 Ga0436363_0685849 3300039450 Bacteria 3656
550 Ga0436363_1287920 3300039450 Bacteria 573
551 Ga0436362_0365348 3300039453 Bacteria 691
552 Ga0436362_0480976 3300039453 Bacteria 875
553 Ga0436362_0802298 3300039453 Bacteria 513
554 Ga0436362_1203116 3300039453 Bacteria 1142
555 Ga0451793_0975550 3300041452 Bacteria 888
556 Ga0451806_845660 3300041462 Bacteria 551
557 Ga0451804_1026453 3300041463 Bacteria 1110
558 Ga0439448_0169593 3300042005 Bacteria 761
559 Ga0439459_0101830 3300042438 Bacteria 704
560 Ga0466969_0045930 3300044656 Bacteria 2167
561 Ga0466972_0246077 3300044658 Bacteria 836
562 Ga0466966_0209838 3300044684 Bacteria 1177
563 Ga0466966_0228389 3300044684 Bacteria 1123
564 Ga0466961_0008157 3300044693 Bacteria 6671
565 Ga0466963_0723053 3300044694 Bacteria 702
566 Ga0466968_0261127 3300044735 Bacteria 825
567 Ga0466959_0207388 3300045049 Bacteria 1363
568 Ga0466967_0061888 3300045976 Bacteria 3321
569 Ga0466967_0080982 3300045976 Bacteria 2932
570 Ga0466967_0901860 3300045976 Bacteria 879
571 Ga0466967_1145492 3300045976 Bacteria 775
572 Ga0495592_0033307 3300046454 Bacteria 3886
573 Ga0495592_0449639 3300046454 Bacteria 807
574 Ga0495592_0492785 3300046454 Bacteria 761
575 Ga0495603_0005395 3300046455 Bacteria 7630
576 Ga0495629_0567659 3300046459 Bacteria 761
577 Ga0495629_0746502 3300046459 Bacteria 648
578 Ga0495641_0111169 3300046461 Bacteria 1222
579 Ga0495641_0128575 3300046461 Bacteria 1131
580 Ga0495651_0025942 3300046462 Bacteria 4562
581 Ga0495651_0031975 3300046462 Bacteria 4104
582 Ga0495651_0048621 3300046462 Bacteria 3275
583 Ga0495651_0528730 3300046462 Bacteria 752
584 Ga0495653_0010681 3300046463 Bacteria 7518
585 Ga0495653_0071429 3300046463 Bacteria 2595
586 Ga0495653_0094777 3300046463 Bacteria 2174
587 Ga0495580_0011041 3300046472 Bacteria 7001
588 Ga0495582_0038830 3300046473 Bacteria 2620
589 Ga0495582_0671234 3300046473 Bacteria 600
590 Ga0495582_0694275 3300046473 Bacteria 589
591 Ga0495639_0005051 3300046475 Bacteria 5667
592 Ga0495662_0001071 3300046476 Bacteria 13454
593 Ga0495662_0257421 3300046476 Bacteria 859
594 Ga0495608_0018178 3300046511 Bacteria 4853
595 Ga0495608_0134893 3300046511 Bacteria 1578
596 Ga0495608_0285552 3300046511 Bacteria 1023
597 Ga0495608_0695510 3300046511 Bacteria 605
598 Ga0495618_0004257 3300046514 Bacteria 8827
599 Ga0495618_0050706 3300046514 Bacteria 2622
600 Ga0495628_0021834 3300046516 Bacteria 5260
601 Ga0495628_0156406 3300046516 Bacteria 1734
602 Ga0495628_0184339 3300046516 Bacteria 1578
603 Ga0495628_1012678 3300046516 Bacteria 571
604 Ga0495630_0124677 3300046517 Bacteria 1954
605 Ga0495630_0424893 3300046517 Bacteria 1018
606 Ga0495630_0775258 3300046517 Bacteria 732
607 Ga0495630_1099981 3300046517 Bacteria 602
608 Ga0495666_0011710 3300046526 Bacteria 4373
609 Ga0495666_0077157 3300046526 Bacteria 1579
610 Ga0495666_0547149 3300046526 Bacteria 516
611 Ga0495652_0025271 3300046529 Bacteria 5256
612 Ga0495652_0052687 3300046529 Bacteria 3469
613 Ga0495652_0312970 3300046529 Bacteria 1137
614 Ga0495652_0546599 3300046529 Bacteria 797
615 Ga0495665_0000609 3300046531 Bacteria 18209
616 Ga0495665_0435645 3300046531 Bacteria 663
617 Ga0495640_0011262 3300046533 Bacteria 6885
618 Ga0495640_0051013 3300046533 Bacteria 2846
619 Ga0495640_0080467 3300046533 Bacteria 2166
620 Ga0495586_0399648 3300046535 Bacteria 791
621 Ga0495587_0001347 3300046536 Bacteria 16314
622 Ga0495587_0072829 3300046536 Bacteria 1996
623 Ga0495587_0076967 3300046536 Bacteria 1937
624 Ga0495587_0334261 3300046536 Bacteria 845
625 Ga0495587_0477112 3300046536 Bacteria 690
626 Ga0495645_0100029 3300046543 Bacteria 2062
627 Ga0495645_0121337 3300046543 Bacteria 1840
628 Ga0495667_0004648 3300046559 Bacteria 9284
629 Ga0495667_0006539 3300046559 Bacteria 7911
630 Ga0495667_0013627 3300046559 Bacteria 5497
631 Ga0495667_0051276 3300046559 Bacteria 2722
632 Ga0495667_0162575 3300046559 Bacteria 1436
633 Ga0495667_0836467 3300046559 Bacteria 566
634 Ga0495635_0010729 3300046663 Bacteria 6417
635 Ga0495635_0034972 3300046663 Bacteria 3484
636 Ga0495635_0038913 3300046663 Bacteria 3292
637 Ga0495635_0046693 3300046663 Bacteria 2987
638 Ga0495657_0004896 3300046675 Bacteria 10661
639 Ga0495657_0009780 3300046675 Bacteria 7239
640 Ga0495657_0029808 3300046675 Bacteria 3825
641 Ga0495657_0055518 3300046675 Bacteria 2641
642 Ga0495599_0002162 3300046678 Bacteria 11421
643 Ga0495599_0006221 3300046678 Bacteria 7195
644 Ga0495599_0029504 3300046678 Bacteria 3439
645 Ga0495599_0134784 3300046678 Bacteria 1533
646 Ga0495599_0270710 3300046678 Bacteria 1031
647 Ga0495599_0346641 3300046678 Bacteria 891
648 Ga0495623_0049876 3300046679 Bacteria 2652
649 Ga0495646_0004125 3300046680 Bacteria 9122
650 Ga0495646_0704752 3300046680 Bacteria 507
651 Ga0495658_0002903 3300046683 Bacteria 8607
652 Ga0495613_0124617 3300046689 Bacteria 1848
653 Ga0495624_0067474 3300046690 Bacteria 2231
654 Ga0495600_0016514 3300046809 Bacteria 4686
655 Ga0495600_0029698 3300046809 Bacteria 3540
656 Ga0495600_0042046 3300046809 Bacteria 2979
657 Ga0495600_0701542 3300046809 Bacteria 609
658 Ga0495581_0017527 3300047315 Bacteria 4160
659 Ga0495604_0194675 3300047317 Bacteria 1410
660 Ga0495604_0336861 3300047317 Bacteria 1005
661 Ga0495604_0469798 3300047317 Bacteria 819
662 Ga0495674_0009070 3300047319 Bacteria 9448
663 Ga0495674_0107468 3300047319 Bacteria 2368
664 Ga0495674_0131180 3300047319 Bacteria 2111
665 Ga0495674_0139752 3300047319 Bacteria 2036
666 Ga0495672_0087601 3300047320 Bacteria 1719
667 Ga0495676_0163140 3300047321 Bacteria 1575
668 Ga0495676_0177979 3300047321 Bacteria 1492
669 Ga0495676_0288169 3300047321 Bacteria 1110
670 Ga0495676_0329424 3300047321 Bacteria 1024
671 Ga0495680_0033256 3300047322 Bacteria 4176
672 Ga0495680_0037424 3300047322 Bacteria 3886
673 Ga0495680_0038711 3300047322 Bacteria 3808
674 Ga0495680_0080713 3300047322 Bacteria 2457
675 Ga0495675_0010105 3300047444 Bacteria 5888
676 Ga0495675_0046768 3300047444 Bacteria 2754
677 Ga0495684_0004828 3300047471 Bacteria 10519
678 Ga0495684_0035516 3300047471 Bacteria 3822
679 Ga0495684_0054305 3300047471 Bacteria 3056
680 Ga0495684_0382717 3300047471 Bacteria 992
681 Ga0495684_0625472 3300047471 Bacteria 723
682 Ga0495684_0699345 3300047471 Bacteria 672
683 Ga0495593_0025454 3300047673 Bacteria 3275
684 Ga0495593_0229369 3300047673 Bacteria 931
685 Ga0495602_0030412 3300048088 Bacteria 5121
686 Ga0495602_0366052 3300048088 Bacteria 1036
687 Ga0495614_0003380 3300048089 Bacteria 7138
688 Ga0496100_0220820 3300048903 Bacteria 1391
689 Ga0496101_0021776 3300048904 Bacteria 4405
690 Ga0496101_0485075 3300048904 Bacteria 976
691 Ga0496102_0013321 3300048905 Bacteria 7122
692 Ga0496102_0192269 3300048905 Bacteria 1923
693 Ga0496102_0265710 3300048905 Bacteria 1618
694 Ga0496103_0431403 3300048906 Bacteria 846
695 Ga0496104_0010640 3300048907 Bacteria 8222
696 Ga0496104_0192660 3300048907 Bacteria 1950
697 Ga0496104_0511917 3300048907 Bacteria 1111
698 Ga0496105_0038880 3300048908 Bacteria 3920
699 Ga0496105_0119535 3300048908 Bacteria 2173
700 Ga0496105_0167093 3300048908 Bacteria 1805
701 Ga0496106_0007645 3300048909 Bacteria 7994
702 Ga0496106_0357573 3300048909 Bacteria 1173
703 Ga0496107_0020679 3300048910 Bacteria 4650
704 Ga0496107_1365173 3300048910 Bacteria 505
705 Ga0496108_0014892 3300048911 Bacteria 6345
706 Ga0496108_0065593 3300048911 Bacteria 3060
707 Ga0496108_0156074 3300048911 Bacteria 1971
708 Ga0496109_0005650 3300048912 Bacteria 10461
709 Ga0496109_0032747 3300048912 Bacteria 4674
710 Ga0496109_1502911 3300048912 Bacteria 608
711 Ga0496110_0056972 3300048913 Bacteria 3439
712 Ga0496110_0078225 3300048913 Bacteria 2944
713 Ga0496110_0131709 3300048913 Bacteria 2258
714 Ga0496110_0596667 3300048913 Bacteria 1002
715 Ga0496111_0007464 3300048914 Bacteria 7170
716 Ga0496111_0023645 3300048914 Bacteria 4317
717 Ga0496111_0090752 3300048914 Bacteria 2238
718 Ga0496112_0018081 3300048915 Bacteria 6632
719 Ga0496112_0052633 3300048915 Bacteria 3996
720 Ga0496112_0137016 3300048915 Bacteria 2418
721 Ga0496113_0003643 3300048916 Bacteria 9263
722 Ga0496113_0032280 3300048916 Bacteria 3806
723 Ga0496113_0037236 3300048916 Bacteria 3568
724 Ga0496114_0051179 3300048917 Bacteria 3438
725 Ga0496114_0553956 3300048917 Bacteria 1016
726 Ga0496115_0046842 3300048918 Bacteria 3457
727 Ga0496115_0475254 3300048918 Bacteria 1007
728 Ga0496115_0513593 3300048918 Bacteria 961
729 Ga0496115_0898718 3300048918 Bacteria 683
730 Ga0496115_1235526 3300048918 Bacteria 560
731 Ga0496117_0018305 3300048920 Bacteria 5809
732 Ga0496118_0044420 3300048921 Bacteria 3479
733 Ga0496119_0000437 3300048922 Bacteria 57106
734 Ga0496119_0004896 3300048922 Bacteria 13098
735 Ga0496119_0063237 3300048922 Bacteria 2202
736 Ga0496120_0002152 3300048923 Bacteria 20990
737 Ga0496120_0007258 3300048923 Bacteria 8286
738 Ga0496120_0098451 3300048923 Bacteria 1550
739 Ga0496122_0299869 3300048925 Bacteria 867
740 Ga0496125_0195706 3300048928 Bacteria 1330
741 Ga0496126_0174750 3300048929 Bacteria 1828
742 Ga0496126_0689652 3300048929 Bacteria 795
743 Ga0501036_1274927 3300049572 Bacteria 598
744 Ga0501039_0054886 3300049575 Bacteria 3085
745 Ga0501040_0121832 3300049576 Bacteria 1830
746 Ga0501040_1215653 3300049576 Bacteria 547
747 Ga0501041_0011634 3300049577 Bacteria 5208
748 Ga0501041_0639670 3300049577 Bacteria 680
749 Ga0501042_0040795 3300049578 Bacteria 3299
750 Ga0501068_0289693 3300049584 Bacteria 1047
751 Ga0501068_0296658 3300049584 Bacteria 1034
752 Ga0501071_0012248 3300049587 Bacteria 5810
753 Ga0501072_0171695 3300049588 Bacteria 1730
754 Ga0501075_0119824 3300049591 Bacteria 2002
755 Ga0501076_0004632 3300049592 Bacteria 9796
756 Ga0501079_0262276 3300049741 Bacteria 1350
757 Ga0501081_0111526 3300049743 Bacteria 1941
758 Ga0501045_0194537 3300049824 Bacteria 1511
759 nmdc:mga03683_15919_c1 3300050489 Bacteria 2816
760 nmdc:mga03683_296669_c1 3300050489 Bacteria 757
761 nmdc:mga00v17_349787_c1 3300050491 Bacteria 961
762 nmdc:mga00v17_36919_c1 3300050491 Bacteria 2915
763 nmdc:mga0yw44_4986_c1 3300050492 Bacteria 6196
764 nmdc:mga0k408_529990_c1 3300050493 Bacteria 697
765 nmdc:mga07m45_51214_c1 3300050496 Bacteria 2328
766 nmdc:mga05p37_761729_c1 3300050507 Bacteria 1065
767 nmdc:mga0n895_1963604_c1 3300050512 Bacteria 543
768 nmdc:mga0n895_513311_c1 3300050512 Bacteria 1206
769 nmdc:mga0rr50_702838_c1 3300050513 Bacteria 863
770 nmdc:mga08x19_251138_c1 3300050514 Bacteria 1221
771 nmdc:mga08x19_76191_c1 3300050514 Bacteria 2194
772 nmdc:mga0sz30_70275_c1 3300050516 Bacteria 1506
773 Ga0495601_0044913 3300053077 Bacteria 2777
774 Ga0495601_0110824 3300053077 Bacteria 1777
775 Ga0495601_0272509 3300053077 Bacteria 1104
776 Ga0495612_0016653 3300053078 Bacteria 2945
777 Ga0495612_0114993 3300053078 Bacteria 1154
778 Ga0500635_0001360 3300053080 Bacteria 5862
779 Ga0495595_0053088 3300053084 Bacteria 1882
780 Ga0495595_0132254 3300053084 Bacteria 1220
781 Ga0495619_0005684 3300053085 Bacteria 7908
782 Ga0495619_0325866 3300053085 Bacteria 1063
783 Ga0495619_1123083 3300053085 Bacteria 522
784 Ga0500651_0000251 3300053093 Bacteria 32614
785 Ga0500568_0000031 3300053139 Bacteria 153522
786 Ga0500590_004215 3300053148 Bacteria 6753
787 Ga0500620_000199 3300053155 Bacteria 12023
788 Ga0501084_0116867 3300054114 Bacteria 2242
789 Ga0501082_0135258 3300060353 Bacteria 2139
790 Ga0530510_0288979 3300061734 Bacteria 1225

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100366639 Ga0070714_1003666391 128
2 3300006914 Ga0075436_100101712 Ga0075436_1001017122 128
3 3300035724 Ga0373933_0923331 Ga0373933_0923331_177_563 128
4 3300046511 Ga0495608_0695510 Ga0495608_0695510_149_535 128
5 3300048918 Ga0496115_1235526 Ga0496115_1235526_22_459 128
6 3300046516 Ga0495628_1012678 Ga0495628_1012678_168_557 129
7 3300005618 Ga0068864_101005768 Ga0068864_1010057682 130
8 3300025901 Ga0207688_11097767 Ga0207688_110977671 130
9 3300025928 Ga0207700_10459930 Ga0207700_104599301 130
10 3300031852 Ga0307410_10387660 Ga0307410_103876603 130
11 3300032005 Ga0307411_11290776 Ga0307411_112907762 130
12 3300035170 Ga0373943_0526226 Ga0373943_0526226_25_417 130
13 3300037853 Ga0436364_1041443 Ga0436364_1041443_3122_3514 130
14 3300047320 Ga0495672_0087601 Ga0495672_0087601_602_1042 130
15 3300048922 Ga0496119_0004896 Ga0496119_0004896_4067_4501 130
16 3300048923 Ga0496120_0098451 Ga0496120_0098451_211_645 130
17 3300053084 Ga0495595_0132254 Ga0495595_0132254_44_436 130
18 3300005436 Ga0070713_100228102 Ga0070713_1002281023 131
19 3300005439 Ga0070711_100038693 Ga0070711_1000386931 131
20 3300006175 Ga0070712_100450425 Ga0070712_1004504251 131
21 3300013105 Ga0157369_12464517 Ga0157369_124645171 131
22 3300025915 Ga0207693_10391570 Ga0207693_103915703 131
23 3300025916 Ga0207663_10062027 Ga0207663_100620271 131
24 3300025928 Ga0207700_10225561 Ga0207700_102255613 131
25 3300031649 Ga0307514_10387275 Ga0307514_103872752 131
26 3300031889 Ga0326468_10000782 Ga0326468_100007824 131
27 3300042438 Ga0439459_0101830 Ga0439459_0101830_65_502 131
28 3300048904 Ga0496101_0021776 Ga0496101_0021776_3931_4368 131
29 3300048907 Ga0496104_0511917 Ga0496104_0511917_227_664 131
30 3300048908 Ga0496105_0119535 Ga0496105_0119535_553_990 131
31 3300048909 Ga0496106_0357573 Ga0496106_0357573_621_1058 131
32 3300048910 Ga0496107_1365173 Ga0496107_1365173_25_462 131
33 3300048912 Ga0496109_0032747 Ga0496109_0032747_1121_1558 131
34 3300048913 Ga0496110_0056972 Ga0496110_0056972_2162_2599 131
35 3300048914 Ga0496111_0090752 Ga0496111_0090752_1122_1559 131
36 3300048916 Ga0496113_0032280 Ga0496113_0032280_45_482 131
37 3300048920 Ga0496117_0018305 Ga0496117_0018305_1986_2423 131
38 3300048921 Ga0496118_0044420 Ga0496118_0044420_370_807 131
39 3300048922 Ga0496119_0000437 Ga0496119_0000437_9691_10128 131
40 3300048922 Ga0496119_0063237 Ga0496119_0063237_811_1248 131
41 3300048923 Ga0496120_0002152 Ga0496120_0002152_2425_2862 131
42 3300053093 Ga0500651_0000251 Ga0500651_0000251_18435_18872 131
43 3300053148 Ga0500590_004215 Ga0500590_004215_902_1339 131
44 3300053155 Ga0500620_000199 Ga0500620_000199_7075_7512 131
45 iso_pu_bacteria 2791354901 2791911791 131
46 3300005327 Ga0070658_10011102 Ga0070658_100111025 132
47 3300005327 Ga0070658_10026589 Ga0070658_100265893 132
48 3300005329 Ga0070683_100058012 Ga0070683_1000580125 132
49 3300005337 Ga0070682_100194670 Ga0070682_1001946702 132
50 3300005338 Ga0068868_100116827 Ga0068868_1001168272 132
51 3300005339 Ga0070660_100053561 Ga0070660_1000535614 132
52 3300005341 Ga0070691_10101240 Ga0070691_101012403 132
53 3300005366 Ga0070659_100003309 Ga0070659_1000033093 132
54 3300005367 Ga0070667_100498144 Ga0070667_1004981441 132
55 3300005434 Ga0070709_10012138 Ga0070709_100121383 132
56 3300005435 Ga0070714_100406691 Ga0070714_1004066912 132
57 3300005436 Ga0070713_100446993 Ga0070713_1004469933 132
58 3300005437 Ga0070710_10214185 Ga0070710_102141853 132
59 3300005439 Ga0070711_100126962 Ga0070711_1001269622 132
60 3300005440 Ga0070705_100785918 Ga0070705_1007859181 132
61 3300005445 Ga0070708_101012003 Ga0070708_1010120032 132
62 3300005445 Ga0070708_101329652 Ga0070708_1013296522 132
63 3300005458 Ga0070681_10852618 Ga0070681_108526181 132
64 3300005466 Ga0070685_10012830 Ga0070685_100128304 132
65 3300005467 Ga0070706_102052535 Ga0070706_1020525351 132
66 3300005468 Ga0070707_100031696 Ga0070707_1000316963 132
67 3300005468 Ga0070707_100084253 Ga0070707_1000842533 132
68 3300005535 Ga0070684_100167382 Ga0070684_1001673824 132
69 3300005539 Ga0068853_100043867 Ga0068853_1000438673 132
70 3300005539 Ga0068853_100354901 Ga0068853_1003549012 132
71 3300005543 Ga0070672_100004844 Ga0070672_1000048447 132
72 3300005545 Ga0070695_100080131 Ga0070695_1000801311 132
73 3300005563 Ga0068855_100039781 Ga0068855_1000397813 132
74 3300005563 Ga0068855_100059365 Ga0068855_1000593652 132
75 3300005563 Ga0068855_100152689 Ga0068855_1001526891 132
76 3300005563 Ga0068855_100710553 Ga0068855_1007105532 132
77 3300005563 Ga0068855_100920397 Ga0068855_1009203972 132
78 3300005563 Ga0068855_100998174 Ga0068855_1009981742 132
79 3300005563 Ga0068855_101588384 Ga0068855_1015883841 132
80 3300005577 Ga0068857_100567863 Ga0068857_1005678632 132
81 3300005578 Ga0068854_100104518 Ga0068854_1001045183 132
82 3300005614 Ga0068856_100229775 Ga0068856_1002297752 132
83 3300005614 Ga0068856_100375624 Ga0068856_1003756242 132
84 3300005614 Ga0068856_100535489 Ga0068856_1005354892 132
85 3300005616 Ga0068852_100003105 Ga0068852_10000310512 132
86 3300005616 Ga0068852_100008277 Ga0068852_1000082773 132
87 3300005616 Ga0068852_100026637 Ga0068852_1000266373 132
88 3300005618 Ga0068864_100143486 Ga0068864_1001434863 132
89 3300005618 Ga0068864_100449985 Ga0068864_1004499852 132
90 3300005834 Ga0068851_10000022 Ga0068851_1000002261 132
91 3300005841 Ga0068863_100120547 Ga0068863_1001205472 132
92 3300005842 Ga0068858_100001116 Ga0068858_10000111627 132
93 3300005842 Ga0068858_100074709 Ga0068858_1000747094 132
94 3300006028 Ga0070717_10035435 Ga0070717_100354355 132
95 3300006028 Ga0070717_10385980 Ga0070717_103859802 132
96 3300006028 Ga0070717_10470318 Ga0070717_104703182 132
97 3300006028 Ga0070717_10518274 Ga0070717_105182741 132
98 3300006042 Ga0075368_10012045 Ga0075368_100120453 132
99 3300006048 Ga0075363_100166099 Ga0075363_1001660991 132
100 3300006051 Ga0075364_10002703 Ga0075364_100027036 132
101 3300006177 Ga0075362_10004700 Ga0075362_100047004 132
102 3300006178 Ga0075367_10078886 Ga0075367_100788862 132
103 3300006186 Ga0075369_10075638 Ga0075369_100756382 132
104 3300006195 Ga0075366_11068811 Ga0075366_110688111 132
105 3300006237 Ga0097621_100062056 Ga0097621_1000620564 132
106 3300006353 Ga0075370_10060147 Ga0075370_100601472 132
107 3300009011 Ga0105251_10209704 Ga0105251_102097042 132
108 3300009093 Ga0105240_10133676 Ga0105240_101336763 132
109 3300009093 Ga0105240_11476147 Ga0105240_114761472 132
110 3300009098 Ga0105245_10000706 Ga0105245_1000070626 132
111 3300009098 Ga0105245_10090349 Ga0105245_100903496 132
112 3300009098 Ga0105245_10158321 Ga0105245_101583212 132
113 3300009098 Ga0105245_10183085 Ga0105245_101830853 132
114 3300009101 Ga0105247_10259565 Ga0105247_102595652 132
115 3300009101 Ga0105247_10801417 Ga0105247_108014171 132
116 3300009177 Ga0105248_10007015 Ga0105248_1000701513 132
117 3300009177 Ga0105248_10143855 Ga0105248_101438553 132
118 3300009177 Ga0105248_10640833 Ga0105248_106408332 132
119 3300009177 Ga0105248_11532264 Ga0105248_115322642 132
120 3300009545 Ga0105237_10006825 Ga0105237_1000682513 132
121 3300009545 Ga0105237_10120034 Ga0105237_101200342 132
122 3300009545 Ga0105237_10130352 Ga0105237_101303523 132
123 3300009545 Ga0105237_10141667 Ga0105237_101416673 132
124 3300009551 Ga0105238_10237359 Ga0105238_102373593 132
125 3300009551 Ga0105238_10528545 Ga0105238_105285452 132
126 3300009551 Ga0105238_10631771 Ga0105238_106317712 132
127 3300010375 Ga0105239_11304206 Ga0105239_113042062 132
128 3300010375 Ga0105239_12666950 Ga0105239_126669501 132
129 3300011119 Ga0105246_11086745 Ga0105246_110867452 132
130 3300013104 Ga0157370_10104826 Ga0157370_101048263 132
131 3300013105 Ga0157369_10867909 Ga0157369_108679092 132
132 3300013296 Ga0157374_10004488 Ga0157374_100044886 132
133 3300013297 Ga0157378_10432756 Ga0157378_104327563 132
134 3300013308 Ga0157375_10073093 Ga0157375_100730937 132
135 3300014325 Ga0163163_10041656 Ga0163163_100416562 132
136 3300014325 Ga0163163_10236854 Ga0163163_102368541 132
137 3300014745 Ga0157377_10074609 Ga0157377_100746091 132
138 3300014968 Ga0157379_10225546 Ga0157379_102255463 132
139 3300014968 Ga0157379_11343369 Ga0157379_113433692 132
140 3300020075 Ga0206349_1237185 Ga0206349_12371851 132
141 3300020077 Ga0206351_10140329 Ga0206351_101403291 132
142 3300025321 Ga0207656_10000005 Ga0207656_10000005323 132
143 3300025898 Ga0207692_10029315 Ga0207692_100293152 132
144 3300025900 Ga0207710_10317826 Ga0207710_103178261 132
145 3300025906 Ga0207699_10110172 Ga0207699_101101722 132
146 3300025908 Ga0207643_10546382 Ga0207643_105463822 132
147 3300025909 Ga0207705_10021383 Ga0207705_100213831 132
148 3300025909 Ga0207705_10044976 Ga0207705_100449764 132
149 3300025910 Ga0207684_11587885 Ga0207684_115878851 132
150 3300025913 Ga0207695_10010059 Ga0207695_100100597 132
151 3300025913 Ga0207695_10012911 Ga0207695_100129112 132
152 3300025913 Ga0207695_10098913 Ga0207695_100989133 132
153 3300025914 Ga0207671_10000016 Ga0207671_10000016137 132
154 3300025914 Ga0207671_10060170 Ga0207671_100601704 132
155 3300025914 Ga0207671_10090023 Ga0207671_100900233 132
156 3300025914 Ga0207671_10129424 Ga0207671_101294242 132
157 3300025919 Ga0207657_10006398 Ga0207657_1000639813 132
158 3300025920 Ga0207649_10025508 Ga0207649_100255082 132
159 3300025921 Ga0207652_10896704 Ga0207652_108967042 132
160 3300025922 Ga0207646_10153104 Ga0207646_101531042 132
161 3300025924 Ga0207694_10000057 Ga0207694_1000005777 132
162 3300025924 Ga0207694_10130249 Ga0207694_101302491 132
163 3300025927 Ga0207687_10466516 Ga0207687_104665162 132
164 3300025929 Ga0207664_10037876 Ga0207664_100378762 132
165 3300025931 Ga0207644_10852022 Ga0207644_108520222 132
166 3300025932 Ga0207690_10000329 Ga0207690_1000032919 132
167 3300025939 Ga0207665_10083781 Ga0207665_100837813 132
168 3300025940 Ga0207691_10029904 Ga0207691_100299043 132
169 3300025941 Ga0207711_10006065 Ga0207711_100060652 132
170 3300025941 Ga0207711_10069492 Ga0207711_100694923 132
171 3300025941 Ga0207711_10486200 Ga0207711_104862002 132
172 3300025941 Ga0207711_10517086 Ga0207711_105170862 132
173 3300025949 Ga0207667_10008226 Ga0207667_100082264 132
174 3300025949 Ga0207667_10031365 Ga0207667_100313652 132
175 3300025949 Ga0207667_10198511 Ga0207667_101985112 132
176 3300025949 Ga0207667_10259833 Ga0207667_102598332 132
177 3300025949 Ga0207667_10294176 Ga0207667_102941762 132
178 3300025981 Ga0207640_10037102 Ga0207640_100371023 132
179 3300025986 Ga0207658_10047398 Ga0207658_100473982 132
180 3300026035 Ga0207703_10003158 Ga0207703_100031586 132
181 3300026035 Ga0207703_10163815 Ga0207703_101638153 132
182 3300026041 Ga0207639_10019021 Ga0207639_100190213 132
183 3300026041 Ga0207639_10230284 Ga0207639_102302842 132
184 3300026078 Ga0207702_10202816 Ga0207702_102028162 132
185 3300026078 Ga0207702_10218380 Ga0207702_102183802 132
186 3300026078 Ga0207702_10346309 Ga0207702_103463092 132
187 3300026078 Ga0207702_10560487 Ga0207702_105604872 132
188 3300026088 Ga0207641_10072919 Ga0207641_100729192 132
189 3300026088 Ga0207641_10449813 Ga0207641_104498132 132
190 3300026088 Ga0207641_10779048 Ga0207641_107790482 132
191 3300026095 Ga0207676_10294870 Ga0207676_102948702 132
192 3300026095 Ga0207676_10540144 Ga0207676_105401442 132
193 3300026116 Ga0207674_10007743 Ga0207674_1000774313 132
194 3300026116 Ga0207674_10037100 Ga0207674_100371005 132
195 3300026142 Ga0207698_10002133 Ga0207698_1000213312 132
196 3300026142 Ga0207698_10009907 Ga0207698_100099073 132
197 3300028379 Ga0268266_10251511 Ga0268266_102515113 132
198 3300028381 Ga0268264_10701688 Ga0268264_107016881 132
199 3300028794 Ga0307515_10645269 Ga0307515_106452692 132
200 3300028800 Ga0265338_10001315 Ga0265338_1000131514 132
201 3300031241 Ga0265325_10005629 Ga0265325_100056299 132
202 3300031242 Ga0265329_10035092 Ga0265329_100350922 132
203 3300031249 Ga0265339_10003540 Ga0265339_100035405 132
204 3300031250 Ga0265331_10018260 Ga0265331_100182603 132
205 3300031251 Ga0265327_10061537 Ga0265327_100615373 132
206 3300031344 Ga0265316_10297347 Ga0265316_102973472 132
207 3300031595 Ga0265313_10001049 Ga0265313_1000104914 132
208 3300031691 Ga0316579_10233587 Ga0316579_102335872 132
209 3300031711 Ga0265314_10132054 Ga0265314_101320542 132
210 3300031727 Ga0316576_10002554 Ga0316576_100025542 132
211 3300031727 Ga0316576_10141687 Ga0316576_101416872 132
212 3300031728 Ga0316578_10000611 Ga0316578_1000061110 132
213 3300031728 Ga0316578_10014573 Ga0316578_100145732 132
214 3300031995 Ga0307409_100679557 Ga0307409_1006795571 132
215 3300031995 Ga0307409_101225154 Ga0307409_1012251542 132
216 3300032139 Ga0316580_10078666 Ga0316580_100786662 132
217 3300035691 Ga0373931_0298768 Ga0373931_0298768_13_411 132
218 3300036712 Ga0316584_0263991 Ga0316584_0263991_208_648 132
219 3300036712 Ga0316584_0341491 Ga0316584_0341491_365_808 132
220 3300039450 Ga0436363_0114807 Ga0436363_0114807_557_997 132
221 3300041463 Ga0451804_1026453 Ga0451804_1026453_30_479 132
222 3300044735 Ga0466968_0261127 Ga0466968_0261127_32_493 132
223 3300045976 Ga0466967_0901860 Ga0466967_0901860_189_656 132
224 3300048903 Ga0496100_0220820 Ga0496100_0220820_189_629 132
225 3300048904 Ga0496101_0485075 Ga0496101_0485075_521_961 132
226 3300048905 Ga0496102_0192269 Ga0496102_0192269_1363_1803 132
227 3300048905 Ga0496102_0265710 Ga0496102_0265710_403_843 132
228 3300048907 Ga0496104_0192660 Ga0496104_0192660_382_822 132
229 3300048908 Ga0496105_0167093 Ga0496105_0167093_550_990 132
230 3300048911 Ga0496108_0065593 Ga0496108_0065593_1938_2378 132
231 3300048913 Ga0496110_0078225 Ga0496110_0078225_382_822 132
232 3300048914 Ga0496111_0023645 Ga0496111_0023645_1942_2382 132
233 3300048916 Ga0496113_0037236 Ga0496113_0037236_1651_2091 132
234 3300048917 Ga0496114_0553956 Ga0496114_0553956_177_617 132
235 3300048918 Ga0496115_0475254 Ga0496115_0475254_489_929 132
236 3300048923 Ga0496120_0007258 Ga0496120_0007258_7021_7470 132
237 3300048925 Ga0496122_0299869 Ga0496122_0299869_173_619 132
238 3300048928 Ga0496125_0195706 Ga0496125_0195706_786_1235 132
239 3300048929 Ga0496126_0174750 Ga0496126_0174750_1141_1590 132
240 3300048929 Ga0496126_0689652 Ga0496126_0689652_183_632 132
241 3300049575 Ga0501039_0054886 Ga0501039_0054886_2049_2492 132
242 3300049576 Ga0501040_0121832 Ga0501040_0121832_676_1119 132
243 3300049577 Ga0501041_0011634 Ga0501041_0011634_1942_2385 132
244 3300049577 Ga0501041_0639670 Ga0501041_0639670_229_669 132
245 3300049578 Ga0501042_0040795 Ga0501042_0040795_2463_2906 132
246 3300049584 Ga0501068_0289693 Ga0501068_0289693_343_786 132
247 3300049584 Ga0501068_0296658 Ga0501068_0296658_583_1023 132
248 3300049587 Ga0501071_0012248 Ga0501071_0012248_3539_3982 132
249 3300049588 Ga0501072_0171695 Ga0501072_0171695_1156_1599 132
250 3300049591 Ga0501075_0119824 Ga0501075_0119824_452_895 132
251 3300049592 Ga0501076_0004632 Ga0501076_0004632_2421_2864 132
252 3300049741 Ga0501079_0262276 Ga0501079_0262276_484_927 132
253 3300049743 Ga0501081_0111526 Ga0501081_0111526_1180_1623 132
254 3300049824 Ga0501045_0194537 Ga0501045_0194537_30_473 132
255 3300050489 nmdc:mga03683_15919_c1 nmdc:mga03683_15919_c1_1899_2342 132
256 3300050491 nmdc:mga00v17_36919_c1 nmdc:mga00v17_36919_c1_994_1437 132
257 3300050492 nmdc:mga0yw44_4986_c1 nmdc:mga0yw44_4986_c1_4275_4718 132
258 3300050493 nmdc:mga0k408_529990_c1 nmdc:mga0k408_529990_c1_173_616 132
259 3300050496 nmdc:mga07m45_51214_c1 nmdc:mga07m45_51214_c1_839_1282 132
260 3300050516 nmdc:mga0sz30_70275_c1 nmdc:mga0sz30_70275_c1_125_568 132
261 3300053080 Ga0500635_0001360 Ga0500635_0001360_2936_3385 132
262 3300054114 Ga0501084_0116867 Ga0501084_0116867_1058_1501 132
263 3300060353 Ga0501082_0135258 Ga0501082_0135258_804_1247 132
264 3300061734 Ga0530510_0288979 Ga0530510_0288979_596_1039 132
265 iso_pu_bacteria 8004212874 8004213434 132
266 3300005336 Ga0070680_100022387 Ga0070680_1000223874 133
267 3300005337 Ga0070682_100174812 Ga0070682_1001748122 133
268 3300005347 Ga0070668_100153728 Ga0070668_1001537281 133
269 3300005366 Ga0070659_100137804 Ga0070659_1001378042 133
270 3300005435 Ga0070714_100070947 Ga0070714_1000709475 133
271 3300005458 Ga0070681_10014657 Ga0070681_100146576 133
272 3300005458 Ga0070681_10445347 Ga0070681_104453471 133
273 3300005467 Ga0070706_101046923 Ga0070706_1010469231 133
274 3300005530 Ga0070679_100022981 Ga0070679_1000229814 133
275 3300005614 Ga0068856_100884666 Ga0068856_1008846662 133
276 3300005719 Ga0068861_100482793 Ga0068861_1004827933 133
277 3300005844 Ga0068862_100219957 Ga0068862_1002199572 133
278 3300006028 Ga0070717_10697597 Ga0070717_106975972 133
279 3300006028 Ga0070717_11227964 Ga0070717_112279641 133
280 3300006881 Ga0068865_101513678 Ga0068865_1015136781 133
281 3300009147 Ga0114129_10546506 Ga0114129_105465062 133
282 3300011119 Ga0105246_10696032 Ga0105246_106960322 133
283 3300013104 Ga0157370_10846693 Ga0157370_108466932 133
284 3300013105 Ga0157369_10193971 Ga0157369_101939712 133
285 3300013297 Ga0157378_11921530 Ga0157378_119215301 133
286 3300020069 Ga0197907_10450287 Ga0197907_104502873 133
287 3300020070 Ga0206356_10083308 Ga0206356_100833082 133
288 3300020075 Ga0206349_1762186 Ga0206349_17621862 133
289 3300020076 Ga0206355_1500103 Ga0206355_15001032 133
290 3300020077 Ga0206351_10704597 Ga0206351_107045971 133
291 3300020078 Ga0206352_10807676 Ga0206352_108076762 133
292 3300020080 Ga0206350_10990203 Ga0206350_109902032 133
293 3300020080 Ga0206350_11205897 Ga0206350_112058973 133
294 3300020081 Ga0206354_11069328 Ga0206354_110693282 133
295 3300020610 Ga0154015_1348326 Ga0154015_13483261 133
296 3300021384 Ga0213876_10040496 Ga0213876_100404963 133
297 3300022467 Ga0224712_10019923 Ga0224712_100199233 133
298 3300022467 Ga0224712_10123937 Ga0224712_101239372 133
299 3300022734 Ga0224571_107138 Ga0224571_1071381 133
300 3300024225 Ga0224572_1000558 Ga0224572_10005583 133
301 3300024227 Ga0228598_1023934 Ga0228598_10239342 133
302 3300025910 Ga0207684_10678155 Ga0207684_106781552 133
303 3300025910 Ga0207684_11047849 Ga0207684_110478491 133
304 3300025912 Ga0207707_10007656 Ga0207707_100076564 133
305 3300025912 Ga0207707_10033930 Ga0207707_100339302 133
306 3300025917 Ga0207660_10015428 Ga0207660_100154284 133
307 3300025921 Ga0207652_10140846 Ga0207652_101408462 133
308 3300025929 Ga0207664_10135856 Ga0207664_101358563 133
309 3300025929 Ga0207664_10166146 Ga0207664_101661463 133
310 3300026078 Ga0207702_10796466 Ga0207702_107964662 133
311 3300026118 Ga0207675_100033506 Ga0207675_1000335067 133
312 3300028380 Ga0268265_10197181 Ga0268265_101971812 133
313 3300031090 Ga0265760_10014959 Ga0265760_100149592 133
314 3300031595 Ga0265313_10018284 Ga0265313_100182841 133
315 3300035114 Ga0373939_0231670 Ga0373939_0231670_99_545 133
316 3300037853 Ga0436364_1334594 Ga0436364_1334594_6054_6500 133
317 3300039437 Ga0436365_0112287 Ga0436365_0112287_23067_23513 133
318 3300039453 Ga0436362_0480976 Ga0436362_0480976_192_638 133
319 3300039453 Ga0436362_0802298 Ga0436362_0802298_54_497 133
320 3300041452 Ga0451793_0975550 Ga0451793_0975550_69_515 133
321 3300042005 Ga0439448_0169593 Ga0439448_0169593_159_602 133
322 3300044658 Ga0466972_0246077 Ga0466972_0246077_108_557 133
323 3300046459 Ga0495629_0746502 Ga0495629_0746502_38_481 133
324 3300048918 Ga0496115_0513593 Ga0496115_0513593_30_497 133
325 3300049576 Ga0501040_1215653 Ga0501040_1215653_16_465 133
326 3300050489 nmdc:mga03683_296669_c1 nmdc:mga03683_296669_c1_20_466 133
327 3300050491 nmdc:mga00v17_349787_c1 nmdc:mga00v17_349787_c1_224_670 133
328 3300050507 nmdc:mga05p37_761729_c1 nmdc:mga05p37_761729_c1_131_577 133
329 3300001979 JGI24740J21852_10130550 JGI24740J21852_101305501 134
330 3300005328 Ga0070676_11131792 Ga0070676_111317921 134
331 3300005329 Ga0070683_100033200 Ga0070683_1000332005 134
332 3300005331 Ga0070670_100782366 Ga0070670_1007823662 134
333 3300005334 Ga0068869_100008663 Ga0068869_1000086635 134
334 3300005337 Ga0070682_100006527 Ga0070682_1000065275 134
335 3300005338 Ga0068868_100040660 Ga0068868_1000406603 134
336 3300005340 Ga0070689_100333647 Ga0070689_1003336472 134
337 3300005341 Ga0070691_10005725 Ga0070691_100057254 134
338 3300005343 Ga0070687_100122072 Ga0070687_1001220722 134
339 3300005353 Ga0070669_101205879 Ga0070669_1012058791 134
340 3300005355 Ga0070671_100113797 Ga0070671_1001137973 134
341 3300005355 Ga0070671_101588414 Ga0070671_1015884141 134
342 3300005356 Ga0070674_100072492 Ga0070674_1000724922 134
343 3300005366 Ga0070659_100211412 Ga0070659_1002114122 134
344 3300005367 Ga0070667_100172333 Ga0070667_1001723332 134
345 3300005434 Ga0070709_10004900 Ga0070709_100049003 134
346 3300005434 Ga0070709_10015872 Ga0070709_100158723 134
347 3300005434 Ga0070709_10121606 Ga0070709_101216062 134
348 3300005434 Ga0070709_10131973 Ga0070709_101319731 134
349 3300005435 Ga0070714_100038387 Ga0070714_1000383871 134
350 3300005435 Ga0070714_100189514 Ga0070714_1001895142 134
351 3300005435 Ga0070714_100316472 Ga0070714_1003164722 134
352 3300005435 Ga0070714_100424497 Ga0070714_1004244972 134
353 3300005435 Ga0070714_100443839 Ga0070714_1004438392 134
354 3300005435 Ga0070714_100581271 Ga0070714_1005812712 134
355 3300005435 Ga0070714_100736574 Ga0070714_1007365742 134
356 3300005436 Ga0070713_100705383 Ga0070713_1007053832 134
357 3300005437 Ga0070710_10004524 Ga0070710_100045243 134
358 3300005437 Ga0070710_10018559 Ga0070710_100185595 134
359 3300005437 Ga0070710_10028884 Ga0070710_100288843 134
360 3300005437 Ga0070710_10224158 Ga0070710_102241582 134
361 3300005439 Ga0070711_100037903 Ga0070711_1000379033 134
362 3300005439 Ga0070711_100069160 Ga0070711_1000691604 134
363 3300005439 Ga0070711_100072683 Ga0070711_1000726833 134
364 3300005440 Ga0070705_100009830 Ga0070705_1000098305 134
365 3300005440 Ga0070705_100152954 Ga0070705_1001529542 134
366 3300005444 Ga0070694_101044058 Ga0070694_1010440581 134
367 3300005445 Ga0070708_100002254 Ga0070708_1000022545 134
368 3300005445 Ga0070708_100116448 Ga0070708_1001164483 134
369 3300005445 Ga0070708_100379605 Ga0070708_1003796052 134
370 3300005455 Ga0070663_100045037 Ga0070663_1000450373 134
371 3300005456 Ga0070678_100006821 Ga0070678_1000068215 134
372 3300005457 Ga0070662_100877479 Ga0070662_1008774792 134
373 3300005458 Ga0070681_11094482 Ga0070681_110944822 134
374 3300005459 Ga0068867_100168391 Ga0068867_1001683913 134
375 3300005466 Ga0070685_10083761 Ga0070685_100837612 134
376 3300005467 Ga0070706_100053612 Ga0070706_1000536122 134
377 3300005467 Ga0070706_100053853 Ga0070706_1000538532 134
378 3300005467 Ga0070706_100194792 Ga0070706_1001947922 134
379 3300005467 Ga0070706_100407939 Ga0070706_1004079392 134
380 3300005467 Ga0070706_100845864 Ga0070706_1008458642 134
381 3300005468 Ga0070707_100045570 Ga0070707_1000455704 134
382 3300005468 Ga0070707_100066233 Ga0070707_1000662332 134
383 3300005471 Ga0070698_100107441 Ga0070698_1001074413 134
384 3300005471 Ga0070698_101279140 Ga0070698_1012791401 134
385 3300005518 Ga0070699_100004187 Ga0070699_10000418710 134
386 3300005518 Ga0070699_100112445 Ga0070699_1001124452 134
387 3300005530 Ga0070679_100174356 Ga0070679_1001743562 134
388 3300005535 Ga0070684_100136100 Ga0070684_1001361004 134
389 3300005536 Ga0070697_100014160 Ga0070697_1000141605 134
390 3300005536 Ga0070697_100940744 Ga0070697_1009407441 134
391 3300005539 Ga0068853_100353189 Ga0068853_1003531893 134
392 3300005543 Ga0070672_100174471 Ga0070672_1001744715 134
393 3300005546 Ga0070696_100011939 Ga0070696_1000119392 134
394 3300005546 Ga0070696_100721819 Ga0070696_1007218191 134
395 3300005547 Ga0070693_100003246 Ga0070693_1000032463 134
396 3300005548 Ga0070665_100045387 Ga0070665_1000453875 134
397 3300005548 Ga0070665_100120050 Ga0070665_1001200501 134
398 3300005548 Ga0070665_100128802 Ga0070665_1001288023 134
399 3300005549 Ga0070704_100031218 Ga0070704_1000312182 134
400 3300005563 Ga0068855_100212575 Ga0068855_1002125755 134
401 3300005564 Ga0070664_100009586 Ga0070664_1000095865 134
402 3300005577 Ga0068857_100013122 Ga0068857_1000131226 134
403 3300005578 Ga0068854_100212710 Ga0068854_1002127102 134
404 3300005614 Ga0068856_100084217 Ga0068856_1000842173 134
405 3300005614 Ga0068856_100089319 Ga0068856_1000893193 134
406 3300005616 Ga0068852_100151113 Ga0068852_1001511132 134
407 3300005617 Ga0068859_100086190 Ga0068859_1000861905 134
408 3300005618 Ga0068864_100008886 Ga0068864_1000088866 134
409 3300005618 Ga0068864_100742933 Ga0068864_1007429332 134
410 3300005719 Ga0068861_100119740 Ga0068861_1001197401 134
411 3300005841 Ga0068863_100011963 Ga0068863_1000119636 134
412 3300005841 Ga0068863_100298424 Ga0068863_1002984242 134
413 3300005842 Ga0068858_100011040 Ga0068858_1000110405 134
414 3300005843 Ga0068860_100062358 Ga0068860_1000623583 134
415 3300006028 Ga0070717_10009984 Ga0070717_100099848 134
416 3300006028 Ga0070717_10011792 Ga0070717_100117925 134
417 3300006028 Ga0070717_10094460 Ga0070717_100944601 134
418 3300006028 Ga0070717_10097243 Ga0070717_100972433 134
419 3300006028 Ga0070717_10205772 Ga0070717_102057721 134
420 3300006028 Ga0070717_10375563 Ga0070717_103755631 134
421 3300006028 Ga0070717_10584881 Ga0070717_105848812 134
422 3300006028 Ga0070717_10966726 Ga0070717_109667262 134
423 3300006028 Ga0070717_11084937 Ga0070717_110849371 134
424 3300006163 Ga0070715_10244534 Ga0070715_102445342 134
425 3300006173 Ga0070716_100013108 Ga0070716_1000131085 134
426 3300006173 Ga0070716_100034829 Ga0070716_1000348295 134
427 3300006175 Ga0070712_100007749 Ga0070712_1000077496 134
428 3300006175 Ga0070712_100056070 Ga0070712_1000560704 134
429 3300006175 Ga0070712_100199106 Ga0070712_1001991063 134
430 3300006237 Ga0097621_100009840 Ga0097621_1000098406 134
431 3300006237 Ga0097621_100735107 Ga0097621_1007351071 134
432 3300006358 Ga0068871_100006638 Ga0068871_1000066385 134
433 3300006358 Ga0068871_101072043 Ga0068871_1010720431 134
434 3300006914 Ga0075436_100449067 Ga0075436_1004490672 134
435 3300006914 Ga0075436_101087000 Ga0075436_1010870001 134
436 3300006931 Ga0097620_100086188 Ga0097620_1000861885 134
437 3300007076 Ga0075435_100082491 Ga0075435_1000824915 134
438 3300007076 Ga0075435_100282242 Ga0075435_1002822422 134
439 3300007788 Ga0099795_10134317 Ga0099795_101343171 134
440 3300009011 Ga0105251_10090761 Ga0105251_100907612 134
441 3300009093 Ga0105240_11039377 Ga0105240_110393771 134
442 3300009098 Ga0105245_10013431 Ga0105245_100134313 134
443 3300009174 Ga0105241_10087157 Ga0105241_100871573 134
444 3300009176 Ga0105242_10135834 Ga0105242_101358344 134
445 3300009177 Ga0105248_10094046 Ga0105248_100940464 134
446 3300009545 Ga0105237_10056684 Ga0105237_100566845 134
447 3300009545 Ga0105237_10562298 Ga0105237_105622982 134
448 3300009551 Ga0105238_10526626 Ga0105238_105266261 134
449 3300009553 Ga0105249_10287426 Ga0105249_102874261 134
450 3300010159 Ga0099796_10074334 Ga0099796_100743342 134
451 3300010375 Ga0105239_11352481 Ga0105239_113524812 134
452 3300010375 Ga0105239_11426288 Ga0105239_114262882 134
453 3300011119 Ga0105246_10057395 Ga0105246_100573952 134
454 3300011119 Ga0105246_10389723 Ga0105246_103897233 134
455 3300012507 Ga0157342_1037701 Ga0157342_10377012 134
456 3300013104 Ga0157370_10038567 Ga0157370_100385671 134
457 3300013104 Ga0157370_10299654 Ga0157370_102996541 134
458 3300013105 Ga0157369_10036664 Ga0157369_100366644 134
459 3300013105 Ga0157369_10503009 Ga0157369_105030092 134
460 3300013296 Ga0157374_10015131 Ga0157374_100151315 134
461 3300013306 Ga0163162_10104972 Ga0163162_101049723 134
462 3300013307 Ga0157372_10088181 Ga0157372_100881812 134
463 3300013308 Ga0157375_10068114 Ga0157375_100681143 134
464 3300014325 Ga0163163_10119713 Ga0163163_101197133 134
465 3300014325 Ga0163163_10408627 Ga0163163_104086272 134
466 3300014745 Ga0157377_10003346 Ga0157377_100033463 134
467 3300014968 Ga0157379_10019387 Ga0157379_100193876 134
468 3300014969 Ga0157376_10011247 Ga0157376_100112476 134
469 3300014969 Ga0157376_10333235 Ga0157376_103332351 134
470 3300020070 Ga0206356_11851363 Ga0206356_118513631 134
471 3300020078 Ga0206352_10811948 Ga0206352_108119481 134
472 3300020082 Ga0206353_10252478 Ga0206353_102524783 134
473 3300020082 Ga0206353_10876871 Ga0206353_108768712 134
474 3300021388 Ga0213875_10066989 Ga0213875_100669892 134
475 3300021388 Ga0213875_10266276 Ga0213875_102662762 134
476 3300023552 Ga0247551_103345 Ga0247551_1033451 134
477 3300025898 Ga0207692_10008528 Ga0207692_100085284 134
478 3300025898 Ga0207692_10028273 Ga0207692_100282733 134
479 3300025898 Ga0207692_10030704 Ga0207692_100307042 134
480 3300025898 Ga0207692_10205468 Ga0207692_102054682 134
481 3300025898 Ga0207692_10384530 Ga0207692_103845301 134
482 3300025900 Ga0207710_10035869 Ga0207710_100358692 134
483 3300025903 Ga0207680_10273134 Ga0207680_102731341 134
484 3300025904 Ga0207647_10061534 Ga0207647_100615343 134
485 3300025905 Ga0207685_10091175 Ga0207685_100911752 134
486 3300025906 Ga0207699_10001841 Ga0207699_100018416 134
487 3300025906 Ga0207699_10059915 Ga0207699_100599154 134
488 3300025906 Ga0207699_10237305 Ga0207699_102373052 134
489 3300025907 Ga0207645_10350291 Ga0207645_103502912 134
490 3300025910 Ga0207684_10155619 Ga0207684_101556192 134
491 3300025910 Ga0207684_10201187 Ga0207684_102011872 134
492 3300025910 Ga0207684_10721893 Ga0207684_107218932 134
493 3300025911 Ga0207654_10094665 Ga0207654_100946652 134
494 3300025912 Ga0207707_10684160 Ga0207707_106841602 134
495 3300025913 Ga0207695_10059511 Ga0207695_100595113 134
496 3300025914 Ga0207671_10845988 Ga0207671_108459881 134
497 3300025915 Ga0207693_10013359 Ga0207693_100133596 134
498 3300025915 Ga0207693_10193161 Ga0207693_101931612 134
499 3300025915 Ga0207693_10293885 Ga0207693_102938852 134
500 3300025916 Ga0207663_10007438 Ga0207663_100074385 134
501 3300025916 Ga0207663_10007664 Ga0207663_100076646 134
502 3300025917 Ga0207660_10169602 Ga0207660_101696022 134
503 3300025919 Ga0207657_10114578 Ga0207657_101145784 134
504 3300025921 Ga0207652_10134373 Ga0207652_101343734 134
505 3300025922 Ga0207646_10004957 Ga0207646_1000495710 134
506 3300025922 Ga0207646_10039482 Ga0207646_100394824 134
507 3300025922 Ga0207646_10042936 Ga0207646_100429365 134
508 3300025923 Ga0207681_11208321 Ga0207681_112083211 134
509 3300025926 Ga0207659_10124890 Ga0207659_101248902 134
510 3300025927 Ga0207687_10403647 Ga0207687_104036472 134
511 3300025927 Ga0207687_11149015 Ga0207687_111490151 134
512 3300025928 Ga0207700_10002213 Ga0207700_100022137 134
513 3300025928 Ga0207700_10070942 Ga0207700_100709424 134
514 3300025928 Ga0207700_10227297 Ga0207700_102272972 134
515 3300025928 Ga0207700_10643291 Ga0207700_106432912 134
516 3300025929 Ga0207664_10000717 Ga0207664_100007171 134
517 3300025929 Ga0207664_10003182 Ga0207664_100031828 134
518 3300025929 Ga0207664_10010632 Ga0207664_100106326 134
519 3300025929 Ga0207664_10083937 Ga0207664_100839374 134
520 3300025929 Ga0207664_10197799 Ga0207664_101977992 134
521 3300025929 Ga0207664_10234468 Ga0207664_102344681 134
522 3300025929 Ga0207664_10400579 Ga0207664_104005792 134
523 3300025929 Ga0207664_10427549 Ga0207664_104275492 134
524 3300025929 Ga0207664_11569034 Ga0207664_115690341 134
525 3300025931 Ga0207644_10069912 Ga0207644_100699122 134
526 3300025931 Ga0207644_11264980 Ga0207644_112649801 134
527 3300025932 Ga0207690_10047869 Ga0207690_100478691 134
528 3300025934 Ga0207686_10065315 Ga0207686_100653152 134
529 3300025935 Ga0207709_10790832 Ga0207709_107908322 134
530 3300025936 Ga0207670_10238403 Ga0207670_102384032 134
531 3300025937 Ga0207669_10352151 Ga0207669_103521511 134
532 3300025939 Ga0207665_10005764 Ga0207665_100057646 134
533 3300025939 Ga0207665_10019137 Ga0207665_100191371 134
534 3300025939 Ga0207665_10222805 Ga0207665_102228052 134
535 3300025940 Ga0207691_10476711 Ga0207691_104767112 134
536 3300025941 Ga0207711_10058384 Ga0207711_100583841 134
537 3300025942 Ga0207689_10003607 Ga0207689_1000360712 134
538 3300025945 Ga0207679_10223234 Ga0207679_102232342 134
539 3300025945 Ga0207679_10550714 Ga0207679_105507142 134
540 3300025949 Ga0207667_11094120 Ga0207667_110941201 134
541 3300025961 Ga0207712_11301431 Ga0207712_113014311 134
542 3300025981 Ga0207640_10165257 Ga0207640_101652572 134
543 3300026035 Ga0207703_10069559 Ga0207703_100695594 134
544 3300026041 Ga0207639_10154383 Ga0207639_101543832 134
545 3300026067 Ga0207678_10012650 Ga0207678_100126504 134
546 3300026075 Ga0207708_10674797 Ga0207708_106747971 134
547 3300026078 Ga0207702_10013634 Ga0207702_100136345 134
548 3300026088 Ga0207641_11072839 Ga0207641_110728391 134
549 3300026095 Ga0207676_10364381 Ga0207676_103643811 134
550 3300026095 Ga0207676_11314480 Ga0207676_113144801 134
551 3300026116 Ga0207674_10001953 Ga0207674_100019533 134
552 3300026116 Ga0207674_10783125 Ga0207674_107831252 134
553 3300026121 Ga0207683_10008115 Ga0207683_100081154 134
554 3300026142 Ga0207698_10337914 Ga0207698_103379142 134
555 3300028379 Ga0268266_10156416 Ga0268266_101564164 134
556 3300028381 Ga0268264_10185564 Ga0268264_101855643 134
557 3300028800 Ga0265338_10076423 Ga0265338_100764233 134
558 3300028800 Ga0265338_10276170 Ga0265338_102761702 134
559 3300028800 Ga0265338_10905438 Ga0265338_109054381 134
560 3300031090 Ga0265760_10056087 Ga0265760_100560872 134
561 3300031241 Ga0265325_10119661 Ga0265325_101196612 134
562 3300031247 Ga0265340_10290018 Ga0265340_102900181 134
563 3300031249 Ga0265339_10409467 Ga0265339_104094672 134
564 3300031250 Ga0265331_10122286 Ga0265331_101222862 134
565 3300031251 Ga0265327_10000911 Ga0265327_1000091135 134
566 3300031595 Ga0265313_10077676 Ga0265313_100776762 134
567 3300031712 Ga0265342_10165233 Ga0265342_101652332 134
568 3300031712 Ga0265342_10322205 Ga0265342_103222051 134
569 3300031727 Ga0316576_10130936 Ga0316576_101309363 134
570 3300031728 Ga0316578_10600256 Ga0316578_106002561 134
571 3300031852 Ga0307410_10595530 Ga0307410_105955302 134
572 3300031903 Ga0307407_10641683 Ga0307407_106416832 134
573 3300031911 Ga0307412_10047428 Ga0307412_100474282 134
574 3300034816 Ga0373930_0015946 Ga0373930_0015946_891_1337 134
575 3300035083 Ga0373926_0003369 Ga0373926_0003369_730_1176 134
576 3300035086 Ga0373934_0023258 Ga0373934_0023258_1229_1675 134
577 3300035086 Ga0373934_0142489 Ga0373934_0142489_294_740 134
578 3300035088 Ga0373940_0061272 Ga0373940_0061272_444_890 134
579 3300035088 Ga0373940_0253843 Ga0373940_0253843_105_551 134
580 3300035089 Ga0373944_0006402 Ga0373944_0006402_2406_2852 134
581 3300035111 Ga0373923_0191802 Ga0373923_0191802_449_895 134
582 3300035113 Ga0373936_0007347 Ga0373936_0007347_3197_3643 134
583 3300035113 Ga0373936_0014354 Ga0373936_0014354_1332_1778 134
584 3300035116 Ga0373945_0000242 Ga0373945_0000242_14416_14862 134
585 3300035116 Ga0373945_0290335 Ga0373945_0290335_31_477 134
586 3300035116 Ga0373945_0320102 Ga0373945_0320102_69_515 134
587 3300035119 Ga0373956_0202532 Ga0373956_0202532_171_617 134
588 3300035120 Ga0373957_0140555 Ga0373957_0140555_515_961 134
589 3300035170 Ga0373943_0001329 Ga0373943_0001329_1714_2160 134
590 3300035170 Ga0373943_0034526 Ga0373943_0034526_1773_2219 134
591 3300035170 Ga0373943_0588944 Ga0373943_0588944_23_472 134
592 3300035171 Ga0373946_0042975 Ga0373946_0042975_191_637 134
593 3300035171 Ga0373946_0131458 Ga0373946_0131458_90_539 134
594 3300035171 Ga0373946_0563858 Ga0373946_0563858_96_542 134
595 3300035172 Ga0373955_0019563 Ga0373955_0019563_2763_3209 134
596 3300035410 Ga0373924_0042413 Ga0373924_0042413_1231_1677 134
597 3300035410 Ga0373924_0075716 Ga0373924_0075716_833_1279 134
598 3300035410 Ga0373924_0422646 Ga0373924_0422646_29_475 134
599 3300035691 Ga0373931_0324954 Ga0373931_0324954_445_891 134
600 3300035692 Ga0373935_0085778 Ga0373935_0085778_1357_1803 134
601 3300035692 Ga0373935_0538236 Ga0373935_0538236_126_572 134
602 3300035695 Ga0373927_0005581 Ga0373927_0005581_4696_5142 134
603 3300035695 Ga0373927_0071708 Ga0373927_0071708_104_550 134
604 3300035695 Ga0373927_0373956 Ga0373927_0373956_116_562 134
605 3300035724 Ga0373933_0042759 Ga0373933_0042759_2090_2536 134
606 3300035724 Ga0373933_0281024 Ga0373933_0281024_41_487 134
607 3300035725 Ga0373947_0175788 Ga0373947_0175788_227_673 134
608 3300035725 Ga0373947_0242680 Ga0373947_0242680_329_775 134
609 3300035725 Ga0373947_0306942 Ga0373947_0306942_440_886 134
610 3300036401 Ga0373937_0121011 Ga0373937_0121011_1935_2381 134
611 3300036401 Ga0373937_0251952 Ga0373937_0251952_880_1326 134
612 3300036401 Ga0373937_0327154 Ga0373937_0327154_140_589 134
613 3300036401 Ga0373937_0675868 Ga0373937_0675868_219_665 134
614 3300036401 Ga0373937_0947535 Ga0373937_0947535_42_488 134
615 3300036401 Ga0373937_1481550 Ga0373937_1481550_125_574 134
616 3300037068 Ga0373925_0034413 Ga0373925_0034413_3150_3596 134
617 3300037068 Ga0373925_0118053 Ga0373925_0118053_813_1259 134
618 3300037068 Ga0373925_0295292 Ga0373925_0295292_596_1042 134
619 3300037068 Ga0373925_0341759 Ga0373925_0341759_648_1094 134
620 3300037853 Ga0436364_0458942 Ga0436364_0458942_31_477 134
621 3300037853 Ga0436364_0729577 Ga0436364_0729577_37_444 134
622 3300037853 Ga0436364_0796359 Ga0436364_0796359_1014_1460 134
623 3300037853 Ga0436364_0818911 Ga0436364_0818911_49_495 134
624 3300037853 Ga0436364_1197365 Ga0436364_1197365_401_847 134
625 3300037853 Ga0436364_1481992 Ga0436364_1481992_15_422 134
626 3300037853 Ga0436364_1557432 Ga0436364_1557432_73_522 134
627 3300039437 Ga0436365_1145451 Ga0436365_1145451_471_932 134
628 3300039437 Ga0436365_1189314 Ga0436365_1189314_628_1074 134
629 3300039447 Ga0436361_0458380 Ga0436361_0458380_117_566 134
630 3300039450 Ga0436363_0328230 Ga0436363_0328230_956_1402 134
631 3300039450 Ga0436363_0685849 Ga0436363_0685849_2894_3349 134
632 3300039450 Ga0436363_1287920 Ga0436363_1287920_57_506 134
633 3300039453 Ga0436362_0365348 Ga0436362_0365348_147_596 134
634 3300039453 Ga0436362_1203116 Ga0436362_1203116_84_533 134
635 3300041462 Ga0451806_845660 Ga0451806_845660_29_478 134
636 3300044656 Ga0466969_0045930 Ga0466969_0045930_1229_1678 134
637 3300044684 Ga0466966_0209838 Ga0466966_0209838_331_780 134
638 3300044684 Ga0466966_0228389 Ga0466966_0228389_213_662 134
639 3300044693 Ga0466961_0008157 Ga0466961_0008157_1594_2043 134
640 3300044694 Ga0466963_0723053 Ga0466963_0723053_220_666 134
641 3300045049 Ga0466959_0207388 Ga0466959_0207388_653_1102 134
642 3300045976 Ga0466967_0061888 Ga0466967_0061888_2811_3257 134
643 3300045976 Ga0466967_0080982 Ga0466967_0080982_715_1161 134
644 3300045976 Ga0466967_1145492 Ga0466967_1145492_203_649 134
645 3300046454 Ga0495592_0033307 Ga0495592_0033307_1357_1803 134
646 3300046454 Ga0495592_0449639 Ga0495592_0449639_294_743 134
647 3300046454 Ga0495592_0492785 Ga0495592_0492785_239_685 134
648 3300046455 Ga0495603_0005395 Ga0495603_0005395_168_614 134
649 3300046459 Ga0495629_0567659 Ga0495629_0567659_170_619 134
650 3300046461 Ga0495641_0111169 Ga0495641_0111169_521_967 134
651 3300046461 Ga0495641_0128575 Ga0495641_0128575_504_950 134
652 3300046462 Ga0495651_0025942 Ga0495651_0025942_324_770 134
653 3300046462 Ga0495651_0031975 Ga0495651_0031975_2367_2813 134
654 3300046462 Ga0495651_0048621 Ga0495651_0048621_2621_3067 134
655 3300046462 Ga0495651_0528730 Ga0495651_0528730_271_729 134
656 3300046463 Ga0495653_0010681 Ga0495653_0010681_6885_7331 134
657 3300046463 Ga0495653_0071429 Ga0495653_0071429_1829_2275 134
658 3300046463 Ga0495653_0094777 Ga0495653_0094777_1342_1788 134
659 3300046472 Ga0495580_0011041 Ga0495580_0011041_1505_1951 134
660 3300046473 Ga0495582_0038830 Ga0495582_0038830_964_1410 134
661 3300046473 Ga0495582_0671234 Ga0495582_0671234_143_589 134
662 3300046473 Ga0495582_0694275 Ga0495582_0694275_42_446 134
663 3300046475 Ga0495639_0005051 Ga0495639_0005051_2011_2457 134
664 3300046476 Ga0495662_0001071 Ga0495662_0001071_4605_5051 134
665 3300046476 Ga0495662_0257421 Ga0495662_0257421_88_537 134
666 3300046511 Ga0495608_0018178 Ga0495608_0018178_4084_4530 134
667 3300046511 Ga0495608_0134893 Ga0495608_0134893_560_1018 134
668 3300046511 Ga0495608_0285552 Ga0495608_0285552_456_902 134
669 3300046514 Ga0495618_0004257 Ga0495618_0004257_2248_2694 134
670 3300046514 Ga0495618_0050706 Ga0495618_0050706_623_1069 134
671 3300046516 Ga0495628_0021834 Ga0495628_0021834_2309_2755 134
672 3300046516 Ga0495628_0156406 Ga0495628_0156406_255_704 134
673 3300046516 Ga0495628_0184339 Ga0495628_0184339_57_515 134
674 3300046517 Ga0495630_0124677 Ga0495630_0124677_152_598 134
675 3300046517 Ga0495630_0424893 Ga0495630_0424893_454_900 134
676 3300046517 Ga0495630_0775258 Ga0495630_0775258_96_545 134
677 3300046517 Ga0495630_1099981 Ga0495630_1099981_61_507 134
678 3300046526 Ga0495666_0011710 Ga0495666_0011710_2789_3235 134
679 3300046526 Ga0495666_0077157 Ga0495666_0077157_1032_1478 134
680 3300046526 Ga0495666_0547149 Ga0495666_0547149_33_479 134
681 3300046529 Ga0495652_0025271 Ga0495652_0025271_1417_1863 134
682 3300046529 Ga0495652_0052687 Ga0495652_0052687_2515_2961 134
683 3300046529 Ga0495652_0312970 Ga0495652_0312970_251_697 134
684 3300046529 Ga0495652_0546599 Ga0495652_0546599_285_734 134
685 3300046531 Ga0495665_0000609 Ga0495665_0000609_12509_12955 134
686 3300046531 Ga0495665_0435645 Ga0495665_0435645_247_651 134
687 3300046533 Ga0495640_0011262 Ga0495640_0011262_5051_5497 134
688 3300046533 Ga0495640_0051013 Ga0495640_0051013_1726_2172 134
689 3300046533 Ga0495640_0080467 Ga0495640_0080467_1640_2089 134
690 3300046535 Ga0495586_0399648 Ga0495586_0399648_286_732 134
691 3300046536 Ga0495587_0001347 Ga0495587_0001347_3452_3898 134
692 3300046536 Ga0495587_0072829 Ga0495587_0072829_272_718 134
693 3300046536 Ga0495587_0076967 Ga0495587_0076967_1459_1905 134
694 3300046536 Ga0495587_0334261 Ga0495587_0334261_34_480 134
695 3300046536 Ga0495587_0477112 Ga0495587_0477112_65_511 134
696 3300046543 Ga0495645_0100029 Ga0495645_0100029_1573_2019 134
697 3300046543 Ga0495645_0121337 Ga0495645_0121337_564_1013 134
698 3300046559 Ga0495667_0004648 Ga0495667_0004648_3215_3661 134
699 3300046559 Ga0495667_0006539 Ga0495667_0006539_2652_3098 134
700 3300046559 Ga0495667_0013627 Ga0495667_0013627_4837_5283 134
701 3300046559 Ga0495667_0051276 Ga0495667_0051276_49_495 134
702 3300046559 Ga0495667_0162575 Ga0495667_0162575_165_611 134
703 3300046559 Ga0495667_0836467 Ga0495667_0836467_19_465 134
704 3300046663 Ga0495635_0010729 Ga0495635_0010729_4028_4474 134
705 3300046663 Ga0495635_0034972 Ga0495635_0034972_1423_1869 134
706 3300046663 Ga0495635_0038913 Ga0495635_0038913_1926_2372 134
707 3300046663 Ga0495635_0046693 Ga0495635_0046693_1975_2421 134
708 3300046675 Ga0495657_0004896 Ga0495657_0004896_3527_3973 134
709 3300046675 Ga0495657_0009780 Ga0495657_0009780_137_583 134
710 3300046675 Ga0495657_0029808 Ga0495657_0029808_2936_3382 134
711 3300046675 Ga0495657_0055518 Ga0495657_0055518_886_1332 134
712 3300046678 Ga0495599_0002162 Ga0495599_0002162_7305_7751 134
713 3300046678 Ga0495599_0006221 Ga0495599_0006221_6511_6957 134
714 3300046678 Ga0495599_0029504 Ga0495599_0029504_282_728 134
715 3300046678 Ga0495599_0134784 Ga0495599_0134784_13_459 134
716 3300046678 Ga0495599_0270710 Ga0495599_0270710_337_795 134
717 3300046678 Ga0495599_0346641 Ga0495599_0346641_422_868 134
718 3300046679 Ga0495623_0049876 Ga0495623_0049876_494_940 134
719 3300046680 Ga0495646_0004125 Ga0495646_0004125_6152_6598 134
720 3300046680 Ga0495646_0704752 Ga0495646_0704752_47_493 134
721 3300046683 Ga0495658_0002903 Ga0495658_0002903_1488_1934 134
722 3300046689 Ga0495613_0124617 Ga0495613_0124617_168_614 134
723 3300046690 Ga0495624_0067474 Ga0495624_0067474_1627_2073 134
724 3300046809 Ga0495600_0016514 Ga0495600_0016514_3904_4350 134
725 3300046809 Ga0495600_0029698 Ga0495600_0029698_1048_1494 134
726 3300046809 Ga0495600_0042046 Ga0495600_0042046_801_1247 134
727 3300046809 Ga0495600_0701542 Ga0495600_0701542_127_585 134
728 3300047315 Ga0495581_0017527 Ga0495581_0017527_40_486 134
729 3300047317 Ga0495604_0194675 Ga0495604_0194675_775_1221 134
730 3300047317 Ga0495604_0336861 Ga0495604_0336861_125_571 134
731 3300047317 Ga0495604_0469798 Ga0495604_0469798_363_809 134
732 3300047319 Ga0495674_0009070 Ga0495674_0009070_8521_8967 134
733 3300047319 Ga0495674_0107468 Ga0495674_0107468_1117_1563 134
734 3300047319 Ga0495674_0131180 Ga0495674_0131180_135_581 134
735 3300047319 Ga0495674_0139752 Ga0495674_0139752_1341_1790 134
736 3300047321 Ga0495676_0163140 Ga0495676_0163140_41_487 134
737 3300047321 Ga0495676_0177979 Ga0495676_0177979_84_530 134
738 3300047321 Ga0495676_0288169 Ga0495676_0288169_643_1092 134
739 3300047321 Ga0495676_0329424 Ga0495676_0329424_232_678 134
740 3300047322 Ga0495680_0033256 Ga0495680_0033256_1199_1645 134
741 3300047322 Ga0495680_0037424 Ga0495680_0037424_1357_1803 134
742 3300047322 Ga0495680_0038711 Ga0495680_0038711_2551_2997 134
743 3300047322 Ga0495680_0080713 Ga0495680_0080713_134_580 134
744 3300047444 Ga0495675_0010105 Ga0495675_0010105_4952_5398 134
745 3300047444 Ga0495675_0046768 Ga0495675_0046768_1820_2266 134
746 3300047471 Ga0495684_0004828 Ga0495684_0004828_4470_4916 134
747 3300047471 Ga0495684_0035516 Ga0495684_0035516_2083_2529 134
748 3300047471 Ga0495684_0054305 Ga0495684_0054305_2421_2867 134
749 3300047471 Ga0495684_0382717 Ga0495684_0382717_130_579 134
750 3300047471 Ga0495684_0625472 Ga0495684_0625472_39_485 134
751 3300047471 Ga0495684_0699345 Ga0495684_0699345_89_538 134
752 3300047673 Ga0495593_0025454 Ga0495593_0025454_2252_2698 134
753 3300047673 Ga0495593_0229369 Ga0495593_0229369_399_845 134
754 3300048088 Ga0495602_0030412 Ga0495602_0030412_726_1172 134
755 3300048088 Ga0495602_0366052 Ga0495602_0366052_412_858 134
756 3300048089 Ga0495614_0003380 Ga0495614_0003380_6393_6839 134
757 3300048905 Ga0496102_0013321 Ga0496102_0013321_5390_5836 134
758 3300048906 Ga0496103_0431403 Ga0496103_0431403_49_495 134
759 3300048907 Ga0496104_0010640 Ga0496104_0010640_4843_5289 134
760 3300048908 Ga0496105_0038880 Ga0496105_0038880_2079_2525 134
761 3300048909 Ga0496106_0007645 Ga0496106_0007645_6154_6600 134
762 3300048910 Ga0496107_0020679 Ga0496107_0020679_1460_1906 134
763 3300048911 Ga0496108_0014892 Ga0496108_0014892_4263_4709 134
764 3300048911 Ga0496108_0156074 Ga0496108_0156074_1276_1722 134
765 3300048912 Ga0496109_0005650 Ga0496109_0005650_6135_6581 134
766 3300048912 Ga0496109_1502911 Ga0496109_1502911_11_415 134
767 3300048913 Ga0496110_0131709 Ga0496110_0131709_365_811 134
768 3300048913 Ga0496110_0596667 Ga0496110_0596667_245_691 134
769 3300048914 Ga0496111_0007464 Ga0496111_0007464_4849_5295 134
770 3300048915 Ga0496112_0018081 Ga0496112_0018081_4850_5296 134
771 3300048915 Ga0496112_0052633 Ga0496112_0052633_120_566 134
772 3300048915 Ga0496112_0137016 Ga0496112_0137016_722_1168 134
773 3300048916 Ga0496113_0003643 Ga0496113_0003643_7060_7506 134
774 3300048917 Ga0496114_0051179 Ga0496114_0051179_647_1093 134
775 3300048918 Ga0496115_0046842 Ga0496115_0046842_284_730 134
776 3300048918 Ga0496115_0898718 Ga0496115_0898718_150_596 134
777 3300049572 Ga0501036_1274927 Ga0501036_1274927_80_535 134
778 3300050512 nmdc:mga0n895_1963604_c1 nmdc:mga0n895_1963604_c1_80_526 134
779 3300050512 nmdc:mga0n895_513311_c1 nmdc:mga0n895_513311_c1_241_687 134
780 3300050513 nmdc:mga0rr50_702838_c1 nmdc:mga0rr50_702838_c1_262_708 134
781 3300050514 nmdc:mga08x19_251138_c1 nmdc:mga08x19_251138_c1_55_501 134
782 3300050514 nmdc:mga08x19_76191_c1 nmdc:mga08x19_76191_c1_730_1176 134
783 3300053077 Ga0495601_0044913 Ga0495601_0044913_879_1325 134
784 3300053077 Ga0495601_0110824 Ga0495601_0110824_34_480 134
785 3300053077 Ga0495601_0272509 Ga0495601_0272509_435_884 134
786 3300053078 Ga0495612_0016653 Ga0495612_0016653_2485_2931 134
787 3300053078 Ga0495612_0114993 Ga0495612_0114993_505_951 134
788 3300053084 Ga0495595_0053088 Ga0495595_0053088_383_829 134
789 3300053085 Ga0495619_0005684 Ga0495619_0005684_5524_5970 134
790 3300053085 Ga0495619_0325866 Ga0495619_0325866_121_567 134
791 3300053085 Ga0495619_1123083 Ga0495619_1123083_15_419 134
792 3300053139 Ga0500568_0000031 Ga0500568_0000031_115922_116374 134
793 iso_pu_bacteria 2863404153 2863410660 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04075

F420H2_quin_red

F420H(2)-dependent quinone reductase

45

177

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kl8-assembly1.cif.gz_B structure of f420 binding protein rv1558 from mycobacterium tuberculosis with f420 bound 0.9855 2 132
3r5z-assembly2.cif.gz_B structure of a deazaflavin-dependent reductase from nocardia farcinica, with co-factor f420 0.983 2 131
3r5y-assembly3.cif.gz_C structure of a deazaflavin-dependent nitroreductase from nocardia farcinica, with co-factor f420 0.9803 3 132
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.9652 24 131
4y9i-assembly1.cif.gz_A structure of f420-h2 dependent reductase (fdr-a) msmeg_2027 0.9606 25 130
ID Description Score Start End Superfamily
3r5yD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9783 3 132 2.30.110.10
4y9iA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9607 25 130 2.30.110.10
af_P9WP15_14_151_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9372 2 131 2.30.110.10
3r5yD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9284 3 132 2.30.110.10
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9063 15 131 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A3D9Q679-F1-model_v4 deleted 0.9985 1 132
AF-D9VMN6-F1-model_v4 Nitroreductase 0.9984 1 132 GO:0005886
GO:0016491
GO:0070967
AF-A0A024JYH7-F1-model_v4 Deazaflavin-dependent nitroreductase family protein 0.9972 24 132 GO:0005886
GO:0016491
GO:0070967
AF-A0A4R7AU34-F1-model_v4 deleted 0.9969 1 132
AF-A0A4D4M7C0-F1-model_v4 Nitroreductase 0.9968 1 132 GO:0005886
GO:0016491
GO:0070967

Feature Viewer

pLDDT pTM Quality
94.27 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map