F481059
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 793 | 349 | 790 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_11921530|Ga0157378_119215301 |
| Length | 179 |
| Sequence | MTMVPPDVRCPECRPGVAAIAGRPRAFYPDDMALKGEYEPSPAQWVRDQVELYEGSGGTQGNTLRETGLPVIVVTTLGVKSGKIRKIPLMRVEHDGEYALVASKGGAPAHPVWYYNLKDNAGPIEIQDGPEPTEFAVRELSGEERATWWDRAVAAFPPYAEYQAKTDRQIPVFLASPRH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 2 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 113 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 121 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 123 | 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 125 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 185 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 196 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 200 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 208 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 210 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 219 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 232 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 233 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 236 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 239 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 240 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 241 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 242 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 243 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 244 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 245 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 246 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 247 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 294 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 295 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 296 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 297 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 298 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 302 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 303 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 304 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 305 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 306 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 307 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 308 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 309 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 310 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 311 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 312 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 313 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 314 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 328 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 329 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 330 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 331 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 332 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 340 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 343 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 344 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 345 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 346 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 349 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.97 |
| Metatranscriptomes | 2.65 |
| Isolates | 0.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.65 |
| Nodule | 0 |
| Rhizoplane | 5.8 |
| Rhizosphere | 87.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10130550 | 3300001979 | Bacteria | 627 |
| 2 | Ga0070658_10011102 | 3300005327 | Bacteria | 7222 |
| 3 | Ga0070658_10026589 | 3300005327 | Bacteria | 4643 |
| 4 | Ga0070676_11131792 | 3300005328 | Bacteria | 593 |
| 5 | Ga0070683_100033200 | 3300005329 | Bacteria | 4705 |
| 6 | Ga0070683_100058012 | 3300005329 | Bacteria | 3597 |
| 7 | Ga0070670_100782366 | 3300005331 | Bacteria | 861 |
| 8 | Ga0068869_100008663 | 3300005334 | Bacteria | 6570 |
| 9 | Ga0070680_100022387 | 3300005336 | Bacteria | 5034 |
| 10 | Ga0070682_100006527 | 3300005337 | Bacteria | 6547 |
| 11 | Ga0070682_100174812 | 3300005337 | Bacteria | 1495 |
| 12 | Ga0070682_100194670 | 3300005337 | Bacteria | 1426 |
| 13 | Ga0068868_100040660 | 3300005338 | Bacteria | 3619 |
| 14 | Ga0068868_100116827 | 3300005338 | Bacteria | 2173 |
| 15 | Ga0070660_100053561 | 3300005339 | Bacteria | 3112 |
| 16 | Ga0070689_100333647 | 3300005340 | Bacteria | 1269 |
| 17 | Ga0070691_10005725 | 3300005341 | Bacteria | 5666 |
| 18 | Ga0070691_10101240 | 3300005341 | Bacteria | 1431 |
| 19 | Ga0070687_100122072 | 3300005343 | Bacteria | 1491 |
| 20 | Ga0070668_100153728 | 3300005347 | Bacteria | 1863 |
| 21 | Ga0070669_101205879 | 3300005353 | Bacteria | 654 |
| 22 | Ga0070671_100113797 | 3300005355 | Bacteria | 2274 |
| 23 | Ga0070671_101588414 | 3300005355 | Bacteria | 580 |
| 24 | Ga0070674_100072492 | 3300005356 | Bacteria | 2439 |
| 25 | Ga0070659_100003309 | 3300005366 | Bacteria | 11480 |
| 26 | Ga0070659_100137804 | 3300005366 | Bacteria | 1985 |
| 27 | Ga0070659_100211412 | 3300005366 | Bacteria | 1599 |
| 28 | Ga0070667_100172333 | 3300005367 | Bacteria | 1911 |
| 29 | Ga0070667_100498144 | 3300005367 | Bacteria | 1116 |
| 30 | Ga0070709_10004900 | 3300005434 | Bacteria | 7233 |
| 31 | Ga0070709_10012138 | 3300005434 | Bacteria | 4816 |
| 32 | Ga0070709_10015872 | 3300005434 | Bacteria | 4289 |
| 33 | Ga0070709_10121606 | 3300005434 | Bacteria | 1770 |
| 34 | Ga0070709_10131973 | 3300005434 | Bacteria | 1706 |
| 35 | Ga0070714_100038387 | 3300005435 | Bacteria | 4025 |
| 36 | Ga0070714_100070947 | 3300005435 | Bacteria | 3012 |
| 37 | Ga0070714_100189514 | 3300005435 | Bacteria | 1876 |
| 38 | Ga0070714_100316472 | 3300005435 | Bacteria | 1458 |
| 39 | Ga0070714_100366639 | 3300005435 | Bacteria | 1355 |
| 40 | Ga0070714_100406691 | 3300005435 | Bacteria | 1287 |
| 41 | Ga0070714_100424497 | 3300005435 | Bacteria | 1260 |
| 42 | Ga0070714_100443839 | 3300005435 | Bacteria | 1232 |
| 43 | Ga0070714_100581271 | 3300005435 | Bacteria | 1074 |
| 44 | Ga0070714_100736574 | 3300005435 | Bacteria | 952 |
| 45 | Ga0070713_100228102 | 3300005436 | Bacteria | 1692 |
| 46 | Ga0070713_100446993 | 3300005436 | Bacteria | 1213 |
| 47 | Ga0070713_100705383 | 3300005436 | Bacteria | 963 |
| 48 | Ga0070710_10004524 | 3300005437 | Bacteria | 6575 |
| 49 | Ga0070710_10018559 | 3300005437 | Bacteria | 3580 |
| 50 | Ga0070710_10028884 | 3300005437 | Bacteria | 2970 |
| 51 | Ga0070710_10214185 | 3300005437 | Bacteria | 1222 |
| 52 | Ga0070710_10224158 | 3300005437 | Bacteria | 1197 |
| 53 | Ga0070711_100037903 | 3300005439 | Bacteria | 3237 |
| 54 | Ga0070711_100038693 | 3300005439 | Bacteria | 3208 |
| 55 | Ga0070711_100069160 | 3300005439 | Bacteria | 2483 |
| 56 | Ga0070711_100072683 | 3300005439 | Bacteria | 2427 |
| 57 | Ga0070711_100126962 | 3300005439 | Bacteria | 1894 |
| 58 | Ga0070705_100009830 | 3300005440 | Bacteria | 4770 |
| 59 | Ga0070705_100152954 | 3300005440 | Bacteria | 1533 |
| 60 | Ga0070705_100785918 | 3300005440 | Bacteria | 756 |
| 61 | Ga0070694_101044058 | 3300005444 | Bacteria | 680 |
| 62 | Ga0070708_100002254 | 3300005445 | Bacteria | 14909 |
| 63 | Ga0070708_100116448 | 3300005445 | Bacteria | 2461 |
| 64 | Ga0070708_100379605 | 3300005445 | Bacteria | 1332 |
| 65 | Ga0070708_101012003 | 3300005445 | Bacteria | 779 |
| 66 | Ga0070708_101329652 | 3300005445 | Bacteria | 671 |
| 67 | Ga0070663_100045037 | 3300005455 | Bacteria | 3115 |
| 68 | Ga0070678_100006821 | 3300005456 | Bacteria | 6731 |
| 69 | Ga0070662_100877479 | 3300005457 | Bacteria | 765 |
| 70 | Ga0070681_10014657 | 3300005458 | Bacteria | 7797 |
| 71 | Ga0070681_10445347 | 3300005458 | Bacteria | 1207 |
| 72 | Ga0070681_10852618 | 3300005458 | Bacteria | 829 |
| 73 | Ga0070681_11094482 | 3300005458 | Bacteria | 718 |
| 74 | Ga0068867_100168391 | 3300005459 | Bacteria | 1733 |
| 75 | Ga0070685_10012830 | 3300005466 | Bacteria | 4409 |
| 76 | Ga0070685_10083761 | 3300005466 | Bacteria | 1916 |
| 77 | Ga0070706_100053612 | 3300005467 | Bacteria | 3722 |
| 78 | Ga0070706_100053853 | 3300005467 | Bacteria | 3714 |
| 79 | Ga0070706_100194792 | 3300005467 | Bacteria | 1893 |
| 80 | Ga0070706_100407939 | 3300005467 | Bacteria | 1265 |
| 81 | Ga0070706_100845864 | 3300005467 | Bacteria | 846 |
| 82 | Ga0070706_101046923 | 3300005467 | Bacteria | 752 |
| 83 | Ga0070706_102052535 | 3300005467 | Bacteria | 517 |
| 84 | Ga0070707_100031696 | 3300005468 | Bacteria | 5037 |
| 85 | Ga0070707_100045570 | 3300005468 | Bacteria | 4197 |
| 86 | Ga0070707_100066233 | 3300005468 | Bacteria | 3471 |
| 87 | Ga0070707_100084253 | 3300005468 | Bacteria | 3071 |
| 88 | Ga0070698_100107441 | 3300005471 | Bacteria | 2758 |
| 89 | Ga0070698_101279140 | 3300005471 | Bacteria | 683 |
| 90 | Ga0070699_100004187 | 3300005518 | Bacteria | 12764 |
| 91 | Ga0070699_100112445 | 3300005518 | Bacteria | 2392 |
| 92 | Ga0070679_100022981 | 3300005530 | Bacteria | 6099 |
| 93 | Ga0070679_100174356 | 3300005530 | Bacteria | 2123 |
| 94 | Ga0070684_100136100 | 3300005535 | Bacteria | 2219 |
| 95 | Ga0070684_100167382 | 3300005535 | Bacteria | 1995 |
| 96 | Ga0070697_100014160 | 3300005536 | Bacteria | 6264 |
| 97 | Ga0070697_100940744 | 3300005536 | Bacteria | 767 |
| 98 | Ga0068853_100043867 | 3300005539 | Bacteria | 3826 |
| 99 | Ga0068853_100353189 | 3300005539 | Bacteria | 1368 |
| 100 | Ga0068853_100354901 | 3300005539 | Bacteria | 1365 |
| 101 | Ga0070672_100004844 | 3300005543 | Bacteria | 8845 |
| 102 | Ga0070672_100174471 | 3300005543 | Bacteria | 1789 |
| 103 | Ga0070695_100080131 | 3300005545 | Bacteria | 2157 |
| 104 | Ga0070696_100011939 | 3300005546 | Bacteria | 5822 |
| 105 | Ga0070696_100721819 | 3300005546 | Bacteria | 814 |
| 106 | Ga0070693_100003246 | 3300005547 | Bacteria | 7553 |
| 107 | Ga0070665_100045387 | 3300005548 | Bacteria | 4413 |
| 108 | Ga0070665_100120050 | 3300005548 | Bacteria | 2631 |
| 109 | Ga0070665_100128802 | 3300005548 | Bacteria | 2533 |
| 110 | Ga0070704_100031218 | 3300005549 | Bacteria | 3581 |
| 111 | Ga0068855_100039781 | 3300005563 | Bacteria | 5581 |
| 112 | Ga0068855_100059365 | 3300005563 | Bacteria | 4475 |
| 113 | Ga0068855_100152689 | 3300005563 | Bacteria | 2625 |
| 114 | Ga0068855_100212575 | 3300005563 | Bacteria | 2172 |
| 115 | Ga0068855_100710553 | 3300005563 | Bacteria | 1075 |
| 116 | Ga0068855_100920397 | 3300005563 | Bacteria | 923 |
| 117 | Ga0068855_100998174 | 3300005563 | Bacteria | 880 |
| 118 | Ga0068855_101588384 | 3300005563 | Bacteria | 669 |
| 119 | Ga0070664_100009586 | 3300005564 | Bacteria | 7854 |
| 120 | Ga0068857_100013122 | 3300005577 | Bacteria | 7220 |
| 121 | Ga0068857_100567863 | 3300005577 | Bacteria | 1070 |
| 122 | Ga0068854_100104518 | 3300005578 | Bacteria | 2128 |
| 123 | Ga0068854_100212710 | 3300005578 | Bacteria | 1526 |
| 124 | Ga0068856_100084217 | 3300005614 | Bacteria | 3158 |
| 125 | Ga0068856_100089319 | 3300005614 | Bacteria | 3064 |
| 126 | Ga0068856_100229775 | 3300005614 | Bacteria | 1870 |
| 127 | Ga0068856_100375624 | 3300005614 | Bacteria | 1440 |
| 128 | Ga0068856_100535489 | 3300005614 | Bacteria | 1192 |
| 129 | Ga0068856_100884666 | 3300005614 | Bacteria | 912 |
| 130 | Ga0068852_100003105 | 3300005616 | Bacteria | 11562 |
| 131 | Ga0068852_100008277 | 3300005616 | Bacteria | 7654 |
| 132 | Ga0068852_100026637 | 3300005616 | Bacteria | 4703 |
| 133 | Ga0068852_100151113 | 3300005616 | Bacteria | 2159 |
| 134 | Ga0068859_100086190 | 3300005617 | Bacteria | 3187 |
| 135 | Ga0068864_100008886 | 3300005618 | Bacteria | 8283 |
| 136 | Ga0068864_100143486 | 3300005618 | Bacteria | 2156 |
| 137 | Ga0068864_100449985 | 3300005618 | Bacteria | 1231 |
| 138 | Ga0068864_100742933 | 3300005618 | Bacteria | 961 |
| 139 | Ga0068864_101005768 | 3300005618 | Bacteria | 827 |
| 140 | Ga0068861_100119740 | 3300005719 | Bacteria | 2122 |
| 141 | Ga0068861_100482793 | 3300005719 | Bacteria | 1117 |
| 142 | Ga0068851_10000022 | 3300005834 | Bacteria | 129607 |
| 143 | Ga0068863_100011963 | 3300005841 | Bacteria | 8386 |
| 144 | Ga0068863_100120547 | 3300005841 | Bacteria | 2501 |
| 145 | Ga0068863_100298424 | 3300005841 | Bacteria | 1563 |
| 146 | Ga0068858_100001116 | 3300005842 | Bacteria | 27809 |
| 147 | Ga0068858_100011040 | 3300005842 | Bacteria | 8538 |
| 148 | Ga0068858_100074709 | 3300005842 | Bacteria | 3148 |
| 149 | Ga0068860_100062358 | 3300005843 | Bacteria | 3542 |
| 150 | Ga0068862_100219957 | 3300005844 | Bacteria | 1719 |
| 151 | Ga0070717_10009984 | 3300006028 | Bacteria | 7143 |
| 152 | Ga0070717_10011792 | 3300006028 | Bacteria | 6649 |
| 153 | Ga0070717_10035435 | 3300006028 | Bacteria | 4040 |
| 154 | Ga0070717_10094460 | 3300006028 | Bacteria | 2529 |
| 155 | Ga0070717_10097243 | 3300006028 | Bacteria | 2494 |
| 156 | Ga0070717_10205772 | 3300006028 | Bacteria | 1725 |
| 157 | Ga0070717_10375563 | 3300006028 | Bacteria | 1274 |
| 158 | Ga0070717_10385980 | 3300006028 | Bacteria | 1256 |
| 159 | Ga0070717_10470318 | 3300006028 | Bacteria | 1134 |
| 160 | Ga0070717_10518274 | 3300006028 | Bacteria | 1078 |
| 161 | Ga0070717_10584881 | 3300006028 | Bacteria | 1012 |
| 162 | Ga0070717_10697597 | 3300006028 | Bacteria | 922 |
| 163 | Ga0070717_10966726 | 3300006028 | Bacteria | 775 |
| 164 | Ga0070717_11084937 | 3300006028 | Bacteria | 729 |
| 165 | Ga0070717_11227964 | 3300006028 | Bacteria | 682 |
| 166 | Ga0075368_10012045 | 3300006042 | Bacteria | 3158 |
| 167 | Ga0075363_100166099 | 3300006048 | Bacteria | 1251 |
| 168 | Ga0075364_10002703 | 3300006051 | Bacteria | 9966 |
| 169 | Ga0070715_10244534 | 3300006163 | Bacteria | 935 |
| 170 | Ga0070716_100013108 | 3300006173 | Bacteria | 4218 |
| 171 | Ga0070716_100034829 | 3300006173 | Bacteria | 2763 |
| 172 | Ga0070712_100007749 | 3300006175 | Bacteria | 6721 |
| 173 | Ga0070712_100056070 | 3300006175 | Bacteria | 2762 |
| 174 | Ga0070712_100199106 | 3300006175 | Bacteria | 1572 |
| 175 | Ga0070712_100450425 | 3300006175 | Bacteria | 1071 |
| 176 | Ga0075362_10004700 | 3300006177 | Bacteria | 4929 |
| 177 | Ga0075367_10078886 | 3300006178 | Bacteria | 1989 |
| 178 | Ga0075369_10075638 | 3300006186 | Bacteria | 1487 |
| 179 | Ga0075366_11068811 | 3300006195 | Bacteria | 504 |
| 180 | Ga0097621_100009840 | 3300006237 | Bacteria | 6961 |
| 181 | Ga0097621_100062056 | 3300006237 | Bacteria | 3067 |
| 182 | Ga0097621_100735107 | 3300006237 | Bacteria | 911 |
| 183 | Ga0075370_10060147 | 3300006353 | Bacteria | 2164 |
| 184 | Ga0068871_100006638 | 3300006358 | Bacteria | 8209 |
| 185 | Ga0068871_101072043 | 3300006358 | Bacteria | 753 |
| 186 | Ga0068865_101513678 | 3300006881 | Bacteria | 601 |
| 187 | Ga0075436_100101712 | 3300006914 | Bacteria | 2002 |
| 188 | Ga0075436_100449067 | 3300006914 | Bacteria | 938 |
| 189 | Ga0075436_101087000 | 3300006914 | Bacteria | 602 |
| 190 | Ga0097620_100086188 | 3300006931 | Bacteria | 3187 |
| 191 | Ga0075435_100082491 | 3300007076 | Bacteria | 2643 |
| 192 | Ga0075435_100282242 | 3300007076 | Bacteria | 1418 |
| 193 | Ga0099795_10134317 | 3300007788 | Bacteria | 1001 |
| 194 | Ga0105251_10090761 | 3300009011 | Bacteria | 1403 |
| 195 | Ga0105251_10209704 | 3300009011 | Bacteria | 877 |
| 196 | Ga0105240_10133676 | 3300009093 | Bacteria | 2972 |
| 197 | Ga0105240_11039377 | 3300009093 | Bacteria | 874 |
| 198 | Ga0105240_11476147 | 3300009093 | Bacteria | 713 |
| 199 | Ga0105245_10000706 | 3300009098 | Bacteria | 30052 |
| 200 | Ga0105245_10013431 | 3300009098 | Bacteria | 7135 |
| 201 | Ga0105245_10090349 | 3300009098 | Bacteria | 2817 |
| 202 | Ga0105245_10158321 | 3300009098 | Bacteria | 2147 |
| 203 | Ga0105245_10183085 | 3300009098 | Bacteria | 2003 |
| 204 | Ga0105247_10259565 | 3300009101 | Bacteria | 1191 |
| 205 | Ga0105247_10801417 | 3300009101 | Bacteria | 719 |
| 206 | Ga0114129_10546506 | 3300009147 | Bacteria | 1507 |
| 207 | Ga0105241_10087157 | 3300009174 | Bacteria | 2457 |
| 208 | Ga0105242_10135834 | 3300009176 | Bacteria | 2128 |
| 209 | Ga0105248_10007015 | 3300009177 | Bacteria | 12338 |
| 210 | Ga0105248_10094046 | 3300009177 | Bacteria | 3375 |
| 211 | Ga0105248_10143855 | 3300009177 | Bacteria | 2691 |
| 212 | Ga0105248_10640833 | 3300009177 | Bacteria | 1199 |
| 213 | Ga0105248_11532264 | 3300009177 | Bacteria | 755 |
| 214 | Ga0105237_10006825 | 3300009545 | Bacteria | 12584 |
| 215 | Ga0105237_10056684 | 3300009545 | Bacteria | 3921 |
| 216 | Ga0105237_10120034 | 3300009545 | Bacteria | 2623 |
| 217 | Ga0105237_10130352 | 3300009545 | Bacteria | 2509 |
| 218 | Ga0105237_10141667 | 3300009545 | Bacteria | 2398 |
| 219 | Ga0105237_10562298 | 3300009545 | Bacteria | 1147 |
| 220 | Ga0105238_10237359 | 3300009551 | Bacteria | 1800 |
| 221 | Ga0105238_10526626 | 3300009551 | Bacteria | 1185 |
| 222 | Ga0105238_10528545 | 3300009551 | Bacteria | 1182 |
| 223 | Ga0105238_10631771 | 3300009551 | Bacteria | 1080 |
| 224 | Ga0105249_10287426 | 3300009553 | Bacteria | 1645 |
| 225 | Ga0099796_10074334 | 3300010159 | Bacteria | 1234 |
| 226 | Ga0105239_11304206 | 3300010375 | Bacteria | 837 |
| 227 | Ga0105239_11352481 | 3300010375 | Bacteria | 822 |
| 228 | Ga0105239_11426288 | 3300010375 | Bacteria | 800 |
| 229 | Ga0105239_12666950 | 3300010375 | Bacteria | 583 |
| 230 | Ga0105246_10057395 | 3300011119 | Bacteria | 2693 |
| 231 | Ga0105246_10389723 | 3300011119 | Bacteria | 1154 |
| 232 | Ga0105246_10696032 | 3300011119 | Bacteria | 890 |
| 233 | Ga0105246_11086745 | 3300011119 | Bacteria | 730 |
| 234 | Ga0157342_1037701 | 3300012507 | Bacteria | 635 |
| 235 | Ga0157370_10038567 | 3300013104 | Bacteria | 4621 |
| 236 | Ga0157370_10104826 | 3300013104 | Bacteria | 2647 |
| 237 | Ga0157370_10299654 | 3300013104 | Bacteria | 1484 |
| 238 | Ga0157370_10846693 | 3300013104 | Bacteria | 831 |
| 239 | Ga0157369_10036664 | 3300013105 | Bacteria | 5371 |
| 240 | Ga0157369_10193971 | 3300013105 | Bacteria | 2133 |
| 241 | Ga0157369_10503009 | 3300013105 | Bacteria | 1254 |
| 242 | Ga0157369_10867909 | 3300013105 | Bacteria | 926 |
| 243 | Ga0157369_12464517 | 3300013105 | Bacteria | 527 |
| 244 | Ga0157374_10004488 | 3300013296 | Bacteria | 11721 |
| 245 | Ga0157374_10015131 | 3300013296 | Bacteria | 6764 |
| 246 | Ga0157378_10432756 | 3300013297 | Bacteria | 1302 |
| 247 | Ga0157378_11921530 | 3300013297 | Bacteria | 641 |
| 248 | Ga0163162_10104972 | 3300013306 | Bacteria | 2920 |
| 249 | Ga0157372_10088181 | 3300013307 | Bacteria | 3522 |
| 250 | Ga0157375_10068114 | 3300013308 | Bacteria | 3560 |
| 251 | Ga0157375_10073093 | 3300013308 | Bacteria | 3447 |
| 252 | Ga0163163_10041656 | 3300014325 | Bacteria | 4492 |
| 253 | Ga0163163_10119713 | 3300014325 | Bacteria | 2666 |
| 254 | Ga0163163_10236854 | 3300014325 | Bacteria | 1875 |
| 255 | Ga0163163_10408627 | 3300014325 | Bacteria | 1416 |
| 256 | Ga0157377_10003346 | 3300014745 | Bacteria | 7252 |
| 257 | Ga0157377_10074609 | 3300014745 | Bacteria | 1968 |
| 258 | Ga0157379_10019387 | 3300014968 | Bacteria | 6007 |
| 259 | Ga0157379_10225546 | 3300014968 | Bacteria | 1698 |
| 260 | Ga0157379_11343369 | 3300014968 | Bacteria | 691 |
| 261 | Ga0157376_10011247 | 3300014969 | Bacteria | 6588 |
| 262 | Ga0157376_10333235 | 3300014969 | Bacteria | 1447 |
| 263 | Ga0197907_10450287 | 3300020069 | Bacteria | 2316 |
| 264 | Ga0206356_10083308 | 3300020070 | Bacteria | 1420 |
| 265 | Ga0206356_11851363 | 3300020070 | Bacteria | 697 |
| 266 | Ga0206349_1237185 | 3300020075 | Bacteria | 562 |
| 267 | Ga0206349_1762186 | 3300020075 | Bacteria | 2037 |
| 268 | Ga0206355_1500103 | 3300020076 | Bacteria | 721 |
| 269 | Ga0206351_10140329 | 3300020077 | Bacteria | 516 |
| 270 | Ga0206351_10704597 | 3300020077 | Bacteria | 1268 |
| 271 | Ga0206352_10807676 | 3300020078 | Bacteria | 1240 |
| 272 | Ga0206352_10811948 | 3300020078 | Bacteria | 620 |
| 273 | Ga0206350_10990203 | 3300020080 | Bacteria | 2282 |
| 274 | Ga0206350_11205897 | 3300020080 | Bacteria | 1371 |
| 275 | Ga0206354_11069328 | 3300020081 | Bacteria | 1530 |
| 276 | Ga0206353_10252478 | 3300020082 | Bacteria | 1699 |
| 277 | Ga0206353_10876871 | 3300020082 | Bacteria | 2563 |
| 278 | Ga0154015_1348326 | 3300020610 | Bacteria | 710 |
| 279 | Ga0213876_10040496 | 3300021384 | Bacteria | 2461 |
| 280 | Ga0213875_10066989 | 3300021388 | Bacteria | 1677 |
| 281 | Ga0213875_10266276 | 3300021388 | Bacteria | 809 |
| 282 | Ga0224712_10019923 | 3300022467 | Bacteria | 2270 |
| 283 | Ga0224712_10123937 | 3300022467 | Bacteria | 1122 |
| 284 | Ga0224571_107138 | 3300022734 | Bacteria | 751 |
| 285 | Ga0247551_103345 | 3300023552 | Bacteria | 613 |
| 286 | Ga0224572_1000558 | 3300024225 | Bacteria | 4572 |
| 287 | Ga0228598_1023934 | 3300024227 | Bacteria | 1202 |
| 288 | Ga0207656_10000005 | 3300025321 | Bacteria | 490514 |
| 289 | Ga0207692_10008528 | 3300025898 | Bacteria | 4244 |
| 290 | Ga0207692_10028273 | 3300025898 | Bacteria | 2650 |
| 291 | Ga0207692_10029315 | 3300025898 | Bacteria | 2614 |
| 292 | Ga0207692_10030704 | 3300025898 | Bacteria | 2565 |
| 293 | Ga0207692_10205468 | 3300025898 | Bacteria | 1160 |
| 294 | Ga0207692_10384530 | 3300025898 | Bacteria | 872 |
| 295 | Ga0207710_10035869 | 3300025900 | Bacteria | 2184 |
| 296 | Ga0207710_10317826 | 3300025900 | Bacteria | 789 |
| 297 | Ga0207688_11097767 | 3300025901 | Bacteria | 502 |
| 298 | Ga0207680_10273134 | 3300025903 | Bacteria | 1173 |
| 299 | Ga0207647_10061534 | 3300025904 | Bacteria | 2290 |
| 300 | Ga0207685_10091175 | 3300025905 | Bacteria | 1283 |
| 301 | Ga0207699_10001841 | 3300025906 | Bacteria | 9974 |
| 302 | Ga0207699_10059915 | 3300025906 | Bacteria | 2283 |
| 303 | Ga0207699_10110172 | 3300025906 | Bacteria | 1763 |
| 304 | Ga0207699_10237305 | 3300025906 | Bacteria | 1251 |
| 305 | Ga0207645_10350291 | 3300025907 | Bacteria | 988 |
| 306 | Ga0207643_10546382 | 3300025908 | Bacteria | 743 |
| 307 | Ga0207705_10021383 | 3300025909 | Bacteria | 4617 |
| 308 | Ga0207705_10044976 | 3300025909 | Bacteria | 3173 |
| 309 | Ga0207684_10155619 | 3300025910 | Bacteria | 1967 |
| 310 | Ga0207684_10201187 | 3300025910 | Bacteria | 1718 |
| 311 | Ga0207684_10678155 | 3300025910 | Bacteria | 877 |
| 312 | Ga0207684_10721893 | 3300025910 | Bacteria | 846 |
| 313 | Ga0207684_11047849 | 3300025910 | Bacteria | 681 |
| 314 | Ga0207684_11587885 | 3300025910 | Bacteria | 530 |
| 315 | Ga0207654_10094665 | 3300025911 | Bacteria | 1828 |
| 316 | Ga0207707_10007656 | 3300025912 | Bacteria | 9410 |
| 317 | Ga0207707_10033930 | 3300025912 | Bacteria | 4466 |
| 318 | Ga0207707_10684160 | 3300025912 | Bacteria | 862 |
| 319 | Ga0207695_10010059 | 3300025913 | Bacteria | 11616 |
| 320 | Ga0207695_10012911 | 3300025913 | Bacteria | 9997 |
| 321 | Ga0207695_10059511 | 3300025913 | Bacteria | 3960 |
| 322 | Ga0207695_10098913 | 3300025913 | Bacteria | 2916 |
| 323 | Ga0207671_10000016 | 3300025914 | Bacteria | 435413 |
| 324 | Ga0207671_10060170 | 3300025914 | Bacteria | 2817 |
| 325 | Ga0207671_10090023 | 3300025914 | Bacteria | 2310 |
| 326 | Ga0207671_10129424 | 3300025914 | Bacteria | 1936 |
| 327 | Ga0207671_10845988 | 3300025914 | Bacteria | 724 |
| 328 | Ga0207693_10013359 | 3300025915 | Bacteria | 6620 |
| 329 | Ga0207693_10193161 | 3300025915 | Bacteria | 1602 |
| 330 | Ga0207693_10293885 | 3300025915 | Bacteria | 1273 |
| 331 | Ga0207693_10391570 | 3300025915 | Bacteria | 1087 |
| 332 | Ga0207663_10007438 | 3300025916 | Bacteria | 5679 |
| 333 | Ga0207663_10007664 | 3300025916 | Bacteria | 5612 |
| 334 | Ga0207663_10062027 | 3300025916 | Bacteria | 2375 |
| 335 | Ga0207660_10015428 | 3300025917 | Bacteria | 5042 |
| 336 | Ga0207660_10169602 | 3300025917 | Bacteria | 1689 |
| 337 | Ga0207657_10006398 | 3300025919 | Bacteria | 12228 |
| 338 | Ga0207657_10114578 | 3300025919 | Bacteria | 2223 |
| 339 | Ga0207649_10025508 | 3300025920 | Bacteria | 3446 |
| 340 | Ga0207652_10134373 | 3300025921 | Bacteria | 2208 |
| 341 | Ga0207652_10140846 | 3300025921 | Bacteria | 2156 |
| 342 | Ga0207652_10896704 | 3300025921 | Bacteria | 783 |
| 343 | Ga0207646_10004957 | 3300025922 | Bacteria | 14225 |
| 344 | Ga0207646_10039482 | 3300025922 | Bacteria | 4249 |
| 345 | Ga0207646_10042936 | 3300025922 | Bacteria | 4062 |
| 346 | Ga0207646_10153104 | 3300025922 | Bacteria | 2079 |
| 347 | Ga0207681_11208321 | 3300025923 | Bacteria | 635 |
| 348 | Ga0207694_10000057 | 3300025924 | Bacteria | 146441 |
| 349 | Ga0207694_10130249 | 3300025924 | Bacteria | 2016 |
| 350 | Ga0207659_10124890 | 3300025926 | Bacteria | 1977 |
| 351 | Ga0207687_10403647 | 3300025927 | Bacteria | 1124 |
| 352 | Ga0207687_10466516 | 3300025927 | Bacteria | 1049 |
| 353 | Ga0207687_11149015 | 3300025927 | Bacteria | 667 |
| 354 | Ga0207700_10002213 | 3300025928 | Bacteria | 11159 |
| 355 | Ga0207700_10070942 | 3300025928 | Bacteria | 2680 |
| 356 | Ga0207700_10225561 | 3300025928 | Bacteria | 1590 |
| 357 | Ga0207700_10227297 | 3300025928 | Bacteria | 1585 |
| 358 | Ga0207700_10459930 | 3300025928 | Bacteria | 1122 |
| 359 | Ga0207700_10643291 | 3300025928 | Bacteria | 945 |
| 360 | Ga0207664_10000717 | 3300025929 | Bacteria | 22557 |
| 361 | Ga0207664_10003182 | 3300025929 | Bacteria | 10913 |
| 362 | Ga0207664_10010632 | 3300025929 | Bacteria | 6505 |
| 363 | Ga0207664_10037876 | 3300025929 | Bacteria | 3735 |
| 364 | Ga0207664_10083937 | 3300025929 | Bacteria | 2597 |
| 365 | Ga0207664_10135856 | 3300025929 | Bacteria | 2075 |
| 366 | Ga0207664_10166146 | 3300025929 | Bacteria | 1885 |
| 367 | Ga0207664_10197799 | 3300025929 | Bacteria | 1734 |
| 368 | Ga0207664_10234468 | 3300025929 | Bacteria | 1596 |
| 369 | Ga0207664_10400579 | 3300025929 | Bacteria | 1220 |
| 370 | Ga0207664_10427549 | 3300025929 | Bacteria | 1180 |
| 371 | Ga0207664_11569034 | 3300025929 | Bacteria | 580 |
| 372 | Ga0207644_10069912 | 3300025931 | Bacteria | 2564 |
| 373 | Ga0207644_10852022 | 3300025931 | Bacteria | 763 |
| 374 | Ga0207644_11264980 | 3300025931 | Bacteria | 620 |
| 375 | Ga0207690_10000329 | 3300025932 | Bacteria | 31684 |
| 376 | Ga0207690_10047869 | 3300025932 | Bacteria | 2839 |
| 377 | Ga0207686_10065315 | 3300025934 | Bacteria | 2320 |
| 378 | Ga0207709_10790832 | 3300025935 | Bacteria | 765 |
| 379 | Ga0207670_10238403 | 3300025936 | Bacteria | 1400 |
| 380 | Ga0207669_10352151 | 3300025937 | Bacteria | 1138 |
| 381 | Ga0207665_10005764 | 3300025939 | Bacteria | 8239 |
| 382 | Ga0207665_10019137 | 3300025939 | Bacteria | 4499 |
| 383 | Ga0207665_10083781 | 3300025939 | Bacteria | 2200 |
| 384 | Ga0207665_10222805 | 3300025939 | Bacteria | 1383 |
| 385 | Ga0207691_10029904 | 3300025940 | Bacteria | 5095 |
| 386 | Ga0207691_10476711 | 3300025940 | Bacteria | 1061 |
| 387 | Ga0207711_10006065 | 3300025941 | Bacteria | 10214 |
| 388 | Ga0207711_10058384 | 3300025941 | Bacteria | 3320 |
| 389 | Ga0207711_10069492 | 3300025941 | Bacteria | 3053 |
| 390 | Ga0207711_10486200 | 3300025941 | Bacteria | 1150 |
| 391 | Ga0207711_10517086 | 3300025941 | Bacteria | 1113 |
| 392 | Ga0207689_10003607 | 3300025942 | Bacteria | 14137 |
| 393 | Ga0207679_10223234 | 3300025945 | Bacteria | 1586 |
| 394 | Ga0207679_10550714 | 3300025945 | Bacteria | 1035 |
| 395 | Ga0207667_10008226 | 3300025949 | Bacteria | 12411 |
| 396 | Ga0207667_10031365 | 3300025949 | Bacteria | 5737 |
| 397 | Ga0207667_10198511 | 3300025949 | Bacteria | 2058 |
| 398 | Ga0207667_10259833 | 3300025949 | Bacteria | 1776 |
| 399 | Ga0207667_10294176 | 3300025949 | Bacteria | 1659 |
| 400 | Ga0207667_11094120 | 3300025949 | Bacteria | 780 |
| 401 | Ga0207712_11301431 | 3300025961 | Bacteria | 650 |
| 402 | Ga0207640_10037102 | 3300025981 | Bacteria | 3064 |
| 403 | Ga0207640_10165257 | 3300025981 | Bacteria | 1643 |
| 404 | Ga0207658_10047398 | 3300025986 | Bacteria | 3145 |
| 405 | Ga0207703_10003158 | 3300026035 | Bacteria | 13903 |
| 406 | Ga0207703_10069559 | 3300026035 | Bacteria | 2903 |
| 407 | Ga0207703_10163815 | 3300026035 | Bacteria | 1949 |
| 408 | Ga0207639_10019021 | 3300026041 | Bacteria | 4891 |
| 409 | Ga0207639_10154383 | 3300026041 | Bacteria | 1927 |
| 410 | Ga0207639_10230284 | 3300026041 | Bacteria | 1606 |
| 411 | Ga0207678_10012650 | 3300026067 | Bacteria | 7414 |
| 412 | Ga0207708_10674797 | 3300026075 | Bacteria | 881 |
| 413 | Ga0207702_10013634 | 3300026078 | Bacteria | 6751 |
| 414 | Ga0207702_10202816 | 3300026078 | Bacteria | 1839 |
| 415 | Ga0207702_10218380 | 3300026078 | Bacteria | 1776 |
| 416 | Ga0207702_10346309 | 3300026078 | Bacteria | 1421 |
| 417 | Ga0207702_10560487 | 3300026078 | Bacteria | 1118 |
| 418 | Ga0207702_10796466 | 3300026078 | Bacteria | 934 |
| 419 | Ga0207641_10072919 | 3300026088 | Bacteria | 2958 |
| 420 | Ga0207641_10449813 | 3300026088 | Bacteria | 1245 |
| 421 | Ga0207641_10779048 | 3300026088 | Bacteria | 945 |
| 422 | Ga0207641_11072839 | 3300026088 | Bacteria | 803 |
| 423 | Ga0207676_10294870 | 3300026095 | Bacteria | 1478 |
| 424 | Ga0207676_10364381 | 3300026095 | Bacteria | 1340 |
| 425 | Ga0207676_10540144 | 3300026095 | Bacteria | 1112 |
| 426 | Ga0207676_11314480 | 3300026095 | Bacteria | 718 |
| 427 | Ga0207674_10001953 | 3300026116 | Bacteria | 26128 |
| 428 | Ga0207674_10007743 | 3300026116 | Bacteria | 12503 |
| 429 | Ga0207674_10037100 | 3300026116 | Bacteria | 5072 |
| 430 | Ga0207674_10783125 | 3300026116 | Bacteria | 920 |
| 431 | Ga0207675_100033506 | 3300026118 | Bacteria | 4786 |
| 432 | Ga0207683_10008115 | 3300026121 | Bacteria | 8977 |
| 433 | Ga0207698_10002133 | 3300026142 | Bacteria | 11674 |
| 434 | Ga0207698_10009907 | 3300026142 | Bacteria | 6096 |
| 435 | Ga0207698_10337914 | 3300026142 | Bacteria | 1417 |
| 436 | Ga0268266_10156416 | 3300028379 | Bacteria | 2059 |
| 437 | Ga0268266_10251511 | 3300028379 | Bacteria | 1635 |
| 438 | Ga0268265_10197181 | 3300028380 | Bacteria | 1743 |
| 439 | Ga0268264_10185564 | 3300028381 | Bacteria | 1892 |
| 440 | Ga0268264_10701688 | 3300028381 | Bacteria | 1005 |
| 441 | Ga0307515_10645269 | 3300028794 | Bacteria | 671 |
| 442 | Ga0265338_10001315 | 3300028800 | Bacteria | 40706 |
| 443 | Ga0265338_10076423 | 3300028800 | Bacteria | 2837 |
| 444 | Ga0265338_10276170 | 3300028800 | Bacteria | 1229 |
| 445 | Ga0265338_10905438 | 3300028800 | Bacteria | 600 |
| 446 | Ga0265760_10014959 | 3300031090 | Bacteria | 2223 |
| 447 | Ga0265760_10056087 | 3300031090 | Bacteria | 1192 |
| 448 | Ga0265325_10005629 | 3300031241 | Bacteria | 7713 |
| 449 | Ga0265325_10119661 | 3300031241 | Bacteria | 1271 |
| 450 | Ga0265329_10035092 | 3300031242 | Bacteria | 1619 |
| 451 | Ga0265340_10290018 | 3300031247 | Bacteria | 726 |
| 452 | Ga0265339_10003540 | 3300031249 | Bacteria | 10917 |
| 453 | Ga0265339_10409467 | 3300031249 | Bacteria | 633 |
| 454 | Ga0265331_10018260 | 3300031250 | Bacteria | 3643 |
| 455 | Ga0265331_10122286 | 3300031250 | Bacteria | 1190 |
| 456 | Ga0265327_10000911 | 3300031251 | Bacteria | 43377 |
| 457 | Ga0265327_10061537 | 3300031251 | Bacteria | 1915 |
| 458 | Ga0265316_10297347 | 3300031344 | Bacteria | 1176 |
| 459 | Ga0265313_10001049 | 3300031595 | Bacteria | 26890 |
| 460 | Ga0265313_10018284 | 3300031595 | Bacteria | 3942 |
| 461 | Ga0265313_10077676 | 3300031595 | Bacteria | 1515 |
| 462 | Ga0307514_10387275 | 3300031649 | Bacteria | 722 |
| 463 | Ga0316579_10233587 | 3300031691 | Bacteria | 889 |
| 464 | Ga0265314_10132054 | 3300031711 | Bacteria | 1556 |
| 465 | Ga0265342_10165233 | 3300031712 | Bacteria | 1221 |
| 466 | Ga0265342_10322205 | 3300031712 | Bacteria | 810 |
| 467 | Ga0316576_10002554 | 3300031727 | Bacteria | 10385 |
| 468 | Ga0316576_10130936 | 3300031727 | Bacteria | 1887 |
| 469 | Ga0316576_10141687 | 3300031727 | Bacteria | 1810 |
| 470 | Ga0316578_10000611 | 3300031728 | Bacteria | 12514 |
| 471 | Ga0316578_10014573 | 3300031728 | Bacteria | 4205 |
| 472 | Ga0316578_10600256 | 3300031728 | Bacteria | 645 |
| 473 | Ga0307410_10387660 | 3300031852 | Bacteria | 1126 |
| 474 | Ga0307410_10595530 | 3300031852 | Bacteria | 921 |
| 475 | Ga0326468_10000782 | 3300031889 | Bacteria | 3194 |
| 476 | Ga0307407_10641683 | 3300031903 | Bacteria | 794 |
| 477 | Ga0307412_10047428 | 3300031911 | Bacteria | 2822 |
| 478 | Ga0307409_100679557 | 3300031995 | Bacteria | 1027 |
| 479 | Ga0307409_101225154 | 3300031995 | Bacteria | 774 |
| 480 | Ga0307411_11290776 | 3300032005 | Bacteria | 665 |
| 481 | Ga0316580_10078666 | 3300032139 | Bacteria | 1009 |
| 482 | Ga0373930_0015946 | 3300034816 | Bacteria | 1416 |
| 483 | Ga0373926_0003369 | 3300035083 | Bacteria | 5144 |
| 484 | Ga0373934_0023258 | 3300035086 | Bacteria | 2394 |
| 485 | Ga0373934_0142489 | 3300035086 | Bacteria | 980 |
| 486 | Ga0373940_0061272 | 3300035088 | Bacteria | 1077 |
| 487 | Ga0373940_0253843 | 3300035088 | Bacteria | 593 |
| 488 | Ga0373944_0006402 | 3300035089 | Bacteria | 3126 |
| 489 | Ga0373923_0191802 | 3300035111 | Bacteria | 942 |
| 490 | Ga0373936_0007347 | 3300035113 | Bacteria | 4146 |
| 491 | Ga0373936_0014354 | 3300035113 | Bacteria | 3026 |
| 492 | Ga0373939_0231670 | 3300035114 | Bacteria | 711 |
| 493 | Ga0373945_0000242 | 3300035116 | Bacteria | 15109 |
| 494 | Ga0373945_0290335 | 3300035116 | Bacteria | 698 |
| 495 | Ga0373945_0320102 | 3300035116 | Bacteria | 667 |
| 496 | Ga0373956_0202532 | 3300035119 | Bacteria | 941 |
| 497 | Ga0373957_0140555 | 3300035120 | Bacteria | 987 |
| 498 | Ga0373943_0001329 | 3300035170 | Bacteria | 11130 |
| 499 | Ga0373943_0034526 | 3300035170 | Bacteria | 2413 |
| 500 | Ga0373943_0526226 | 3300035170 | Bacteria | 692 |
| 501 | Ga0373943_0588944 | 3300035170 | Bacteria | 654 |
| 502 | Ga0373946_0042975 | 3300035171 | Bacteria | 1860 |
| 503 | Ga0373946_0131458 | 3300035171 | Bacteria | 1152 |
| 504 | Ga0373946_0563858 | 3300035171 | Bacteria | 588 |
| 505 | Ga0373955_0019563 | 3300035172 | Bacteria | 3387 |
| 506 | Ga0373924_0042413 | 3300035410 | Bacteria | 1866 |
| 507 | Ga0373924_0075716 | 3300035410 | Bacteria | 1425 |
| 508 | Ga0373924_0422646 | 3300035410 | Bacteria | 596 |
| 509 | Ga0373931_0298768 | 3300035691 | Bacteria | 994 |
| 510 | Ga0373931_0324954 | 3300035691 | Bacteria | 957 |
| 511 | Ga0373935_0085778 | 3300035692 | Bacteria | 2053 |
| 512 | Ga0373935_0538236 | 3300035692 | Bacteria | 850 |
| 513 | Ga0373927_0005581 | 3300035695 | Bacteria | 8650 |
| 514 | Ga0373927_0071708 | 3300035695 | Bacteria | 2242 |
| 515 | Ga0373927_0373956 | 3300035695 | Bacteria | 939 |
| 516 | Ga0373933_0042759 | 3300035724 | Bacteria | 2678 |
| 517 | Ga0373933_0281024 | 3300035724 | Bacteria | 1075 |
| 518 | Ga0373933_0923331 | 3300035724 | Bacteria | 575 |
| 519 | Ga0373947_0175788 | 3300035725 | Bacteria | 1391 |
| 520 | Ga0373947_0242680 | 3300035725 | Bacteria | 1189 |
| 521 | Ga0373947_0306942 | 3300035725 | Bacteria | 1059 |
| 522 | Ga0373937_0121011 | 3300036401 | Bacteria | 2439 |
| 523 | Ga0373937_0251952 | 3300036401 | Bacteria | 1664 |
| 524 | Ga0373937_0327154 | 3300036401 | Bacteria | 1450 |
| 525 | Ga0373937_0675868 | 3300036401 | Bacteria | 978 |
| 526 | Ga0373937_0947535 | 3300036401 | Bacteria | 809 |
| 527 | Ga0373937_1481550 | 3300036401 | Bacteria | 626 |
| 528 | Ga0316584_0263991 | 3300036712 | Bacteria | 1255 |
| 529 | Ga0316584_0341491 | 3300036712 | Bacteria | 1076 |
| 530 | Ga0373925_0034413 | 3300037068 | Bacteria | 3733 |
| 531 | Ga0373925_0118053 | 3300037068 | Bacteria | 2056 |
| 532 | Ga0373925_0295292 | 3300037068 | Bacteria | 1307 |
| 533 | Ga0373925_0341759 | 3300037068 | Bacteria | 1214 |
| 534 | Ga0436364_0458942 | 3300037853 | Bacteria | 732 |
| 535 | Ga0436364_0729577 | 3300037853 | Bacteria | 709 |
| 536 | Ga0436364_0796359 | 3300037853 | Bacteria | 2113 |
| 537 | Ga0436364_0818911 | 3300037853 | Bacteria | 4812 |
| 538 | Ga0436364_1041443 | 3300037853 | Bacteria | 6640 |
| 539 | Ga0436364_1197365 | 3300037853 | Bacteria | 6719 |
| 540 | Ga0436364_1334594 | 3300037853 | Bacteria | 9804 |
| 541 | Ga0436364_1481992 | 3300037853 | Bacteria | 665 |
| 542 | Ga0436364_1557432 | 3300037853 | Bacteria | 625 |
| 543 | Ga0436365_0112287 | 3300039437 | Bacteria | 28019 |
| 544 | Ga0436365_1145451 | 3300039437 | Bacteria | 2300 |
| 545 | Ga0436365_1189314 | 3300039437 | Bacteria | 1328 |
| 546 | Ga0436361_0458380 | 3300039447 | Bacteria | 600 |
| 547 | Ga0436363_0114807 | 3300039450 | Bacteria | 1049 |
| 548 | Ga0436363_0328230 | 3300039450 | Bacteria | 1553 |
| 549 | Ga0436363_0685849 | 3300039450 | Bacteria | 3656 |
| 550 | Ga0436363_1287920 | 3300039450 | Bacteria | 573 |
| 551 | Ga0436362_0365348 | 3300039453 | Bacteria | 691 |
| 552 | Ga0436362_0480976 | 3300039453 | Bacteria | 875 |
| 553 | Ga0436362_0802298 | 3300039453 | Bacteria | 513 |
| 554 | Ga0436362_1203116 | 3300039453 | Bacteria | 1142 |
| 555 | Ga0451793_0975550 | 3300041452 | Bacteria | 888 |
| 556 | Ga0451806_845660 | 3300041462 | Bacteria | 551 |
| 557 | Ga0451804_1026453 | 3300041463 | Bacteria | 1110 |
| 558 | Ga0439448_0169593 | 3300042005 | Bacteria | 761 |
| 559 | Ga0439459_0101830 | 3300042438 | Bacteria | 704 |
| 560 | Ga0466969_0045930 | 3300044656 | Bacteria | 2167 |
| 561 | Ga0466972_0246077 | 3300044658 | Bacteria | 836 |
| 562 | Ga0466966_0209838 | 3300044684 | Bacteria | 1177 |
| 563 | Ga0466966_0228389 | 3300044684 | Bacteria | 1123 |
| 564 | Ga0466961_0008157 | 3300044693 | Bacteria | 6671 |
| 565 | Ga0466963_0723053 | 3300044694 | Bacteria | 702 |
| 566 | Ga0466968_0261127 | 3300044735 | Bacteria | 825 |
| 567 | Ga0466959_0207388 | 3300045049 | Bacteria | 1363 |
| 568 | Ga0466967_0061888 | 3300045976 | Bacteria | 3321 |
| 569 | Ga0466967_0080982 | 3300045976 | Bacteria | 2932 |
| 570 | Ga0466967_0901860 | 3300045976 | Bacteria | 879 |
| 571 | Ga0466967_1145492 | 3300045976 | Bacteria | 775 |
| 572 | Ga0495592_0033307 | 3300046454 | Bacteria | 3886 |
| 573 | Ga0495592_0449639 | 3300046454 | Bacteria | 807 |
| 574 | Ga0495592_0492785 | 3300046454 | Bacteria | 761 |
| 575 | Ga0495603_0005395 | 3300046455 | Bacteria | 7630 |
| 576 | Ga0495629_0567659 | 3300046459 | Bacteria | 761 |
| 577 | Ga0495629_0746502 | 3300046459 | Bacteria | 648 |
| 578 | Ga0495641_0111169 | 3300046461 | Bacteria | 1222 |
| 579 | Ga0495641_0128575 | 3300046461 | Bacteria | 1131 |
| 580 | Ga0495651_0025942 | 3300046462 | Bacteria | 4562 |
| 581 | Ga0495651_0031975 | 3300046462 | Bacteria | 4104 |
| 582 | Ga0495651_0048621 | 3300046462 | Bacteria | 3275 |
| 583 | Ga0495651_0528730 | 3300046462 | Bacteria | 752 |
| 584 | Ga0495653_0010681 | 3300046463 | Bacteria | 7518 |
| 585 | Ga0495653_0071429 | 3300046463 | Bacteria | 2595 |
| 586 | Ga0495653_0094777 | 3300046463 | Bacteria | 2174 |
| 587 | Ga0495580_0011041 | 3300046472 | Bacteria | 7001 |
| 588 | Ga0495582_0038830 | 3300046473 | Bacteria | 2620 |
| 589 | Ga0495582_0671234 | 3300046473 | Bacteria | 600 |
| 590 | Ga0495582_0694275 | 3300046473 | Bacteria | 589 |
| 591 | Ga0495639_0005051 | 3300046475 | Bacteria | 5667 |
| 592 | Ga0495662_0001071 | 3300046476 | Bacteria | 13454 |
| 593 | Ga0495662_0257421 | 3300046476 | Bacteria | 859 |
| 594 | Ga0495608_0018178 | 3300046511 | Bacteria | 4853 |
| 595 | Ga0495608_0134893 | 3300046511 | Bacteria | 1578 |
| 596 | Ga0495608_0285552 | 3300046511 | Bacteria | 1023 |
| 597 | Ga0495608_0695510 | 3300046511 | Bacteria | 605 |
| 598 | Ga0495618_0004257 | 3300046514 | Bacteria | 8827 |
| 599 | Ga0495618_0050706 | 3300046514 | Bacteria | 2622 |
| 600 | Ga0495628_0021834 | 3300046516 | Bacteria | 5260 |
| 601 | Ga0495628_0156406 | 3300046516 | Bacteria | 1734 |
| 602 | Ga0495628_0184339 | 3300046516 | Bacteria | 1578 |
| 603 | Ga0495628_1012678 | 3300046516 | Bacteria | 571 |
| 604 | Ga0495630_0124677 | 3300046517 | Bacteria | 1954 |
| 605 | Ga0495630_0424893 | 3300046517 | Bacteria | 1018 |
| 606 | Ga0495630_0775258 | 3300046517 | Bacteria | 732 |
| 607 | Ga0495630_1099981 | 3300046517 | Bacteria | 602 |
| 608 | Ga0495666_0011710 | 3300046526 | Bacteria | 4373 |
| 609 | Ga0495666_0077157 | 3300046526 | Bacteria | 1579 |
| 610 | Ga0495666_0547149 | 3300046526 | Bacteria | 516 |
| 611 | Ga0495652_0025271 | 3300046529 | Bacteria | 5256 |
| 612 | Ga0495652_0052687 | 3300046529 | Bacteria | 3469 |
| 613 | Ga0495652_0312970 | 3300046529 | Bacteria | 1137 |
| 614 | Ga0495652_0546599 | 3300046529 | Bacteria | 797 |
| 615 | Ga0495665_0000609 | 3300046531 | Bacteria | 18209 |
| 616 | Ga0495665_0435645 | 3300046531 | Bacteria | 663 |
| 617 | Ga0495640_0011262 | 3300046533 | Bacteria | 6885 |
| 618 | Ga0495640_0051013 | 3300046533 | Bacteria | 2846 |
| 619 | Ga0495640_0080467 | 3300046533 | Bacteria | 2166 |
| 620 | Ga0495586_0399648 | 3300046535 | Bacteria | 791 |
| 621 | Ga0495587_0001347 | 3300046536 | Bacteria | 16314 |
| 622 | Ga0495587_0072829 | 3300046536 | Bacteria | 1996 |
| 623 | Ga0495587_0076967 | 3300046536 | Bacteria | 1937 |
| 624 | Ga0495587_0334261 | 3300046536 | Bacteria | 845 |
| 625 | Ga0495587_0477112 | 3300046536 | Bacteria | 690 |
| 626 | Ga0495645_0100029 | 3300046543 | Bacteria | 2062 |
| 627 | Ga0495645_0121337 | 3300046543 | Bacteria | 1840 |
| 628 | Ga0495667_0004648 | 3300046559 | Bacteria | 9284 |
| 629 | Ga0495667_0006539 | 3300046559 | Bacteria | 7911 |
| 630 | Ga0495667_0013627 | 3300046559 | Bacteria | 5497 |
| 631 | Ga0495667_0051276 | 3300046559 | Bacteria | 2722 |
| 632 | Ga0495667_0162575 | 3300046559 | Bacteria | 1436 |
| 633 | Ga0495667_0836467 | 3300046559 | Bacteria | 566 |
| 634 | Ga0495635_0010729 | 3300046663 | Bacteria | 6417 |
| 635 | Ga0495635_0034972 | 3300046663 | Bacteria | 3484 |
| 636 | Ga0495635_0038913 | 3300046663 | Bacteria | 3292 |
| 637 | Ga0495635_0046693 | 3300046663 | Bacteria | 2987 |
| 638 | Ga0495657_0004896 | 3300046675 | Bacteria | 10661 |
| 639 | Ga0495657_0009780 | 3300046675 | Bacteria | 7239 |
| 640 | Ga0495657_0029808 | 3300046675 | Bacteria | 3825 |
| 641 | Ga0495657_0055518 | 3300046675 | Bacteria | 2641 |
| 642 | Ga0495599_0002162 | 3300046678 | Bacteria | 11421 |
| 643 | Ga0495599_0006221 | 3300046678 | Bacteria | 7195 |
| 644 | Ga0495599_0029504 | 3300046678 | Bacteria | 3439 |
| 645 | Ga0495599_0134784 | 3300046678 | Bacteria | 1533 |
| 646 | Ga0495599_0270710 | 3300046678 | Bacteria | 1031 |
| 647 | Ga0495599_0346641 | 3300046678 | Bacteria | 891 |
| 648 | Ga0495623_0049876 | 3300046679 | Bacteria | 2652 |
| 649 | Ga0495646_0004125 | 3300046680 | Bacteria | 9122 |
| 650 | Ga0495646_0704752 | 3300046680 | Bacteria | 507 |
| 651 | Ga0495658_0002903 | 3300046683 | Bacteria | 8607 |
| 652 | Ga0495613_0124617 | 3300046689 | Bacteria | 1848 |
| 653 | Ga0495624_0067474 | 3300046690 | Bacteria | 2231 |
| 654 | Ga0495600_0016514 | 3300046809 | Bacteria | 4686 |
| 655 | Ga0495600_0029698 | 3300046809 | Bacteria | 3540 |
| 656 | Ga0495600_0042046 | 3300046809 | Bacteria | 2979 |
| 657 | Ga0495600_0701542 | 3300046809 | Bacteria | 609 |
| 658 | Ga0495581_0017527 | 3300047315 | Bacteria | 4160 |
| 659 | Ga0495604_0194675 | 3300047317 | Bacteria | 1410 |
| 660 | Ga0495604_0336861 | 3300047317 | Bacteria | 1005 |
| 661 | Ga0495604_0469798 | 3300047317 | Bacteria | 819 |
| 662 | Ga0495674_0009070 | 3300047319 | Bacteria | 9448 |
| 663 | Ga0495674_0107468 | 3300047319 | Bacteria | 2368 |
| 664 | Ga0495674_0131180 | 3300047319 | Bacteria | 2111 |
| 665 | Ga0495674_0139752 | 3300047319 | Bacteria | 2036 |
| 666 | Ga0495672_0087601 | 3300047320 | Bacteria | 1719 |
| 667 | Ga0495676_0163140 | 3300047321 | Bacteria | 1575 |
| 668 | Ga0495676_0177979 | 3300047321 | Bacteria | 1492 |
| 669 | Ga0495676_0288169 | 3300047321 | Bacteria | 1110 |
| 670 | Ga0495676_0329424 | 3300047321 | Bacteria | 1024 |
| 671 | Ga0495680_0033256 | 3300047322 | Bacteria | 4176 |
| 672 | Ga0495680_0037424 | 3300047322 | Bacteria | 3886 |
| 673 | Ga0495680_0038711 | 3300047322 | Bacteria | 3808 |
| 674 | Ga0495680_0080713 | 3300047322 | Bacteria | 2457 |
| 675 | Ga0495675_0010105 | 3300047444 | Bacteria | 5888 |
| 676 | Ga0495675_0046768 | 3300047444 | Bacteria | 2754 |
| 677 | Ga0495684_0004828 | 3300047471 | Bacteria | 10519 |
| 678 | Ga0495684_0035516 | 3300047471 | Bacteria | 3822 |
| 679 | Ga0495684_0054305 | 3300047471 | Bacteria | 3056 |
| 680 | Ga0495684_0382717 | 3300047471 | Bacteria | 992 |
| 681 | Ga0495684_0625472 | 3300047471 | Bacteria | 723 |
| 682 | Ga0495684_0699345 | 3300047471 | Bacteria | 672 |
| 683 | Ga0495593_0025454 | 3300047673 | Bacteria | 3275 |
| 684 | Ga0495593_0229369 | 3300047673 | Bacteria | 931 |
| 685 | Ga0495602_0030412 | 3300048088 | Bacteria | 5121 |
| 686 | Ga0495602_0366052 | 3300048088 | Bacteria | 1036 |
| 687 | Ga0495614_0003380 | 3300048089 | Bacteria | 7138 |
| 688 | Ga0496100_0220820 | 3300048903 | Bacteria | 1391 |
| 689 | Ga0496101_0021776 | 3300048904 | Bacteria | 4405 |
| 690 | Ga0496101_0485075 | 3300048904 | Bacteria | 976 |
| 691 | Ga0496102_0013321 | 3300048905 | Bacteria | 7122 |
| 692 | Ga0496102_0192269 | 3300048905 | Bacteria | 1923 |
| 693 | Ga0496102_0265710 | 3300048905 | Bacteria | 1618 |
| 694 | Ga0496103_0431403 | 3300048906 | Bacteria | 846 |
| 695 | Ga0496104_0010640 | 3300048907 | Bacteria | 8222 |
| 696 | Ga0496104_0192660 | 3300048907 | Bacteria | 1950 |
| 697 | Ga0496104_0511917 | 3300048907 | Bacteria | 1111 |
| 698 | Ga0496105_0038880 | 3300048908 | Bacteria | 3920 |
| 699 | Ga0496105_0119535 | 3300048908 | Bacteria | 2173 |
| 700 | Ga0496105_0167093 | 3300048908 | Bacteria | 1805 |
| 701 | Ga0496106_0007645 | 3300048909 | Bacteria | 7994 |
| 702 | Ga0496106_0357573 | 3300048909 | Bacteria | 1173 |
| 703 | Ga0496107_0020679 | 3300048910 | Bacteria | 4650 |
| 704 | Ga0496107_1365173 | 3300048910 | Bacteria | 505 |
| 705 | Ga0496108_0014892 | 3300048911 | Bacteria | 6345 |
| 706 | Ga0496108_0065593 | 3300048911 | Bacteria | 3060 |
| 707 | Ga0496108_0156074 | 3300048911 | Bacteria | 1971 |
| 708 | Ga0496109_0005650 | 3300048912 | Bacteria | 10461 |
| 709 | Ga0496109_0032747 | 3300048912 | Bacteria | 4674 |
| 710 | Ga0496109_1502911 | 3300048912 | Bacteria | 608 |
| 711 | Ga0496110_0056972 | 3300048913 | Bacteria | 3439 |
| 712 | Ga0496110_0078225 | 3300048913 | Bacteria | 2944 |
| 713 | Ga0496110_0131709 | 3300048913 | Bacteria | 2258 |
| 714 | Ga0496110_0596667 | 3300048913 | Bacteria | 1002 |
| 715 | Ga0496111_0007464 | 3300048914 | Bacteria | 7170 |
| 716 | Ga0496111_0023645 | 3300048914 | Bacteria | 4317 |
| 717 | Ga0496111_0090752 | 3300048914 | Bacteria | 2238 |
| 718 | Ga0496112_0018081 | 3300048915 | Bacteria | 6632 |
| 719 | Ga0496112_0052633 | 3300048915 | Bacteria | 3996 |
| 720 | Ga0496112_0137016 | 3300048915 | Bacteria | 2418 |
| 721 | Ga0496113_0003643 | 3300048916 | Bacteria | 9263 |
| 722 | Ga0496113_0032280 | 3300048916 | Bacteria | 3806 |
| 723 | Ga0496113_0037236 | 3300048916 | Bacteria | 3568 |
| 724 | Ga0496114_0051179 | 3300048917 | Bacteria | 3438 |
| 725 | Ga0496114_0553956 | 3300048917 | Bacteria | 1016 |
| 726 | Ga0496115_0046842 | 3300048918 | Bacteria | 3457 |
| 727 | Ga0496115_0475254 | 3300048918 | Bacteria | 1007 |
| 728 | Ga0496115_0513593 | 3300048918 | Bacteria | 961 |
| 729 | Ga0496115_0898718 | 3300048918 | Bacteria | 683 |
| 730 | Ga0496115_1235526 | 3300048918 | Bacteria | 560 |
| 731 | Ga0496117_0018305 | 3300048920 | Bacteria | 5809 |
| 732 | Ga0496118_0044420 | 3300048921 | Bacteria | 3479 |
| 733 | Ga0496119_0000437 | 3300048922 | Bacteria | 57106 |
| 734 | Ga0496119_0004896 | 3300048922 | Bacteria | 13098 |
| 735 | Ga0496119_0063237 | 3300048922 | Bacteria | 2202 |
| 736 | Ga0496120_0002152 | 3300048923 | Bacteria | 20990 |
| 737 | Ga0496120_0007258 | 3300048923 | Bacteria | 8286 |
| 738 | Ga0496120_0098451 | 3300048923 | Bacteria | 1550 |
| 739 | Ga0496122_0299869 | 3300048925 | Bacteria | 867 |
| 740 | Ga0496125_0195706 | 3300048928 | Bacteria | 1330 |
| 741 | Ga0496126_0174750 | 3300048929 | Bacteria | 1828 |
| 742 | Ga0496126_0689652 | 3300048929 | Bacteria | 795 |
| 743 | Ga0501036_1274927 | 3300049572 | Bacteria | 598 |
| 744 | Ga0501039_0054886 | 3300049575 | Bacteria | 3085 |
| 745 | Ga0501040_0121832 | 3300049576 | Bacteria | 1830 |
| 746 | Ga0501040_1215653 | 3300049576 | Bacteria | 547 |
| 747 | Ga0501041_0011634 | 3300049577 | Bacteria | 5208 |
| 748 | Ga0501041_0639670 | 3300049577 | Bacteria | 680 |
| 749 | Ga0501042_0040795 | 3300049578 | Bacteria | 3299 |
| 750 | Ga0501068_0289693 | 3300049584 | Bacteria | 1047 |
| 751 | Ga0501068_0296658 | 3300049584 | Bacteria | 1034 |
| 752 | Ga0501071_0012248 | 3300049587 | Bacteria | 5810 |
| 753 | Ga0501072_0171695 | 3300049588 | Bacteria | 1730 |
| 754 | Ga0501075_0119824 | 3300049591 | Bacteria | 2002 |
| 755 | Ga0501076_0004632 | 3300049592 | Bacteria | 9796 |
| 756 | Ga0501079_0262276 | 3300049741 | Bacteria | 1350 |
| 757 | Ga0501081_0111526 | 3300049743 | Bacteria | 1941 |
| 758 | Ga0501045_0194537 | 3300049824 | Bacteria | 1511 |
| 759 | nmdc:mga03683_15919_c1 | 3300050489 | Bacteria | 2816 |
| 760 | nmdc:mga03683_296669_c1 | 3300050489 | Bacteria | 757 |
| 761 | nmdc:mga00v17_349787_c1 | 3300050491 | Bacteria | 961 |
| 762 | nmdc:mga00v17_36919_c1 | 3300050491 | Bacteria | 2915 |
| 763 | nmdc:mga0yw44_4986_c1 | 3300050492 | Bacteria | 6196 |
| 764 | nmdc:mga0k408_529990_c1 | 3300050493 | Bacteria | 697 |
| 765 | nmdc:mga07m45_51214_c1 | 3300050496 | Bacteria | 2328 |
| 766 | nmdc:mga05p37_761729_c1 | 3300050507 | Bacteria | 1065 |
| 767 | nmdc:mga0n895_1963604_c1 | 3300050512 | Bacteria | 543 |
| 768 | nmdc:mga0n895_513311_c1 | 3300050512 | Bacteria | 1206 |
| 769 | nmdc:mga0rr50_702838_c1 | 3300050513 | Bacteria | 863 |
| 770 | nmdc:mga08x19_251138_c1 | 3300050514 | Bacteria | 1221 |
| 771 | nmdc:mga08x19_76191_c1 | 3300050514 | Bacteria | 2194 |
| 772 | nmdc:mga0sz30_70275_c1 | 3300050516 | Bacteria | 1506 |
| 773 | Ga0495601_0044913 | 3300053077 | Bacteria | 2777 |
| 774 | Ga0495601_0110824 | 3300053077 | Bacteria | 1777 |
| 775 | Ga0495601_0272509 | 3300053077 | Bacteria | 1104 |
| 776 | Ga0495612_0016653 | 3300053078 | Bacteria | 2945 |
| 777 | Ga0495612_0114993 | 3300053078 | Bacteria | 1154 |
| 778 | Ga0500635_0001360 | 3300053080 | Bacteria | 5862 |
| 779 | Ga0495595_0053088 | 3300053084 | Bacteria | 1882 |
| 780 | Ga0495595_0132254 | 3300053084 | Bacteria | 1220 |
| 781 | Ga0495619_0005684 | 3300053085 | Bacteria | 7908 |
| 782 | Ga0495619_0325866 | 3300053085 | Bacteria | 1063 |
| 783 | Ga0495619_1123083 | 3300053085 | Bacteria | 522 |
| 784 | Ga0500651_0000251 | 3300053093 | Bacteria | 32614 |
| 785 | Ga0500568_0000031 | 3300053139 | Bacteria | 153522 |
| 786 | Ga0500590_004215 | 3300053148 | Bacteria | 6753 |
| 787 | Ga0500620_000199 | 3300053155 | Bacteria | 12023 |
| 788 | Ga0501084_0116867 | 3300054114 | Bacteria | 2242 |
| 789 | Ga0501082_0135258 | 3300060353 | Bacteria | 2139 |
| 790 | Ga0530510_0288979 | 3300061734 | Bacteria | 1225 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005435 | Ga0070714_100366639 | Ga0070714_1003666391 | 128 |
| 2 | 3300006914 | Ga0075436_100101712 | Ga0075436_1001017122 | 128 |
| 3 | 3300035724 | Ga0373933_0923331 | Ga0373933_0923331_177_563 | 128 |
| 4 | 3300046511 | Ga0495608_0695510 | Ga0495608_0695510_149_535 | 128 |
| 5 | 3300048918 | Ga0496115_1235526 | Ga0496115_1235526_22_459 | 128 |
| 6 | 3300046516 | Ga0495628_1012678 | Ga0495628_1012678_168_557 | 129 |
| 7 | 3300005618 | Ga0068864_101005768 | Ga0068864_1010057682 | 130 |
| 8 | 3300025901 | Ga0207688_11097767 | Ga0207688_110977671 | 130 |
| 9 | 3300025928 | Ga0207700_10459930 | Ga0207700_104599301 | 130 |
| 10 | 3300031852 | Ga0307410_10387660 | Ga0307410_103876603 | 130 |
| 11 | 3300032005 | Ga0307411_11290776 | Ga0307411_112907762 | 130 |
| 12 | 3300035170 | Ga0373943_0526226 | Ga0373943_0526226_25_417 | 130 |
| 13 | 3300037853 | Ga0436364_1041443 | Ga0436364_1041443_3122_3514 | 130 |
| 14 | 3300047320 | Ga0495672_0087601 | Ga0495672_0087601_602_1042 | 130 |
| 15 | 3300048922 | Ga0496119_0004896 | Ga0496119_0004896_4067_4501 | 130 |
| 16 | 3300048923 | Ga0496120_0098451 | Ga0496120_0098451_211_645 | 130 |
| 17 | 3300053084 | Ga0495595_0132254 | Ga0495595_0132254_44_436 | 130 |
| 18 | 3300005436 | Ga0070713_100228102 | Ga0070713_1002281023 | 131 |
| 19 | 3300005439 | Ga0070711_100038693 | Ga0070711_1000386931 | 131 |
| 20 | 3300006175 | Ga0070712_100450425 | Ga0070712_1004504251 | 131 |
| 21 | 3300013105 | Ga0157369_12464517 | Ga0157369_124645171 | 131 |
| 22 | 3300025915 | Ga0207693_10391570 | Ga0207693_103915703 | 131 |
| 23 | 3300025916 | Ga0207663_10062027 | Ga0207663_100620271 | 131 |
| 24 | 3300025928 | Ga0207700_10225561 | Ga0207700_102255613 | 131 |
| 25 | 3300031649 | Ga0307514_10387275 | Ga0307514_103872752 | 131 |
| 26 | 3300031889 | Ga0326468_10000782 | Ga0326468_100007824 | 131 |
| 27 | 3300042438 | Ga0439459_0101830 | Ga0439459_0101830_65_502 | 131 |
| 28 | 3300048904 | Ga0496101_0021776 | Ga0496101_0021776_3931_4368 | 131 |
| 29 | 3300048907 | Ga0496104_0511917 | Ga0496104_0511917_227_664 | 131 |
| 30 | 3300048908 | Ga0496105_0119535 | Ga0496105_0119535_553_990 | 131 |
| 31 | 3300048909 | Ga0496106_0357573 | Ga0496106_0357573_621_1058 | 131 |
| 32 | 3300048910 | Ga0496107_1365173 | Ga0496107_1365173_25_462 | 131 |
| 33 | 3300048912 | Ga0496109_0032747 | Ga0496109_0032747_1121_1558 | 131 |
| 34 | 3300048913 | Ga0496110_0056972 | Ga0496110_0056972_2162_2599 | 131 |
| 35 | 3300048914 | Ga0496111_0090752 | Ga0496111_0090752_1122_1559 | 131 |
| 36 | 3300048916 | Ga0496113_0032280 | Ga0496113_0032280_45_482 | 131 |
| 37 | 3300048920 | Ga0496117_0018305 | Ga0496117_0018305_1986_2423 | 131 |
| 38 | 3300048921 | Ga0496118_0044420 | Ga0496118_0044420_370_807 | 131 |
| 39 | 3300048922 | Ga0496119_0000437 | Ga0496119_0000437_9691_10128 | 131 |
| 40 | 3300048922 | Ga0496119_0063237 | Ga0496119_0063237_811_1248 | 131 |
| 41 | 3300048923 | Ga0496120_0002152 | Ga0496120_0002152_2425_2862 | 131 |
| 42 | 3300053093 | Ga0500651_0000251 | Ga0500651_0000251_18435_18872 | 131 |
| 43 | 3300053148 | Ga0500590_004215 | Ga0500590_004215_902_1339 | 131 |
| 44 | 3300053155 | Ga0500620_000199 | Ga0500620_000199_7075_7512 | 131 |
| 45 | iso_pu_bacteria | 2791354901 | 2791911791 | 131 |
| 46 | 3300005327 | Ga0070658_10011102 | Ga0070658_100111025 | 132 |
| 47 | 3300005327 | Ga0070658_10026589 | Ga0070658_100265893 | 132 |
| 48 | 3300005329 | Ga0070683_100058012 | Ga0070683_1000580125 | 132 |
| 49 | 3300005337 | Ga0070682_100194670 | Ga0070682_1001946702 | 132 |
| 50 | 3300005338 | Ga0068868_100116827 | Ga0068868_1001168272 | 132 |
| 51 | 3300005339 | Ga0070660_100053561 | Ga0070660_1000535614 | 132 |
| 52 | 3300005341 | Ga0070691_10101240 | Ga0070691_101012403 | 132 |
| 53 | 3300005366 | Ga0070659_100003309 | Ga0070659_1000033093 | 132 |
| 54 | 3300005367 | Ga0070667_100498144 | Ga0070667_1004981441 | 132 |
| 55 | 3300005434 | Ga0070709_10012138 | Ga0070709_100121383 | 132 |
| 56 | 3300005435 | Ga0070714_100406691 | Ga0070714_1004066912 | 132 |
| 57 | 3300005436 | Ga0070713_100446993 | Ga0070713_1004469933 | 132 |
| 58 | 3300005437 | Ga0070710_10214185 | Ga0070710_102141853 | 132 |
| 59 | 3300005439 | Ga0070711_100126962 | Ga0070711_1001269622 | 132 |
| 60 | 3300005440 | Ga0070705_100785918 | Ga0070705_1007859181 | 132 |
| 61 | 3300005445 | Ga0070708_101012003 | Ga0070708_1010120032 | 132 |
| 62 | 3300005445 | Ga0070708_101329652 | Ga0070708_1013296522 | 132 |
| 63 | 3300005458 | Ga0070681_10852618 | Ga0070681_108526181 | 132 |
| 64 | 3300005466 | Ga0070685_10012830 | Ga0070685_100128304 | 132 |
| 65 | 3300005467 | Ga0070706_102052535 | Ga0070706_1020525351 | 132 |
| 66 | 3300005468 | Ga0070707_100031696 | Ga0070707_1000316963 | 132 |
| 67 | 3300005468 | Ga0070707_100084253 | Ga0070707_1000842533 | 132 |
| 68 | 3300005535 | Ga0070684_100167382 | Ga0070684_1001673824 | 132 |
| 69 | 3300005539 | Ga0068853_100043867 | Ga0068853_1000438673 | 132 |
| 70 | 3300005539 | Ga0068853_100354901 | Ga0068853_1003549012 | 132 |
| 71 | 3300005543 | Ga0070672_100004844 | Ga0070672_1000048447 | 132 |
| 72 | 3300005545 | Ga0070695_100080131 | Ga0070695_1000801311 | 132 |
| 73 | 3300005563 | Ga0068855_100039781 | Ga0068855_1000397813 | 132 |
| 74 | 3300005563 | Ga0068855_100059365 | Ga0068855_1000593652 | 132 |
| 75 | 3300005563 | Ga0068855_100152689 | Ga0068855_1001526891 | 132 |
| 76 | 3300005563 | Ga0068855_100710553 | Ga0068855_1007105532 | 132 |
| 77 | 3300005563 | Ga0068855_100920397 | Ga0068855_1009203972 | 132 |
| 78 | 3300005563 | Ga0068855_100998174 | Ga0068855_1009981742 | 132 |
| 79 | 3300005563 | Ga0068855_101588384 | Ga0068855_1015883841 | 132 |
| 80 | 3300005577 | Ga0068857_100567863 | Ga0068857_1005678632 | 132 |
| 81 | 3300005578 | Ga0068854_100104518 | Ga0068854_1001045183 | 132 |
| 82 | 3300005614 | Ga0068856_100229775 | Ga0068856_1002297752 | 132 |
| 83 | 3300005614 | Ga0068856_100375624 | Ga0068856_1003756242 | 132 |
| 84 | 3300005614 | Ga0068856_100535489 | Ga0068856_1005354892 | 132 |
| 85 | 3300005616 | Ga0068852_100003105 | Ga0068852_10000310512 | 132 |
| 86 | 3300005616 | Ga0068852_100008277 | Ga0068852_1000082773 | 132 |
| 87 | 3300005616 | Ga0068852_100026637 | Ga0068852_1000266373 | 132 |
| 88 | 3300005618 | Ga0068864_100143486 | Ga0068864_1001434863 | 132 |
| 89 | 3300005618 | Ga0068864_100449985 | Ga0068864_1004499852 | 132 |
| 90 | 3300005834 | Ga0068851_10000022 | Ga0068851_1000002261 | 132 |
| 91 | 3300005841 | Ga0068863_100120547 | Ga0068863_1001205472 | 132 |
| 92 | 3300005842 | Ga0068858_100001116 | Ga0068858_10000111627 | 132 |
| 93 | 3300005842 | Ga0068858_100074709 | Ga0068858_1000747094 | 132 |
| 94 | 3300006028 | Ga0070717_10035435 | Ga0070717_100354355 | 132 |
| 95 | 3300006028 | Ga0070717_10385980 | Ga0070717_103859802 | 132 |
| 96 | 3300006028 | Ga0070717_10470318 | Ga0070717_104703182 | 132 |
| 97 | 3300006028 | Ga0070717_10518274 | Ga0070717_105182741 | 132 |
| 98 | 3300006042 | Ga0075368_10012045 | Ga0075368_100120453 | 132 |
| 99 | 3300006048 | Ga0075363_100166099 | Ga0075363_1001660991 | 132 |
| 100 | 3300006051 | Ga0075364_10002703 | Ga0075364_100027036 | 132 |
| 101 | 3300006177 | Ga0075362_10004700 | Ga0075362_100047004 | 132 |
| 102 | 3300006178 | Ga0075367_10078886 | Ga0075367_100788862 | 132 |
| 103 | 3300006186 | Ga0075369_10075638 | Ga0075369_100756382 | 132 |
| 104 | 3300006195 | Ga0075366_11068811 | Ga0075366_110688111 | 132 |
| 105 | 3300006237 | Ga0097621_100062056 | Ga0097621_1000620564 | 132 |
| 106 | 3300006353 | Ga0075370_10060147 | Ga0075370_100601472 | 132 |
| 107 | 3300009011 | Ga0105251_10209704 | Ga0105251_102097042 | 132 |
| 108 | 3300009093 | Ga0105240_10133676 | Ga0105240_101336763 | 132 |
| 109 | 3300009093 | Ga0105240_11476147 | Ga0105240_114761472 | 132 |
| 110 | 3300009098 | Ga0105245_10000706 | Ga0105245_1000070626 | 132 |
| 111 | 3300009098 | Ga0105245_10090349 | Ga0105245_100903496 | 132 |
| 112 | 3300009098 | Ga0105245_10158321 | Ga0105245_101583212 | 132 |
| 113 | 3300009098 | Ga0105245_10183085 | Ga0105245_101830853 | 132 |
| 114 | 3300009101 | Ga0105247_10259565 | Ga0105247_102595652 | 132 |
| 115 | 3300009101 | Ga0105247_10801417 | Ga0105247_108014171 | 132 |
| 116 | 3300009177 | Ga0105248_10007015 | Ga0105248_1000701513 | 132 |
| 117 | 3300009177 | Ga0105248_10143855 | Ga0105248_101438553 | 132 |
| 118 | 3300009177 | Ga0105248_10640833 | Ga0105248_106408332 | 132 |
| 119 | 3300009177 | Ga0105248_11532264 | Ga0105248_115322642 | 132 |
| 120 | 3300009545 | Ga0105237_10006825 | Ga0105237_1000682513 | 132 |
| 121 | 3300009545 | Ga0105237_10120034 | Ga0105237_101200342 | 132 |
| 122 | 3300009545 | Ga0105237_10130352 | Ga0105237_101303523 | 132 |
| 123 | 3300009545 | Ga0105237_10141667 | Ga0105237_101416673 | 132 |
| 124 | 3300009551 | Ga0105238_10237359 | Ga0105238_102373593 | 132 |
| 125 | 3300009551 | Ga0105238_10528545 | Ga0105238_105285452 | 132 |
| 126 | 3300009551 | Ga0105238_10631771 | Ga0105238_106317712 | 132 |
| 127 | 3300010375 | Ga0105239_11304206 | Ga0105239_113042062 | 132 |
| 128 | 3300010375 | Ga0105239_12666950 | Ga0105239_126669501 | 132 |
| 129 | 3300011119 | Ga0105246_11086745 | Ga0105246_110867452 | 132 |
| 130 | 3300013104 | Ga0157370_10104826 | Ga0157370_101048263 | 132 |
| 131 | 3300013105 | Ga0157369_10867909 | Ga0157369_108679092 | 132 |
| 132 | 3300013296 | Ga0157374_10004488 | Ga0157374_100044886 | 132 |
| 133 | 3300013297 | Ga0157378_10432756 | Ga0157378_104327563 | 132 |
| 134 | 3300013308 | Ga0157375_10073093 | Ga0157375_100730937 | 132 |
| 135 | 3300014325 | Ga0163163_10041656 | Ga0163163_100416562 | 132 |
| 136 | 3300014325 | Ga0163163_10236854 | Ga0163163_102368541 | 132 |
| 137 | 3300014745 | Ga0157377_10074609 | Ga0157377_100746091 | 132 |
| 138 | 3300014968 | Ga0157379_10225546 | Ga0157379_102255463 | 132 |
| 139 | 3300014968 | Ga0157379_11343369 | Ga0157379_113433692 | 132 |
| 140 | 3300020075 | Ga0206349_1237185 | Ga0206349_12371851 | 132 |
| 141 | 3300020077 | Ga0206351_10140329 | Ga0206351_101403291 | 132 |
| 142 | 3300025321 | Ga0207656_10000005 | Ga0207656_10000005323 | 132 |
| 143 | 3300025898 | Ga0207692_10029315 | Ga0207692_100293152 | 132 |
| 144 | 3300025900 | Ga0207710_10317826 | Ga0207710_103178261 | 132 |
| 145 | 3300025906 | Ga0207699_10110172 | Ga0207699_101101722 | 132 |
| 146 | 3300025908 | Ga0207643_10546382 | Ga0207643_105463822 | 132 |
| 147 | 3300025909 | Ga0207705_10021383 | Ga0207705_100213831 | 132 |
| 148 | 3300025909 | Ga0207705_10044976 | Ga0207705_100449764 | 132 |
| 149 | 3300025910 | Ga0207684_11587885 | Ga0207684_115878851 | 132 |
| 150 | 3300025913 | Ga0207695_10010059 | Ga0207695_100100597 | 132 |
| 151 | 3300025913 | Ga0207695_10012911 | Ga0207695_100129112 | 132 |
| 152 | 3300025913 | Ga0207695_10098913 | Ga0207695_100989133 | 132 |
| 153 | 3300025914 | Ga0207671_10000016 | Ga0207671_10000016137 | 132 |
| 154 | 3300025914 | Ga0207671_10060170 | Ga0207671_100601704 | 132 |
| 155 | 3300025914 | Ga0207671_10090023 | Ga0207671_100900233 | 132 |
| 156 | 3300025914 | Ga0207671_10129424 | Ga0207671_101294242 | 132 |
| 157 | 3300025919 | Ga0207657_10006398 | Ga0207657_1000639813 | 132 |
| 158 | 3300025920 | Ga0207649_10025508 | Ga0207649_100255082 | 132 |
| 159 | 3300025921 | Ga0207652_10896704 | Ga0207652_108967042 | 132 |
| 160 | 3300025922 | Ga0207646_10153104 | Ga0207646_101531042 | 132 |
| 161 | 3300025924 | Ga0207694_10000057 | Ga0207694_1000005777 | 132 |
| 162 | 3300025924 | Ga0207694_10130249 | Ga0207694_101302491 | 132 |
| 163 | 3300025927 | Ga0207687_10466516 | Ga0207687_104665162 | 132 |
| 164 | 3300025929 | Ga0207664_10037876 | Ga0207664_100378762 | 132 |
| 165 | 3300025931 | Ga0207644_10852022 | Ga0207644_108520222 | 132 |
| 166 | 3300025932 | Ga0207690_10000329 | Ga0207690_1000032919 | 132 |
| 167 | 3300025939 | Ga0207665_10083781 | Ga0207665_100837813 | 132 |
| 168 | 3300025940 | Ga0207691_10029904 | Ga0207691_100299043 | 132 |
| 169 | 3300025941 | Ga0207711_10006065 | Ga0207711_100060652 | 132 |
| 170 | 3300025941 | Ga0207711_10069492 | Ga0207711_100694923 | 132 |
| 171 | 3300025941 | Ga0207711_10486200 | Ga0207711_104862002 | 132 |
| 172 | 3300025941 | Ga0207711_10517086 | Ga0207711_105170862 | 132 |
| 173 | 3300025949 | Ga0207667_10008226 | Ga0207667_100082264 | 132 |
| 174 | 3300025949 | Ga0207667_10031365 | Ga0207667_100313652 | 132 |
| 175 | 3300025949 | Ga0207667_10198511 | Ga0207667_101985112 | 132 |
| 176 | 3300025949 | Ga0207667_10259833 | Ga0207667_102598332 | 132 |
| 177 | 3300025949 | Ga0207667_10294176 | Ga0207667_102941762 | 132 |
| 178 | 3300025981 | Ga0207640_10037102 | Ga0207640_100371023 | 132 |
| 179 | 3300025986 | Ga0207658_10047398 | Ga0207658_100473982 | 132 |
| 180 | 3300026035 | Ga0207703_10003158 | Ga0207703_100031586 | 132 |
| 181 | 3300026035 | Ga0207703_10163815 | Ga0207703_101638153 | 132 |
| 182 | 3300026041 | Ga0207639_10019021 | Ga0207639_100190213 | 132 |
| 183 | 3300026041 | Ga0207639_10230284 | Ga0207639_102302842 | 132 |
| 184 | 3300026078 | Ga0207702_10202816 | Ga0207702_102028162 | 132 |
| 185 | 3300026078 | Ga0207702_10218380 | Ga0207702_102183802 | 132 |
| 186 | 3300026078 | Ga0207702_10346309 | Ga0207702_103463092 | 132 |
| 187 | 3300026078 | Ga0207702_10560487 | Ga0207702_105604872 | 132 |
| 188 | 3300026088 | Ga0207641_10072919 | Ga0207641_100729192 | 132 |
| 189 | 3300026088 | Ga0207641_10449813 | Ga0207641_104498132 | 132 |
| 190 | 3300026088 | Ga0207641_10779048 | Ga0207641_107790482 | 132 |
| 191 | 3300026095 | Ga0207676_10294870 | Ga0207676_102948702 | 132 |
| 192 | 3300026095 | Ga0207676_10540144 | Ga0207676_105401442 | 132 |
| 193 | 3300026116 | Ga0207674_10007743 | Ga0207674_1000774313 | 132 |
| 194 | 3300026116 | Ga0207674_10037100 | Ga0207674_100371005 | 132 |
| 195 | 3300026142 | Ga0207698_10002133 | Ga0207698_1000213312 | 132 |
| 196 | 3300026142 | Ga0207698_10009907 | Ga0207698_100099073 | 132 |
| 197 | 3300028379 | Ga0268266_10251511 | Ga0268266_102515113 | 132 |
| 198 | 3300028381 | Ga0268264_10701688 | Ga0268264_107016881 | 132 |
| 199 | 3300028794 | Ga0307515_10645269 | Ga0307515_106452692 | 132 |
| 200 | 3300028800 | Ga0265338_10001315 | Ga0265338_1000131514 | 132 |
| 201 | 3300031241 | Ga0265325_10005629 | Ga0265325_100056299 | 132 |
| 202 | 3300031242 | Ga0265329_10035092 | Ga0265329_100350922 | 132 |
| 203 | 3300031249 | Ga0265339_10003540 | Ga0265339_100035405 | 132 |
| 204 | 3300031250 | Ga0265331_10018260 | Ga0265331_100182603 | 132 |
| 205 | 3300031251 | Ga0265327_10061537 | Ga0265327_100615373 | 132 |
| 206 | 3300031344 | Ga0265316_10297347 | Ga0265316_102973472 | 132 |
| 207 | 3300031595 | Ga0265313_10001049 | Ga0265313_1000104914 | 132 |
| 208 | 3300031691 | Ga0316579_10233587 | Ga0316579_102335872 | 132 |
| 209 | 3300031711 | Ga0265314_10132054 | Ga0265314_101320542 | 132 |
| 210 | 3300031727 | Ga0316576_10002554 | Ga0316576_100025542 | 132 |
| 211 | 3300031727 | Ga0316576_10141687 | Ga0316576_101416872 | 132 |
| 212 | 3300031728 | Ga0316578_10000611 | Ga0316578_1000061110 | 132 |
| 213 | 3300031728 | Ga0316578_10014573 | Ga0316578_100145732 | 132 |
| 214 | 3300031995 | Ga0307409_100679557 | Ga0307409_1006795571 | 132 |
| 215 | 3300031995 | Ga0307409_101225154 | Ga0307409_1012251542 | 132 |
| 216 | 3300032139 | Ga0316580_10078666 | Ga0316580_100786662 | 132 |
| 217 | 3300035691 | Ga0373931_0298768 | Ga0373931_0298768_13_411 | 132 |
| 218 | 3300036712 | Ga0316584_0263991 | Ga0316584_0263991_208_648 | 132 |
| 219 | 3300036712 | Ga0316584_0341491 | Ga0316584_0341491_365_808 | 132 |
| 220 | 3300039450 | Ga0436363_0114807 | Ga0436363_0114807_557_997 | 132 |
| 221 | 3300041463 | Ga0451804_1026453 | Ga0451804_1026453_30_479 | 132 |
| 222 | 3300044735 | Ga0466968_0261127 | Ga0466968_0261127_32_493 | 132 |
| 223 | 3300045976 | Ga0466967_0901860 | Ga0466967_0901860_189_656 | 132 |
| 224 | 3300048903 | Ga0496100_0220820 | Ga0496100_0220820_189_629 | 132 |
| 225 | 3300048904 | Ga0496101_0485075 | Ga0496101_0485075_521_961 | 132 |
| 226 | 3300048905 | Ga0496102_0192269 | Ga0496102_0192269_1363_1803 | 132 |
| 227 | 3300048905 | Ga0496102_0265710 | Ga0496102_0265710_403_843 | 132 |
| 228 | 3300048907 | Ga0496104_0192660 | Ga0496104_0192660_382_822 | 132 |
| 229 | 3300048908 | Ga0496105_0167093 | Ga0496105_0167093_550_990 | 132 |
| 230 | 3300048911 | Ga0496108_0065593 | Ga0496108_0065593_1938_2378 | 132 |
| 231 | 3300048913 | Ga0496110_0078225 | Ga0496110_0078225_382_822 | 132 |
| 232 | 3300048914 | Ga0496111_0023645 | Ga0496111_0023645_1942_2382 | 132 |
| 233 | 3300048916 | Ga0496113_0037236 | Ga0496113_0037236_1651_2091 | 132 |
| 234 | 3300048917 | Ga0496114_0553956 | Ga0496114_0553956_177_617 | 132 |
| 235 | 3300048918 | Ga0496115_0475254 | Ga0496115_0475254_489_929 | 132 |
| 236 | 3300048923 | Ga0496120_0007258 | Ga0496120_0007258_7021_7470 | 132 |
| 237 | 3300048925 | Ga0496122_0299869 | Ga0496122_0299869_173_619 | 132 |
| 238 | 3300048928 | Ga0496125_0195706 | Ga0496125_0195706_786_1235 | 132 |
| 239 | 3300048929 | Ga0496126_0174750 | Ga0496126_0174750_1141_1590 | 132 |
| 240 | 3300048929 | Ga0496126_0689652 | Ga0496126_0689652_183_632 | 132 |
| 241 | 3300049575 | Ga0501039_0054886 | Ga0501039_0054886_2049_2492 | 132 |
| 242 | 3300049576 | Ga0501040_0121832 | Ga0501040_0121832_676_1119 | 132 |
| 243 | 3300049577 | Ga0501041_0011634 | Ga0501041_0011634_1942_2385 | 132 |
| 244 | 3300049577 | Ga0501041_0639670 | Ga0501041_0639670_229_669 | 132 |
| 245 | 3300049578 | Ga0501042_0040795 | Ga0501042_0040795_2463_2906 | 132 |
| 246 | 3300049584 | Ga0501068_0289693 | Ga0501068_0289693_343_786 | 132 |
| 247 | 3300049584 | Ga0501068_0296658 | Ga0501068_0296658_583_1023 | 132 |
| 248 | 3300049587 | Ga0501071_0012248 | Ga0501071_0012248_3539_3982 | 132 |
| 249 | 3300049588 | Ga0501072_0171695 | Ga0501072_0171695_1156_1599 | 132 |
| 250 | 3300049591 | Ga0501075_0119824 | Ga0501075_0119824_452_895 | 132 |
| 251 | 3300049592 | Ga0501076_0004632 | Ga0501076_0004632_2421_2864 | 132 |
| 252 | 3300049741 | Ga0501079_0262276 | Ga0501079_0262276_484_927 | 132 |
| 253 | 3300049743 | Ga0501081_0111526 | Ga0501081_0111526_1180_1623 | 132 |
| 254 | 3300049824 | Ga0501045_0194537 | Ga0501045_0194537_30_473 | 132 |
| 255 | 3300050489 | nmdc:mga03683_15919_c1 | nmdc:mga03683_15919_c1_1899_2342 | 132 |
| 256 | 3300050491 | nmdc:mga00v17_36919_c1 | nmdc:mga00v17_36919_c1_994_1437 | 132 |
| 257 | 3300050492 | nmdc:mga0yw44_4986_c1 | nmdc:mga0yw44_4986_c1_4275_4718 | 132 |
| 258 | 3300050493 | nmdc:mga0k408_529990_c1 | nmdc:mga0k408_529990_c1_173_616 | 132 |
| 259 | 3300050496 | nmdc:mga07m45_51214_c1 | nmdc:mga07m45_51214_c1_839_1282 | 132 |
| 260 | 3300050516 | nmdc:mga0sz30_70275_c1 | nmdc:mga0sz30_70275_c1_125_568 | 132 |
| 261 | 3300053080 | Ga0500635_0001360 | Ga0500635_0001360_2936_3385 | 132 |
| 262 | 3300054114 | Ga0501084_0116867 | Ga0501084_0116867_1058_1501 | 132 |
| 263 | 3300060353 | Ga0501082_0135258 | Ga0501082_0135258_804_1247 | 132 |
| 264 | 3300061734 | Ga0530510_0288979 | Ga0530510_0288979_596_1039 | 132 |
| 265 | iso_pu_bacteria | 8004212874 | 8004213434 | 132 |
| 266 | 3300005336 | Ga0070680_100022387 | Ga0070680_1000223874 | 133 |
| 267 | 3300005337 | Ga0070682_100174812 | Ga0070682_1001748122 | 133 |
| 268 | 3300005347 | Ga0070668_100153728 | Ga0070668_1001537281 | 133 |
| 269 | 3300005366 | Ga0070659_100137804 | Ga0070659_1001378042 | 133 |
| 270 | 3300005435 | Ga0070714_100070947 | Ga0070714_1000709475 | 133 |
| 271 | 3300005458 | Ga0070681_10014657 | Ga0070681_100146576 | 133 |
| 272 | 3300005458 | Ga0070681_10445347 | Ga0070681_104453471 | 133 |
| 273 | 3300005467 | Ga0070706_101046923 | Ga0070706_1010469231 | 133 |
| 274 | 3300005530 | Ga0070679_100022981 | Ga0070679_1000229814 | 133 |
| 275 | 3300005614 | Ga0068856_100884666 | Ga0068856_1008846662 | 133 |
| 276 | 3300005719 | Ga0068861_100482793 | Ga0068861_1004827933 | 133 |
| 277 | 3300005844 | Ga0068862_100219957 | Ga0068862_1002199572 | 133 |
| 278 | 3300006028 | Ga0070717_10697597 | Ga0070717_106975972 | 133 |
| 279 | 3300006028 | Ga0070717_11227964 | Ga0070717_112279641 | 133 |
| 280 | 3300006881 | Ga0068865_101513678 | Ga0068865_1015136781 | 133 |
| 281 | 3300009147 | Ga0114129_10546506 | Ga0114129_105465062 | 133 |
| 282 | 3300011119 | Ga0105246_10696032 | Ga0105246_106960322 | 133 |
| 283 | 3300013104 | Ga0157370_10846693 | Ga0157370_108466932 | 133 |
| 284 | 3300013105 | Ga0157369_10193971 | Ga0157369_101939712 | 133 |
| 285 | 3300013297 | Ga0157378_11921530 | Ga0157378_119215301 | 133 |
| 286 | 3300020069 | Ga0197907_10450287 | Ga0197907_104502873 | 133 |
| 287 | 3300020070 | Ga0206356_10083308 | Ga0206356_100833082 | 133 |
| 288 | 3300020075 | Ga0206349_1762186 | Ga0206349_17621862 | 133 |
| 289 | 3300020076 | Ga0206355_1500103 | Ga0206355_15001032 | 133 |
| 290 | 3300020077 | Ga0206351_10704597 | Ga0206351_107045971 | 133 |
| 291 | 3300020078 | Ga0206352_10807676 | Ga0206352_108076762 | 133 |
| 292 | 3300020080 | Ga0206350_10990203 | Ga0206350_109902032 | 133 |
| 293 | 3300020080 | Ga0206350_11205897 | Ga0206350_112058973 | 133 |
| 294 | 3300020081 | Ga0206354_11069328 | Ga0206354_110693282 | 133 |
| 295 | 3300020610 | Ga0154015_1348326 | Ga0154015_13483261 | 133 |
| 296 | 3300021384 | Ga0213876_10040496 | Ga0213876_100404963 | 133 |
| 297 | 3300022467 | Ga0224712_10019923 | Ga0224712_100199233 | 133 |
| 298 | 3300022467 | Ga0224712_10123937 | Ga0224712_101239372 | 133 |
| 299 | 3300022734 | Ga0224571_107138 | Ga0224571_1071381 | 133 |
| 300 | 3300024225 | Ga0224572_1000558 | Ga0224572_10005583 | 133 |
| 301 | 3300024227 | Ga0228598_1023934 | Ga0228598_10239342 | 133 |
| 302 | 3300025910 | Ga0207684_10678155 | Ga0207684_106781552 | 133 |
| 303 | 3300025910 | Ga0207684_11047849 | Ga0207684_110478491 | 133 |
| 304 | 3300025912 | Ga0207707_10007656 | Ga0207707_100076564 | 133 |
| 305 | 3300025912 | Ga0207707_10033930 | Ga0207707_100339302 | 133 |
| 306 | 3300025917 | Ga0207660_10015428 | Ga0207660_100154284 | 133 |
| 307 | 3300025921 | Ga0207652_10140846 | Ga0207652_101408462 | 133 |
| 308 | 3300025929 | Ga0207664_10135856 | Ga0207664_101358563 | 133 |
| 309 | 3300025929 | Ga0207664_10166146 | Ga0207664_101661463 | 133 |
| 310 | 3300026078 | Ga0207702_10796466 | Ga0207702_107964662 | 133 |
| 311 | 3300026118 | Ga0207675_100033506 | Ga0207675_1000335067 | 133 |
| 312 | 3300028380 | Ga0268265_10197181 | Ga0268265_101971812 | 133 |
| 313 | 3300031090 | Ga0265760_10014959 | Ga0265760_100149592 | 133 |
| 314 | 3300031595 | Ga0265313_10018284 | Ga0265313_100182841 | 133 |
| 315 | 3300035114 | Ga0373939_0231670 | Ga0373939_0231670_99_545 | 133 |
| 316 | 3300037853 | Ga0436364_1334594 | Ga0436364_1334594_6054_6500 | 133 |
| 317 | 3300039437 | Ga0436365_0112287 | Ga0436365_0112287_23067_23513 | 133 |
| 318 | 3300039453 | Ga0436362_0480976 | Ga0436362_0480976_192_638 | 133 |
| 319 | 3300039453 | Ga0436362_0802298 | Ga0436362_0802298_54_497 | 133 |
| 320 | 3300041452 | Ga0451793_0975550 | Ga0451793_0975550_69_515 | 133 |
| 321 | 3300042005 | Ga0439448_0169593 | Ga0439448_0169593_159_602 | 133 |
| 322 | 3300044658 | Ga0466972_0246077 | Ga0466972_0246077_108_557 | 133 |
| 323 | 3300046459 | Ga0495629_0746502 | Ga0495629_0746502_38_481 | 133 |
| 324 | 3300048918 | Ga0496115_0513593 | Ga0496115_0513593_30_497 | 133 |
| 325 | 3300049576 | Ga0501040_1215653 | Ga0501040_1215653_16_465 | 133 |
| 326 | 3300050489 | nmdc:mga03683_296669_c1 | nmdc:mga03683_296669_c1_20_466 | 133 |
| 327 | 3300050491 | nmdc:mga00v17_349787_c1 | nmdc:mga00v17_349787_c1_224_670 | 133 |
| 328 | 3300050507 | nmdc:mga05p37_761729_c1 | nmdc:mga05p37_761729_c1_131_577 | 133 |
| 329 | 3300001979 | JGI24740J21852_10130550 | JGI24740J21852_101305501 | 134 |
| 330 | 3300005328 | Ga0070676_11131792 | Ga0070676_111317921 | 134 |
| 331 | 3300005329 | Ga0070683_100033200 | Ga0070683_1000332005 | 134 |
| 332 | 3300005331 | Ga0070670_100782366 | Ga0070670_1007823662 | 134 |
| 333 | 3300005334 | Ga0068869_100008663 | Ga0068869_1000086635 | 134 |
| 334 | 3300005337 | Ga0070682_100006527 | Ga0070682_1000065275 | 134 |
| 335 | 3300005338 | Ga0068868_100040660 | Ga0068868_1000406603 | 134 |
| 336 | 3300005340 | Ga0070689_100333647 | Ga0070689_1003336472 | 134 |
| 337 | 3300005341 | Ga0070691_10005725 | Ga0070691_100057254 | 134 |
| 338 | 3300005343 | Ga0070687_100122072 | Ga0070687_1001220722 | 134 |
| 339 | 3300005353 | Ga0070669_101205879 | Ga0070669_1012058791 | 134 |
| 340 | 3300005355 | Ga0070671_100113797 | Ga0070671_1001137973 | 134 |
| 341 | 3300005355 | Ga0070671_101588414 | Ga0070671_1015884141 | 134 |
| 342 | 3300005356 | Ga0070674_100072492 | Ga0070674_1000724922 | 134 |
| 343 | 3300005366 | Ga0070659_100211412 | Ga0070659_1002114122 | 134 |
| 344 | 3300005367 | Ga0070667_100172333 | Ga0070667_1001723332 | 134 |
| 345 | 3300005434 | Ga0070709_10004900 | Ga0070709_100049003 | 134 |
| 346 | 3300005434 | Ga0070709_10015872 | Ga0070709_100158723 | 134 |
| 347 | 3300005434 | Ga0070709_10121606 | Ga0070709_101216062 | 134 |
| 348 | 3300005434 | Ga0070709_10131973 | Ga0070709_101319731 | 134 |
| 349 | 3300005435 | Ga0070714_100038387 | Ga0070714_1000383871 | 134 |
| 350 | 3300005435 | Ga0070714_100189514 | Ga0070714_1001895142 | 134 |
| 351 | 3300005435 | Ga0070714_100316472 | Ga0070714_1003164722 | 134 |
| 352 | 3300005435 | Ga0070714_100424497 | Ga0070714_1004244972 | 134 |
| 353 | 3300005435 | Ga0070714_100443839 | Ga0070714_1004438392 | 134 |
| 354 | 3300005435 | Ga0070714_100581271 | Ga0070714_1005812712 | 134 |
| 355 | 3300005435 | Ga0070714_100736574 | Ga0070714_1007365742 | 134 |
| 356 | 3300005436 | Ga0070713_100705383 | Ga0070713_1007053832 | 134 |
| 357 | 3300005437 | Ga0070710_10004524 | Ga0070710_100045243 | 134 |
| 358 | 3300005437 | Ga0070710_10018559 | Ga0070710_100185595 | 134 |
| 359 | 3300005437 | Ga0070710_10028884 | Ga0070710_100288843 | 134 |
| 360 | 3300005437 | Ga0070710_10224158 | Ga0070710_102241582 | 134 |
| 361 | 3300005439 | Ga0070711_100037903 | Ga0070711_1000379033 | 134 |
| 362 | 3300005439 | Ga0070711_100069160 | Ga0070711_1000691604 | 134 |
| 363 | 3300005439 | Ga0070711_100072683 | Ga0070711_1000726833 | 134 |
| 364 | 3300005440 | Ga0070705_100009830 | Ga0070705_1000098305 | 134 |
| 365 | 3300005440 | Ga0070705_100152954 | Ga0070705_1001529542 | 134 |
| 366 | 3300005444 | Ga0070694_101044058 | Ga0070694_1010440581 | 134 |
| 367 | 3300005445 | Ga0070708_100002254 | Ga0070708_1000022545 | 134 |
| 368 | 3300005445 | Ga0070708_100116448 | Ga0070708_1001164483 | 134 |
| 369 | 3300005445 | Ga0070708_100379605 | Ga0070708_1003796052 | 134 |
| 370 | 3300005455 | Ga0070663_100045037 | Ga0070663_1000450373 | 134 |
| 371 | 3300005456 | Ga0070678_100006821 | Ga0070678_1000068215 | 134 |
| 372 | 3300005457 | Ga0070662_100877479 | Ga0070662_1008774792 | 134 |
| 373 | 3300005458 | Ga0070681_11094482 | Ga0070681_110944822 | 134 |
| 374 | 3300005459 | Ga0068867_100168391 | Ga0068867_1001683913 | 134 |
| 375 | 3300005466 | Ga0070685_10083761 | Ga0070685_100837612 | 134 |
| 376 | 3300005467 | Ga0070706_100053612 | Ga0070706_1000536122 | 134 |
| 377 | 3300005467 | Ga0070706_100053853 | Ga0070706_1000538532 | 134 |
| 378 | 3300005467 | Ga0070706_100194792 | Ga0070706_1001947922 | 134 |
| 379 | 3300005467 | Ga0070706_100407939 | Ga0070706_1004079392 | 134 |
| 380 | 3300005467 | Ga0070706_100845864 | Ga0070706_1008458642 | 134 |
| 381 | 3300005468 | Ga0070707_100045570 | Ga0070707_1000455704 | 134 |
| 382 | 3300005468 | Ga0070707_100066233 | Ga0070707_1000662332 | 134 |
| 383 | 3300005471 | Ga0070698_100107441 | Ga0070698_1001074413 | 134 |
| 384 | 3300005471 | Ga0070698_101279140 | Ga0070698_1012791401 | 134 |
| 385 | 3300005518 | Ga0070699_100004187 | Ga0070699_10000418710 | 134 |
| 386 | 3300005518 | Ga0070699_100112445 | Ga0070699_1001124452 | 134 |
| 387 | 3300005530 | Ga0070679_100174356 | Ga0070679_1001743562 | 134 |
| 388 | 3300005535 | Ga0070684_100136100 | Ga0070684_1001361004 | 134 |
| 389 | 3300005536 | Ga0070697_100014160 | Ga0070697_1000141605 | 134 |
| 390 | 3300005536 | Ga0070697_100940744 | Ga0070697_1009407441 | 134 |
| 391 | 3300005539 | Ga0068853_100353189 | Ga0068853_1003531893 | 134 |
| 392 | 3300005543 | Ga0070672_100174471 | Ga0070672_1001744715 | 134 |
| 393 | 3300005546 | Ga0070696_100011939 | Ga0070696_1000119392 | 134 |
| 394 | 3300005546 | Ga0070696_100721819 | Ga0070696_1007218191 | 134 |
| 395 | 3300005547 | Ga0070693_100003246 | Ga0070693_1000032463 | 134 |
| 396 | 3300005548 | Ga0070665_100045387 | Ga0070665_1000453875 | 134 |
| 397 | 3300005548 | Ga0070665_100120050 | Ga0070665_1001200501 | 134 |
| 398 | 3300005548 | Ga0070665_100128802 | Ga0070665_1001288023 | 134 |
| 399 | 3300005549 | Ga0070704_100031218 | Ga0070704_1000312182 | 134 |
| 400 | 3300005563 | Ga0068855_100212575 | Ga0068855_1002125755 | 134 |
| 401 | 3300005564 | Ga0070664_100009586 | Ga0070664_1000095865 | 134 |
| 402 | 3300005577 | Ga0068857_100013122 | Ga0068857_1000131226 | 134 |
| 403 | 3300005578 | Ga0068854_100212710 | Ga0068854_1002127102 | 134 |
| 404 | 3300005614 | Ga0068856_100084217 | Ga0068856_1000842173 | 134 |
| 405 | 3300005614 | Ga0068856_100089319 | Ga0068856_1000893193 | 134 |
| 406 | 3300005616 | Ga0068852_100151113 | Ga0068852_1001511132 | 134 |
| 407 | 3300005617 | Ga0068859_100086190 | Ga0068859_1000861905 | 134 |
| 408 | 3300005618 | Ga0068864_100008886 | Ga0068864_1000088866 | 134 |
| 409 | 3300005618 | Ga0068864_100742933 | Ga0068864_1007429332 | 134 |
| 410 | 3300005719 | Ga0068861_100119740 | Ga0068861_1001197401 | 134 |
| 411 | 3300005841 | Ga0068863_100011963 | Ga0068863_1000119636 | 134 |
| 412 | 3300005841 | Ga0068863_100298424 | Ga0068863_1002984242 | 134 |
| 413 | 3300005842 | Ga0068858_100011040 | Ga0068858_1000110405 | 134 |
| 414 | 3300005843 | Ga0068860_100062358 | Ga0068860_1000623583 | 134 |
| 415 | 3300006028 | Ga0070717_10009984 | Ga0070717_100099848 | 134 |
| 416 | 3300006028 | Ga0070717_10011792 | Ga0070717_100117925 | 134 |
| 417 | 3300006028 | Ga0070717_10094460 | Ga0070717_100944601 | 134 |
| 418 | 3300006028 | Ga0070717_10097243 | Ga0070717_100972433 | 134 |
| 419 | 3300006028 | Ga0070717_10205772 | Ga0070717_102057721 | 134 |
| 420 | 3300006028 | Ga0070717_10375563 | Ga0070717_103755631 | 134 |
| 421 | 3300006028 | Ga0070717_10584881 | Ga0070717_105848812 | 134 |
| 422 | 3300006028 | Ga0070717_10966726 | Ga0070717_109667262 | 134 |
| 423 | 3300006028 | Ga0070717_11084937 | Ga0070717_110849371 | 134 |
| 424 | 3300006163 | Ga0070715_10244534 | Ga0070715_102445342 | 134 |
| 425 | 3300006173 | Ga0070716_100013108 | Ga0070716_1000131085 | 134 |
| 426 | 3300006173 | Ga0070716_100034829 | Ga0070716_1000348295 | 134 |
| 427 | 3300006175 | Ga0070712_100007749 | Ga0070712_1000077496 | 134 |
| 428 | 3300006175 | Ga0070712_100056070 | Ga0070712_1000560704 | 134 |
| 429 | 3300006175 | Ga0070712_100199106 | Ga0070712_1001991063 | 134 |
| 430 | 3300006237 | Ga0097621_100009840 | Ga0097621_1000098406 | 134 |
| 431 | 3300006237 | Ga0097621_100735107 | Ga0097621_1007351071 | 134 |
| 432 | 3300006358 | Ga0068871_100006638 | Ga0068871_1000066385 | 134 |
| 433 | 3300006358 | Ga0068871_101072043 | Ga0068871_1010720431 | 134 |
| 434 | 3300006914 | Ga0075436_100449067 | Ga0075436_1004490672 | 134 |
| 435 | 3300006914 | Ga0075436_101087000 | Ga0075436_1010870001 | 134 |
| 436 | 3300006931 | Ga0097620_100086188 | Ga0097620_1000861885 | 134 |
| 437 | 3300007076 | Ga0075435_100082491 | Ga0075435_1000824915 | 134 |
| 438 | 3300007076 | Ga0075435_100282242 | Ga0075435_1002822422 | 134 |
| 439 | 3300007788 | Ga0099795_10134317 | Ga0099795_101343171 | 134 |
| 440 | 3300009011 | Ga0105251_10090761 | Ga0105251_100907612 | 134 |
| 441 | 3300009093 | Ga0105240_11039377 | Ga0105240_110393771 | 134 |
| 442 | 3300009098 | Ga0105245_10013431 | Ga0105245_100134313 | 134 |
| 443 | 3300009174 | Ga0105241_10087157 | Ga0105241_100871573 | 134 |
| 444 | 3300009176 | Ga0105242_10135834 | Ga0105242_101358344 | 134 |
| 445 | 3300009177 | Ga0105248_10094046 | Ga0105248_100940464 | 134 |
| 446 | 3300009545 | Ga0105237_10056684 | Ga0105237_100566845 | 134 |
| 447 | 3300009545 | Ga0105237_10562298 | Ga0105237_105622982 | 134 |
| 448 | 3300009551 | Ga0105238_10526626 | Ga0105238_105266261 | 134 |
| 449 | 3300009553 | Ga0105249_10287426 | Ga0105249_102874261 | 134 |
| 450 | 3300010159 | Ga0099796_10074334 | Ga0099796_100743342 | 134 |
| 451 | 3300010375 | Ga0105239_11352481 | Ga0105239_113524812 | 134 |
| 452 | 3300010375 | Ga0105239_11426288 | Ga0105239_114262882 | 134 |
| 453 | 3300011119 | Ga0105246_10057395 | Ga0105246_100573952 | 134 |
| 454 | 3300011119 | Ga0105246_10389723 | Ga0105246_103897233 | 134 |
| 455 | 3300012507 | Ga0157342_1037701 | Ga0157342_10377012 | 134 |
| 456 | 3300013104 | Ga0157370_10038567 | Ga0157370_100385671 | 134 |
| 457 | 3300013104 | Ga0157370_10299654 | Ga0157370_102996541 | 134 |
| 458 | 3300013105 | Ga0157369_10036664 | Ga0157369_100366644 | 134 |
| 459 | 3300013105 | Ga0157369_10503009 | Ga0157369_105030092 | 134 |
| 460 | 3300013296 | Ga0157374_10015131 | Ga0157374_100151315 | 134 |
| 461 | 3300013306 | Ga0163162_10104972 | Ga0163162_101049723 | 134 |
| 462 | 3300013307 | Ga0157372_10088181 | Ga0157372_100881812 | 134 |
| 463 | 3300013308 | Ga0157375_10068114 | Ga0157375_100681143 | 134 |
| 464 | 3300014325 | Ga0163163_10119713 | Ga0163163_101197133 | 134 |
| 465 | 3300014325 | Ga0163163_10408627 | Ga0163163_104086272 | 134 |
| 466 | 3300014745 | Ga0157377_10003346 | Ga0157377_100033463 | 134 |
| 467 | 3300014968 | Ga0157379_10019387 | Ga0157379_100193876 | 134 |
| 468 | 3300014969 | Ga0157376_10011247 | Ga0157376_100112476 | 134 |
| 469 | 3300014969 | Ga0157376_10333235 | Ga0157376_103332351 | 134 |
| 470 | 3300020070 | Ga0206356_11851363 | Ga0206356_118513631 | 134 |
| 471 | 3300020078 | Ga0206352_10811948 | Ga0206352_108119481 | 134 |
| 472 | 3300020082 | Ga0206353_10252478 | Ga0206353_102524783 | 134 |
| 473 | 3300020082 | Ga0206353_10876871 | Ga0206353_108768712 | 134 |
| 474 | 3300021388 | Ga0213875_10066989 | Ga0213875_100669892 | 134 |
| 475 | 3300021388 | Ga0213875_10266276 | Ga0213875_102662762 | 134 |
| 476 | 3300023552 | Ga0247551_103345 | Ga0247551_1033451 | 134 |
| 477 | 3300025898 | Ga0207692_10008528 | Ga0207692_100085284 | 134 |
| 478 | 3300025898 | Ga0207692_10028273 | Ga0207692_100282733 | 134 |
| 479 | 3300025898 | Ga0207692_10030704 | Ga0207692_100307042 | 134 |
| 480 | 3300025898 | Ga0207692_10205468 | Ga0207692_102054682 | 134 |
| 481 | 3300025898 | Ga0207692_10384530 | Ga0207692_103845301 | 134 |
| 482 | 3300025900 | Ga0207710_10035869 | Ga0207710_100358692 | 134 |
| 483 | 3300025903 | Ga0207680_10273134 | Ga0207680_102731341 | 134 |
| 484 | 3300025904 | Ga0207647_10061534 | Ga0207647_100615343 | 134 |
| 485 | 3300025905 | Ga0207685_10091175 | Ga0207685_100911752 | 134 |
| 486 | 3300025906 | Ga0207699_10001841 | Ga0207699_100018416 | 134 |
| 487 | 3300025906 | Ga0207699_10059915 | Ga0207699_100599154 | 134 |
| 488 | 3300025906 | Ga0207699_10237305 | Ga0207699_102373052 | 134 |
| 489 | 3300025907 | Ga0207645_10350291 | Ga0207645_103502912 | 134 |
| 490 | 3300025910 | Ga0207684_10155619 | Ga0207684_101556192 | 134 |
| 491 | 3300025910 | Ga0207684_10201187 | Ga0207684_102011872 | 134 |
| 492 | 3300025910 | Ga0207684_10721893 | Ga0207684_107218932 | 134 |
| 493 | 3300025911 | Ga0207654_10094665 | Ga0207654_100946652 | 134 |
| 494 | 3300025912 | Ga0207707_10684160 | Ga0207707_106841602 | 134 |
| 495 | 3300025913 | Ga0207695_10059511 | Ga0207695_100595113 | 134 |
| 496 | 3300025914 | Ga0207671_10845988 | Ga0207671_108459881 | 134 |
| 497 | 3300025915 | Ga0207693_10013359 | Ga0207693_100133596 | 134 |
| 498 | 3300025915 | Ga0207693_10193161 | Ga0207693_101931612 | 134 |
| 499 | 3300025915 | Ga0207693_10293885 | Ga0207693_102938852 | 134 |
| 500 | 3300025916 | Ga0207663_10007438 | Ga0207663_100074385 | 134 |
| 501 | 3300025916 | Ga0207663_10007664 | Ga0207663_100076646 | 134 |
| 502 | 3300025917 | Ga0207660_10169602 | Ga0207660_101696022 | 134 |
| 503 | 3300025919 | Ga0207657_10114578 | Ga0207657_101145784 | 134 |
| 504 | 3300025921 | Ga0207652_10134373 | Ga0207652_101343734 | 134 |
| 505 | 3300025922 | Ga0207646_10004957 | Ga0207646_1000495710 | 134 |
| 506 | 3300025922 | Ga0207646_10039482 | Ga0207646_100394824 | 134 |
| 507 | 3300025922 | Ga0207646_10042936 | Ga0207646_100429365 | 134 |
| 508 | 3300025923 | Ga0207681_11208321 | Ga0207681_112083211 | 134 |
| 509 | 3300025926 | Ga0207659_10124890 | Ga0207659_101248902 | 134 |
| 510 | 3300025927 | Ga0207687_10403647 | Ga0207687_104036472 | 134 |
| 511 | 3300025927 | Ga0207687_11149015 | Ga0207687_111490151 | 134 |
| 512 | 3300025928 | Ga0207700_10002213 | Ga0207700_100022137 | 134 |
| 513 | 3300025928 | Ga0207700_10070942 | Ga0207700_100709424 | 134 |
| 514 | 3300025928 | Ga0207700_10227297 | Ga0207700_102272972 | 134 |
| 515 | 3300025928 | Ga0207700_10643291 | Ga0207700_106432912 | 134 |
| 516 | 3300025929 | Ga0207664_10000717 | Ga0207664_100007171 | 134 |
| 517 | 3300025929 | Ga0207664_10003182 | Ga0207664_100031828 | 134 |
| 518 | 3300025929 | Ga0207664_10010632 | Ga0207664_100106326 | 134 |
| 519 | 3300025929 | Ga0207664_10083937 | Ga0207664_100839374 | 134 |
| 520 | 3300025929 | Ga0207664_10197799 | Ga0207664_101977992 | 134 |
| 521 | 3300025929 | Ga0207664_10234468 | Ga0207664_102344681 | 134 |
| 522 | 3300025929 | Ga0207664_10400579 | Ga0207664_104005792 | 134 |
| 523 | 3300025929 | Ga0207664_10427549 | Ga0207664_104275492 | 134 |
| 524 | 3300025929 | Ga0207664_11569034 | Ga0207664_115690341 | 134 |
| 525 | 3300025931 | Ga0207644_10069912 | Ga0207644_100699122 | 134 |
| 526 | 3300025931 | Ga0207644_11264980 | Ga0207644_112649801 | 134 |
| 527 | 3300025932 | Ga0207690_10047869 | Ga0207690_100478691 | 134 |
| 528 | 3300025934 | Ga0207686_10065315 | Ga0207686_100653152 | 134 |
| 529 | 3300025935 | Ga0207709_10790832 | Ga0207709_107908322 | 134 |
| 530 | 3300025936 | Ga0207670_10238403 | Ga0207670_102384032 | 134 |
| 531 | 3300025937 | Ga0207669_10352151 | Ga0207669_103521511 | 134 |
| 532 | 3300025939 | Ga0207665_10005764 | Ga0207665_100057646 | 134 |
| 533 | 3300025939 | Ga0207665_10019137 | Ga0207665_100191371 | 134 |
| 534 | 3300025939 | Ga0207665_10222805 | Ga0207665_102228052 | 134 |
| 535 | 3300025940 | Ga0207691_10476711 | Ga0207691_104767112 | 134 |
| 536 | 3300025941 | Ga0207711_10058384 | Ga0207711_100583841 | 134 |
| 537 | 3300025942 | Ga0207689_10003607 | Ga0207689_1000360712 | 134 |
| 538 | 3300025945 | Ga0207679_10223234 | Ga0207679_102232342 | 134 |
| 539 | 3300025945 | Ga0207679_10550714 | Ga0207679_105507142 | 134 |
| 540 | 3300025949 | Ga0207667_11094120 | Ga0207667_110941201 | 134 |
| 541 | 3300025961 | Ga0207712_11301431 | Ga0207712_113014311 | 134 |
| 542 | 3300025981 | Ga0207640_10165257 | Ga0207640_101652572 | 134 |
| 543 | 3300026035 | Ga0207703_10069559 | Ga0207703_100695594 | 134 |
| 544 | 3300026041 | Ga0207639_10154383 | Ga0207639_101543832 | 134 |
| 545 | 3300026067 | Ga0207678_10012650 | Ga0207678_100126504 | 134 |
| 546 | 3300026075 | Ga0207708_10674797 | Ga0207708_106747971 | 134 |
| 547 | 3300026078 | Ga0207702_10013634 | Ga0207702_100136345 | 134 |
| 548 | 3300026088 | Ga0207641_11072839 | Ga0207641_110728391 | 134 |
| 549 | 3300026095 | Ga0207676_10364381 | Ga0207676_103643811 | 134 |
| 550 | 3300026095 | Ga0207676_11314480 | Ga0207676_113144801 | 134 |
| 551 | 3300026116 | Ga0207674_10001953 | Ga0207674_100019533 | 134 |
| 552 | 3300026116 | Ga0207674_10783125 | Ga0207674_107831252 | 134 |
| 553 | 3300026121 | Ga0207683_10008115 | Ga0207683_100081154 | 134 |
| 554 | 3300026142 | Ga0207698_10337914 | Ga0207698_103379142 | 134 |
| 555 | 3300028379 | Ga0268266_10156416 | Ga0268266_101564164 | 134 |
| 556 | 3300028381 | Ga0268264_10185564 | Ga0268264_101855643 | 134 |
| 557 | 3300028800 | Ga0265338_10076423 | Ga0265338_100764233 | 134 |
| 558 | 3300028800 | Ga0265338_10276170 | Ga0265338_102761702 | 134 |
| 559 | 3300028800 | Ga0265338_10905438 | Ga0265338_109054381 | 134 |
| 560 | 3300031090 | Ga0265760_10056087 | Ga0265760_100560872 | 134 |
| 561 | 3300031241 | Ga0265325_10119661 | Ga0265325_101196612 | 134 |
| 562 | 3300031247 | Ga0265340_10290018 | Ga0265340_102900181 | 134 |
| 563 | 3300031249 | Ga0265339_10409467 | Ga0265339_104094672 | 134 |
| 564 | 3300031250 | Ga0265331_10122286 | Ga0265331_101222862 | 134 |
| 565 | 3300031251 | Ga0265327_10000911 | Ga0265327_1000091135 | 134 |
| 566 | 3300031595 | Ga0265313_10077676 | Ga0265313_100776762 | 134 |
| 567 | 3300031712 | Ga0265342_10165233 | Ga0265342_101652332 | 134 |
| 568 | 3300031712 | Ga0265342_10322205 | Ga0265342_103222051 | 134 |
| 569 | 3300031727 | Ga0316576_10130936 | Ga0316576_101309363 | 134 |
| 570 | 3300031728 | Ga0316578_10600256 | Ga0316578_106002561 | 134 |
| 571 | 3300031852 | Ga0307410_10595530 | Ga0307410_105955302 | 134 |
| 572 | 3300031903 | Ga0307407_10641683 | Ga0307407_106416832 | 134 |
| 573 | 3300031911 | Ga0307412_10047428 | Ga0307412_100474282 | 134 |
| 574 | 3300034816 | Ga0373930_0015946 | Ga0373930_0015946_891_1337 | 134 |
| 575 | 3300035083 | Ga0373926_0003369 | Ga0373926_0003369_730_1176 | 134 |
| 576 | 3300035086 | Ga0373934_0023258 | Ga0373934_0023258_1229_1675 | 134 |
| 577 | 3300035086 | Ga0373934_0142489 | Ga0373934_0142489_294_740 | 134 |
| 578 | 3300035088 | Ga0373940_0061272 | Ga0373940_0061272_444_890 | 134 |
| 579 | 3300035088 | Ga0373940_0253843 | Ga0373940_0253843_105_551 | 134 |
| 580 | 3300035089 | Ga0373944_0006402 | Ga0373944_0006402_2406_2852 | 134 |
| 581 | 3300035111 | Ga0373923_0191802 | Ga0373923_0191802_449_895 | 134 |
| 582 | 3300035113 | Ga0373936_0007347 | Ga0373936_0007347_3197_3643 | 134 |
| 583 | 3300035113 | Ga0373936_0014354 | Ga0373936_0014354_1332_1778 | 134 |
| 584 | 3300035116 | Ga0373945_0000242 | Ga0373945_0000242_14416_14862 | 134 |
| 585 | 3300035116 | Ga0373945_0290335 | Ga0373945_0290335_31_477 | 134 |
| 586 | 3300035116 | Ga0373945_0320102 | Ga0373945_0320102_69_515 | 134 |
| 587 | 3300035119 | Ga0373956_0202532 | Ga0373956_0202532_171_617 | 134 |
| 588 | 3300035120 | Ga0373957_0140555 | Ga0373957_0140555_515_961 | 134 |
| 589 | 3300035170 | Ga0373943_0001329 | Ga0373943_0001329_1714_2160 | 134 |
| 590 | 3300035170 | Ga0373943_0034526 | Ga0373943_0034526_1773_2219 | 134 |
| 591 | 3300035170 | Ga0373943_0588944 | Ga0373943_0588944_23_472 | 134 |
| 592 | 3300035171 | Ga0373946_0042975 | Ga0373946_0042975_191_637 | 134 |
| 593 | 3300035171 | Ga0373946_0131458 | Ga0373946_0131458_90_539 | 134 |
| 594 | 3300035171 | Ga0373946_0563858 | Ga0373946_0563858_96_542 | 134 |
| 595 | 3300035172 | Ga0373955_0019563 | Ga0373955_0019563_2763_3209 | 134 |
| 596 | 3300035410 | Ga0373924_0042413 | Ga0373924_0042413_1231_1677 | 134 |
| 597 | 3300035410 | Ga0373924_0075716 | Ga0373924_0075716_833_1279 | 134 |
| 598 | 3300035410 | Ga0373924_0422646 | Ga0373924_0422646_29_475 | 134 |
| 599 | 3300035691 | Ga0373931_0324954 | Ga0373931_0324954_445_891 | 134 |
| 600 | 3300035692 | Ga0373935_0085778 | Ga0373935_0085778_1357_1803 | 134 |
| 601 | 3300035692 | Ga0373935_0538236 | Ga0373935_0538236_126_572 | 134 |
| 602 | 3300035695 | Ga0373927_0005581 | Ga0373927_0005581_4696_5142 | 134 |
| 603 | 3300035695 | Ga0373927_0071708 | Ga0373927_0071708_104_550 | 134 |
| 604 | 3300035695 | Ga0373927_0373956 | Ga0373927_0373956_116_562 | 134 |
| 605 | 3300035724 | Ga0373933_0042759 | Ga0373933_0042759_2090_2536 | 134 |
| 606 | 3300035724 | Ga0373933_0281024 | Ga0373933_0281024_41_487 | 134 |
| 607 | 3300035725 | Ga0373947_0175788 | Ga0373947_0175788_227_673 | 134 |
| 608 | 3300035725 | Ga0373947_0242680 | Ga0373947_0242680_329_775 | 134 |
| 609 | 3300035725 | Ga0373947_0306942 | Ga0373947_0306942_440_886 | 134 |
| 610 | 3300036401 | Ga0373937_0121011 | Ga0373937_0121011_1935_2381 | 134 |
| 611 | 3300036401 | Ga0373937_0251952 | Ga0373937_0251952_880_1326 | 134 |
| 612 | 3300036401 | Ga0373937_0327154 | Ga0373937_0327154_140_589 | 134 |
| 613 | 3300036401 | Ga0373937_0675868 | Ga0373937_0675868_219_665 | 134 |
| 614 | 3300036401 | Ga0373937_0947535 | Ga0373937_0947535_42_488 | 134 |
| 615 | 3300036401 | Ga0373937_1481550 | Ga0373937_1481550_125_574 | 134 |
| 616 | 3300037068 | Ga0373925_0034413 | Ga0373925_0034413_3150_3596 | 134 |
| 617 | 3300037068 | Ga0373925_0118053 | Ga0373925_0118053_813_1259 | 134 |
| 618 | 3300037068 | Ga0373925_0295292 | Ga0373925_0295292_596_1042 | 134 |
| 619 | 3300037068 | Ga0373925_0341759 | Ga0373925_0341759_648_1094 | 134 |
| 620 | 3300037853 | Ga0436364_0458942 | Ga0436364_0458942_31_477 | 134 |
| 621 | 3300037853 | Ga0436364_0729577 | Ga0436364_0729577_37_444 | 134 |
| 622 | 3300037853 | Ga0436364_0796359 | Ga0436364_0796359_1014_1460 | 134 |
| 623 | 3300037853 | Ga0436364_0818911 | Ga0436364_0818911_49_495 | 134 |
| 624 | 3300037853 | Ga0436364_1197365 | Ga0436364_1197365_401_847 | 134 |
| 625 | 3300037853 | Ga0436364_1481992 | Ga0436364_1481992_15_422 | 134 |
| 626 | 3300037853 | Ga0436364_1557432 | Ga0436364_1557432_73_522 | 134 |
| 627 | 3300039437 | Ga0436365_1145451 | Ga0436365_1145451_471_932 | 134 |
| 628 | 3300039437 | Ga0436365_1189314 | Ga0436365_1189314_628_1074 | 134 |
| 629 | 3300039447 | Ga0436361_0458380 | Ga0436361_0458380_117_566 | 134 |
| 630 | 3300039450 | Ga0436363_0328230 | Ga0436363_0328230_956_1402 | 134 |
| 631 | 3300039450 | Ga0436363_0685849 | Ga0436363_0685849_2894_3349 | 134 |
| 632 | 3300039450 | Ga0436363_1287920 | Ga0436363_1287920_57_506 | 134 |
| 633 | 3300039453 | Ga0436362_0365348 | Ga0436362_0365348_147_596 | 134 |
| 634 | 3300039453 | Ga0436362_1203116 | Ga0436362_1203116_84_533 | 134 |
| 635 | 3300041462 | Ga0451806_845660 | Ga0451806_845660_29_478 | 134 |
| 636 | 3300044656 | Ga0466969_0045930 | Ga0466969_0045930_1229_1678 | 134 |
| 637 | 3300044684 | Ga0466966_0209838 | Ga0466966_0209838_331_780 | 134 |
| 638 | 3300044684 | Ga0466966_0228389 | Ga0466966_0228389_213_662 | 134 |
| 639 | 3300044693 | Ga0466961_0008157 | Ga0466961_0008157_1594_2043 | 134 |
| 640 | 3300044694 | Ga0466963_0723053 | Ga0466963_0723053_220_666 | 134 |
| 641 | 3300045049 | Ga0466959_0207388 | Ga0466959_0207388_653_1102 | 134 |
| 642 | 3300045976 | Ga0466967_0061888 | Ga0466967_0061888_2811_3257 | 134 |
| 643 | 3300045976 | Ga0466967_0080982 | Ga0466967_0080982_715_1161 | 134 |
| 644 | 3300045976 | Ga0466967_1145492 | Ga0466967_1145492_203_649 | 134 |
| 645 | 3300046454 | Ga0495592_0033307 | Ga0495592_0033307_1357_1803 | 134 |
| 646 | 3300046454 | Ga0495592_0449639 | Ga0495592_0449639_294_743 | 134 |
| 647 | 3300046454 | Ga0495592_0492785 | Ga0495592_0492785_239_685 | 134 |
| 648 | 3300046455 | Ga0495603_0005395 | Ga0495603_0005395_168_614 | 134 |
| 649 | 3300046459 | Ga0495629_0567659 | Ga0495629_0567659_170_619 | 134 |
| 650 | 3300046461 | Ga0495641_0111169 | Ga0495641_0111169_521_967 | 134 |
| 651 | 3300046461 | Ga0495641_0128575 | Ga0495641_0128575_504_950 | 134 |
| 652 | 3300046462 | Ga0495651_0025942 | Ga0495651_0025942_324_770 | 134 |
| 653 | 3300046462 | Ga0495651_0031975 | Ga0495651_0031975_2367_2813 | 134 |
| 654 | 3300046462 | Ga0495651_0048621 | Ga0495651_0048621_2621_3067 | 134 |
| 655 | 3300046462 | Ga0495651_0528730 | Ga0495651_0528730_271_729 | 134 |
| 656 | 3300046463 | Ga0495653_0010681 | Ga0495653_0010681_6885_7331 | 134 |
| 657 | 3300046463 | Ga0495653_0071429 | Ga0495653_0071429_1829_2275 | 134 |
| 658 | 3300046463 | Ga0495653_0094777 | Ga0495653_0094777_1342_1788 | 134 |
| 659 | 3300046472 | Ga0495580_0011041 | Ga0495580_0011041_1505_1951 | 134 |
| 660 | 3300046473 | Ga0495582_0038830 | Ga0495582_0038830_964_1410 | 134 |
| 661 | 3300046473 | Ga0495582_0671234 | Ga0495582_0671234_143_589 | 134 |
| 662 | 3300046473 | Ga0495582_0694275 | Ga0495582_0694275_42_446 | 134 |
| 663 | 3300046475 | Ga0495639_0005051 | Ga0495639_0005051_2011_2457 | 134 |
| 664 | 3300046476 | Ga0495662_0001071 | Ga0495662_0001071_4605_5051 | 134 |
| 665 | 3300046476 | Ga0495662_0257421 | Ga0495662_0257421_88_537 | 134 |
| 666 | 3300046511 | Ga0495608_0018178 | Ga0495608_0018178_4084_4530 | 134 |
| 667 | 3300046511 | Ga0495608_0134893 | Ga0495608_0134893_560_1018 | 134 |
| 668 | 3300046511 | Ga0495608_0285552 | Ga0495608_0285552_456_902 | 134 |
| 669 | 3300046514 | Ga0495618_0004257 | Ga0495618_0004257_2248_2694 | 134 |
| 670 | 3300046514 | Ga0495618_0050706 | Ga0495618_0050706_623_1069 | 134 |
| 671 | 3300046516 | Ga0495628_0021834 | Ga0495628_0021834_2309_2755 | 134 |
| 672 | 3300046516 | Ga0495628_0156406 | Ga0495628_0156406_255_704 | 134 |
| 673 | 3300046516 | Ga0495628_0184339 | Ga0495628_0184339_57_515 | 134 |
| 674 | 3300046517 | Ga0495630_0124677 | Ga0495630_0124677_152_598 | 134 |
| 675 | 3300046517 | Ga0495630_0424893 | Ga0495630_0424893_454_900 | 134 |
| 676 | 3300046517 | Ga0495630_0775258 | Ga0495630_0775258_96_545 | 134 |
| 677 | 3300046517 | Ga0495630_1099981 | Ga0495630_1099981_61_507 | 134 |
| 678 | 3300046526 | Ga0495666_0011710 | Ga0495666_0011710_2789_3235 | 134 |
| 679 | 3300046526 | Ga0495666_0077157 | Ga0495666_0077157_1032_1478 | 134 |
| 680 | 3300046526 | Ga0495666_0547149 | Ga0495666_0547149_33_479 | 134 |
| 681 | 3300046529 | Ga0495652_0025271 | Ga0495652_0025271_1417_1863 | 134 |
| 682 | 3300046529 | Ga0495652_0052687 | Ga0495652_0052687_2515_2961 | 134 |
| 683 | 3300046529 | Ga0495652_0312970 | Ga0495652_0312970_251_697 | 134 |
| 684 | 3300046529 | Ga0495652_0546599 | Ga0495652_0546599_285_734 | 134 |
| 685 | 3300046531 | Ga0495665_0000609 | Ga0495665_0000609_12509_12955 | 134 |
| 686 | 3300046531 | Ga0495665_0435645 | Ga0495665_0435645_247_651 | 134 |
| 687 | 3300046533 | Ga0495640_0011262 | Ga0495640_0011262_5051_5497 | 134 |
| 688 | 3300046533 | Ga0495640_0051013 | Ga0495640_0051013_1726_2172 | 134 |
| 689 | 3300046533 | Ga0495640_0080467 | Ga0495640_0080467_1640_2089 | 134 |
| 690 | 3300046535 | Ga0495586_0399648 | Ga0495586_0399648_286_732 | 134 |
| 691 | 3300046536 | Ga0495587_0001347 | Ga0495587_0001347_3452_3898 | 134 |
| 692 | 3300046536 | Ga0495587_0072829 | Ga0495587_0072829_272_718 | 134 |
| 693 | 3300046536 | Ga0495587_0076967 | Ga0495587_0076967_1459_1905 | 134 |
| 694 | 3300046536 | Ga0495587_0334261 | Ga0495587_0334261_34_480 | 134 |
| 695 | 3300046536 | Ga0495587_0477112 | Ga0495587_0477112_65_511 | 134 |
| 696 | 3300046543 | Ga0495645_0100029 | Ga0495645_0100029_1573_2019 | 134 |
| 697 | 3300046543 | Ga0495645_0121337 | Ga0495645_0121337_564_1013 | 134 |
| 698 | 3300046559 | Ga0495667_0004648 | Ga0495667_0004648_3215_3661 | 134 |
| 699 | 3300046559 | Ga0495667_0006539 | Ga0495667_0006539_2652_3098 | 134 |
| 700 | 3300046559 | Ga0495667_0013627 | Ga0495667_0013627_4837_5283 | 134 |
| 701 | 3300046559 | Ga0495667_0051276 | Ga0495667_0051276_49_495 | 134 |
| 702 | 3300046559 | Ga0495667_0162575 | Ga0495667_0162575_165_611 | 134 |
| 703 | 3300046559 | Ga0495667_0836467 | Ga0495667_0836467_19_465 | 134 |
| 704 | 3300046663 | Ga0495635_0010729 | Ga0495635_0010729_4028_4474 | 134 |
| 705 | 3300046663 | Ga0495635_0034972 | Ga0495635_0034972_1423_1869 | 134 |
| 706 | 3300046663 | Ga0495635_0038913 | Ga0495635_0038913_1926_2372 | 134 |
| 707 | 3300046663 | Ga0495635_0046693 | Ga0495635_0046693_1975_2421 | 134 |
| 708 | 3300046675 | Ga0495657_0004896 | Ga0495657_0004896_3527_3973 | 134 |
| 709 | 3300046675 | Ga0495657_0009780 | Ga0495657_0009780_137_583 | 134 |
| 710 | 3300046675 | Ga0495657_0029808 | Ga0495657_0029808_2936_3382 | 134 |
| 711 | 3300046675 | Ga0495657_0055518 | Ga0495657_0055518_886_1332 | 134 |
| 712 | 3300046678 | Ga0495599_0002162 | Ga0495599_0002162_7305_7751 | 134 |
| 713 | 3300046678 | Ga0495599_0006221 | Ga0495599_0006221_6511_6957 | 134 |
| 714 | 3300046678 | Ga0495599_0029504 | Ga0495599_0029504_282_728 | 134 |
| 715 | 3300046678 | Ga0495599_0134784 | Ga0495599_0134784_13_459 | 134 |
| 716 | 3300046678 | Ga0495599_0270710 | Ga0495599_0270710_337_795 | 134 |
| 717 | 3300046678 | Ga0495599_0346641 | Ga0495599_0346641_422_868 | 134 |
| 718 | 3300046679 | Ga0495623_0049876 | Ga0495623_0049876_494_940 | 134 |
| 719 | 3300046680 | Ga0495646_0004125 | Ga0495646_0004125_6152_6598 | 134 |
| 720 | 3300046680 | Ga0495646_0704752 | Ga0495646_0704752_47_493 | 134 |
| 721 | 3300046683 | Ga0495658_0002903 | Ga0495658_0002903_1488_1934 | 134 |
| 722 | 3300046689 | Ga0495613_0124617 | Ga0495613_0124617_168_614 | 134 |
| 723 | 3300046690 | Ga0495624_0067474 | Ga0495624_0067474_1627_2073 | 134 |
| 724 | 3300046809 | Ga0495600_0016514 | Ga0495600_0016514_3904_4350 | 134 |
| 725 | 3300046809 | Ga0495600_0029698 | Ga0495600_0029698_1048_1494 | 134 |
| 726 | 3300046809 | Ga0495600_0042046 | Ga0495600_0042046_801_1247 | 134 |
| 727 | 3300046809 | Ga0495600_0701542 | Ga0495600_0701542_127_585 | 134 |
| 728 | 3300047315 | Ga0495581_0017527 | Ga0495581_0017527_40_486 | 134 |
| 729 | 3300047317 | Ga0495604_0194675 | Ga0495604_0194675_775_1221 | 134 |
| 730 | 3300047317 | Ga0495604_0336861 | Ga0495604_0336861_125_571 | 134 |
| 731 | 3300047317 | Ga0495604_0469798 | Ga0495604_0469798_363_809 | 134 |
| 732 | 3300047319 | Ga0495674_0009070 | Ga0495674_0009070_8521_8967 | 134 |
| 733 | 3300047319 | Ga0495674_0107468 | Ga0495674_0107468_1117_1563 | 134 |
| 734 | 3300047319 | Ga0495674_0131180 | Ga0495674_0131180_135_581 | 134 |
| 735 | 3300047319 | Ga0495674_0139752 | Ga0495674_0139752_1341_1790 | 134 |
| 736 | 3300047321 | Ga0495676_0163140 | Ga0495676_0163140_41_487 | 134 |
| 737 | 3300047321 | Ga0495676_0177979 | Ga0495676_0177979_84_530 | 134 |
| 738 | 3300047321 | Ga0495676_0288169 | Ga0495676_0288169_643_1092 | 134 |
| 739 | 3300047321 | Ga0495676_0329424 | Ga0495676_0329424_232_678 | 134 |
| 740 | 3300047322 | Ga0495680_0033256 | Ga0495680_0033256_1199_1645 | 134 |
| 741 | 3300047322 | Ga0495680_0037424 | Ga0495680_0037424_1357_1803 | 134 |
| 742 | 3300047322 | Ga0495680_0038711 | Ga0495680_0038711_2551_2997 | 134 |
| 743 | 3300047322 | Ga0495680_0080713 | Ga0495680_0080713_134_580 | 134 |
| 744 | 3300047444 | Ga0495675_0010105 | Ga0495675_0010105_4952_5398 | 134 |
| 745 | 3300047444 | Ga0495675_0046768 | Ga0495675_0046768_1820_2266 | 134 |
| 746 | 3300047471 | Ga0495684_0004828 | Ga0495684_0004828_4470_4916 | 134 |
| 747 | 3300047471 | Ga0495684_0035516 | Ga0495684_0035516_2083_2529 | 134 |
| 748 | 3300047471 | Ga0495684_0054305 | Ga0495684_0054305_2421_2867 | 134 |
| 749 | 3300047471 | Ga0495684_0382717 | Ga0495684_0382717_130_579 | 134 |
| 750 | 3300047471 | Ga0495684_0625472 | Ga0495684_0625472_39_485 | 134 |
| 751 | 3300047471 | Ga0495684_0699345 | Ga0495684_0699345_89_538 | 134 |
| 752 | 3300047673 | Ga0495593_0025454 | Ga0495593_0025454_2252_2698 | 134 |
| 753 | 3300047673 | Ga0495593_0229369 | Ga0495593_0229369_399_845 | 134 |
| 754 | 3300048088 | Ga0495602_0030412 | Ga0495602_0030412_726_1172 | 134 |
| 755 | 3300048088 | Ga0495602_0366052 | Ga0495602_0366052_412_858 | 134 |
| 756 | 3300048089 | Ga0495614_0003380 | Ga0495614_0003380_6393_6839 | 134 |
| 757 | 3300048905 | Ga0496102_0013321 | Ga0496102_0013321_5390_5836 | 134 |
| 758 | 3300048906 | Ga0496103_0431403 | Ga0496103_0431403_49_495 | 134 |
| 759 | 3300048907 | Ga0496104_0010640 | Ga0496104_0010640_4843_5289 | 134 |
| 760 | 3300048908 | Ga0496105_0038880 | Ga0496105_0038880_2079_2525 | 134 |
| 761 | 3300048909 | Ga0496106_0007645 | Ga0496106_0007645_6154_6600 | 134 |
| 762 | 3300048910 | Ga0496107_0020679 | Ga0496107_0020679_1460_1906 | 134 |
| 763 | 3300048911 | Ga0496108_0014892 | Ga0496108_0014892_4263_4709 | 134 |
| 764 | 3300048911 | Ga0496108_0156074 | Ga0496108_0156074_1276_1722 | 134 |
| 765 | 3300048912 | Ga0496109_0005650 | Ga0496109_0005650_6135_6581 | 134 |
| 766 | 3300048912 | Ga0496109_1502911 | Ga0496109_1502911_11_415 | 134 |
| 767 | 3300048913 | Ga0496110_0131709 | Ga0496110_0131709_365_811 | 134 |
| 768 | 3300048913 | Ga0496110_0596667 | Ga0496110_0596667_245_691 | 134 |
| 769 | 3300048914 | Ga0496111_0007464 | Ga0496111_0007464_4849_5295 | 134 |
| 770 | 3300048915 | Ga0496112_0018081 | Ga0496112_0018081_4850_5296 | 134 |
| 771 | 3300048915 | Ga0496112_0052633 | Ga0496112_0052633_120_566 | 134 |
| 772 | 3300048915 | Ga0496112_0137016 | Ga0496112_0137016_722_1168 | 134 |
| 773 | 3300048916 | Ga0496113_0003643 | Ga0496113_0003643_7060_7506 | 134 |
| 774 | 3300048917 | Ga0496114_0051179 | Ga0496114_0051179_647_1093 | 134 |
| 775 | 3300048918 | Ga0496115_0046842 | Ga0496115_0046842_284_730 | 134 |
| 776 | 3300048918 | Ga0496115_0898718 | Ga0496115_0898718_150_596 | 134 |
| 777 | 3300049572 | Ga0501036_1274927 | Ga0501036_1274927_80_535 | 134 |
| 778 | 3300050512 | nmdc:mga0n895_1963604_c1 | nmdc:mga0n895_1963604_c1_80_526 | 134 |
| 779 | 3300050512 | nmdc:mga0n895_513311_c1 | nmdc:mga0n895_513311_c1_241_687 | 134 |
| 780 | 3300050513 | nmdc:mga0rr50_702838_c1 | nmdc:mga0rr50_702838_c1_262_708 | 134 |
| 781 | 3300050514 | nmdc:mga08x19_251138_c1 | nmdc:mga08x19_251138_c1_55_501 | 134 |
| 782 | 3300050514 | nmdc:mga08x19_76191_c1 | nmdc:mga08x19_76191_c1_730_1176 | 134 |
| 783 | 3300053077 | Ga0495601_0044913 | Ga0495601_0044913_879_1325 | 134 |
| 784 | 3300053077 | Ga0495601_0110824 | Ga0495601_0110824_34_480 | 134 |
| 785 | 3300053077 | Ga0495601_0272509 | Ga0495601_0272509_435_884 | 134 |
| 786 | 3300053078 | Ga0495612_0016653 | Ga0495612_0016653_2485_2931 | 134 |
| 787 | 3300053078 | Ga0495612_0114993 | Ga0495612_0114993_505_951 | 134 |
| 788 | 3300053084 | Ga0495595_0053088 | Ga0495595_0053088_383_829 | 134 |
| 789 | 3300053085 | Ga0495619_0005684 | Ga0495619_0005684_5524_5970 | 134 |
| 790 | 3300053085 | Ga0495619_0325866 | Ga0495619_0325866_121_567 | 134 |
| 791 | 3300053085 | Ga0495619_1123083 | Ga0495619_1123083_15_419 | 134 |
| 792 | 3300053139 | Ga0500568_0000031 | Ga0500568_0000031_115922_116374 | 134 |
| 793 | iso_pu_bacteria | 2863404153 | 2863410660 | 134 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kl8-assembly1.cif.gz_B | structure of f420 binding protein rv1558 from mycobacterium tuberculosis with f420 bound | 0.9855 | 2 | 132 |
| 3r5z-assembly2.cif.gz_B | structure of a deazaflavin-dependent reductase from nocardia farcinica, with co-factor f420 | 0.983 | 2 | 131 |
| 3r5y-assembly3.cif.gz_C | structure of a deazaflavin-dependent nitroreductase from nocardia farcinica, with co-factor f420 | 0.9803 | 3 | 132 |
| 3r5r-assembly2.cif.gz_B | structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 | 0.9652 | 24 | 131 |
| 4y9i-assembly1.cif.gz_A | structure of f420-h2 dependent reductase (fdr-a) msmeg_2027 | 0.9606 | 25 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r5yD00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9783 | 3 | 132 | 2.30.110.10 |
| 4y9iA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9607 | 25 | 130 | 2.30.110.10 |
| af_P9WP15_14_151_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9372 | 2 | 131 | 2.30.110.10 |
| 3r5yD00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9284 | 3 | 132 | 2.30.110.10 |
| af_O53328_2_119_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9063 | 15 | 131 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D9Q679-F1-model_v4 | deleted | 0.9985 | 1 | 132 |
|
| AF-D9VMN6-F1-model_v4 | Nitroreductase | 0.9984 | 1 | 132 |
GO:0005886
GO:0016491 GO:0070967 |
| AF-A0A024JYH7-F1-model_v4 | Deazaflavin-dependent nitroreductase family protein | 0.9972 | 24 | 132 |
GO:0005886
GO:0016491 GO:0070967 |
| AF-A0A4R7AU34-F1-model_v4 | deleted | 0.9969 | 1 | 132 |
|
| AF-A0A4D4M7C0-F1-model_v4 | Nitroreductase | 0.9968 | 1 | 132 |
GO:0005886
GO:0016491 GO:0070967 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar