F481055

General Info

Members Datasets Scaffolds Average Seq Length
793 279 681 168

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1010448|Ga0079104_10104483
Length 173
Sequence MALPRKLKYLNLFNDGLSYMGIVSSVTLPKLTRKLENYRGGGMNGSAPVDFGLDDEALNVEWAIGGLPDDALWGQYAAASASTVPLRFCGSYQRDDTGDVVAVEIVLRGRHKEMDFGEQKQGEDTETKITTQCTYYKLTIDGKERIEIDTINMIERVNGVDMLERHRRNIGLS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
8 2547132181 Kosakonia sacchari SP1 Isolate Stem
9 2547132374 Acidovorax radicis N35 Isolate Unclassified
10 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
11 2561511199 Enterobacter sp. R4-368 Isolate Nodule
12 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
13 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
14 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
15 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
16 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
17 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
18 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
19 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
20 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
21 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
22 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
23 2643221621 Achromobacter sp. Root83 Isolate Unclassified
24 2643221717 Acidovorax sp. Root267 Isolate Unclassified
25 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
26 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
27 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
28 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
29 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
30 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
31 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
32 2721755523 Delftia sp. HK171 Isolate Unclassified
33 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
34 2751185917 Enterobacter sp. HK169 Isolate Unclassified
35 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
36 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
37 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
38 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
39 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
40 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
41 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
42 2818991436 Collimonas arenae 515 Isolate Unclassified
43 2821118458 Enterobacter asburiae 609 Isolate Unclassified
44 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
45 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
46 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
47 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
48 2847085930 Erwinia persicina B64 Isolate Bulb
49 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
50 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
51 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
52 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
53 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
54 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
55 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
56 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
57 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
58 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
59 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
60 2904504865 Serratia marcescens 1822 Isolate Unclassified
61 2904564687 Burkholderia sp. 571 Isolate Unclassified
62 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
63 2919150387 Rahnella aceris 1817 Isolate Unclassified
64 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
65 2927143783 Rahnella sp. 2050 Isolate Unclassified
66 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
67 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
68 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
69 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
70 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
71 2937539931 Pantoea sp. LS15 Isolate Unclassified
72 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
73 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
74 2952252522 Salinicola sp. DM10 Isolate Unclassified
75 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
76 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
77 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
78 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
79 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
80 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
81 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
82 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
83 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
84 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
85 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
86 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
87 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
88 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
89 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
90 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
91 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
92 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
93 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
94 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
95 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
96 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
97 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
98 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
99 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
100 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
101 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
105 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
106 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
134 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
135 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
136 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
139 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
148 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
150 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
151 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
152 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
155 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
159 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
174 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
188 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
191 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
192 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
193 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
194 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
195 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
196 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
199 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
218 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
221 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
240 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
241 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
242 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
250 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
270 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
274 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
275 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
276 640753048 Serratia proteamaculans 568 Isolate Endosphere
277 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
278 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
279 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.63
Metatranscriptomes 0
Isolates 13.37

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0.13
Endosphere 11.73
Nodule 3.4
Rhizoplane 4.16
Rhizosphere 46.91
Stem 0.13
Stem Tuber 0.13
Unclassified 33.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2559758 2162886007 Bacteria 1577
2 SwRhRL2b_contig_3198297 2162886007 Bacteria 4413
3 SwRhRL2b_contig_3769278 2162886007 Bacteria 1088
4 SwRhRL2b_contig_3810457 2162886007 Bacteria 1789
5 SwRhRL2b_contig_996573 2162886007 Bacteria 20335
6 JGI25155J39150_1000118 3300002704 Bacteria 38758
7 JGI25155J39150_1000976 3300002704 Bacteria 3335
8 JGI25155J39150_1002784 3300002704 Viruses 921
9 JGI25156J39149_1003570 3300002705 Bacteria 5038
10 JGI25156J39149_1003652 3300002705 Bacteria 4951
11 JGI25156J39149_1007371 3300002705 Bacteria 2899
12 JGI25162J39368_1000025 3300002737 Bacteria 228879
13 JGI25162J39368_1000029 3300002737 Bacteria 220066
14 JGI25162J39368_1000035 3300002737 Bacteria 180993
15 JGI25162J39368_1000256 3300002737 Bacteria 50829
16 JGI25154J39366_1000164 3300002738 Bacteria 51579
17 JGI25154J39366_1002333 3300002738 Bacteria 5038
18 JGI25154J39366_1002373 3300002738 Bacteria 4951
19 JGI25157J39369_1002598 3300002741 Bacteria 4298
20 JGI25157J39369_1002608 3300002741 Bacteria 4277
21 JGI25157J39369_1006293 3300002741 Viruses 1823
22 JGI25157J39369_1006484 3300002741 Bacteria 1776
23 JGI25163J39215_1000022 3300002771 Bacteria 73877
24 JGI25163J39215_1000056 3300002771 Bacteria 50829
25 JGI25163J39215_1000086 3300002771 Bacteria 39925
26 JGI25164J39214_1000008 3300002772 Bacteria 311285
27 JGI25164J39214_1000019 3300002772 Bacteria 180993
28 JGI25164J39214_1000201 3300002772 Bacteria 50829
29 JGI25165J46597_1000054 3300003214 Bacteria 228891
30 rootH1_10081081 3300003316 Bacteria 15317
31 rootH2_10101949 3300003320 Bacteria 1278
32 Ga0055538_1000014 3300003751 Bacteria 311285
33 Ga0055538_1000019 3300003751 Bacteria 282365
34 Ga0055538_1000026 3300003751 Bacteria 228891
35 Ga0055538_1000039 3300003751 Bacteria 180993
36 Ga0055538_1000139 3300003751 Bacteria 50829
37 Ga0055539_1000020 3300003752 Bacteria 311285
38 Ga0055539_1000033 3300003752 Bacteria 228891
39 Ga0055539_1000050 3300003752 Bacteria 180993
40 Ga0055539_1000189 3300003752 Bacteria 50829
41 Ga0055533_1000027 3300003756 Bacteria 311285
42 Ga0055533_1000044 3300003756 Bacteria 228891
43 Ga0055533_1000062 3300003756 Bacteria 180993
44 Ga0055533_1000190 3300003756 Bacteria 50829
45 Ga0055532_1000160 3300003758 Bacteria 58377
46 Ga0055525_1000032 3300003759 Bacteria 311285
47 Ga0055525_1000052 3300003759 Bacteria 228891
48 Ga0055525_1000072 3300003759 Bacteria 180993
49 Ga0055525_1000256 3300003759 Bacteria 50829
50 Ga0055527_1000174 3300003760 Bacteria 43934
51 Ga0055535_1000230 3300003761 Bacteria 58820
52 Ga0055542_1000249 3300003762 Bacteria 61927
53 Ga0055529_1000284 3300003763 Bacteria 60225
54 Ga0055541_1000014 3300003841 Bacteria 311285
55 Ga0055541_1000038 3300003841 Bacteria 180993
56 Ga0055541_1000049 3300003841 Bacteria 134251
57 Ga0055541_1000124 3300003841 Bacteria 50829
58 Ga0058692_1000270 3300003856 Bacteria 27729
59 Ga0058692_1000963 3300003856 Bacteria 11328
60 Ga0058692_1003418 3300003856 Bacteria 4897
61 Ga0058692_1007280 3300003856 Bacteria 2952
62 Ga0058692_1034175 3300003856 Bacteria 936
63 Ga0065714_10066358 3300005288 Bacteria 7013
64 Ga0065704_10001004 3300005289 Bacteria 10170
65 Ga0065704_10002842 3300005289 Bacteria 14551
66 Ga0065704_10003042 3300005289 Bacteria 6504
67 Ga0065704_10022339 3300005289 Bacteria 1442
68 Ga0065704_10076166 3300005289 Bacteria 5237
69 Ga0065704_10082104 3300005289 Bacteria 3653
70 Ga0065704_10108619 3300005289 Bacteria 2022
71 Ga0065704_10153341 3300005289 Bacteria 1411
72 Ga0065704_10184005 3300005289 Bacteria 1222
73 Ga0065704_10260752 3300005289 Bacteria 965
74 Ga0070665_100000241 3300005548 Bacteria 90760
75 Ga0068855_100047686 3300005563 Bacteria 5061
76 Ga0068855_100088927 3300005563 Bacteria 3567
77 Ga0068855_100550690 3300005563 Bacteria 1249
78 Ga0068857_100001290 3300005577 Bacteria 19683
79 Ga0068856_100000138 3300005614 Bacteria 73748
80 Ga0068851_10039880 3300005834 Bacteria 2359
81 Ga0068851_10834611 3300005834 Bacteria 574
82 Ga0075364_10003545 3300006051 Bacteria 8881
83 Ga0075364_10008481 3300006051 Bacteria 6148
84 Ga0075364_10012622 3300006051 Bacteria 5174
85 Ga0075366_10017633 3300006195 Bacteria 4112
86 Ga0079104_1000034 3300006946 Bacteria 199368
87 Ga0079104_1000566 3300006946 Bacteria 37770
88 Ga0079104_1000589 3300006946 Bacteria 36214
89 Ga0079104_1003639 3300006946 Bacteria 7029
90 Ga0079104_1004684 3300006946 Bacteria 5735
91 Ga0079104_1006645 3300006946 Bacteria 4330
92 Ga0079104_1009062 3300006946 Bacteria 3406
93 Ga0079104_1010448 3300006946 Bacteria 3060
94 Ga0079104_1013444 3300006946 Bacteria 2520
95 Ga0079104_1029637 3300006946 Bacteria 1376
96 Ga0079104_1039130 3300006946 Bacteria 1119
97 Ga0105251_10006118 3300009011 Bacteria 7752
98 Ga0105251_10014090 3300009011 Bacteria 4439
99 Ga0105251_10014946 3300009011 Bacteria 4262
100 Ga0105251_10039336 3300009011 Bacteria 2312
101 Ga0105251_10044944 3300009011 Bacteria 2131
102 Ga0105251_10056549 3300009011 Bacteria 1856
103 Ga0105251_10150607 3300009011 Bacteria 1051
104 Ga0105251_10171214 3300009011 Bacteria 978
105 Ga0105251_10208293 3300009011 Bacteria 880
106 Ga0105244_10000715 3300009036 Bacteria 28677
107 Ga0105244_10000932 3300009036 Bacteria 24659
108 Ga0105244_10002520 3300009036 Bacteria 13778
109 Ga0105244_10003430 3300009036 Bacteria 11301
110 Ga0105244_10009493 3300009036 Bacteria 5977
111 Ga0105244_10020764 3300009036 Bacteria 3643
112 Ga0105244_10073680 3300009036 Bacteria 1699
113 Ga0105250_10000039 3300009092 Bacteria 136696
114 Ga0105250_10000430 3300009092 Bacteria 30669
115 Ga0105250_10000611 3300009092 Bacteria 23296
116 Ga0105250_10001268 3300009092 Bacteria 13907
117 Ga0105250_10002346 3300009092 Bacteria 9570
118 Ga0105250_10003808 3300009092 Bacteria 7083
119 Ga0105250_10006704 3300009092 Bacteria 5004
120 Ga0105250_10007170 3300009092 Bacteria 4809
121 Ga0105250_10020659 3300009092 Bacteria 2660
122 Ga0105250_10022395 3300009092 Bacteria 2548
123 Ga0105250_10056732 3300009092 Bacteria 1572
124 Ga0105240_10000241 3300009093 Bacteria 108694
125 Ga0105240_10093292 3300009093 Bacteria 3675
126 Ga0105240_10275341 3300009093 Bacteria 1936
127 Ga0105240_10364933 3300009093 Bacteria 1635
128 Ga0105240_10429320 3300009093 Bacteria 1483
129 Ga0105240_11197416 3300009093 Viruses 804
130 Ga0105247_10000301 3300009101 Bacteria 44602
131 Ga0105243_10004315 3300009148 Bacteria 11257
132 Ga0105243_10045904 3300009148 Bacteria 3435
133 Ga0105241_10000005 3300009174 Bacteria 384203
134 Ga0105241_10000006 3300009174 Bacteria 373608
135 Ga0105248_11158945 3300009177 Bacteria 874
136 Ga0105237_10301891 3300009545 Bacteria 1604
137 Ga0105237_10593245 3300009545 Bacteria 1115
138 Ga0105238_10322650 3300009551 Bacteria 1530
139 Ga0105239_10064442 3300010375 Bacteria 4023
140 Ga0105239_10073005 3300010375 Bacteria 3773
141 Ga0105239_10260892 3300010375 Bacteria 1947
142 Ga0105246_10007939 3300011119 Bacteria 6514
143 Ga0157373_10040530 3300013100 Bacteria 3332
144 Ga0157373_10090517 3300013100 Bacteria 2155
145 Ga0157371_10000831 3300013102 Bacteria 35373
146 Ga0157371_10001008 3300013102 Bacteria 31048
147 Ga0157371_10002415 3300013102 Bacteria 17878
148 Ga0157371_10057539 3300013102 Bacteria 2757
149 Ga0157371_10312004 3300013102 Bacteria 1140
150 Ga0157371_10372588 3300013102 Bacteria 1042
151 Ga0157371_10865423 3300013102 Bacteria 684
152 Ga0157370_10002229 3300013104 Bacteria 23584
153 Ga0157370_10003126 3300013104 Bacteria 19609
154 Ga0157370_10072410 3300013104 Bacteria 3252
155 Ga0157370_11260168 3300013104 Bacteria 666
156 Ga0157369_10000956 3300013105 Bacteria 36674
157 Ga0157369_10001073 3300013105 Bacteria 34290
158 Ga0157369_10045170 3300013105 Bacteria 4793
159 Ga0157374_10232464 3300013296 Bacteria 1811
160 Ga0163162_10000472 3300013306 Bacteria 37342
161 Ga0163162_10048418 3300013306 Bacteria 4259
162 Ga0163162_10372059 3300013306 Bacteria 1562
163 Ga0157372_10000765 3300013307 Bacteria 34854
164 Ga0182008_10000095 3300014497 Bacteria 67716
165 Ga0182008_10036982 3300014497 Bacteria 2442
166 Ga0182008_10184156 3300014497 Bacteria 1058
167 Ga0182008_10346760 3300014497 Bacteria 787
168 Ga0182006_1000078 3300015261 Bacteria 123372
169 Ga0182006_1001153 3300015261 Bacteria 16680
170 Ga0182007_10000011 3300015262 Bacteria 264045
171 Ga0182007_10002930 3300015262 Bacteria 8288
172 Ga0182007_10004208 3300015262 Bacteria 6578
173 Ga0182007_10009926 3300015262 Bacteria 3795
174 Ga0182007_10013976 3300015262 Bacteria 3042
175 Ga0182007_10031584 3300015262 Bacteria 1802
176 Ga0182005_1024568 3300015265 Bacteria 1645
177 Ga0182005_1047140 3300015265 Bacteria 1171
178 Ga0182005_1061430 3300015265 Bacteria 1026
179 Ga0183366_1002 3300015679 Bacteria 791639
180 Ga0183370_1002 3300015680 Bacteria 791639
181 Ga0183369_1002 3300015685 Bacteria 791621
182 Ga0183368_1005 3300015687 Bacteria 791621
183 Ga0163161_10000001 3300017792 Bacteria 2041488
184 Ga0163161_10000002 3300017792 Bacteria 411983
185 Ga0163161_10000401 3300017792 Bacteria 36231
186 Ga0163161_10012634 3300017792 Bacteria 5866
187 Ga0209435_100095 3300025206 Bacteria 38810
188 Ga0209435_100238 3300025206 Bacteria 14828
189 Ga0209435_100272 3300025206 Bacteria 12618
190 Ga0209760_100001 3300025207 Bacteria 348781
191 Ga0209760_100002 3300025207 Bacteria 274743
192 Ga0209760_100086 3300025207 Bacteria 74006
193 Ga0209784_100001 3300025224 Bacteria 3600592
194 Ga0209784_100020 3300025224 Bacteria 412353
195 Ga0209784_100030 3300025224 Bacteria 327457
196 Ga0209566_100001 3300025225 Bacteria 3600765
197 Ga0209566_100020 3300025225 Bacteria 412353
198 Ga0209566_100034 3300025225 Bacteria 327457
199 Ga0209674_100002 3300025226 Bacteria 3600592
200 Ga0209674_100035 3300025226 Bacteria 412353
201 Ga0209674_100052 3300025226 Bacteria 327457
202 Ga0209672_100054 3300025228 Bacteria 222217
203 Ga0209672_108135 3300025228 Bacteria 1573
204 Ga0209672_108265 3300025228 Bacteria 1552
205 Ga0209147_100085 3300025229 Bacteria 185813
206 Ga0209563_100002 3300025230 Bacteria 2045675
207 Ga0209563_100008 3300025230 Bacteria 1554545
208 Ga0209563_100038 3300025230 Bacteria 412353
209 Ga0209563_100054 3300025230 Bacteria 327457
210 Ga0207427_100002 3300025231 Bacteria 1355321
211 Ga0207427_100012 3300025231 Bacteria 585657
212 Ga0207427_100035 3300025231 Bacteria 311526
213 Ga0207427_101046 3300025231 Bacteria 11503
214 Ga0209437_100001 3300025233 Bacteria 2045675
215 Ga0209437_100007 3300025233 Bacteria 938377
216 Ga0209437_100066 3300025233 Bacteria 327883
217 Ga0209437_100068 3300025233 Bacteria 311526
218 Ga0209258_100168 3300025242 Bacteria 145329
219 Ga0207425_1034697 3300025245 Bacteria 988
220 Ga0209646_1000309 3300025246 Bacteria 38810
221 Ga0209646_1000421 3300025246 Bacteria 23771
222 Ga0209646_1000457 3300025246 Bacteria 21282
223 Ga0209026_1000597 3300025250 Bacteria 23494
224 Ga0209026_1001273 3300025250 Bacteria 11473
225 Ga0209026_1003588 3300025250 Bacteria 5003
226 Ga0209677_100002 3300025253 Bacteria 2045675
227 Ga0209677_100004 3300025253 Bacteria 1554545
228 Ga0209677_100031 3300025253 Bacteria 329719
229 Ga0209677_100032 3300025253 Bacteria 327457
230 Ga0209148_1000119 3300025254 Bacteria 188079
231 Ga0209759_1000080 3300025256 Bacteria 171186
232 Ga0209759_1001557 3300025256 Bacteria 12531
233 Ga0209759_1004535 3300025256 Bacteria 5142
234 Ga0209129_1000103 3300025258 Bacteria 161305
235 Ga0209233_1000060 3300025261 Bacteria 412379
236 Ga0209233_1001041 3300025261 Bacteria 11642
237 Ga0209233_1014494 3300025261 Bacteria 2218
238 Ga0209455_1000217 3300025272 Bacteria 80610
239 Ga0209758_1008286 3300025297 Bacteria 6792
240 Ga0209050_1002778 3300025298 Bacteria 14031
241 Ga0207656_10556123 3300025321 Bacteria 585
242 Ga0207696_1000001 3300025711 Bacteria 2579611
243 Ga0207696_1000009 3300025711 Bacteria 564405
244 Ga0207696_1000026 3300025711 Bacteria 418166
245 Ga0207696_1000183 3300025711 Bacteria 97885
246 Ga0207696_1000278 3300025711 Bacteria 60620
247 Ga0207696_1000282 3300025711 Bacteria 59781
248 Ga0207696_1000483 3300025711 Bacteria 33546
249 Ga0207696_1000514 3300025711 Bacteria 32164
250 Ga0207696_1000556 3300025711 Bacteria 29660
251 Ga0207696_1001146 3300025711 Bacteria 15233
252 Ga0207696_1001258 3300025711 Bacteria 14239
253 Ga0207696_1001950 3300025711 Bacteria 10486
254 Ga0207696_1046832 3300025711 Bacteria 1247
255 Ga0207655_1000278 3300025728 Bacteria 79448
256 Ga0207655_1000318 3300025728 Bacteria 71503
257 Ga0207655_1000721 3300025728 Bacteria 37520
258 Ga0207655_1000752 3300025728 Bacteria 36357
259 Ga0207655_1003988 3300025728 Bacteria 10669
260 Ga0207655_1159074 3300025728 Bacteria 708
261 Ga0207713_1000123 3300025735 Bacteria 122033
262 Ga0207713_1000640 3300025735 Bacteria 33797
263 Ga0207713_1000713 3300025735 Bacteria 31052
264 Ga0207713_1001153 3300025735 Bacteria 22315
265 Ga0207713_1005125 3300025735 Bacteria 8292
266 Ga0207713_1011414 3300025735 Bacteria 4832
267 Ga0207713_1016672 3300025735 Bacteria 3720
268 Ga0207713_1030137 3300025735 Bacteria 2419
269 Ga0207713_1093872 3300025735 Bacteria 1048
270 Ga0207713_1110080 3300025735 Bacteria 938
271 Ga0207713_1140432 3300025735 Bacteria 789
272 Ga0207710_10000061 3300025900 Bacteria 166665
273 Ga0207654_10000007 3300025911 Bacteria 384211
274 Ga0207654_10000008 3300025911 Bacteria 375871
275 Ga0207695_10000442 3300025913 Bacteria 90842
276 Ga0207695_10058364 3300025913 Bacteria 4006
277 Ga0207695_10089178 3300025913 Bacteria 3101
278 Ga0207695_10183048 3300025913 Bacteria 2015
279 Ga0207671_10249302 3300025914 Bacteria 1396
280 Ga0207709_10000361 3300025935 Bacteria 45918
281 Ga0207667_10018177 3300025949 Bacteria 7891
282 Ga0207667_10491105 3300025949 Bacteria 1246
283 Ga0207712_10000045 3300025961 Bacteria 168093
284 Ga0207702_10000740 3300026078 Bacteria 34919
285 Ga0207674_10001229 3300026116 Bacteria 33433
286 Ga0207674_11003089 3300026116 Bacteria 804
287 Ga0209281_1000003 3300027111 Bacteria 1260089
288 Ga0209281_1000004 3300027111 Bacteria 1253949
289 Ga0209281_1000005 3300027111 Bacteria 1242284
290 Ga0209281_1000027 3300027111 Bacteria 463409
291 Ga0209281_1000089 3300027111 Bacteria 243650
292 Ga0209281_1000225 3300027111 Bacteria 120218
293 Ga0209281_1000308 3300027111 Bacteria 87362
294 Ga0209281_1000498 3300027111 Bacteria 53099
295 Ga0209281_1000707 3300027111 Bacteria 33791
296 Ga0209281_1000888 3300027111 Bacteria 25470
297 Ga0209281_1002170 3300027111 Bacteria 8563
298 Ga0209281_1005853 3300027111 Bacteria 3309
299 Ga0209281_1007005 3300027111 Bacteria 2861
300 Ga0209371_1000013 3300027312 Bacteria 691516
301 Ga0209371_1000019 3300027312 Bacteria 583561
302 Ga0209371_1000098 3300027312 Bacteria 155524
303 Ga0209371_1000143 3300027312 Bacteria 117814
304 Ga0209371_1000386 3300027312 Bacteria 46682
305 Ga0209371_1000499 3300027312 Bacteria 38097
306 Ga0209371_1000909 3300027312 Bacteria 23464
307 Ga0209371_1004289 3300027312 Bacteria 6310
308 Ga0209371_1004566 3300027312 Viruses 5935
309 Ga0209371_1010835 3300027312 Bacteria 2764
310 Ga0268266_10000041 3300028379 Bacteria 322311
311 Ga0268256_1000014 3300030500 Bacteria 691435
312 Ga0268256_1000024 3300030500 Bacteria 488637
313 Ga0268256_1000031 3300030500 Bacteria 425730
314 Ga0268256_1000113 3300030500 Bacteria 117659
315 Ga0268256_1000227 3300030500 Bacteria 60732
316 Ga0268256_1000425 3300030500 Bacteria 38097
317 Ga0268256_1001861 3300030500 Bacteria 11678
318 Ga0268256_1017731 3300030500 Bacteria 1996
319 Ga0268256_1084929 3300030500 Bacteria 585
320 Ga0265327_10000731 3300031251 Bacteria 51292
321 Ga0307408_100000048 3300031548 Bacteria 165579
322 Ga0307408_100000449 3300031548 Bacteria 36063
323 Ga0307406_10000508 3300031901 Bacteria 22370
324 Ga0307412_10001906 3300031911 Bacteria 11525
325 Ga0307412_10002563 3300031911 Bacteria 10091
326 Ga0307414_10432416 3300032004 Bacteria 1150
327 Ga0373942_0017960 3300035207 Viruses 1750
328 Ga0373931_0258573 3300035691 Viruses 1061
329 Ga0395898_0000339 3300037466 Bacteria 105864
330 Ga0395898_0000989 3300037466 Bacteria 44706
331 Ga0395898_0018155 3300037466 Bacteria 7179
332 Ga0395898_0256901 3300037466 Bacteria 1666
333 Ga0395901_0000631 3300038443 Bacteria 40942
334 Ga0395901_0000970 3300038443 Bacteria 31192
335 Ga0395901_0005549 3300038443 Bacteria 12777
336 Ga0436361_0307909 3300039447 Bacteria 733
337 Ga0436361_0952169 3300039447 Bacteria 2715
338 Ga0439438_000119 3300041405 Bacteria 35892
339 Ga0439438_024716 3300041405 Bacteria 1643
340 Ga0451797_0932188 3300041453 Bacteria 1493
341 Ga0451853_0054418 3300041512 Bacteria 1568
342 Ga0439442_006327 3300042002 Bacteria 2377
343 Ga0439432_000064 3300042006 Bacteria 32779
344 Ga0439432_000096 3300042006 Bacteria 28211
345 Ga0439432_041459 3300042006 Bacteria 1457
346 Ga0439432_094566 3300042006 Bacteria 897
347 Ga0439451_007981 3300042009 Bacteria 2147
348 Ga0439452_000121 3300042010 Bacteria 60858
349 Ga0439452_000191 3300042010 Bacteria 45233
350 Ga0439452_001388 3300042010 Bacteria 9968
351 Ga0439456_050393 3300042013 Bacteria 909
352 Ga0450902_033954 3300042137 Bacteria 862
353 Ga0450893_0005128 3300042532 Bacteria 2095
354 Ga0466969_0000161 3300044656 Bacteria 36432
355 Ga0466969_0006948 3300044656 Bacteria 6022
356 Ga0466973_0025317 3300044659 Bacteria 5690
357 Ga0466982_0011981 3300044672 Bacteria 4590
358 Ga0466965_0001101 3300044683 Bacteria 10531
359 Ga0466966_0000025 3300044684 Bacteria 107839
360 Ga0466966_0003497 3300044684 Bacteria 10357
361 Ga0466966_0155178 3300044684 Bacteria 1395
362 Ga0466961_0000141 3300044693 Bacteria 48686
363 Ga0466961_0000262 3300044693 Bacteria 35089
364 Ga0466961_0000540 3300044693 Bacteria 24121
365 Ga0466961_0024229 3300044693 Bacteria 3904
366 Ga0466961_0058647 3300044693 Bacteria 2449
367 Ga0466970_0000214 3300044765 Bacteria 28327
368 Ga0466970_0000336 3300044765 Bacteria 22984
369 Ga0466957_0236160 3300044842 Bacteria 1212
370 Ga0466959_0000350 3300045049 Bacteria 27331
371 Ga0466959_0000539 3300045049 Bacteria 21973
372 Ga0466959_0000714 3300045049 Bacteria 19396
373 Ga0466959_0001300 3300045049 Bacteria 15125
374 Ga0466958_0220685 3300045836 Bacteria 1209
375 Ga0466967_0122764 3300045976 Bacteria 2403
376 Ga0466967_0175298 3300045976 Bacteria 2020
377 Ga0495591_000003 3300046458 Bacteria 449825
378 Ga0495638_0001517 3300046460 Bacteria 20889
379 Ga0495638_0001900 3300046460 Bacteria 18017
380 Ga0495651_0000584 3300046462 Bacteria 28298
381 Ga0495651_0001320 3300046462 Bacteria 19220
382 Ga0495651_0004825 3300046462 Bacteria 10317
383 Ga0495651_0016272 3300046462 Bacteria 5759
384 Ga0495651_0086642 3300046462 Bacteria 2356
385 Ga0495651_0229446 3300046462 Bacteria 1279
386 Ga0495653_0000359 3300046463 Bacteria 36889
387 Ga0495653_0044014 3300046463 Bacteria 3467
388 Ga0495653_0683738 3300046463 Bacteria 624
389 Ga0495650_0000004 3300046471 Bacteria 779487
390 Ga0495650_0000018 3300046471 Bacteria 538888
391 Ga0495650_0000040 3300046471 Bacteria 366254
392 Ga0495650_0000120 3300046471 Bacteria 184191
393 Ga0495650_0000134 3300046471 Bacteria 173331
394 Ga0495584_0000415 3300046491 Bacteria 29392
395 Ga0495584_0001174 3300046491 Bacteria 16110
396 Ga0495607_0000489 3300046501 Bacteria 39617
397 Ga0495583_0000877 3300046506 Bacteria 36406
398 Ga0495606_0000975 3300046507 Bacteria 41812
399 Ga0495606_0008041 3300046507 Bacteria 9259
400 Ga0495606_0036475 3300046507 Bacteria 3348
401 Ga0495610_0000571 3300046512 Bacteria 36691
402 Ga0495610_0000820 3300046512 Bacteria 29146
403 Ga0495620_0000975 3300046515 Bacteria 17628
404 Ga0495628_0002729 3300046516 Bacteria 15781
405 Ga0495628_0003945 3300046516 Bacteria 13211
406 Ga0495628_0098920 3300046516 Bacteria 2253
407 Ga0495631_0006505 3300046518 Bacteria 6028
408 Ga0495632_0000402 3300046519 Bacteria 40770
409 Ga0495637_0000343 3300046520 Bacteria 35765
410 Ga0495637_0000405 3300046520 Bacteria 31961
411 Ga0495643_0000738 3300046522 Bacteria 37218
412 Ga0495643_0026195 3300046522 Bacteria 3292
413 Ga0495652_0003827 3300046529 Bacteria 14689
414 Ga0495652_0014602 3300046529 Bacteria 7041
415 Ga0495652_0025075 3300046529 Bacteria 5277
416 Ga0495652_0027051 3300046529 Bacteria 5058
417 Ga0495652_0028063 3300046529 Bacteria 4957
418 Ga0495652_0276913 3300046529 Bacteria 1230
419 Ga0495652_0433642 3300046529 Bacteria 923
420 Ga0495654_0000148 3300046530 Bacteria 72863
421 Ga0495654_0000204 3300046530 Bacteria 56840
422 Ga0495654_0059316 3300046530 Bacteria 1843
423 Ga0495654_0115099 3300046530 Bacteria 1223
424 Ga0495587_0000236 3300046536 Bacteria 40903
425 Ga0495597_0000203 3300046542 Bacteria 54510
426 Ga0495597_0001645 3300046542 Bacteria 15607
427 Ga0495645_0047290 3300046543 Bacteria 3135
428 Ga0495645_0229928 3300046543 Bacteria 1243
429 Ga0495645_0275565 3300046543 Bacteria 1108
430 Ga0495622_0004878 3300046557 Bacteria 6211
431 Ga0495633_0003275 3300046558 Bacteria 10898
432 Ga0495668_0000748 3300046616 Bacteria 38582
433 Ga0495588_0055375 3300046674 Bacteria 2047
434 Ga0495599_0136560 3300046678 Bacteria 1522
435 Ga0495623_0000602 3300046679 Bacteria 23961
436 Ga0495623_0056513 3300046679 Bacteria 2470
437 Ga0495623_0087091 3300046679 Bacteria 1924
438 Ga0495646_0000079 3300046680 Bacteria 46003
439 Ga0495646_0002475 3300046680 Bacteria 11354
440 Ga0495646_0017962 3300046680 Bacteria 4481
441 Ga0495669_0161098 3300046684 Bacteria 1065
442 Ga0495613_0028473 3300046689 Bacteria 4155
443 Ga0495624_0203109 3300046690 Bacteria 1204
444 Ga0495671_0000411 3300046692 Bacteria 34432
445 Ga0495671_0000431 3300046692 Bacteria 33266
446 Ga0495649_0004680 3300046694 Bacteria 8885
447 Ga0495649_0487720 3300046694 Bacteria 613
448 Ga0495589_0000002 3300046794 Bacteria 758846
449 Ga0495589_0000023 3300046794 Bacteria 195535
450 Ga0495589_0169824 3300046794 Bacteria 1037
451 Ga0495660_0000004 3300046810 Bacteria 1003183
452 Ga0495660_0000063 3300046810 Bacteria 129364
453 Ga0495660_0052350 3300046810 Bacteria 2218
454 Ga0495604_0000426 3300047317 Bacteria 37917
455 Ga0495604_0389990 3300047317 Bacteria 919
456 Ga0495672_0032853 3300047320 Bacteria 3221
457 Ga0495676_0000502 3300047321 Bacteria 32036
458 Ga0495680_0000249 3300047322 Bacteria 59690
459 Ga0495683_0000401 3300047323 Bacteria 34825
460 Ga0495673_0000692 3300047469 Bacteria 32966
461 Ga0495681_0163100 3300047470 Bacteria 927
462 Ga0495686_0002990 3300047472 Bacteria 15046
463 Ga0495602_0121623 3300048088 Bacteria 2099
464 Ga0495602_0403483 3300048088 Bacteria 974
465 Ga0495626_0069406 3300048091 Bacteria 1587
466 Ga0496101_0013446 3300048904 Bacteria 5485
467 Ga0496102_0392834 3300048905 Bacteria 1305
468 Ga0496104_0001702 3300048907 Bacteria 18996
469 Ga0496104_0124340 3300048907 Bacteria 2476
470 Ga0496104_0319140 3300048907 Bacteria 1466
471 Ga0496104_0449130 3300048907 Bacteria 1201
472 Ga0496104_1040440 3300048907 Bacteria 722
473 Ga0496105_0033134 3300048908 Bacteria 4241
474 Ga0496105_0434972 3300048908 Bacteria 1037
475 Ga0496113_0947977 3300048916 Bacteria 679
476 Ga0496116_0000015 3300048919 Bacteria 560702
477 Ga0496116_0000016 3300048919 Bacteria 555146
478 Ga0496116_0000023 3300048919 Bacteria 475792
479 Ga0496116_0000096 3300048919 Bacteria 202230
480 Ga0496116_0000106 3300048919 Bacteria 188941
481 Ga0496116_0000920 3300048919 Bacteria 36387
482 Ga0496116_0000964 3300048919 Bacteria 35524
483 Ga0496116_0001483 3300048919 Bacteria 26200
484 Ga0496116_0008086 3300048919 Bacteria 9194
485 Ga0496116_0010478 3300048919 Bacteria 7761
486 Ga0496116_0042350 3300048919 Bacteria 3114
487 Ga0496116_0117786 3300048919 Bacteria 1544
488 Ga0496116_0199563 3300048919 Bacteria 1048
489 Ga0496116_0250806 3300048919 Bacteria 881
490 Ga0496117_0000032 3300048920 Bacteria 375533
491 Ga0496117_0000267 3300048920 Bacteria 98737
492 Ga0496117_0000709 3300048920 Bacteria 52851
493 Ga0496117_0001102 3300048920 Bacteria 40740
494 Ga0496117_0001134 3300048920 Bacteria 40197
495 Ga0496117_0001231 3300048920 Bacteria 38343
496 Ga0496117_0001457 3300048920 Bacteria 34106
497 Ga0496117_0001550 3300048920 Bacteria 32632
498 Ga0496117_0002805 3300048920 Bacteria 21246
499 Ga0496117_0004178 3300048920 Bacteria 16147
500 Ga0496117_0004935 3300048920 Bacteria 14331
501 Ga0496117_0007809 3300048920 Bacteria 10307
502 Ga0496117_0017639 3300048920 Bacteria 5955
503 Ga0496117_0033208 3300048920 Bacteria 3905
504 Ga0496117_0091424 3300048920 Bacteria 1957
505 Ga0496117_0115698 3300048920 Bacteria 1659
506 Ga0496117_0122497 3300048920 Bacteria 1594
507 Ga0496118_0000027 3300048921 Bacteria 375533
508 Ga0496118_0000157 3300048921 Bacteria 121411
509 Ga0496118_0000924 3300048921 Bacteria 45908
510 Ga0496118_0001390 3300048921 Bacteria 36480
511 Ga0496118_0001622 3300048921 Bacteria 33213
512 Ga0496118_0001913 3300048921 Bacteria 29615
513 Ga0496118_0003304 3300048921 Bacteria 20474
514 Ga0496118_0004692 3300048921 Bacteria 16018
515 Ga0496118_0004808 3300048921 Bacteria 15758
516 Ga0496118_0005577 3300048921 Bacteria 14249
517 Ga0496118_0005926 3300048921 Bacteria 13669
518 Ga0496118_0010360 3300048921 Bacteria 9237
519 Ga0496118_0011547 3300048921 Bacteria 8605
520 Ga0496118_0011871 3300048921 Bacteria 8440
521 Ga0496118_0013258 3300048921 Bacteria 7815
522 Ga0496118_0014769 3300048921 Bacteria 7286
523 Ga0496118_0025535 3300048921 Bacteria 5061
524 Ga0496118_0080045 3300048921 Bacteria 2301
525 Ga0496118_0083086 3300048921 Bacteria 2240
526 Ga0496118_0140637 3300048921 Bacteria 1530
527 Ga0496118_0151258 3300048921 Bacteria 1452
528 Ga0496118_0153443 3300048921 Bacteria 1437
529 Ga0496118_0301506 3300048921 Bacteria 879
530 Ga0496118_0308677 3300048921 Bacteria 864
531 Ga0496118_0316182 3300048921 Bacteria 849
532 Ga0496119_0000031 3300048922 Bacteria 239685
533 Ga0496119_0000355 3300048922 Bacteria 64264
534 Ga0496119_0000739 3300048922 Bacteria 44001
535 Ga0496119_0000907 3300048922 Bacteria 38493
536 Ga0496119_0001152 3300048922 Bacteria 33163
537 Ga0496119_0002104 3300048922 Bacteria 22453
538 Ga0496119_0002846 3300048922 Bacteria 18486
539 Ga0496119_0003311 3300048922 Bacteria 16813
540 Ga0496119_0013751 3300048922 Bacteria 6409
541 Ga0496119_0024199 3300048922 Bacteria 4278
542 Ga0496119_0026342 3300048922 Bacteria 4033
543 Ga0496119_0038689 3300048922 Bacteria 3078
544 Ga0496119_0084311 3300048922 Bacteria 1822
545 Ga0496119_0188982 3300048922 Bacteria 1074
546 Ga0496120_0000504 3300048923 Bacteria 60989
547 Ga0496120_0000751 3300048923 Bacteria 47018
548 Ga0496120_0000956 3300048923 Bacteria 39360
549 Ga0496120_0000990 3300048923 Bacteria 38462
550 Ga0496120_0001112 3300048923 Bacteria 34967
551 Ga0496120_0001186 3300048923 Bacteria 33163
552 Ga0496120_0001422 3300048923 Bacteria 28874
553 Ga0496120_0001487 3300048923 Bacteria 27813
554 Ga0496120_0001612 3300048923 Bacteria 26155
555 Ga0496120_0002785 3300048923 Bacteria 16968
556 Ga0496120_0003972 3300048923 Bacteria 12857
557 Ga0496120_0025527 3300048923 Bacteria 3665
558 Ga0496120_0029605 3300048923 Bacteria 3342
559 Ga0496120_0031750 3300048923 Bacteria 3193
560 Ga0496120_0039180 3300048923 Bacteria 2798
561 Ga0496120_0039371 3300048923 Bacteria 2789
562 Ga0496120_0110882 3300048923 Bacteria 1434
563 Ga0496120_0146057 3300048923 Bacteria 1194
564 Ga0496120_0180536 3300048923 Bacteria 1036
565 Ga0496120_0453189 3300048923 Bacteria 558
566 Ga0496121_0000966 3300048924 Bacteria 51632
567 Ga0496121_0001746 3300048924 Bacteria 35496
568 Ga0496121_0001898 3300048924 Bacteria 33488
569 Ga0496121_0002058 3300048924 Bacteria 31836
570 Ga0496121_0002267 3300048924 Bacteria 29935
571 Ga0496121_0002434 3300048924 Bacteria 28458
572 Ga0496121_0002824 3300048924 Bacteria 25673
573 Ga0496121_0003949 3300048924 Bacteria 20498
574 Ga0496121_0004831 3300048924 Bacteria 17742
575 Ga0496121_0004879 3300048924 Bacteria 17615
576 Ga0496121_0005647 3300048924 Bacteria 15913
577 Ga0496121_0007869 3300048924 Bacteria 12749
578 Ga0496121_0010079 3300048924 Bacteria 10722
579 Ga0496121_0019866 3300048924 Bacteria 6690
580 Ga0496121_0021928 3300048924 Bacteria 6230
581 Ga0496121_0085984 3300048924 Bacteria 2472
582 Ga0496121_0092247 3300048924 Bacteria 2361
583 Ga0496121_0102823 3300048924 Bacteria 2199
584 Ga0496121_0113147 3300048924 Bacteria 2066
585 Ga0496122_0000007 3300048925 Bacteria 606493
586 Ga0496122_0000058 3300048925 Bacteria 248805
587 Ga0496122_0000213 3300048925 Bacteria 129218
588 Ga0496122_0000481 3300048925 Bacteria 82890
589 Ga0496122_0001389 3300048925 Bacteria 39277
590 Ga0496122_0001704 3300048925 Bacteria 34075
591 Ga0496122_0002444 3300048925 Bacteria 26332
592 Ga0496122_0019323 3300048925 Bacteria 6229
593 Ga0496122_0021002 3300048925 Bacteria 5865
594 Ga0496122_0039628 3300048925 Bacteria 3754
595 Ga0496122_0062450 3300048925 Bacteria 2727
596 Ga0496122_0093465 3300048925 Bacteria 2039
597 Ga0496122_0100332 3300048925 Bacteria 1937
598 Ga0496122_0154564 3300048925 Bacteria 1410
599 Ga0496122_0241495 3300048925 Bacteria 1018
600 Ga0496123_0000004 3300048926 Bacteria 777230
601 Ga0496123_0000044 3300048926 Bacteria 253396
602 Ga0496123_0000177 3300048926 Bacteria 129218
603 Ga0496123_0000385 3300048926 Bacteria 82890
604 Ga0496123_0002001 3300048926 Bacteria 26332
605 Ga0496123_0002601 3300048926 Bacteria 21934
606 Ga0496123_0003398 3300048926 Bacteria 17924
607 Ga0496123_0004536 3300048926 Bacteria 14502
608 Ga0496123_0005130 3300048926 Bacteria 13356
609 Ga0496123_0080977 3300048926 Bacteria 1975
610 Ga0496123_0206404 3300048926 Viruses 1002
611 Ga0496124_0000021 3300048927 Bacteria 432123
612 Ga0496124_0000026 3300048927 Bacteria 385387
613 Ga0496124_0000105 3300048927 Bacteria 176783
614 Ga0496124_0000369 3300048927 Bacteria 82290
615 Ga0496124_0000371 3300048927 Bacteria 82246
616 Ga0496124_0000496 3300048927 Bacteria 67552
617 Ga0496124_0000995 3300048927 Bacteria 44930
618 Ga0496124_0001955 3300048927 Bacteria 28142
619 Ga0496124_0001962 3300048927 Bacteria 28115
620 Ga0496124_0015316 3300048927 Bacteria 7359
621 Ga0496124_0019462 3300048927 Bacteria 6317
622 Ga0496124_0027299 3300048927 Bacteria 5127
623 Ga0496124_0048518 3300048927 Bacteria 3627
624 Ga0496124_0061501 3300048927 Bacteria 3147
625 Ga0496124_0082203 3300048927 Bacteria 2644
626 Ga0496124_0096772 3300048927 Bacteria 2397
627 Ga0496124_0121104 3300048927 Bacteria 2091
628 Ga0496124_0158159 3300048927 Bacteria 1769
629 Ga0496124_0218282 3300048927 Bacteria 1436
630 Ga0496124_0303583 3300048927 Bacteria 1151
631 Ga0496124_0379214 3300048927 Bacteria 989
632 Ga0496124_0590702 3300048927 Bacteria 724
633 Ga0496125_0000013 3300048928 Bacteria 628761
634 Ga0496125_0000817 3300048928 Bacteria 50621
635 Ga0496125_0000943 3300048928 Bacteria 45676
636 Ga0496125_0001468 3300048928 Bacteria 34158
637 Ga0496125_0001940 3300048928 Bacteria 28254
638 Ga0496125_0004263 3300048928 Bacteria 16642
639 Ga0496125_0007212 3300048928 Bacteria 11850
640 Ga0496125_0008382 3300048928 Bacteria 10831
641 Ga0496125_0009178 3300048928 Bacteria 10220
642 Ga0496125_0063522 3300048928 Bacteria 2943
643 Ga0496126_0000825 3300048929 Bacteria 55137
644 Ga0496126_0000991 3300048929 Bacteria 48453
645 Ga0496126_0001761 3300048929 Bacteria 32026
646 Ga0496126_0001846 3300048929 Bacteria 30902
647 Ga0496126_0002139 3300048929 Bacteria 27526
648 Ga0496126_0002237 3300048929 Bacteria 26749
649 Ga0496126_0002435 3300048929 Bacteria 25143
650 Ga0496126_0002847 3300048929 Bacteria 22634
651 Ga0496126_0004611 3300048929 Bacteria 16346
652 Ga0496126_0005286 3300048929 Bacteria 14816
653 Ga0496126_0008756 3300048929 Bacteria 10862
654 Ga0496126_0009982 3300048929 Bacteria 10024
655 Ga0496126_0013680 3300048929 Bacteria 8237
656 Ga0496126_0014330 3300048929 Bacteria 8016
657 Ga0496126_0022894 3300048929 Bacteria 6065
658 Ga0496126_0025887 3300048929 Bacteria 5634
659 Ga0496126_0035423 3300048929 Bacteria 4678
660 Ga0496126_0066047 3300048929 Bacteria 3235
661 Ga0496126_0069727 3300048929 Bacteria 3134
662 Ga0496126_0081540 3300048929 Bacteria 2859
663 Ga0496126_0098017 3300048929 Bacteria 2569
664 Ga0496126_0132206 3300048929 Bacteria 2156
665 Ga0496126_0207150 3300048929 Bacteria 1652
666 Ga0496126_0246123 3300048929 Bacteria 1491
667 Ga0496126_0335186 3300048929 Bacteria 1240
668 Ga0496126_0437196 3300048929 Bacteria 1055
669 Ga0496126_0739583 3300048929 Bacteria 760
670 Ga0495678_000305 3300049459 Bacteria 53082
671 Ga0495678_000710 3300049459 Bacteria 30279
672 Ga0495678_000946 3300049459 Bacteria 25181
673 Ga0495682_0001447 3300049460 Bacteria 12827
674 Ga0495682_0135733 3300049460 Bacteria 879
675 Ga0501044_0116200 3300049823 Bacteria 2681
676 nmdc:mga00v17_205511_c1 3300050491 Bacteria 1274
677 nmdc:mga00v17_4713_c1 3300050491 Bacteria 7126
678 nmdc:mga00v17_810_c1 3300050491 Bacteria 17005
679 Ga0500618_000322 3300053125 Bacteria 35172
680 Ga0500574_116528 3300053141 Bacteria 790
681 Ga0500619_000458 3300053154 Bacteria 7205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035207 Ga0373942_0017960 Ga0373942_0017960_196_705 136
2 3300035691 Ga0373931_0258573 Ga0373931_0258573_293_802 137
3 3300010375 Ga0105239_10073005 Ga0105239_100730054 140
4 3300015261 Ga0182006_1000078 Ga0182006_100007865 148
5 3300048920 Ga0496117_0000032 Ga0496117_0000032_137551_138060 148
6 3300048921 Ga0496118_0000027 Ga0496118_0000027_237474_237983 148
7 3300002704 JGI25155J39150_1000976 JGI25155J39150_10009761 150
8 3300002704 JGI25155J39150_1002784 JGI25155J39150_10027842 150
9 3300002705 JGI25156J39149_1003570 JGI25156J39149_10035706 150
10 3300002705 JGI25156J39149_1003652 JGI25156J39149_10036526 150
11 3300002738 JGI25154J39366_1002333 JGI25154J39366_10023336 150
12 3300002738 JGI25154J39366_1002373 JGI25154J39366_10023733 150
13 3300002741 JGI25157J39369_1002598 JGI25157J39369_10025983 150
14 3300002741 JGI25157J39369_1002608 JGI25157J39369_10026083 150
15 3300002741 JGI25157J39369_1006293 JGI25157J39369_10062933 150
16 3300009093 Ga0105240_10275341 Ga0105240_102753412 150
17 3300009093 Ga0105240_11197416 Ga0105240_111974161 150
18 3300009551 Ga0105238_10322650 Ga0105238_103226504 150
19 3300025206 Ga0209435_100238 Ga0209435_1002384 150
20 3300025206 Ga0209435_100272 Ga0209435_1002724 150
21 3300025246 Ga0209646_1000421 Ga0209646_10004214 150
22 3300025246 Ga0209646_1000457 Ga0209646_10004574 150
23 3300025250 Ga0209026_1001273 Ga0209026_10012734 150
24 3300025250 Ga0209026_1003588 Ga0209026_10035884 150
25 3300025256 Ga0209759_1001557 Ga0209759_10015574 150
26 3300025256 Ga0209759_1004535 Ga0209759_10045354 150
27 3300025913 Ga0207695_10058364 Ga0207695_100583644 150
28 3300025913 Ga0207695_10089178 Ga0207695_100891783 150
29 3300025913 Ga0207695_10183048 Ga0207695_101830482 150
30 3300046471 Ga0495650_0000134 Ga0495650_0000134_18568_19080 151
31 3300048925 Ga0496122_0001704 Ga0496122_0001704_2262_2771 152
32 3300048926 Ga0496123_0005130 Ga0496123_0005130_6706_7215 152
33 3300009092 Ga0105250_10000430 Ga0105250_1000043034 154
34 3300009177 Ga0105248_11158945 Ga0105248_111589452 154
35 3300025711 Ga0207696_1000282 Ga0207696_100028264 154
36 3300046471 Ga0495650_0000018 Ga0495650_0000018_346646_347164 154
37 3300046810 Ga0495660_0000004 Ga0495660_0000004_594481_594999 154
38 3300048925 Ga0496122_0000007 Ga0496122_0000007_564587_565105 154
39 3300048926 Ga0496123_0000004 Ga0496123_0000004_212125_212643 154
40 3300048929 Ga0496126_0004611 Ga0496126_0004611_13082_13600 154
41 3300015262 Ga0182007_10000011 Ga0182007_10000011137 157
42 3300046558 Ga0495633_0003275 Ga0495633_0003275_3665_4174 157
43 3300048919 Ga0496116_0250806 Ga0496116_0250806_211_720 157
44 3300048924 Ga0496121_0113147 Ga0496121_0113147_1124_1633 157
45 3300015261 Ga0182006_1001153 Ga0182006_10011534 158
46 3300046463 Ga0495653_0683738 Ga0495653_0683738_125_601 158
47 3300048923 Ga0496120_0453189 Ga0496120_0453189_14_493 159
48 3300048927 Ga0496124_0001962 Ga0496124_0001962_19647_20126 159
49 3300048929 Ga0496126_0132206 Ga0496126_0132206_1379_1858 159
50 3300013100 Ga0157373_10090517 Ga0157373_100905171 161
51 3300048916 Ga0496113_0947977 Ga0496113_0947977_59_544 161
52 3300048920 Ga0496117_0001550 Ga0496117_0001550_21087_21572 161
53 3300048921 Ga0496118_0005926 Ga0496118_0005926_10747_11232 161
54 3300048921 Ga0496118_0316182 Ga0496118_0316182_18_503 161
55 3300048922 Ga0496119_0188982 Ga0496119_0188982_17_502 161
56 3300050491 nmdc:mga00v17_205511_c1 nmdc:mga00v17_205511_c1_18_503 161
57 3300042010 Ga0439452_000121 Ga0439452_000121_27006_27497 163
58 3300048908 Ga0496105_0434972 Ga0496105_0434972_393_884 163
59 3300048919 Ga0496116_0199563 Ga0496116_0199563_540_1031 163
60 3300048920 Ga0496117_0122497 Ga0496117_0122497_587_1078 163
61 3300048921 Ga0496118_0080045 Ga0496118_0080045_1194_1685 163
62 3300048922 Ga0496119_0000355 Ga0496119_0000355_27032_27523 163
63 3300048923 Ga0496120_0025527 Ga0496120_0025527_3003_3494 163
64 3300048925 Ga0496122_0093465 Ga0496122_0093465_340_831 163
65 3300048926 Ga0496123_0206404 Ga0496123_0206404_300_791 163
66 3300048927 Ga0496124_0000496 Ga0496124_0000496_26586_27077 163
67 3300048928 Ga0496125_0063522 Ga0496125_0063522_1259_1750 163
68 3300048929 Ga0496126_0009982 Ga0496126_0009982_2109_2600 163
69 iso_pu_bacteria 2847085930 2847089202 164
70 iso_pu_bacteria 2879163058 2879166691 164
71 iso_pu_bacteria 2928968154 2928969522 164
72 iso_pu_bacteria 2984564862 2984565640 164
73 iso_pu_bacteria 2501025502 2501085326 165
74 iso_pu_bacteria 2506520007 2506576825 165
75 iso_pu_bacteria 2506520008 2506581963 165
76 iso_pu_bacteria 2508501071 2508850791 165
77 iso_pu_bacteria 2508501071 2508854265 165
78 iso_pu_bacteria 2510917013 2511090750 165
79 iso_pu_bacteria 2547132374 2548501171 165
80 iso_pu_bacteria 2585427591 2585825722 165
81 iso_pu_bacteria 2585427591 2585826121 165
82 iso_pu_bacteria 2585427592 2585831905 165
83 iso_pu_bacteria 2599185239 2599734952 165
84 iso_pu_bacteria 2643221717 2644645737 165
85 iso_pu_bacteria 2654587920 2656276206 165
86 iso_pu_bacteria 2667528173 2671106371 165
87 iso_pu_bacteria 2667528173 2671109673 165
88 iso_pu_bacteria 2687453601 2689443219 165
89 iso_pu_bacteria 2687453601 2689444204 165
90 iso_pu_bacteria 2721755523 2722884706 165
91 iso_pu_bacteria 2734482258 2735816095 165
92 iso_pu_bacteria 2734482258 2735817191 165
93 iso_pu_bacteria 2765235838 2765571211 165
94 iso_pu_bacteria 2806310673 2807177564 165
95 iso_pu_bacteria 2818991436 2819540886 165
96 iso_pu_bacteria 2818991436 2819544533 165
97 iso_pu_bacteria 2839138175 2839138586 165
98 iso_pu_bacteria 2856287931 2856288846 165
99 iso_pu_bacteria 2857547612 2857551981 165
100 iso_pu_bacteria 2869551831 2869552625 165
101 iso_pu_bacteria 2883087390 2883092753 165
102 iso_pu_bacteria 2885080285 2885082454 165
103 iso_pu_bacteria 2885080285 2885084552 165
104 iso_pu_bacteria 2888366609 2888368266 165
105 iso_pu_bacteria 2904434214 2904437937 165
106 iso_pu_bacteria 2904474040 2904474488 165
107 iso_pu_bacteria 2904474040 2904477976 165
108 iso_pu_bacteria 2904474040 2904478094 165
109 iso_pu_bacteria 2904564687 2904569441 165
110 iso_pu_bacteria 2904571731 2904576722 165
111 iso_pu_bacteria 2919150387 2919150834 165
112 iso_pu_bacteria 2919150387 2919153942 165
113 iso_pu_bacteria 2919150387 2919154060 165
114 iso_pu_bacteria 2927143783 2927145708 165
115 iso_pu_bacteria 2927143783 2927147479 165
116 iso_pu_bacteria 2927143783 2927147597 165
117 iso_pu_bacteria 2932410948 2932413951 165
118 iso_pu_bacteria 2932416698 2932418011 165
119 iso_pu_bacteria 640753048 640936377 165
120 3300048922 Ga0496119_0000031 Ga0496119_0000031_208777_209280 166
121 3300048923 Ga0496120_0000751 Ga0496120_0000751_44051_44554 166
122 3300048927 Ga0496124_0000371 Ga0496124_0000371_12963_13463 166
123 iso_pu_bacteria 2952252522 2952255873 166
124 3300046507 Ga0495606_0036475 Ga0495606_0036475_1936_2439 167
125 iso_pu_bacteria 2643221565 2643840827 167
126 iso_pu_bacteria 2643221621 2644119464 167
127 iso_pu_bacteria 2806310673 2807176596 167
128 iso_pu_bacteria 2846540461 2846544927 167
129 iso_pu_bacteria 2869551831 2869553805 167
130 iso_pu_bacteria 2904504865 2904505934 167
131 iso_pu_bacteria 8055693939 8055695479 167
132 3300002704 JGI25155J39150_1000118 JGI25155J39150_100011832 168
133 3300002705 JGI25156J39149_1007371 JGI25156J39149_10073712 168
134 3300002738 JGI25154J39366_1000164 JGI25154J39366_100016450 168
135 3300002741 JGI25157J39369_1006484 JGI25157J39369_10064842 168
136 3300009036 Ga0105244_10073680 Ga0105244_100736802 168
137 3300009545 Ga0105237_10301891 Ga0105237_103018914 168
138 3300025206 Ga0209435_100095 Ga0209435_10009524 168
139 3300025246 Ga0209646_1000309 Ga0209646_100030924 168
140 3300025250 Ga0209026_1000597 Ga0209026_10005974 168
141 3300025256 Ga0209759_1000080 Ga0209759_1000080154 168
142 3300025298 Ga0209050_1002778 Ga0209050_100277814 168
143 3300025914 Ga0207671_10249302 Ga0207671_102493022 168
144 3300026116 Ga0207674_11003089 Ga0207674_110030891 168
145 3300027312 Ga0209371_1000098 Ga0209371_100009854 168
146 3300027312 Ga0209371_1004566 Ga0209371_10045666 168
147 3300030500 Ga0268256_1000031 Ga0268256_100003188 168
148 3300031911 Ga0307412_10001906 Ga0307412_100019068 168
149 3300046530 Ga0495654_0059316 Ga0495654_0059316_34_543 168
150 3300048919 Ga0496116_0000106 Ga0496116_0000106_57033_57542 168
151 3300048921 Ga0496118_0025535 Ga0496118_0025535_1318_1824 168
152 3300048922 Ga0496119_0000907 Ga0496119_0000907_28777_29286 168
153 3300048923 Ga0496120_0000990 Ga0496120_0000990_28763_29272 168
154 3300048925 Ga0496122_0154564 Ga0496122_0154564_625_1131 168
155 3300048925 Ga0496122_0241495 Ga0496122_0241495_277_783 168
156 3300048926 Ga0496123_0004536 Ga0496123_0004536_6569_7075 168
157 3300049459 Ga0495678_000305 Ga0495678_000305_47029_47538 168
158 iso_pu_bacteria 2537561728 2538424410 168
159 iso_pu_bacteria 2547132181 2547698718 168
160 iso_pu_bacteria 2547132416 2548648668 168
161 iso_pu_bacteria 2561511199 2562463912 168
162 iso_pu_bacteria 2561511199 2562464491 168
163 iso_pu_bacteria 2600255256 2601533320 168
164 iso_pu_bacteria 2600255256 2601536658 168
165 iso_pu_bacteria 2600255257 2601538684 168
166 iso_pu_bacteria 2600255257 2601542030 168
167 iso_pu_bacteria 2600255310 2601757033 168
168 iso_pu_bacteria 2600255310 2601760390 168
169 iso_pu_bacteria 2600255311 2601761512 168
170 iso_pu_bacteria 2600255311 2601765745 168
171 iso_pu_bacteria 2602042046 2603639630 168
172 iso_pu_bacteria 2602042046 2603641676 168
173 iso_pu_bacteria 2602042047 2603644204 168
174 iso_pu_bacteria 2602042067 2603704803 168
175 iso_pu_bacteria 2667528172 2671104670 168
176 iso_pu_bacteria 2667528173 2671106869 168
177 iso_pu_bacteria 2681812866 2681997977 168
178 iso_pu_bacteria 2681812869 2682005509 168
179 iso_pu_bacteria 2681812869 2682008088 168
180 iso_pu_bacteria 2706794495 2707100363 168
181 iso_pu_bacteria 2751185917 2753857610 168
182 iso_pu_bacteria 2765235842 2765590715 168
183 iso_pu_bacteria 2791355010 2792314312 168
184 iso_pu_bacteria 2791355275 2793404029 168
185 iso_pu_bacteria 2811995292 2813727530 168
186 iso_pu_bacteria 2814123068 2814694286 168
187 iso_pu_bacteria 2814123068 2814695075 168
188 iso_pu_bacteria 2821118458 2821120597 168
189 iso_pu_bacteria 2823373977 2823376478 168
190 iso_pu_bacteria 2844425489 2844429073 168
191 iso_pu_bacteria 2854601825 2854605403 168
192 iso_pu_bacteria 2891670763 2891674819 168
193 iso_pu_bacteria 2891670763 2891674825 168
194 iso_pu_bacteria 2923634449 2923636605 168
195 iso_pu_bacteria 2927833300 2927836919 168
196 iso_pu_bacteria 2935625433 2935629185 168
197 iso_pu_bacteria 2937539931 2937543984 168
198 iso_pu_bacteria 2939617950 2939621775 168
199 iso_pu_bacteria 2939642701 2939645495 168
200 iso_pu_bacteria 2974310843 2974315057 168
201 iso_pu_bacteria 2974435778 2974439679 168
202 iso_pu_bacteria 3000376612 3000379512 168
203 iso_pu_bacteria 8018405270 8018406954 168
204 iso_pu_bacteria 8019504834 8019508907 168
205 2162886007 SwRhRL2b_contig_3769278 SwRhRL2b_0380.00000980 169
206 3300002737 JGI25162J39368_1000025 JGI25162J39368_1000025212 169
207 3300002737 JGI25162J39368_1000029 JGI25162J39368_100002926 169
208 3300002737 JGI25162J39368_1000035 JGI25162J39368_10000352 169
209 3300002737 JGI25162J39368_1000256 JGI25162J39368_10002562 169
210 3300002771 JGI25163J39215_1000022 JGI25163J39215_100002254 169
211 3300002771 JGI25163J39215_1000056 JGI25163J39215_10000562 169
212 3300002771 JGI25163J39215_1000086 JGI25163J39215_10000862 169
213 3300002772 JGI25164J39214_1000008 JGI25164J39214_100000826 169
214 3300002772 JGI25164J39214_1000019 JGI25164J39214_10000192 169
215 3300002772 JGI25164J39214_1000201 JGI25164J39214_100020156 169
216 3300003214 JGI25165J46597_1000054 JGI25165J46597_1000054213 169
217 3300003316 rootH1_10081081 rootH1_1008108114 169
218 3300003320 rootH2_10101949 rootH2_101019492 169
219 3300003751 Ga0055538_1000014 Ga0055538_100001426 169
220 3300003751 Ga0055538_1000019 Ga0055538_1000019225 169
221 3300003751 Ga0055538_1000026 Ga0055538_100002613 169
222 3300003751 Ga0055538_1000039 Ga0055538_10000392 169
223 3300003751 Ga0055538_1000139 Ga0055538_10001392 169
224 3300003752 Ga0055539_1000020 Ga0055539_1000020272 169
225 3300003752 Ga0055539_1000033 Ga0055539_100003313 169
226 3300003752 Ga0055539_1000050 Ga0055539_1000050167 169
227 3300003752 Ga0055539_1000189 Ga0055539_10001892 169
228 3300003756 Ga0055533_1000027 Ga0055533_100002726 169
229 3300003756 Ga0055533_1000044 Ga0055533_100004413 169
230 3300003756 Ga0055533_1000062 Ga0055533_10000622 169
231 3300003756 Ga0055533_1000190 Ga0055533_10001902 169
232 3300003758 Ga0055532_1000160 Ga0055532_100016047 169
233 3300003759 Ga0055525_1000032 Ga0055525_1000032272 169
234 3300003759 Ga0055525_1000052 Ga0055525_100005213 169
235 3300003759 Ga0055525_1000072 Ga0055525_1000072167 169
236 3300003759 Ga0055525_1000256 Ga0055525_10002562 169
237 3300003760 Ga0055527_1000174 Ga0055527_100017421 169
238 3300003761 Ga0055535_1000230 Ga0055535_100023047 169
239 3300003762 Ga0055542_1000249 Ga0055542_100024925 169
240 3300003763 Ga0055529_1000284 Ga0055529_100028447 169
241 3300003841 Ga0055541_1000014 Ga0055541_1000014272 169
242 3300003841 Ga0055541_1000038 Ga0055541_1000038167 169
243 3300003841 Ga0055541_1000049 Ga0055541_1000049129 169
244 3300003841 Ga0055541_1000124 Ga0055541_100012456 169
245 3300005289 Ga0065704_10002842 Ga0065704_1000284222 169
246 3300005289 Ga0065704_10076166 Ga0065704_100761665 169
247 3300005289 Ga0065704_10082104 Ga0065704_100821041 169
248 3300005289 Ga0065704_10153341 Ga0065704_101533412 169
249 3300005289 Ga0065704_10184005 Ga0065704_101840052 169
250 3300005289 Ga0065704_10260752 Ga0065704_102607522 169
251 3300005563 Ga0068855_100047686 Ga0068855_1000476863 169
252 3300005563 Ga0068855_100088927 Ga0068855_1000889272 169
253 3300005563 Ga0068855_100550690 Ga0068855_1005506902 169
254 3300005614 Ga0068856_100000138 Ga0068856_10000013826 169
255 3300005834 Ga0068851_10834611 Ga0068851_108346111 169
256 3300006946 Ga0079104_1000034 Ga0079104_100003493 169
257 3300006946 Ga0079104_1009062 Ga0079104_10090623 169
258 3300009011 Ga0105251_10014946 Ga0105251_100149464 169
259 3300009011 Ga0105251_10039336 Ga0105251_100393362 169
260 3300009036 Ga0105244_10000715 Ga0105244_100007158 169
261 3300009036 Ga0105244_10000932 Ga0105244_1000093224 169
262 3300009036 Ga0105244_10002520 Ga0105244_1000252015 169
263 3300009092 Ga0105250_10000611 Ga0105250_100006112 169
264 3300009092 Ga0105250_10001268 Ga0105250_1000126815 169
265 3300009092 Ga0105250_10003808 Ga0105250_100038087 169
266 3300009092 Ga0105250_10006704 Ga0105250_100067048 169
267 3300009092 Ga0105250_10020659 Ga0105250_100206593 169
268 3300009093 Ga0105240_10000241 Ga0105240_1000024193 169
269 3300009093 Ga0105240_10093292 Ga0105240_100932923 169
270 3300009093 Ga0105240_10429320 Ga0105240_104293202 169
271 3300009101 Ga0105247_10000301 Ga0105247_1000030131 169
272 3300009148 Ga0105243_10004315 Ga0105243_100043154 169
273 3300009174 Ga0105241_10000006 Ga0105241_10000006134 169
274 3300010375 Ga0105239_10064442 Ga0105239_100644422 169
275 3300010375 Ga0105239_10260892 Ga0105239_102608922 169
276 3300013102 Ga0157371_10001008 Ga0157371_1000100814 169
277 3300013102 Ga0157371_10057539 Ga0157371_100575392 169
278 3300013104 Ga0157370_10002229 Ga0157370_1000222913 169
279 3300013104 Ga0157370_10072410 Ga0157370_100724104 169
280 3300013105 Ga0157369_10001073 Ga0157369_1000107341 169
281 3300013296 Ga0157374_10232464 Ga0157374_102324642 169
282 3300013306 Ga0163162_10048418 Ga0163162_100484183 169
283 3300013306 Ga0163162_10372059 Ga0163162_103720594 169
284 3300014497 Ga0182008_10000095 Ga0182008_1000009545 169
285 3300015262 Ga0182007_10002930 Ga0182007_100029307 169
286 3300015262 Ga0182007_10013976 Ga0182007_100139764 169
287 3300015262 Ga0182007_10031584 Ga0182007_100315844 169
288 3300015265 Ga0182005_1024568 Ga0182005_10245682 169
289 3300017792 Ga0163161_10000002 Ga0163161_10000002348 169
290 3300017792 Ga0163161_10012634 Ga0163161_100126348 169
291 3300025207 Ga0209760_100001 Ga0209760_1000017 169
292 3300025207 Ga0209760_100002 Ga0209760_10000287 169
293 3300025207 Ga0209760_100086 Ga0209760_10008626 169
294 3300025224 Ga0209784_100001 Ga0209784_1000011269 169
295 3300025224 Ga0209784_100001 Ga0209784_1000012754 169
296 3300025224 Ga0209784_100020 Ga0209784_100020278 169
297 3300025224 Ga0209784_100030 Ga0209784_10003026 169
298 3300025225 Ga0209566_100001 Ga0209566_1000011269 169
299 3300025225 Ga0209566_100001 Ga0209566_1000012754 169
300 3300025225 Ga0209566_100020 Ga0209566_100020278 169
301 3300025225 Ga0209566_100034 Ga0209566_10003426 169
302 3300025226 Ga0209674_100002 Ga0209674_1000021269 169
303 3300025226 Ga0209674_100002 Ga0209674_1000022754 169
304 3300025226 Ga0209674_100035 Ga0209674_100035278 169
305 3300025226 Ga0209674_100052 Ga0209674_10005226 169
306 3300025228 Ga0209672_100054 Ga0209672_100054125 169
307 3300025228 Ga0209672_108135 Ga0209672_1081352 169
308 3300025228 Ga0209672_108265 Ga0209672_1082652 169
309 3300025229 Ga0209147_100085 Ga0209147_10008565 169
310 3300025230 Ga0209563_100002 Ga0209563_1000021289 169
311 3300025230 Ga0209563_100008 Ga0209563_1000081271 169
312 3300025230 Ga0209563_100038 Ga0209563_100038278 169
313 3300025230 Ga0209563_100054 Ga0209563_10005426 169
314 3300025231 Ga0207427_100002 Ga0207427_1000027 169
315 3300025231 Ga0207427_100012 Ga0207427_10001261 169
316 3300025231 Ga0207427_100035 Ga0207427_10003526 169
317 3300025231 Ga0207427_101046 Ga0207427_1010464 169
318 3300025233 Ga0209437_100001 Ga0209437_1000011289 169
319 3300025233 Ga0209437_100007 Ga0209437_100007723 169
320 3300025233 Ga0209437_100066 Ga0209437_100066103 169
321 3300025233 Ga0209437_100068 Ga0209437_10006826 169
322 3300025242 Ga0209258_100168 Ga0209258_10016864 169
323 3300025253 Ga0209677_100002 Ga0209677_1000021289 169
324 3300025253 Ga0209677_100004 Ga0209677_1000041271 169
325 3300025253 Ga0209677_100031 Ga0209677_100031218 169
326 3300025253 Ga0209677_100032 Ga0209677_10003226 169
327 3300025254 Ga0209148_1000119 Ga0209148_1000119121 169
328 3300025261 Ga0209233_1000060 Ga0209233_1000060278 169
329 3300025261 Ga0209233_1001041 Ga0209233_10010419 169
330 3300025261 Ga0209233_1014494 Ga0209233_10144942 169
331 3300025272 Ga0209455_1000217 Ga0209455_100021746 169
332 3300025297 Ga0209758_1008286 Ga0209758_10082869 169
333 3300025321 Ga0207656_10556123 Ga0207656_105561231 169
334 3300025711 Ga0207696_1000009 Ga0207696_100000927 169
335 3300025711 Ga0207696_1000483 Ga0207696_10004838 169
336 3300025711 Ga0207696_1000514 Ga0207696_100051436 169
337 3300025711 Ga0207696_1001146 Ga0207696_100114618 169
338 3300025728 Ga0207655_1000721 Ga0207655_100072121 169
339 3300025728 Ga0207655_1000752 Ga0207655_100075222 169
340 3300025728 Ga0207655_1003988 Ga0207655_10039888 169
341 3300025735 Ga0207713_1000123 Ga0207713_100012395 169
342 3300025735 Ga0207713_1140432 Ga0207713_11404322 169
343 3300025900 Ga0207710_10000061 Ga0207710_1000006127 169
344 3300025911 Ga0207654_10000008 Ga0207654_10000008137 169
345 3300025913 Ga0207695_10000442 Ga0207695_1000044273 169
346 3300025935 Ga0207709_10000361 Ga0207709_1000036148 169
347 3300025949 Ga0207667_10018177 Ga0207667_100181774 169
348 3300025949 Ga0207667_10491105 Ga0207667_104911052 169
349 3300025961 Ga0207712_10000045 Ga0207712_1000004572 169
350 3300026078 Ga0207702_10000740 Ga0207702_1000074035 169
351 3300027111 Ga0209281_1000005 Ga0209281_100000592 169
352 3300027111 Ga0209281_1000225 Ga0209281_10002252 169
353 3300031251 Ga0265327_10000731 Ga0265327_100007319 169
354 3300031548 Ga0307408_100000048 Ga0307408_100000048132 169
355 3300031901 Ga0307406_10000508 Ga0307406_100005089 169
356 3300032004 Ga0307414_10432416 Ga0307414_104324162 169
357 3300037466 Ga0395898_0000339 Ga0395898_0000339_64088_64597 169
358 3300037466 Ga0395898_0000989 Ga0395898_0000989_13069_13578 169
359 3300037466 Ga0395898_0018155 Ga0395898_0018155_1911_2420 169
360 3300037466 Ga0395898_0256901 Ga0395898_0256901_283_792 169
361 3300038443 Ga0395901_0000631 Ga0395901_0000631_23849_24358 169
362 3300038443 Ga0395901_0000970 Ga0395901_0000970_12271_12780 169
363 3300038443 Ga0395901_0005549 Ga0395901_0005549_10817_11326 169
364 3300039447 Ga0436361_0307909 Ga0436361_0307909_171_680 169
365 3300039447 Ga0436361_0952169 Ga0436361_0952169_871_1380 169
366 3300042006 Ga0439432_094566 Ga0439432_094566_193_702 169
367 3300042013 Ga0439456_050393 Ga0439456_050393_15_524 169
368 3300042532 Ga0450893_0005128 Ga0450893_0005128_1538_2047 169
369 3300044656 Ga0466969_0000161 Ga0466969_0000161_13406_13915 169
370 3300044656 Ga0466969_0006948 Ga0466969_0006948_3038_3547 169
371 3300044659 Ga0466973_0025317 Ga0466973_0025317_3518_4027 169
372 3300044672 Ga0466982_0011981 Ga0466982_0011981_2881_3390 169
373 3300044683 Ga0466965_0001101 Ga0466965_0001101_8218_8727 169
374 3300044684 Ga0466966_0000025 Ga0466966_0000025_17967_18476 169
375 3300044684 Ga0466966_0003497 Ga0466966_0003497_8948_9457 169
376 3300044684 Ga0466966_0155178 Ga0466966_0155178_134_643 169
377 3300044693 Ga0466961_0000141 Ga0466961_0000141_18366_18875 169
378 3300044693 Ga0466961_0000262 Ga0466961_0000262_29655_30164 169
379 3300044693 Ga0466961_0000540 Ga0466961_0000540_11728_12237 169
380 3300044693 Ga0466961_0024229 Ga0466961_0024229_1780_2289 169
381 3300044693 Ga0466961_0058647 Ga0466961_0058647_440_949 169
382 3300044765 Ga0466970_0000214 Ga0466970_0000214_12348_12857 169
383 3300044765 Ga0466970_0000336 Ga0466970_0000336_14371_14880 169
384 3300044842 Ga0466957_0236160 Ga0466957_0236160_465_974 169
385 3300045049 Ga0466959_0000350 Ga0466959_0000350_23617_24126 169
386 3300045049 Ga0466959_0000539 Ga0466959_0000539_11808_12317 169
387 3300045049 Ga0466959_0000714 Ga0466959_0000714_7360_7869 169
388 3300045049 Ga0466959_0001300 Ga0466959_0001300_6161_6670 169
389 3300045836 Ga0466958_0220685 Ga0466958_0220685_680_1189 169
390 3300045976 Ga0466967_0122764 Ga0466967_0122764_99_608 169
391 3300045976 Ga0466967_0175298 Ga0466967_0175298_688_1197 169
392 3300046462 Ga0495651_0000584 Ga0495651_0000584_14784_15293 169
393 3300046462 Ga0495651_0001320 Ga0495651_0001320_13302_13811 169
394 3300046462 Ga0495651_0004825 Ga0495651_0004825_4089_4598 169
395 3300046462 Ga0495651_0016272 Ga0495651_0016272_1565_2074 169
396 3300046462 Ga0495651_0086642 Ga0495651_0086642_395_904 169
397 3300046462 Ga0495651_0229446 Ga0495651_0229446_384_893 169
398 3300046463 Ga0495653_0044014 Ga0495653_0044014_1304_1813 169
399 3300046471 Ga0495650_0000004 Ga0495650_0000004_505382_505891 169
400 3300046471 Ga0495650_0000120 Ga0495650_0000120_20888_21397 169
401 3300046491 Ga0495584_0000415 Ga0495584_0000415_24610_25119 169
402 3300046507 Ga0495606_0008041 Ga0495606_0008041_5932_6441 169
403 3300046512 Ga0495610_0000571 Ga0495610_0000571_14564_15073 169
404 3300046516 Ga0495628_0002729 Ga0495628_0002729_9844_10353 169
405 3300046516 Ga0495628_0003945 Ga0495628_0003945_5294_5803 169
406 3300046522 Ga0495643_0000738 Ga0495643_0000738_4171_4680 169
407 3300046529 Ga0495652_0003827 Ga0495652_0003827_4441_4950 169
408 3300046529 Ga0495652_0014602 Ga0495652_0014602_1854_2363 169
409 3300046529 Ga0495652_0025075 Ga0495652_0025075_4287_4796 169
410 3300046529 Ga0495652_0027051 Ga0495652_0027051_1814_2323 169
411 3300046529 Ga0495652_0028063 Ga0495652_0028063_2489_2998 169
412 3300046529 Ga0495652_0276913 Ga0495652_0276913_551_1060 169
413 3300046529 Ga0495652_0433642 Ga0495652_0433642_160_669 169
414 3300046530 Ga0495654_0000148 Ga0495654_0000148_10687_11196 169
415 3300046530 Ga0495654_0115099 Ga0495654_0115099_561_1070 169
416 3300046543 Ga0495645_0047290 Ga0495645_0047290_2515_3024 169
417 3300046543 Ga0495645_0229928 Ga0495645_0229928_620_1129 169
418 3300046543 Ga0495645_0275565 Ga0495645_0275565_555_1064 169
419 3300046678 Ga0495599_0136560 Ga0495599_0136560_661_1170 169
420 3300046679 Ga0495623_0056513 Ga0495623_0056513_1810_2319 169
421 3300046679 Ga0495623_0087091 Ga0495623_0087091_1396_1905 169
422 3300046680 Ga0495646_0002475 Ga0495646_0002475_6527_7036 169
423 3300046680 Ga0495646_0017962 Ga0495646_0017962_1697_2206 169
424 3300046690 Ga0495624_0203109 Ga0495624_0203109_556_1065 169
425 3300046692 Ga0495671_0000411 Ga0495671_0000411_7984_8493 169
426 3300046694 Ga0495649_0487720 Ga0495649_0487720_63_572 169
427 3300046794 Ga0495589_0000023 Ga0495589_0000023_22495_23004 169
428 3300046794 Ga0495589_0169824 Ga0495589_0169824_149_670 169
429 3300046810 Ga0495660_0000063 Ga0495660_0000063_107925_108434 169
430 3300047317 Ga0495604_0389990 Ga0495604_0389990_386_895 169
431 3300047321 Ga0495676_0000502 Ga0495676_0000502_14861_15370 169
432 3300047323 Ga0495683_0000401 Ga0495683_0000401_4964_5473 169
433 3300048088 Ga0495602_0121623 Ga0495602_0121623_1559_2068 169
434 3300048088 Ga0495602_0403483 Ga0495602_0403483_197_706 169
435 3300048907 Ga0496104_0124340 Ga0496104_0124340_514_1023 169
436 3300048919 Ga0496116_0000015 Ga0496116_0000015_23939_24448 169
437 3300048919 Ga0496116_0000016 Ga0496116_0000016_376905_377414 169
438 3300048919 Ga0496116_0000023 Ga0496116_0000023_396940_397449 169
439 3300048919 Ga0496116_0000096 Ga0496116_0000096_20778_21287 169
440 3300048920 Ga0496117_0000709 Ga0496117_0000709_7126_7635 169
441 3300048920 Ga0496117_0001134 Ga0496117_0001134_9251_9760 169
442 3300048920 Ga0496117_0002805 Ga0496117_0002805_7030_7539 169
443 3300048920 Ga0496117_0017639 Ga0496117_0017639_4732_5241 169
444 3300048920 Ga0496117_0115698 Ga0496117_0115698_431_940 169
445 3300048921 Ga0496118_0000924 Ga0496118_0000924_5374_5883 169
446 3300048921 Ga0496118_0003304 Ga0496118_0003304_4249_4758 169
447 3300048921 Ga0496118_0010360 Ga0496118_0010360_3978_4487 169
448 3300048921 Ga0496118_0011547 Ga0496118_0011547_7753_8262 169
449 3300048921 Ga0496118_0011871 Ga0496118_0011871_5431_5940 169
450 3300048921 Ga0496118_0014769 Ga0496118_0014769_1445_1954 169
451 3300048921 Ga0496118_0153443 Ga0496118_0153443_34_543 169
452 3300048922 Ga0496119_0003311 Ga0496119_0003311_4981_5490 169
453 3300048922 Ga0496119_0024199 Ga0496119_0024199_1010_1519 169
454 3300048922 Ga0496119_0038689 Ga0496119_0038689_2272_2781 169
455 3300048923 Ga0496120_0001422 Ga0496120_0001422_28068_28577 169
456 3300048923 Ga0496120_0002785 Ga0496120_0002785_11324_11833 169
457 3300048923 Ga0496120_0110882 Ga0496120_0110882_452_961 169
458 3300048924 Ga0496121_0002434 Ga0496121_0002434_22120_22629 169
459 3300048925 Ga0496122_0000058 Ga0496122_0000058_195784_196293 169
460 3300048925 Ga0496122_0000213 Ga0496122_0000213_20918_21427 169
461 3300048925 Ga0496122_0000481 Ga0496122_0000481_57959_58468 169
462 3300048926 Ga0496123_0000044 Ga0496123_0000044_195784_196293 169
463 3300048926 Ga0496123_0000177 Ga0496123_0000177_107792_108301 169
464 3300048926 Ga0496123_0000385 Ga0496123_0000385_24423_24932 169
465 3300048927 Ga0496124_0000026 Ga0496124_0000026_125573_126082 169
466 3300048927 Ga0496124_0000026 Ga0496124_0000026_3930_4439 169
467 3300048927 Ga0496124_0000105 Ga0496124_0000105_169413_169922 169
468 3300048927 Ga0496124_0000369 Ga0496124_0000369_1169_1678 169
469 3300048927 Ga0496124_0001955 Ga0496124_0001955_1588_2097 169
470 3300048927 Ga0496124_0096772 Ga0496124_0096772_304_813 169
471 3300048927 Ga0496124_0121104 Ga0496124_0121104_1343_1852 169
472 3300048927 Ga0496124_0158159 Ga0496124_0158159_511_1020 169
473 3300048927 Ga0496124_0303583 Ga0496124_0303583_268_777 169
474 3300048927 Ga0496124_0590702 Ga0496124_0590702_85_594 169
475 3300048928 Ga0496125_0000943 Ga0496125_0000943_21232_21741 169
476 3300048928 Ga0496125_0001940 Ga0496125_0001940_25684_26193 169
477 3300048928 Ga0496125_0004263 Ga0496125_0004263_6050_6559 169
478 3300048928 Ga0496125_0007212 Ga0496125_0007212_4188_4697 169
479 3300048928 Ga0496125_0009178 Ga0496125_0009178_5244_5753 169
480 3300048929 Ga0496126_0001761 Ga0496126_0001761_25771_26280 169
481 3300048929 Ga0496126_0001846 Ga0496126_0001846_27461_27970 169
482 3300048929 Ga0496126_0002139 Ga0496126_0002139_7924_8433 169
483 3300048929 Ga0496126_0002847 Ga0496126_0002847_15291_15800 169
484 3300048929 Ga0496126_0014330 Ga0496126_0014330_1868_2377 169
485 3300048929 Ga0496126_0022894 Ga0496126_0022894_4189_4698 169
486 3300048929 Ga0496126_0025887 Ga0496126_0025887_1157_1666 169
487 3300048929 Ga0496126_0035423 Ga0496126_0035423_2336_2845 169
488 3300048929 Ga0496126_0069727 Ga0496126_0069727_1814_2323 169
489 3300048929 Ga0496126_0081540 Ga0496126_0081540_1195_1704 169
490 3300048929 Ga0496126_0098017 Ga0496126_0098017_1601_2110 169
491 3300049460 Ga0495682_0001447 Ga0495682_0001447_11178_11687 169
492 3300049460 Ga0495682_0135733 Ga0495682_0135733_168_677 169
493 3300053125 Ga0500618_000322 Ga0500618_000322_17881_18390 169
494 3300053141 Ga0500574_116528 Ga0500574_116528_262_771 169
495 3300053154 Ga0500619_000458 Ga0500619_000458_227_736 169
496 3300005288 Ga0065714_10066358 Ga0065714_100663586 171
497 3300006946 Ga0079104_1000566 Ga0079104_100056643 171
498 3300009011 Ga0105251_10150607 Ga0105251_101506072 171
499 3300009011 Ga0105251_10171214 Ga0105251_101712142 171
500 3300009092 Ga0105250_10000039 Ga0105250_10000039146 171
501 3300009092 Ga0105250_10002346 Ga0105250_100023464 171
502 3300009174 Ga0105241_10000005 Ga0105241_10000005357 171
503 3300013102 Ga0157371_10000831 Ga0157371_1000083118 171
504 3300013306 Ga0163162_10000472 Ga0163162_1000047220 171
505 3300014497 Ga0182008_10036982 Ga0182008_100369822 171
506 3300014497 Ga0182008_10184156 Ga0182008_101841562 171
507 3300015262 Ga0182007_10004208 Ga0182007_100042084 171
508 3300015262 Ga0182007_10009926 Ga0182007_100099264 171
509 3300015265 Ga0182005_1047140 Ga0182005_10471402 171
510 3300015265 Ga0182005_1061430 Ga0182005_10614302 171
511 3300017792 Ga0163161_10000001 Ga0163161_10000001679 171
512 3300017792 Ga0163161_10000401 Ga0163161_1000040131 171
513 3300025711 Ga0207696_1000001 Ga0207696_1000001754 171
514 3300025711 Ga0207696_1000026 Ga0207696_1000026265 171
515 3300025711 Ga0207696_1000183 Ga0207696_100018380 171
516 3300025711 Ga0207696_1000278 Ga0207696_100027854 171
517 3300025735 Ga0207713_1093872 Ga0207713_10938722 171
518 3300025735 Ga0207713_1110080 Ga0207713_11100802 171
519 3300025911 Ga0207654_10000007 Ga0207654_1000000733 171
520 3300027111 Ga0209281_1000003 Ga0209281_10000031078 171
521 3300027111 Ga0209281_1000027 Ga0209281_1000027137 171
522 3300027312 Ga0209371_1010835 Ga0209371_10108354 171
523 3300030500 Ga0268256_1017731 Ga0268256_10177312 171
524 3300031548 Ga0307408_100000449 Ga0307408_10000044921 171
525 3300031911 Ga0307412_10002563 Ga0307412_100025636 171
526 3300041405 Ga0439438_000119 Ga0439438_000119_17025_17540 171
527 3300042002 Ga0439442_006327 Ga0439442_006327_715_1230 171
528 3300042006 Ga0439432_000096 Ga0439432_000096_3895_4410 171
529 3300042009 Ga0439451_007981 Ga0439451_007981_971_1486 171
530 3300042137 Ga0450902_033954 Ga0450902_033954_266_781 171
531 3300046460 Ga0495638_0001900 Ga0495638_0001900_12596_13111 171
532 3300046463 Ga0495653_0000359 Ga0495653_0000359_21572_22087 171
533 3300046491 Ga0495584_0001174 Ga0495584_0001174_11271_11786 171
534 3300046501 Ga0495607_0000489 Ga0495607_0000489_13060_13575 171
535 3300046506 Ga0495583_0000877 Ga0495583_0000877_33464_33979 171
536 3300046507 Ga0495606_0000975 Ga0495606_0000975_22682_23197 171
537 3300046512 Ga0495610_0000820 Ga0495610_0000820_5070_5585 171
538 3300046516 Ga0495628_0098920 Ga0495628_0098920_1183_1698 171
539 3300046518 Ga0495631_0006505 Ga0495631_0006505_3428_3943 171
540 3300046519 Ga0495632_0000402 Ga0495632_0000402_16184_16699 171
541 3300046520 Ga0495637_0000343 Ga0495637_0000343_20237_20752 171
542 3300046520 Ga0495637_0000405 Ga0495637_0000405_23658_24173 171
543 3300046522 Ga0495643_0026195 Ga0495643_0026195_258_773 171
544 3300046536 Ga0495587_0000236 Ga0495587_0000236_19560_20075 171
545 3300046542 Ga0495597_0001645 Ga0495597_0001645_1490_2005 171
546 3300046557 Ga0495622_0004878 Ga0495622_0004878_3547_4062 171
547 3300046616 Ga0495668_0000748 Ga0495668_0000748_22513_23028 171
548 3300046679 Ga0495623_0000602 Ga0495623_0000602_20987_21502 171
549 3300046680 Ga0495646_0000079 Ga0495646_0000079_24763_25278 171
550 3300046684 Ga0495669_0161098 Ga0495669_0161098_422_937 171
551 3300046689 Ga0495613_0028473 Ga0495613_0028473_1630_2145 171
552 3300046692 Ga0495671_0000431 Ga0495671_0000431_17175_17690 171
553 3300046810 Ga0495660_0052350 Ga0495660_0052350_288_803 171
554 3300047317 Ga0495604_0000426 Ga0495604_0000426_22710_23225 171
555 3300047320 Ga0495672_0032853 Ga0495672_0032853_1337_1852 171
556 3300047322 Ga0495680_0000249 Ga0495680_0000249_21030_21545 171
557 3300047469 Ga0495673_0000692 Ga0495673_0000692_13911_14426 171
558 3300047470 Ga0495681_0163100 Ga0495681_0163100_133_648 171
559 3300047472 Ga0495686_0002990 Ga0495686_0002990_12771_13286 171
560 3300048091 Ga0495626_0069406 Ga0495626_0069406_694_1209 171
561 3300048921 Ga0496118_0001390 Ga0496118_0001390_28739_29254 171
562 3300048921 Ga0496118_0140637 Ga0496118_0140637_814_1329 171
563 3300048922 Ga0496119_0000739 Ga0496119_0000739_37251_37766 171
564 3300048923 Ga0496120_0000504 Ga0496120_0000504_38162_38677 171
565 3300048927 Ga0496124_0000021 Ga0496124_0000021_210712_211227 171
566 3300048927 Ga0496124_0027299 Ga0496124_0027299_1358_1873 171
567 3300049459 Ga0495678_000710 Ga0495678_000710_14497_15012 171
568 3300049459 Ga0495678_000946 Ga0495678_000946_15551_16066 171
569 3300049823 Ga0501044_0116200 Ga0501044_0116200_646_1161 171
570 2162886007 SwRhRL2b_contig_2559758 SwRhRL2b_0195.00005700 172
571 2162886007 SwRhRL2b_contig_3198297 SwRhRL2b_0909.00007040 172
572 2162886007 SwRhRL2b_contig_3810457 SwRhRL2b_0257.00006760 172
573 2162886007 SwRhRL2b_contig_996573 SwRhRL2b_0415.00006650 172
574 3300003856 Ga0058692_1000270 Ga0058692_100027022 172
575 3300003856 Ga0058692_1000963 Ga0058692_10009633 172
576 3300003856 Ga0058692_1003418 Ga0058692_10034181 172
577 3300003856 Ga0058692_1007280 Ga0058692_10072803 172
578 3300003856 Ga0058692_1034175 Ga0058692_10341751 172
579 3300005289 Ga0065704_10001004 Ga0065704_100010044 172
580 3300005289 Ga0065704_10003042 Ga0065704_100030425 172
581 3300005289 Ga0065704_10022339 Ga0065704_100223391 172
582 3300005289 Ga0065704_10108619 Ga0065704_101086192 172
583 3300005548 Ga0070665_100000241 Ga0070665_10000024169 172
584 3300005577 Ga0068857_100001290 Ga0068857_10000129027 172
585 3300005834 Ga0068851_10039880 Ga0068851_100398802 172
586 3300006051 Ga0075364_10003545 Ga0075364_100035455 172
587 3300006051 Ga0075364_10008481 Ga0075364_100084814 172
588 3300006051 Ga0075364_10012622 Ga0075364_100126225 172
589 3300006195 Ga0075366_10017633 Ga0075366_100176334 172
590 3300006946 Ga0079104_1000589 Ga0079104_100058929 172
591 3300006946 Ga0079104_1003639 Ga0079104_10036396 172
592 3300006946 Ga0079104_1004684 Ga0079104_10046845 172
593 3300006946 Ga0079104_1006645 Ga0079104_10066455 172
594 3300006946 Ga0079104_1010448 Ga0079104_10104483 172
595 3300006946 Ga0079104_1013444 Ga0079104_10134443 172
596 3300006946 Ga0079104_1029637 Ga0079104_10296371 172
597 3300006946 Ga0079104_1039130 Ga0079104_10391302 172
598 3300009011 Ga0105251_10006118 Ga0105251_100061188 172
599 3300009011 Ga0105251_10014090 Ga0105251_100140902 172
600 3300009011 Ga0105251_10044944 Ga0105251_100449442 172
601 3300009011 Ga0105251_10056549 Ga0105251_100565492 172
602 3300009011 Ga0105251_10208293 Ga0105251_102082932 172
603 3300009036 Ga0105244_10003430 Ga0105244_100034303 172
604 3300009036 Ga0105244_10009493 Ga0105244_100094932 172
605 3300009036 Ga0105244_10020764 Ga0105244_100207642 172
606 3300009092 Ga0105250_10007170 Ga0105250_100071706 172
607 3300009092 Ga0105250_10022395 Ga0105250_100223952 172
608 3300009092 Ga0105250_10056732 Ga0105250_100567322 172
609 3300009093 Ga0105240_10364933 Ga0105240_103649332 172
610 3300009148 Ga0105243_10045904 Ga0105243_100459043 172
611 3300009545 Ga0105237_10593245 Ga0105237_105932452 172
612 3300011119 Ga0105246_10007939 Ga0105246_100079398 172
613 3300013100 Ga0157373_10040530 Ga0157373_100405303 172
614 3300013102 Ga0157371_10002415 Ga0157371_1000241518 172
615 3300013102 Ga0157371_10312004 Ga0157371_103120042 172
616 3300013102 Ga0157371_10372588 Ga0157371_103725881 172
617 3300013102 Ga0157371_10865423 Ga0157371_108654232 172
618 3300013104 Ga0157370_10003126 Ga0157370_1000312621 172
619 3300013104 Ga0157370_11260168 Ga0157370_112601682 172
620 3300013105 Ga0157369_10000956 Ga0157369_1000095611 172
621 3300013105 Ga0157369_10045170 Ga0157369_100451704 172
622 3300013307 Ga0157372_10000765 Ga0157372_1000076536 172
623 3300014497 Ga0182008_10346760 Ga0182008_103467602 172
624 3300015679 Ga0183366_1002 Ga0183366_1002554 172
625 3300015680 Ga0183370_1002 Ga0183370_1002554 172
626 3300015685 Ga0183369_1002 Ga0183369_1002554 172
627 3300015687 Ga0183368_1005 Ga0183368_1005554 172
628 3300025245 Ga0207425_1034697 Ga0207425_10346971 172
629 3300025258 Ga0209129_1000103 Ga0209129_1000103131 172
630 3300025711 Ga0207696_1000556 Ga0207696_100055615 172
631 3300025711 Ga0207696_1001258 Ga0207696_10012584 172
632 3300025711 Ga0207696_1001950 Ga0207696_10019501 172
633 3300025711 Ga0207696_1046832 Ga0207696_10468322 172
634 3300025728 Ga0207655_1000278 Ga0207655_10002787 172
635 3300025728 Ga0207655_1000318 Ga0207655_100031867 172
636 3300025728 Ga0207655_1159074 Ga0207655_11590741 172
637 3300025735 Ga0207713_1000640 Ga0207713_100064010 172
638 3300025735 Ga0207713_1000713 Ga0207713_100071329 172
639 3300025735 Ga0207713_1001153 Ga0207713_100115315 172
640 3300025735 Ga0207713_1005125 Ga0207713_10051258 172
641 3300025735 Ga0207713_1011414 Ga0207713_10114145 172
642 3300025735 Ga0207713_1016672 Ga0207713_10166722 172
643 3300025735 Ga0207713_1030137 Ga0207713_10301372 172
644 3300026116 Ga0207674_10001229 Ga0207674_1000122921 172
645 3300027111 Ga0209281_1000004 Ga0209281_1000004389 172
646 3300027111 Ga0209281_1000004 Ga0209281_1000004817 172
647 3300027111 Ga0209281_1000089 Ga0209281_1000089144 172
648 3300027111 Ga0209281_1000308 Ga0209281_100030833 172
649 3300027111 Ga0209281_1000498 Ga0209281_100049815 172
650 3300027111 Ga0209281_1000707 Ga0209281_10007073 172
651 3300027111 Ga0209281_1000888 Ga0209281_100088828 172
652 3300027111 Ga0209281_1002170 Ga0209281_10021709 172
653 3300027111 Ga0209281_1005853 Ga0209281_10058532 172
654 3300027111 Ga0209281_1007005 Ga0209281_10070053 172
655 3300027312 Ga0209371_1000013 Ga0209371_1000013458 172
656 3300027312 Ga0209371_1000019 Ga0209371_1000019346 172
657 3300027312 Ga0209371_1000143 Ga0209371_100014350 172
658 3300027312 Ga0209371_1000386 Ga0209371_100038648 172
659 3300027312 Ga0209371_1000499 Ga0209371_100049929 172
660 3300027312 Ga0209371_1000909 Ga0209371_10009097 172
661 3300027312 Ga0209371_1004289 Ga0209371_10042896 172
662 3300028379 Ga0268266_10000041 Ga0268266_10000041247 172
663 3300030500 Ga0268256_1000014 Ga0268256_1000014219 172
664 3300030500 Ga0268256_1000024 Ga0268256_1000024180 172
665 3300030500 Ga0268256_1000113 Ga0268256_100011349 172
666 3300030500 Ga0268256_1000227 Ga0268256_100022732 172
667 3300030500 Ga0268256_1000425 Ga0268256_100042529 172
668 3300030500 Ga0268256_1001861 Ga0268256_10018617 172
669 3300030500 Ga0268256_1084929 Ga0268256_10849291 172
670 3300041405 Ga0439438_024716 Ga0439438_024716_34_552 172
671 3300041453 Ga0451797_0932188 Ga0451797_0932188_635_1153 172
672 3300041512 Ga0451853_0054418 Ga0451853_0054418_190_708 172
673 3300042006 Ga0439432_000064 Ga0439432_000064_25989_26507 172
674 3300042006 Ga0439432_041459 Ga0439432_041459_129_647 172
675 3300042010 Ga0439452_000191 Ga0439452_000191_37123_37641 172
676 3300042010 Ga0439452_001388 Ga0439452_001388_5382_5903 172
677 3300046458 Ga0495591_000003 Ga0495591_000003_2388_2906 172
678 3300046460 Ga0495638_0001517 Ga0495638_0001517_16027_16545 172
679 3300046471 Ga0495650_0000040 Ga0495650_0000040_219861_220379 172
680 3300046515 Ga0495620_0000975 Ga0495620_0000975_2491_3009 172
681 3300046530 Ga0495654_0000204 Ga0495654_0000204_22250_22771 172
682 3300046542 Ga0495597_0000203 Ga0495597_0000203_35147_35668 172
683 3300046674 Ga0495588_0055375 Ga0495588_0055375_43_564 172
684 3300046694 Ga0495649_0004680 Ga0495649_0004680_6435_6953 172
685 3300046794 Ga0495589_0000002 Ga0495589_0000002_90299_90817 172
686 3300048904 Ga0496101_0013446 Ga0496101_0013446_321_839 172
687 3300048905 Ga0496102_0392834 Ga0496102_0392834_698_1216 172
688 3300048907 Ga0496104_0001702 Ga0496104_0001702_17290_17808 172
689 3300048907 Ga0496104_0319140 Ga0496104_0319140_323_841 172
690 3300048907 Ga0496104_0449130 Ga0496104_0449130_13_531 172
691 3300048907 Ga0496104_1040440 Ga0496104_1040440_95_613 172
692 3300048908 Ga0496105_0033134 Ga0496105_0033134_374_892 172
693 3300048919 Ga0496116_0000920 Ga0496116_0000920_28437_28955 172
694 3300048919 Ga0496116_0000964 Ga0496116_0000964_5161_5679 172
695 3300048919 Ga0496116_0001483 Ga0496116_0001483_6085_6603 172
696 3300048919 Ga0496116_0008086 Ga0496116_0008086_7472_7990 172
697 3300048919 Ga0496116_0010478 Ga0496116_0010478_6300_6818 172
698 3300048919 Ga0496116_0042350 Ga0496116_0042350_305_823 172
699 3300048919 Ga0496116_0117786 Ga0496116_0117786_620_1138 172
700 3300048920 Ga0496117_0000267 Ga0496117_0000267_6184_6702 172
701 3300048920 Ga0496117_0001102 Ga0496117_0001102_7872_8390 172
702 3300048920 Ga0496117_0001231 Ga0496117_0001231_21987_22505 172
703 3300048920 Ga0496117_0001457 Ga0496117_0001457_8950_9468 172
704 3300048920 Ga0496117_0004178 Ga0496117_0004178_1399_1917 172
705 3300048920 Ga0496117_0004935 Ga0496117_0004935_10756_11274 172
706 3300048920 Ga0496117_0007809 Ga0496117_0007809_6140_6658 172
707 3300048920 Ga0496117_0033208 Ga0496117_0033208_2039_2557 172
708 3300048920 Ga0496117_0091424 Ga0496117_0091424_1390_1908 172
709 3300048921 Ga0496118_0000157 Ga0496118_0000157_80868_81386 172
710 3300048921 Ga0496118_0001622 Ga0496118_0001622_24639_25157 172
711 3300048921 Ga0496118_0001913 Ga0496118_0001913_1391_1909 172
712 3300048921 Ga0496118_0004692 Ga0496118_0004692_5923_6441 172
713 3300048921 Ga0496118_0004808 Ga0496118_0004808_14644_15162 172
714 3300048921 Ga0496118_0005577 Ga0496118_0005577_9481_9999 172
715 3300048921 Ga0496118_0013258 Ga0496118_0013258_1212_1730 172
716 3300048921 Ga0496118_0083086 Ga0496118_0083086_1218_1736 172
717 3300048921 Ga0496118_0151258 Ga0496118_0151258_310_828 172
718 3300048921 Ga0496118_0301506 Ga0496118_0301506_31_549 172
719 3300048921 Ga0496118_0308677 Ga0496118_0308677_37_555 172
720 3300048922 Ga0496119_0001152 Ga0496119_0001152_24674_25192 172
721 3300048922 Ga0496119_0002104 Ga0496119_0002104_14194_14712 172
722 3300048922 Ga0496119_0002846 Ga0496119_0002846_5924_6442 172
723 3300048922 Ga0496119_0013751 Ga0496119_0013751_1944_2462 172
724 3300048922 Ga0496119_0026342 Ga0496119_0026342_3155_3673 172
725 3300048922 Ga0496119_0084311 Ga0496119_0084311_395_913 172
726 3300048923 Ga0496120_0000956 Ga0496120_0000956_4597_5115 172
727 3300048923 Ga0496120_0001112 Ga0496120_0001112_7736_8254 172
728 3300048923 Ga0496120_0001186 Ga0496120_0001186_7972_8490 172
729 3300048923 Ga0496120_0001487 Ga0496120_0001487_3592_4110 172
730 3300048923 Ga0496120_0001612 Ga0496120_0001612_6085_6603 172
731 3300048923 Ga0496120_0003972 Ga0496120_0003972_6065_6583 172
732 3300048923 Ga0496120_0029605 Ga0496120_0029605_1212_1730 172
733 3300048923 Ga0496120_0031750 Ga0496120_0031750_50_568 172
734 3300048923 Ga0496120_0039180 Ga0496120_0039180_355_873 172
735 3300048923 Ga0496120_0039371 Ga0496120_0039371_422_940 172
736 3300048923 Ga0496120_0146057 Ga0496120_0146057_29_547 172
737 3300048923 Ga0496120_0180536 Ga0496120_0180536_80_598 172
738 3300048924 Ga0496121_0000966 Ga0496121_0000966_19169_19687 172
739 3300048924 Ga0496121_0001746 Ga0496121_0001746_8528_9046 172
740 3300048924 Ga0496121_0001898 Ga0496121_0001898_26911_27429 172
741 3300048924 Ga0496121_0002058 Ga0496121_0002058_24442_24960 172
742 3300048924 Ga0496121_0002267 Ga0496121_0002267_7944_8462 172
743 3300048924 Ga0496121_0002824 Ga0496121_0002824_23811_24329 172
744 3300048924 Ga0496121_0003949 Ga0496121_0003949_5144_5662 172
745 3300048924 Ga0496121_0004831 Ga0496121_0004831_11142_11660 172
746 3300048924 Ga0496121_0004879 Ga0496121_0004879_4827_5345 172
747 3300048924 Ga0496121_0005647 Ga0496121_0005647_36_554 172
748 3300048924 Ga0496121_0007869 Ga0496121_0007869_274_792 172
749 3300048924 Ga0496121_0010079 Ga0496121_0010079_1930_2448 172
750 3300048924 Ga0496121_0019866 Ga0496121_0019866_2324_2842 172
751 3300048924 Ga0496121_0021928 Ga0496121_0021928_5358_5876 172
752 3300048924 Ga0496121_0085984 Ga0496121_0085984_367_885 172
753 3300048924 Ga0496121_0092247 Ga0496121_0092247_1417_1935 172
754 3300048924 Ga0496121_0102823 Ga0496121_0102823_1103_1621 172
755 3300048925 Ga0496122_0001389 Ga0496122_0001389_33890_34408 172
756 3300048925 Ga0496122_0002444 Ga0496122_0002444_3607_4125 172
757 3300048925 Ga0496122_0019323 Ga0496122_0019323_2784_3302 172
758 3300048925 Ga0496122_0021002 Ga0496122_0021002_5167_5685 172
759 3300048925 Ga0496122_0039628 Ga0496122_0039628_2362_2880 172
760 3300048925 Ga0496122_0062450 Ga0496122_0062450_1778_2296 172
761 3300048925 Ga0496122_0100332 Ga0496122_0100332_29_547 172
762 3300048926 Ga0496123_0002001 Ga0496123_0002001_3607_4125 172
763 3300048926 Ga0496123_0002601 Ga0496123_0002601_4870_5388 172
764 3300048926 Ga0496123_0003398 Ga0496123_0003398_11400_11918 172
765 3300048926 Ga0496123_0080977 Ga0496123_0080977_67_585 172
766 3300048927 Ga0496124_0000496 Ga0496124_0000496_59365_59883 172
767 3300048927 Ga0496124_0000995 Ga0496124_0000995_35361_35879 172
768 3300048927 Ga0496124_0015316 Ga0496124_0015316_6791_7309 172
769 3300048927 Ga0496124_0019462 Ga0496124_0019462_1749_2267 172
770 3300048927 Ga0496124_0048518 Ga0496124_0048518_1868_2386 172
771 3300048927 Ga0496124_0061501 Ga0496124_0061501_2430_2948 172
772 3300048927 Ga0496124_0082203 Ga0496124_0082203_1452_1970 172
773 3300048927 Ga0496124_0218282 Ga0496124_0218282_908_1426 172
774 3300048927 Ga0496124_0379214 Ga0496124_0379214_23_541 172
775 3300048928 Ga0496125_0000013 Ga0496125_0000013_16201_16719 172
776 3300048928 Ga0496125_0000817 Ga0496125_0000817_32123_32641 172
777 3300048928 Ga0496125_0001468 Ga0496125_0001468_5274_5792 172
778 3300048928 Ga0496125_0008382 Ga0496125_0008382_2039_2557 172
779 3300048929 Ga0496126_0000825 Ga0496126_0000825_23756_24274 172
780 3300048929 Ga0496126_0000991 Ga0496126_0000991_5900_6418 172
781 3300048929 Ga0496126_0002237 Ga0496126_0002237_7281_7799 172
782 3300048929 Ga0496126_0002435 Ga0496126_0002435_18410_18928 172
783 3300048929 Ga0496126_0005286 Ga0496126_0005286_6027_6545 172
784 3300048929 Ga0496126_0008756 Ga0496126_0008756_9112_9630 172
785 3300048929 Ga0496126_0013680 Ga0496126_0013680_1900_2418 172
786 3300048929 Ga0496126_0066047 Ga0496126_0066047_110_628 172
787 3300048929 Ga0496126_0207150 Ga0496126_0207150_447_965 172
788 3300048929 Ga0496126_0246123 Ga0496126_0246123_366_884 172
789 3300048929 Ga0496126_0335186 Ga0496126_0335186_242_760 172
790 3300048929 Ga0496126_0437196 Ga0496126_0437196_277_795 172
791 3300048929 Ga0496126_0739583 Ga0496126_0739583_33_551 172
792 3300050491 nmdc:mga00v17_4713_c1 nmdc:mga00v17_4713_c1_3716_4234 172
793 3300050491 nmdc:mga00v17_810_c1 nmdc:mga00v17_810_c1_6862_7380 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04985

Phage_tube

Phage tail tube protein FII

4

171

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u5f-assembly1.cif.gz_M cryoem structure of pyocin r2 - precontracted - collar 0.9373 3 172
6u5f-assembly1.cif.gz_M cryoem structure of pyocin r2 - precontracted - collar 0.932 3 172
6j0b-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath-tube complex in extended state 0.6928 3 139
6rao-assembly1.cif.gz_F cryo-em structure of the anti-feeding prophage (afp) baseplate, 6-fold symmetrised 0.6836 1 139
3he1-assembly1.cif.gz_A secreted protein hcp3 from pseudomonas aeruginosa. 0.6787 57 144
ID Description Score Start End Superfamily
6a2vB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.599 22 144 2.30.110.20
4w64B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.5847 23 160 2.30.110.20
af_Q54I75_61_201_2.30.110.20 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.5379 28 156 2.30.110.20
3eaaB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.5291 10 156 2.30.110.20
1y12B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.5222 23 156 2.30.110.20
ID Description Score Start End GO Terms
AF-A0A376JS17-F1-model_v4 Phage major tail tube protein FII 0.984 1 152
AF-A0A611ERL2-F1-model_v4 Phage major tail tube protein 0.9792 1 148
AF-A0A0H3GX02-F1-model_v4 Prophage tail tube protein 0.9739 1 172
AF-A0A379C9M6-F1-model_v4 Phage major tail tube protein 0.9739 1 172
AF-A0A611ERL2-F1-model_v4 Phage major tail tube protein 0.9727 1 148

Feature Viewer

pLDDT pTM Quality
95.86 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map