F481012
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 792 | 264 | 790 | 232 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10098438|Ga0070709_100984383 |
| Length | 226 |
| Sequence | MREIVFDTETTGLNPLGGDRMVEIGCIEIINRVETGRHFHAYFYPEREMPFEAEMVHGLTNAFLSDKPLFAEKAEELIENASFDFGFLNHELERCGRPGVPMSRMVDTLTLARSRHPGAKHSLDALCMRFGIDRSHRVKHGALLDAQLLAQVYVELTGGRQIGLGLVADAGTISVAQSTGPIIIRERRPPRPHAPLAEELERHRAFIAKLVNPIWERFAPHHQGVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 2 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 163 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 164 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 165 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 166 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 167 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 182 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 183 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 186 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 193 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 202 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 203 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 204 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 211 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 212 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 213 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 214 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 243 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 244 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 245 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 248 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 249 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 250 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 251 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 253 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 254 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 255 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 256 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 257 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 258 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 259 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 260 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 261 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 262 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 263 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 264 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.75 |
| Metatranscriptomes | 0 |
| Isolates | 0.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.14 |
| Nodule | 0 |
| Rhizoplane | 2.78 |
| Rhizosphere | 95.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000066 | 3300001904 | Bacteria | 17179 |
| 2 | JGI24736J21556_1000114 | 3300001904 | Bacteria | 13747 |
| 3 | JGI24741J21665_1003089 | 3300001915 | Bacteria | 4095 |
| 4 | JGI24740J21852_10004210 | 3300001979 | Bacteria | 6212 |
| 5 | JGI24739J22299_10008994 | 3300001989 | Bacteria | 3728 |
| 6 | JGI24737J22298_10001822 | 3300001990 | Bacteria | 7629 |
| 7 | JGI24735J21928_10009963 | 3300002067 | Bacteria | 3043 |
| 8 | JGI24735J21928_10025273 | 3300002067 | Bacteria | 1793 |
| 9 | JGI24745J21846_1005029 | 3300002073 | Bacteria | 1431 |
| 10 | JGI24738J21930_10000704 | 3300002075 | Bacteria | 9639 |
| 11 | Ga0065715_10000565 | 3300005293 | Bacteria | 10505 |
| 12 | Ga0065715_10166590 | 3300005293 | Bacteria | 1557 |
| 13 | Ga0070658_10000177 | 3300005327 | Bacteria | 56043 |
| 14 | Ga0070658_10030017 | 3300005327 | Bacteria | 4368 |
| 15 | Ga0070658_10055314 | 3300005327 | Bacteria | 3224 |
| 16 | Ga0070658_10060673 | 3300005327 | Bacteria | 3080 |
| 17 | Ga0070658_10076279 | 3300005327 | Bacteria | 2749 |
| 18 | Ga0070658_10770909 | 3300005327 | Bacteria | 835 |
| 19 | Ga0070676_10042193 | 3300005328 | Bacteria | 2648 |
| 20 | Ga0070676_10050997 | 3300005328 | Bacteria | 2428 |
| 21 | Ga0070676_10069490 | 3300005328 | Bacteria | 2111 |
| 22 | Ga0070676_10113685 | 3300005328 | Bacteria | 1689 |
| 23 | Ga0070683_100002630 | 3300005329 | Bacteria | 14354 |
| 24 | Ga0070683_100004360 | 3300005329 | Bacteria | 11644 |
| 25 | Ga0070683_100010738 | 3300005329 | Bacteria | 7878 |
| 26 | Ga0070683_100036480 | 3300005329 | Bacteria | 4498 |
| 27 | Ga0070683_100040449 | 3300005329 | Bacteria | 4287 |
| 28 | Ga0070670_100007610 | 3300005331 | Bacteria | 9199 |
| 29 | Ga0070670_100014078 | 3300005331 | Bacteria | 6862 |
| 30 | Ga0070670_100064639 | 3300005331 | Bacteria | 3139 |
| 31 | Ga0070670_100075622 | 3300005331 | Bacteria | 2893 |
| 32 | Ga0070677_10005158 | 3300005333 | Bacteria | 4293 |
| 33 | Ga0070677_10121833 | 3300005333 | Bacteria | 1179 |
| 34 | Ga0068869_100153426 | 3300005334 | Bacteria | 1788 |
| 35 | Ga0070666_10000205 | 3300005335 | Bacteria | 40586 |
| 36 | Ga0070666_10002806 | 3300005335 | Bacteria | 10520 |
| 37 | Ga0070666_10200552 | 3300005335 | Bacteria | 1404 |
| 38 | Ga0070682_100032930 | 3300005337 | Bacteria | 3146 |
| 39 | Ga0068868_100001585 | 3300005338 | Bacteria | 15507 |
| 40 | Ga0068868_100382456 | 3300005338 | Bacteria | 1211 |
| 41 | Ga0068868_100512449 | 3300005338 | Bacteria | 1052 |
| 42 | Ga0070660_100000065 | 3300005339 | Bacteria | 61999 |
| 43 | Ga0070660_100005580 | 3300005339 | Bacteria | 8722 |
| 44 | Ga0070660_100030157 | 3300005339 | Bacteria | 4067 |
| 45 | Ga0070660_100056680 | 3300005339 | Bacteria | 3032 |
| 46 | Ga0070660_100056812 | 3300005339 | Bacteria | 3029 |
| 47 | Ga0070660_100272161 | 3300005339 | Bacteria | 1384 |
| 48 | Ga0070660_100382842 | 3300005339 | Bacteria | 1161 |
| 49 | Ga0070689_100138728 | 3300005340 | Bacteria | 1954 |
| 50 | Ga0070689_100207404 | 3300005340 | Bacteria | 1603 |
| 51 | Ga0070691_10044907 | 3300005341 | Bacteria | 2096 |
| 52 | Ga0070661_100000084 | 3300005344 | Bacteria | 74971 |
| 53 | Ga0070661_100007237 | 3300005344 | Bacteria | 7654 |
| 54 | Ga0070661_100013518 | 3300005344 | Bacteria | 5732 |
| 55 | Ga0070661_100015630 | 3300005344 | Bacteria | 5357 |
| 56 | Ga0070661_100059608 | 3300005344 | Bacteria | 2800 |
| 57 | Ga0070661_100073642 | 3300005344 | Bacteria | 2515 |
| 58 | Ga0070661_100136002 | 3300005344 | Bacteria | 1849 |
| 59 | Ga0070661_100224446 | 3300005344 | Bacteria | 1442 |
| 60 | Ga0070692_10003068 | 3300005345 | Bacteria | 6675 |
| 61 | Ga0070692_10017116 | 3300005345 | Bacteria | 3460 |
| 62 | Ga0070668_100007118 | 3300005347 | Bacteria | 8289 |
| 63 | Ga0070668_100251930 | 3300005347 | Bacteria | 1466 |
| 64 | Ga0070669_100005425 | 3300005353 | Bacteria | 9200 |
| 65 | Ga0070669_100036160 | 3300005353 | Bacteria | 3577 |
| 66 | Ga0070669_100117379 | 3300005353 | Bacteria | 2026 |
| 67 | Ga0070669_100125866 | 3300005353 | Bacteria | 1961 |
| 68 | Ga0070675_100005450 | 3300005354 | Bacteria | 9731 |
| 69 | Ga0070675_100016431 | 3300005354 | Bacteria | 5874 |
| 70 | Ga0070675_100063724 | 3300005354 | Bacteria | 3048 |
| 71 | Ga0070675_100184831 | 3300005354 | Bacteria | 1803 |
| 72 | Ga0070671_100005160 | 3300005355 | Bacteria | 10397 |
| 73 | Ga0070671_100011633 | 3300005355 | Bacteria | 7077 |
| 74 | Ga0070671_100022991 | 3300005355 | Bacteria | 5094 |
| 75 | Ga0070671_100034473 | 3300005355 | Bacteria | 4190 |
| 76 | Ga0070671_100039621 | 3300005355 | Bacteria | 3911 |
| 77 | Ga0070671_100072955 | 3300005355 | Bacteria | 2867 |
| 78 | Ga0070674_100009250 | 3300005356 | Bacteria | 5897 |
| 79 | Ga0070674_100076178 | 3300005356 | Bacteria | 2384 |
| 80 | Ga0070673_100000376 | 3300005364 | Bacteria | 23364 |
| 81 | Ga0070673_100003783 | 3300005364 | Bacteria | 9492 |
| 82 | Ga0070673_100019485 | 3300005364 | Bacteria | 4870 |
| 83 | Ga0070673_100173546 | 3300005364 | Bacteria | 1841 |
| 84 | Ga0070659_100001520 | 3300005366 | Bacteria | 16726 |
| 85 | Ga0070659_100056006 | 3300005366 | Bacteria | 3108 |
| 86 | Ga0070659_100090297 | 3300005366 | Bacteria | 2455 |
| 87 | Ga0070659_100120609 | 3300005366 | Bacteria | 2123 |
| 88 | Ga0070659_100278025 | 3300005366 | Bacteria | 1392 |
| 89 | Ga0070667_100001373 | 3300005367 | Bacteria | 21792 |
| 90 | Ga0070667_100003791 | 3300005367 | Bacteria | 12860 |
| 91 | Ga0070667_100005308 | 3300005367 | Bacteria | 10765 |
| 92 | Ga0070667_100119477 | 3300005367 | Bacteria | 2292 |
| 93 | Ga0070667_100125820 | 3300005367 | Bacteria | 2233 |
| 94 | Ga0070667_100712950 | 3300005367 | Bacteria | 929 |
| 95 | Ga0070709_10098438 | 3300005434 | Bacteria | 1944 |
| 96 | Ga0070714_100020576 | 3300005435 | Bacteria | 5391 |
| 97 | Ga0070714_100046589 | 3300005435 | Bacteria | 3679 |
| 98 | Ga0070713_100255994 | 3300005436 | Bacteria | 1598 |
| 99 | Ga0070700_100008201 | 3300005441 | Bacteria | 5684 |
| 100 | Ga0070663_100001477 | 3300005455 | Bacteria | 12918 |
| 101 | Ga0070663_100006039 | 3300005455 | Bacteria | 7248 |
| 102 | Ga0070663_100081532 | 3300005455 | Bacteria | 2378 |
| 103 | Ga0070663_100086544 | 3300005455 | Bacteria | 2314 |
| 104 | Ga0070663_100130633 | 3300005455 | Bacteria | 1907 |
| 105 | Ga0070678_100000919 | 3300005456 | Bacteria | 15133 |
| 106 | Ga0070678_100039998 | 3300005456 | Bacteria | 3314 |
| 107 | Ga0070678_100062596 | 3300005456 | Bacteria | 2748 |
| 108 | Ga0070678_100593207 | 3300005456 | Bacteria | 988 |
| 109 | Ga0070662_100000017 | 3300005457 | Bacteria | 105478 |
| 110 | Ga0070662_100000350 | 3300005457 | Bacteria | 27678 |
| 111 | Ga0070662_100200557 | 3300005457 | Bacteria | 1583 |
| 112 | Ga0070681_10276098 | 3300005458 | Bacteria | 1592 |
| 113 | Ga0070681_10277224 | 3300005458 | Bacteria | 1588 |
| 114 | Ga0070681_10498269 | 3300005458 | Bacteria | 1131 |
| 115 | Ga0068867_100017538 | 3300005459 | Bacteria | 5084 |
| 116 | Ga0068867_100364543 | 3300005459 | Bacteria | 1209 |
| 117 | Ga0070679_100551324 | 3300005530 | Bacteria | 1096 |
| 118 | Ga0070684_100015289 | 3300005535 | Bacteria | 6245 |
| 119 | Ga0070684_100020259 | 3300005535 | Bacteria | 5517 |
| 120 | Ga0070684_100042518 | 3300005535 | Bacteria | 3923 |
| 121 | Ga0068853_100000703 | 3300005539 | Bacteria | 23188 |
| 122 | Ga0068853_100008841 | 3300005539 | Bacteria | 8102 |
| 123 | Ga0068853_100061639 | 3300005539 | Bacteria | 3245 |
| 124 | Ga0068853_100149179 | 3300005539 | Bacteria | 2104 |
| 125 | Ga0068853_100157526 | 3300005539 | Bacteria | 2047 |
| 126 | Ga0068853_100169151 | 3300005539 | Bacteria | 1977 |
| 127 | Ga0068853_100830510 | 3300005539 | Bacteria | 886 |
| 128 | Ga0070672_100001101 | 3300005543 | Bacteria | 16486 |
| 129 | Ga0070672_100004066 | 3300005543 | Bacteria | 9547 |
| 130 | Ga0070672_100107798 | 3300005543 | Bacteria | 2267 |
| 131 | Ga0070695_100248198 | 3300005545 | Bacteria | 1294 |
| 132 | Ga0070696_100385711 | 3300005546 | Bacteria | 1093 |
| 133 | Ga0070693_100009123 | 3300005547 | Bacteria | 4924 |
| 134 | Ga0070693_100520703 | 3300005547 | Bacteria | 847 |
| 135 | Ga0070665_100005491 | 3300005548 | Bacteria | 13062 |
| 136 | Ga0070665_100009518 | 3300005548 | Bacteria | 9828 |
| 137 | Ga0070665_100124648 | 3300005548 | Bacteria | 2578 |
| 138 | Ga0070665_100300473 | 3300005548 | Bacteria | 1608 |
| 139 | Ga0070665_100301553 | 3300005548 | Bacteria | 1605 |
| 140 | Ga0068855_100000194 | 3300005563 | Bacteria | 78505 |
| 141 | Ga0068855_100108475 | 3300005563 | Bacteria | 3189 |
| 142 | Ga0068855_100298274 | 3300005563 | Bacteria | 1785 |
| 143 | Ga0068855_100310890 | 3300005563 | Bacteria | 1743 |
| 144 | Ga0068855_100433979 | 3300005563 | Bacteria | 1435 |
| 145 | Ga0068855_100617221 | 3300005563 | Bacteria | 1168 |
| 146 | Ga0068855_100977069 | 3300005563 | Bacteria | 891 |
| 147 | Ga0070664_100000098 | 3300005564 | Bacteria | 55907 |
| 148 | Ga0070664_100005544 | 3300005564 | Bacteria | 10133 |
| 149 | Ga0070664_100006436 | 3300005564 | Bacteria | 9475 |
| 150 | Ga0070664_100022619 | 3300005564 | Bacteria | 5183 |
| 151 | Ga0070664_100040999 | 3300005564 | Bacteria | 3905 |
| 152 | Ga0070664_100097212 | 3300005564 | Bacteria | 2556 |
| 153 | Ga0070664_100397886 | 3300005564 | Bacteria | 1259 |
| 154 | Ga0068857_100032846 | 3300005577 | Bacteria | 4587 |
| 155 | Ga0068857_100056063 | 3300005577 | Bacteria | 3497 |
| 156 | Ga0068857_100073498 | 3300005577 | Bacteria | 3046 |
| 157 | Ga0068857_100509632 | 3300005577 | Bacteria | 1130 |
| 158 | Ga0068854_100002764 | 3300005578 | Bacteria | 10898 |
| 159 | Ga0068854_100003023 | 3300005578 | Bacteria | 10451 |
| 160 | Ga0068854_100014664 | 3300005578 | Bacteria | 5170 |
| 161 | Ga0068854_100025478 | 3300005578 | Bacteria | 4059 |
| 162 | Ga0068854_100041472 | 3300005578 | Bacteria | 3252 |
| 163 | Ga0068854_100071312 | 3300005578 | Bacteria | 2541 |
| 164 | Ga0068856_100000098 | 3300005614 | Bacteria | 83221 |
| 165 | Ga0068856_100027857 | 3300005614 | Bacteria | 5512 |
| 166 | Ga0068856_100054691 | 3300005614 | Bacteria | 3938 |
| 167 | Ga0068856_100474565 | 3300005614 | Bacteria | 1272 |
| 168 | Ga0068852_100000440 | 3300005616 | Bacteria | 27519 |
| 169 | Ga0068852_100006849 | 3300005616 | Bacteria | 8280 |
| 170 | Ga0068852_100031098 | 3300005616 | Bacteria | 4401 |
| 171 | Ga0068852_100062797 | 3300005616 | Bacteria | 3232 |
| 172 | Ga0068852_100068109 | 3300005616 | Bacteria | 3114 |
| 173 | Ga0068852_100166314 | 3300005616 | Bacteria | 2064 |
| 174 | Ga0068852_100318068 | 3300005616 | Bacteria | 1511 |
| 175 | Ga0068859_100001231 | 3300005617 | Bacteria | 26157 |
| 176 | Ga0068859_100005659 | 3300005617 | Bacteria | 12722 |
| 177 | Ga0068859_100010321 | 3300005617 | Bacteria | 9401 |
| 178 | Ga0068859_100030121 | 3300005617 | Bacteria | 5445 |
| 179 | Ga0068864_100000145 | 3300005618 | Bacteria | 68040 |
| 180 | Ga0068864_100000953 | 3300005618 | Bacteria | 24235 |
| 181 | Ga0068864_100010591 | 3300005618 | Bacteria | 7624 |
| 182 | Ga0068866_10124001 | 3300005718 | Bacteria | 1460 |
| 183 | Ga0068861_100304065 | 3300005719 | Bacteria | 1383 |
| 184 | Ga0068870_10011657 | 3300005840 | Bacteria | 4085 |
| 185 | Ga0068863_100000027 | 3300005841 | Bacteria | 181884 |
| 186 | Ga0068863_100002810 | 3300005841 | Bacteria | 17249 |
| 187 | Ga0068863_100003718 | 3300005841 | Bacteria | 15092 |
| 188 | Ga0068863_100008708 | 3300005841 | Bacteria | 9912 |
| 189 | Ga0068863_100467445 | 3300005841 | Bacteria | 1239 |
| 190 | Ga0068858_100000268 | 3300005842 | Bacteria | 55747 |
| 191 | Ga0068858_100000695 | 3300005842 | Bacteria | 35157 |
| 192 | Ga0068858_100003129 | 3300005842 | Bacteria | 16562 |
| 193 | Ga0068858_100009018 | 3300005842 | Bacteria | 9539 |
| 194 | Ga0068858_100032317 | 3300005842 | Bacteria | 4861 |
| 195 | Ga0068858_100115549 | 3300005842 | Bacteria | 2508 |
| 196 | Ga0068860_100000391 | 3300005843 | Bacteria | 57332 |
| 197 | Ga0068860_100020638 | 3300005843 | Bacteria | 6382 |
| 198 | Ga0068860_100064679 | 3300005843 | Bacteria | 3474 |
| 199 | Ga0068862_100000014 | 3300005844 | Bacteria | 251552 |
| 200 | Ga0068862_100007629 | 3300005844 | Bacteria | 8958 |
| 201 | Ga0068862_100011300 | 3300005844 | Bacteria | 7372 |
| 202 | Ga0068862_100011857 | 3300005844 | Bacteria | 7198 |
| 203 | Ga0068862_100044826 | 3300005844 | Bacteria | 3773 |
| 204 | Ga0070717_10082997 | 3300006028 | Bacteria | 2694 |
| 205 | Ga0070716_100115373 | 3300006173 | Bacteria | 1671 |
| 206 | Ga0070712_100270517 | 3300006175 | Bacteria | 1365 |
| 207 | Ga0097621_100132707 | 3300006237 | Bacteria | 2121 |
| 208 | Ga0097621_100153930 | 3300006237 | Bacteria | 1973 |
| 209 | Ga0097621_100352120 | 3300006237 | Bacteria | 1310 |
| 210 | Ga0097621_100361544 | 3300006237 | Bacteria | 1293 |
| 211 | Ga0075370_10005349 | 3300006353 | Bacteria | 6370 |
| 212 | Ga0068871_100069014 | 3300006358 | Unclassified | 2902 |
| 213 | Ga0068871_100244330 | 3300006358 | Bacteria | 1562 |
| 214 | Ga0068871_100259245 | 3300006358 | Bacteria | 1516 |
| 215 | Ga0068865_100647686 | 3300006881 | Bacteria | 898 |
| 216 | Ga0097620_100001231 | 3300006931 | Bacteria | 26157 |
| 217 | Ga0097620_100005660 | 3300006931 | Bacteria | 12722 |
| 218 | Ga0097620_100010321 | 3300006931 | Bacteria | 9401 |
| 219 | Ga0097620_100023168 | 3300006931 | Bacteria | 6229 |
| 220 | Ga0097620_100030122 | 3300006931 | Bacteria | 5445 |
| 221 | Ga0105250_10017407 | 3300009092 | Bacteria | 2922 |
| 222 | Ga0105240_10012132 | 3300009093 | Bacteria | 11930 |
| 223 | Ga0105240_10045839 | 3300009093 | Bacteria | 5545 |
| 224 | Ga0105240_10105813 | 3300009093 | Bacteria | 3414 |
| 225 | Ga0105245_10042402 | 3300009098 | Bacteria | 4061 |
| 226 | Ga0105247_10003692 | 3300009101 | Bacteria | 9932 |
| 227 | Ga0105243_10131029 | 3300009148 | Bacteria | 2127 |
| 228 | Ga0105241_10022968 | 3300009174 | Bacteria | 4625 |
| 229 | Ga0105248_10000184 | 3300009177 | Bacteria | 72728 |
| 230 | Ga0105248_10000390 | 3300009177 | Bacteria | 50573 |
| 231 | Ga0105248_10000444 | 3300009177 | Bacteria | 47003 |
| 232 | Ga0105248_10001388 | 3300009177 | Bacteria | 26986 |
| 233 | Ga0105248_10009540 | 3300009177 | Bacteria | 10681 |
| 234 | Ga0105248_10021785 | 3300009177 | Bacteria | 7102 |
| 235 | Ga0105248_10509186 | 3300009177 | Bacteria | 1357 |
| 236 | Ga0105237_10016649 | 3300009545 | Bacteria | 7635 |
| 237 | Ga0105238_10027588 | 3300009551 | Bacteria | 5787 |
| 238 | Ga0105238_10031317 | 3300009551 | Bacteria | 5413 |
| 239 | Ga0105238_10039780 | 3300009551 | Bacteria | 4767 |
| 240 | Ga0105249_10000002 | 3300009553 | Bacteria | 376207 |
| 241 | Ga0105249_10001466 | 3300009553 | Bacteria | 20693 |
| 242 | Ga0105249_10046397 | 3300009553 | Bacteria | 3954 |
| 243 | Ga0105249_10089940 | 3300009553 | Bacteria | 2870 |
| 244 | Ga0105239_10195634 | 3300010375 | Bacteria | 2264 |
| 245 | Ga0157373_10007297 | 3300013100 | Bacteria | 8232 |
| 246 | Ga0157373_10019148 | 3300013100 | Bacteria | 4984 |
| 247 | Ga0157373_10025832 | 3300013100 | Bacteria | 4246 |
| 248 | Ga0157373_10098826 | 3300013100 | Bacteria | 2054 |
| 249 | Ga0157371_10002003 | 3300013102 | Bacteria | 20140 |
| 250 | Ga0157371_10012251 | 3300013102 | Bacteria | 6566 |
| 251 | Ga0157371_10017812 | 3300013102 | Bacteria | 5267 |
| 252 | Ga0157371_10025908 | 3300013102 | Bacteria | 4267 |
| 253 | Ga0157371_10069359 | 3300013102 | Bacteria | 2496 |
| 254 | Ga0157371_10078646 | 3300013102 | Bacteria | 2336 |
| 255 | Ga0157371_10095601 | 3300013102 | Bacteria | 2105 |
| 256 | Ga0157371_10099573 | 3300013102 | Bacteria | 2061 |
| 257 | Ga0157371_10136844 | 3300013102 | Bacteria | 1744 |
| 258 | Ga0157371_10197177 | 3300013102 | Bacteria | 1443 |
| 259 | Ga0157371_10208569 | 3300013102 | Bacteria | 1402 |
| 260 | Ga0157371_10604169 | 3300013102 | Bacteria | 816 |
| 261 | Ga0157370_10018639 | 3300013104 | Bacteria | 6977 |
| 262 | Ga0157370_10029172 | 3300013104 | Bacteria | 5419 |
| 263 | Ga0157370_10088851 | 3300013104 | Bacteria | 2902 |
| 264 | Ga0157370_10146539 | 3300013104 | Bacteria | 2198 |
| 265 | Ga0157370_10208742 | 3300013104 | Bacteria | 1810 |
| 266 | Ga0157369_10000043 | 3300013105 | Bacteria | 180713 |
| 267 | Ga0157369_10011088 | 3300013105 | Bacteria | 10254 |
| 268 | Ga0157369_10050600 | 3300013105 | Bacteria | 4499 |
| 269 | Ga0157369_10164786 | 3300013105 | Bacteria | 2338 |
| 270 | Ga0157369_10223324 | 3300013105 | Bacteria | 1971 |
| 271 | Ga0157369_10299393 | 3300013105 | Bacteria | 1673 |
| 272 | Ga0157369_10372078 | 3300013105 | Bacteria | 1483 |
| 273 | Ga0157369_10565593 | 3300013105 | Bacteria | 1175 |
| 274 | Ga0157369_10726542 | 3300013105 | Bacteria | 1022 |
| 275 | Ga0157374_10002141 | 3300013296 | Bacteria | 16638 |
| 276 | Ga0157374_10005411 | 3300013296 | Bacteria | 10726 |
| 277 | Ga0157374_10056025 | 3300013296 | Bacteria | 3680 |
| 278 | Ga0157378_10027473 | 3300013297 | Bacteria | 5022 |
| 279 | Ga0157378_10043077 | 3300013297 | Bacteria | 4007 |
| 280 | Ga0157378_10087449 | 3300013297 | Bacteria | 2827 |
| 281 | Ga0157378_10131937 | 3300013297 | Bacteria | 2313 |
| 282 | Ga0163162_10002668 | 3300013306 | Bacteria | 16918 |
| 283 | Ga0163162_10010851 | 3300013306 | Bacteria | 8866 |
| 284 | Ga0163162_10025560 | 3300013306 | Bacteria | 5836 |
| 285 | Ga0163162_10080689 | 3300013306 | Bacteria | 3322 |
| 286 | Ga0163162_10145637 | 3300013306 | Bacteria | 2485 |
| 287 | Ga0157372_10040729 | 3300013307 | Bacteria | 5133 |
| 288 | Ga0157372_10160734 | 3300013307 | Bacteria | 2596 |
| 289 | Ga0157372_10195058 | 3300013307 | Bacteria | 2346 |
| 290 | Ga0157372_10565954 | 3300013307 | Bacteria | 1325 |
| 291 | Ga0157372_10565955 | 3300013307 | Bacteria | 1325 |
| 292 | Ga0157375_10000709 | 3300013308 | Bacteria | 29414 |
| 293 | Ga0157375_10073585 | 3300013308 | Bacteria | 3436 |
| 294 | Ga0157375_10602527 | 3300013308 | Bacteria | 1258 |
| 295 | Ga0163163_10000131 | 3300014325 | Bacteria | 76809 |
| 296 | Ga0163163_10000169 | 3300014325 | Bacteria | 68481 |
| 297 | Ga0163163_10001864 | 3300014325 | Bacteria | 17807 |
| 298 | Ga0163163_10123122 | 3300014325 | Bacteria | 2629 |
| 299 | Ga0157380_10003743 | 3300014326 | Bacteria | 10460 |
| 300 | Ga0157380_10013753 | 3300014326 | Bacteria | 5909 |
| 301 | Ga0157380_10363241 | 3300014326 | Bacteria | 1359 |
| 302 | Ga0157379_10002480 | 3300014968 | Bacteria | 15449 |
| 303 | Ga0157379_10072765 | 3300014968 | Bacteria | 3076 |
| 304 | Ga0163161_10002075 | 3300017792 | Bacteria | 14527 |
| 305 | Ga0163161_10017590 | 3300017792 | Bacteria | 5005 |
| 306 | Ga0209257_1011481 | 3300025304 | Bacteria | 4259 |
| 307 | Ga0207697_10001895 | 3300025315 | Bacteria | 11159 |
| 308 | Ga0207697_10003663 | 3300025315 | Bacteria | 7527 |
| 309 | Ga0207697_10020945 | 3300025315 | Bacteria | 2677 |
| 310 | Ga0207656_10016654 | 3300025321 | Bacteria | 2865 |
| 311 | Ga0207682_10000923 | 3300025893 | Bacteria | 13618 |
| 312 | Ga0207682_10002958 | 3300025893 | Bacteria | 7457 |
| 313 | Ga0207682_10146431 | 3300025893 | Bacteria | 1063 |
| 314 | Ga0207642_10156191 | 3300025899 | Bacteria | 1220 |
| 315 | Ga0207710_10001762 | 3300025900 | Bacteria | 10446 |
| 316 | Ga0207688_10001410 | 3300025901 | Bacteria | 12534 |
| 317 | Ga0207688_10012090 | 3300025901 | Bacteria | 4695 |
| 318 | Ga0207680_10000773 | 3300025903 | Bacteria | 15110 |
| 319 | Ga0207680_10004223 | 3300025903 | Bacteria | 6801 |
| 320 | Ga0207680_10307194 | 3300025903 | Bacteria | 1106 |
| 321 | Ga0207647_10001558 | 3300025904 | Bacteria | 17625 |
| 322 | Ga0207647_10001741 | 3300025904 | Bacteria | 16680 |
| 323 | Ga0207647_10002702 | 3300025904 | Bacteria | 13390 |
| 324 | Ga0207647_10024301 | 3300025904 | Bacteria | 3997 |
| 325 | Ga0207647_10080968 | 3300025904 | Bacteria | 1946 |
| 326 | Ga0207647_10086117 | 3300025904 | Bacteria | 1878 |
| 327 | Ga0207645_10020408 | 3300025907 | Bacteria | 4337 |
| 328 | Ga0207645_10041026 | 3300025907 | Bacteria | 2964 |
| 329 | Ga0207645_10074916 | 3300025907 | Bacteria | 2167 |
| 330 | Ga0207643_10014049 | 3300025908 | Bacteria | 4346 |
| 331 | Ga0207643_10014539 | 3300025908 | Bacteria | 4279 |
| 332 | Ga0207705_10000033 | 3300025909 | Bacteria | 223997 |
| 333 | Ga0207705_10000137 | 3300025909 | Bacteria | 79174 |
| 334 | Ga0207705_10026528 | 3300025909 | Bacteria | 4132 |
| 335 | Ga0207705_10029445 | 3300025909 | Bacteria | 3914 |
| 336 | Ga0207705_10039655 | 3300025909 | Bacteria | 3376 |
| 337 | Ga0207705_10228182 | 3300025909 | Bacteria | 1416 |
| 338 | Ga0207705_10313718 | 3300025909 | Bacteria | 1204 |
| 339 | Ga0207654_10143916 | 3300025911 | Bacteria | 1523 |
| 340 | Ga0207707_10332381 | 3300025912 | Bacteria | 1311 |
| 341 | Ga0207707_10429724 | 3300025912 | Bacteria | 1131 |
| 342 | Ga0207695_10004868 | 3300025913 | Bacteria | 18117 |
| 343 | Ga0207695_10009667 | 3300025913 | Bacteria | 11881 |
| 344 | Ga0207695_10015000 | 3300025913 | Bacteria | 9142 |
| 345 | Ga0207695_10109640 | 3300025913 | Bacteria | 2742 |
| 346 | Ga0207671_10031351 | 3300025914 | Bacteria | 3961 |
| 347 | Ga0207693_10120832 | 3300025915 | Bacteria | 2057 |
| 348 | Ga0207660_10042494 | 3300025917 | Bacteria | 3191 |
| 349 | Ga0207660_10203210 | 3300025917 | Bacteria | 1548 |
| 350 | Ga0207660_10207722 | 3300025917 | Bacteria | 1532 |
| 351 | Ga0207657_10000508 | 3300025919 | Bacteria | 41139 |
| 352 | Ga0207657_10011576 | 3300025919 | Bacteria | 8751 |
| 353 | Ga0207657_10012396 | 3300025919 | Bacteria | 8423 |
| 354 | Ga0207657_10018979 | 3300025919 | Bacteria | 6544 |
| 355 | Ga0207657_10047588 | 3300025919 | Bacteria | 3748 |
| 356 | Ga0207657_10052117 | 3300025919 | Bacteria | 3553 |
| 357 | Ga0207657_10071420 | 3300025919 | Bacteria | 2940 |
| 358 | Ga0207657_10337718 | 3300025919 | Bacteria | 1189 |
| 359 | Ga0207649_10000186 | 3300025920 | Bacteria | 50868 |
| 360 | Ga0207649_10000737 | 3300025920 | Bacteria | 21468 |
| 361 | Ga0207649_10004832 | 3300025920 | Bacteria | 7285 |
| 362 | Ga0207649_10010259 | 3300025920 | Bacteria | 5142 |
| 363 | Ga0207649_10019101 | 3300025920 | Bacteria | 3913 |
| 364 | Ga0207649_10040201 | 3300025920 | Bacteria | 2841 |
| 365 | Ga0207649_10344647 | 3300025920 | Bacteria | 1101 |
| 366 | Ga0207652_10170400 | 3300025921 | Bacteria | 1953 |
| 367 | Ga0207681_10001743 | 3300025923 | Bacteria | 13962 |
| 368 | Ga0207681_10014834 | 3300025923 | Bacteria | 4853 |
| 369 | Ga0207681_10030797 | 3300025923 | Bacteria | 3500 |
| 370 | Ga0207681_10162280 | 3300025923 | Bacteria | 1686 |
| 371 | Ga0207681_10469491 | 3300025923 | Bacteria | 1026 |
| 372 | Ga0207694_10017707 | 3300025924 | Bacteria | 5385 |
| 373 | Ga0207694_10048271 | 3300025924 | Bacteria | 3294 |
| 374 | Ga0207694_10078157 | 3300025924 | Bacteria | 2593 |
| 375 | Ga0207650_10003361 | 3300025925 | Bacteria | 11007 |
| 376 | Ga0207650_10054914 | 3300025925 | Bacteria | 2956 |
| 377 | Ga0207650_10069691 | 3300025925 | Bacteria | 2642 |
| 378 | Ga0207650_10168456 | 3300025925 | Bacteria | 1740 |
| 379 | Ga0207650_10236162 | 3300025925 | Bacteria | 1476 |
| 380 | Ga0207659_10016247 | 3300025926 | Bacteria | 4840 |
| 381 | Ga0207659_10030808 | 3300025926 | Bacteria | 3667 |
| 382 | Ga0207659_10067735 | 3300025926 | Bacteria | 2594 |
| 383 | Ga0207687_10113697 | 3300025927 | Bacteria | 2014 |
| 384 | Ga0207700_10320486 | 3300025928 | Bacteria | 1343 |
| 385 | Ga0207664_10049541 | 3300025929 | Bacteria | 3307 |
| 386 | Ga0207644_10000111 | 3300025931 | Bacteria | 60737 |
| 387 | Ga0207644_10006549 | 3300025931 | Bacteria | 7589 |
| 388 | Ga0207644_10020946 | 3300025931 | Bacteria | 4450 |
| 389 | Ga0207644_10023264 | 3300025931 | Bacteria | 4242 |
| 390 | Ga0207644_10162201 | 3300025931 | Bacteria | 1738 |
| 391 | Ga0207644_10235809 | 3300025931 | Bacteria | 1455 |
| 392 | Ga0207690_10000108 | 3300025932 | Bacteria | 67599 |
| 393 | Ga0207690_10044417 | 3300025932 | Bacteria | 2929 |
| 394 | Ga0207690_10049401 | 3300025932 | Bacteria | 2804 |
| 395 | Ga0207690_10166930 | 3300025932 | Bacteria | 1646 |
| 396 | Ga0207690_10499985 | 3300025932 | Bacteria | 983 |
| 397 | Ga0207690_10512602 | 3300025932 | Bacteria | 971 |
| 398 | Ga0207706_10000276 | 3300025933 | Bacteria | 55889 |
| 399 | Ga0207706_10000514 | 3300025933 | Bacteria | 41167 |
| 400 | Ga0207706_10001018 | 3300025933 | Bacteria | 28609 |
| 401 | Ga0207706_10047462 | 3300025933 | Bacteria | 3799 |
| 402 | Ga0207706_10099945 | 3300025933 | Bacteria | 2552 |
| 403 | Ga0207706_10400451 | 3300025933 | Bacteria | 1190 |
| 404 | Ga0207706_10435473 | 3300025933 | Bacteria | 1135 |
| 405 | Ga0207670_10038785 | 3300025936 | Bacteria | 3114 |
| 406 | Ga0207669_10002765 | 3300025937 | Bacteria | 7524 |
| 407 | Ga0207669_10008335 | 3300025937 | Bacteria | 4859 |
| 408 | Ga0207704_10603433 | 3300025938 | Bacteria | 899 |
| 409 | Ga0207665_10056891 | 3300025939 | Bacteria | 2641 |
| 410 | Ga0207691_10002752 | 3300025940 | Bacteria | 17143 |
| 411 | Ga0207691_10014857 | 3300025940 | Bacteria | 7421 |
| 412 | Ga0207691_10074127 | 3300025940 | Bacteria | 3070 |
| 413 | Ga0207691_10218948 | 3300025940 | Bacteria | 1651 |
| 414 | Ga0207691_10423090 | 3300025940 | Bacteria | 1135 |
| 415 | Ga0207711_10000105 | 3300025941 | Bacteria | 90036 |
| 416 | Ga0207711_10000190 | 3300025941 | Bacteria | 65723 |
| 417 | Ga0207711_10000413 | 3300025941 | Bacteria | 45274 |
| 418 | Ga0207711_10003775 | 3300025941 | Bacteria | 13046 |
| 419 | Ga0207711_10005548 | 3300025941 | Bacteria | 10667 |
| 420 | Ga0207711_10012443 | 3300025941 | Bacteria | 7072 |
| 421 | Ga0207711_10038564 | 3300025941 | Bacteria | 4063 |
| 422 | Ga0207689_10112929 | 3300025942 | Bacteria | 2233 |
| 423 | Ga0207689_10553909 | 3300025942 | Bacteria | 966 |
| 424 | Ga0207661_10007968 | 3300025944 | Bacteria | 7551 |
| 425 | Ga0207661_10022512 | 3300025944 | Bacteria | 4748 |
| 426 | Ga0207661_10034436 | 3300025944 | Bacteria | 3938 |
| 427 | Ga0207661_10075835 | 3300025944 | Bacteria | 2760 |
| 428 | Ga0207661_10098825 | 3300025944 | Bacteria | 2446 |
| 429 | Ga0207661_10535680 | 3300025944 | Bacteria | 1072 |
| 430 | Ga0207679_10000114 | 3300025945 | Bacteria | 64628 |
| 431 | Ga0207679_10038365 | 3300025945 | Bacteria | 3412 |
| 432 | Ga0207679_10046008 | 3300025945 | Bacteria | 3160 |
| 433 | Ga0207679_10168309 | 3300025945 | Bacteria | 1801 |
| 434 | Ga0207679_10196899 | 3300025945 | Bacteria | 1680 |
| 435 | Ga0207679_10237995 | 3300025945 | Bacteria | 1541 |
| 436 | Ga0207667_10016322 | 3300025949 | Bacteria | 8393 |
| 437 | Ga0207667_10081978 | 3300025949 | Bacteria | 3342 |
| 438 | Ga0207667_10103076 | 3300025949 | Bacteria | 2943 |
| 439 | Ga0207667_10206083 | 3300025949 | Bacteria | 2016 |
| 440 | Ga0207667_10259417 | 3300025949 | Bacteria | 1777 |
| 441 | Ga0207667_10351088 | 3300025949 | Bacteria | 1504 |
| 442 | Ga0207667_10456820 | 3300025949 | Bacteria | 1298 |
| 443 | Ga0207651_10001938 | 3300025960 | Bacteria | 9718 |
| 444 | Ga0207651_10108775 | 3300025960 | Bacteria | 2075 |
| 445 | Ga0207651_10172892 | 3300025960 | Bacteria | 1705 |
| 446 | Ga0207651_10176249 | 3300025960 | Bacteria | 1691 |
| 447 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 448 | Ga0207712_10008274 | 3300025961 | Bacteria | 6575 |
| 449 | Ga0207712_10027059 | 3300025961 | Bacteria | 3826 |
| 450 | Ga0207712_10067825 | 3300025961 | Bacteria | 2554 |
| 451 | Ga0207668_10000054 | 3300025972 | Bacteria | 95426 |
| 452 | Ga0207668_10002327 | 3300025972 | Bacteria | 11097 |
| 453 | Ga0207668_10048063 | 3300025972 | Bacteria | 2926 |
| 454 | Ga0207640_10000473 | 3300025981 | Bacteria | 24521 |
| 455 | Ga0207640_10006878 | 3300025981 | Bacteria | 6255 |
| 456 | Ga0207640_10103670 | 3300025981 | Bacteria | 2000 |
| 457 | Ga0207640_10116885 | 3300025981 | Bacteria | 1902 |
| 458 | Ga0207658_10002159 | 3300025986 | Bacteria | 14623 |
| 459 | Ga0207658_10005799 | 3300025986 | Bacteria | 8453 |
| 460 | Ga0207658_10012692 | 3300025986 | Bacteria | 5754 |
| 461 | Ga0207658_10023849 | 3300025986 | Bacteria | 4274 |
| 462 | Ga0207658_10164207 | 3300025986 | Bacteria | 1822 |
| 463 | Ga0207658_10352231 | 3300025986 | Bacteria | 1282 |
| 464 | Ga0207658_10711025 | 3300025986 | Bacteria | 908 |
| 465 | Ga0207677_10000600 | 3300026023 | Bacteria | 22226 |
| 466 | Ga0207677_10067922 | 3300026023 | Bacteria | 2499 |
| 467 | Ga0207703_10000139 | 3300026035 | Bacteria | 86495 |
| 468 | Ga0207703_10000461 | 3300026035 | Bacteria | 42797 |
| 469 | Ga0207703_10004673 | 3300026035 | Bacteria | 11183 |
| 470 | Ga0207703_10005508 | 3300026035 | Bacteria | 10174 |
| 471 | Ga0207639_10000139 | 3300026041 | Bacteria | 54240 |
| 472 | Ga0207639_10003170 | 3300026041 | Bacteria | 11066 |
| 473 | Ga0207639_10045291 | 3300026041 | Bacteria | 3312 |
| 474 | Ga0207639_10119521 | 3300026041 | Bacteria | 2163 |
| 475 | Ga0207639_10176839 | 3300026041 | Bacteria | 1812 |
| 476 | Ga0207678_10000746 | 3300026067 | Bacteria | 29716 |
| 477 | Ga0207678_10005368 | 3300026067 | Bacteria | 11477 |
| 478 | Ga0207678_10006212 | 3300026067 | Bacteria | 10615 |
| 479 | Ga0207678_10019046 | 3300026067 | Bacteria | 6028 |
| 480 | Ga0207678_10023972 | 3300026067 | Bacteria | 5334 |
| 481 | Ga0207708_10069128 | 3300026075 | Bacteria | 2703 |
| 482 | Ga0207708_10240255 | 3300026075 | Bacteria | 1457 |
| 483 | Ga0207702_10001266 | 3300026078 | Bacteria | 25382 |
| 484 | Ga0207702_10012719 | 3300026078 | Bacteria | 7003 |
| 485 | Ga0207702_10013935 | 3300026078 | Bacteria | 6679 |
| 486 | Ga0207702_10021319 | 3300026078 | Bacteria | 5363 |
| 487 | Ga0207702_10586832 | 3300026078 | Bacteria | 1093 |
| 488 | Ga0207702_10712039 | 3300026078 | Bacteria | 990 |
| 489 | Ga0207641_10000045 | 3300026088 | Bacteria | 181882 |
| 490 | Ga0207641_10000172 | 3300026088 | Bacteria | 90549 |
| 491 | Ga0207641_10004364 | 3300026088 | Bacteria | 12251 |
| 492 | Ga0207648_10003539 | 3300026089 | Bacteria | 16337 |
| 493 | Ga0207648_10015998 | 3300026089 | Bacteria | 6874 |
| 494 | Ga0207648_10075650 | 3300026089 | Bacteria | 2935 |
| 495 | Ga0207676_10000072 | 3300026095 | Bacteria | 101978 |
| 496 | Ga0207676_10002758 | 3300026095 | Bacteria | 12490 |
| 497 | Ga0207676_10156502 | 3300026095 | Bacteria | 1969 |
| 498 | Ga0207674_10013020 | 3300026116 | Bacteria | 9267 |
| 499 | Ga0207674_10063263 | 3300026116 | Bacteria | 3735 |
| 500 | Ga0207674_10078211 | 3300026116 | Bacteria | 3313 |
| 501 | Ga0207674_10109713 | 3300026116 | Bacteria | 2735 |
| 502 | Ga0207675_100001317 | 3300026118 | Bacteria | 24894 |
| 503 | Ga0207675_100222537 | 3300026118 | Bacteria | 1819 |
| 504 | Ga0207683_10002199 | 3300026121 | Bacteria | 17148 |
| 505 | Ga0207683_10013394 | 3300026121 | Bacteria | 6992 |
| 506 | Ga0207683_10044948 | 3300026121 | Bacteria | 3862 |
| 507 | Ga0207683_10565818 | 3300026121 | Bacteria | 1051 |
| 508 | Ga0207698_10000598 | 3300026142 | Bacteria | 21116 |
| 509 | Ga0207698_10005864 | 3300026142 | Bacteria | 7634 |
| 510 | Ga0207698_10009468 | 3300026142 | Bacteria | 6215 |
| 511 | Ga0207698_10029422 | 3300026142 | Bacteria | 3934 |
| 512 | Ga0207698_10058247 | 3300026142 | Bacteria | 2993 |
| 513 | Ga0207698_10152943 | 3300026142 | Bacteria | 2005 |
| 514 | Ga0207698_10265868 | 3300026142 | Bacteria | 1578 |
| 515 | Ga0207698_10320895 | 3300026142 | Bacteria | 1450 |
| 516 | Ga0209983_1004501 | 3300027665 | Bacteria | 2928 |
| 517 | Ga0209974_10000990 | 3300027876 | Bacteria | 9987 |
| 518 | Ga0209974_10009484 | 3300027876 | Bacteria | 3305 |
| 519 | Ga0268266_10027905 | 3300028379 | Bacteria | 4801 |
| 520 | Ga0268266_10033207 | 3300028379 | Bacteria | 4388 |
| 521 | Ga0268266_10100141 | 3300028379 | Bacteria | 2552 |
| 522 | Ga0268265_10000607 | 3300028380 | Bacteria | 35893 |
| 523 | Ga0268265_10006136 | 3300028380 | Bacteria | 8153 |
| 524 | Ga0268265_10013973 | 3300028380 | Bacteria | 5467 |
| 525 | Ga0268265_10040240 | 3300028380 | Bacteria | 3451 |
| 526 | Ga0268265_10182082 | 3300028380 | Bacteria | 1806 |
| 527 | Ga0268264_10000634 | 3300028381 | Bacteria | 41826 |
| 528 | Ga0268264_10001019 | 3300028381 | Bacteria | 28201 |
| 529 | Ga0268264_10002547 | 3300028381 | Bacteria | 15981 |
| 530 | Ga0268264_10058285 | 3300028381 | Bacteria | 3233 |
| 531 | Ga0307517_10044322 | 3300028786 | Bacteria | 4709 |
| 532 | Ga0307517_10127210 | 3300028786 | Bacteria | 1853 |
| 533 | Ga0316176_1173477 | 3300030732 | Bacteria | 1859 |
| 534 | Ga0316180_1092407 | 3300030736 | Bacteria | 2435 |
| 535 | Ga0316183_1194200 | 3300030742 | Bacteria | 1074 |
| 536 | Ga0316181_1010522 | 3300030744 | Bacteria | 1798 |
| 537 | Ga0307513_10059999 | 3300031456 | Bacteria | 4035 |
| 538 | Ga0307513_10472561 | 3300031456 | Bacteria | 975 |
| 539 | Ga0307408_100015250 | 3300031548 | Bacteria | 5116 |
| 540 | Ga0307408_100051378 | 3300031548 | Bacteria | 2969 |
| 541 | Ga0307408_100080102 | 3300031548 | Bacteria | 2438 |
| 542 | Ga0307408_100091772 | 3300031548 | Bacteria | 2294 |
| 543 | Ga0307408_100267624 | 3300031548 | Bacteria | 1417 |
| 544 | Ga0307408_100390827 | 3300031548 | Bacteria | 1192 |
| 545 | Ga0307516_10144543 | 3300031730 | Bacteria | 2145 |
| 546 | Ga0307405_10013101 | 3300031731 | Bacteria | 4414 |
| 547 | Ga0307405_10029271 | 3300031731 | Bacteria | 3218 |
| 548 | Ga0307405_10083236 | 3300031731 | Bacteria | 2097 |
| 549 | Ga0307405_10130318 | 3300031731 | Bacteria | 1736 |
| 550 | Ga0307405_10344640 | 3300031731 | Bacteria | 1147 |
| 551 | Ga0307405_10390249 | 3300031731 | Bacteria | 1087 |
| 552 | Ga0307405_10560111 | 3300031731 | Bacteria | 926 |
| 553 | Ga0307413_10006953 | 3300031824 | Bacteria | 5211 |
| 554 | Ga0307413_10023067 | 3300031824 | Bacteria | 3367 |
| 555 | Ga0307413_10045729 | 3300031824 | Bacteria | 2597 |
| 556 | Ga0307413_10156956 | 3300031824 | Unclassified | 1593 |
| 557 | Ga0307410_10001524 | 3300031852 | Bacteria | 10547 |
| 558 | Ga0307410_10002541 | 3300031852 | Bacteria | 8833 |
| 559 | Ga0307410_10006594 | 3300031852 | Bacteria | 6277 |
| 560 | Ga0307410_10010566 | 3300031852 | Bacteria | 5237 |
| 561 | Ga0307410_10013709 | 3300031852 | Bacteria | 4740 |
| 562 | Ga0307410_10036358 | 3300031852 | Bacteria | 3206 |
| 563 | Ga0307410_10043909 | 3300031852 | Bacteria | 2965 |
| 564 | Ga0307410_10045613 | 3300031852 | Bacteria | 2920 |
| 565 | Ga0307410_10252144 | 3300031852 | Bacteria | 1372 |
| 566 | Ga0307406_10033272 | 3300031901 | Bacteria | 3154 |
| 567 | Ga0307406_10062485 | 3300031901 | Bacteria | 2409 |
| 568 | Ga0307406_10094667 | 3300031901 | Bacteria | 2019 |
| 569 | Ga0307406_10097014 | 3300031901 | Bacteria | 1998 |
| 570 | Ga0307406_10146347 | 3300031901 | Bacteria | 1679 |
| 571 | Ga0307406_10256624 | 3300031901 | Bacteria | 1320 |
| 572 | Ga0307406_10265174 | 3300031901 | Bacteria | 1302 |
| 573 | Ga0307406_10300007 | 3300031901 | Bacteria | 1234 |
| 574 | Ga0307406_10320637 | 3300031901 | Bacteria | 1198 |
| 575 | Ga0307406_10525807 | 3300031901 | Bacteria | 963 |
| 576 | Ga0307407_10029956 | 3300031903 | Bacteria | 2929 |
| 577 | Ga0307407_10033216 | 3300031903 | Bacteria | 2813 |
| 578 | Ga0307407_10044587 | 3300031903 | Bacteria | 2501 |
| 579 | Ga0307407_10061890 | 3300031903 | Bacteria | 2190 |
| 580 | Ga0307407_10083516 | 3300031903 | Bacteria | 1938 |
| 581 | Ga0307407_10122908 | 3300031903 | Bacteria | 1648 |
| 582 | Ga0307407_10254322 | 3300031903 | Bacteria | 1205 |
| 583 | Ga0307407_10397299 | 3300031903 | Bacteria | 988 |
| 584 | Ga0307407_10413640 | 3300031903 | Bacteria | 970 |
| 585 | Ga0307412_10002333 | 3300031911 | Bacteria | 10511 |
| 586 | Ga0307412_10003753 | 3300031911 | Bacteria | 8444 |
| 587 | Ga0307412_10019090 | 3300031911 | Bacteria | 4141 |
| 588 | Ga0307412_10056498 | 3300031911 | Bacteria | 2616 |
| 589 | Ga0307412_10083089 | 3300031911 | Bacteria | 2219 |
| 590 | Ga0307412_10086981 | 3300031911 | Bacteria | 2176 |
| 591 | Ga0307412_10170101 | 3300031911 | Bacteria | 1628 |
| 592 | Ga0307412_10234602 | 3300031911 | Bacteria | 1415 |
| 593 | Ga0307412_10315531 | 3300031911 | Bacteria | 1241 |
| 594 | Ga0307412_10566532 | 3300031911 | Bacteria | 956 |
| 595 | Ga0307409_100009382 | 3300031995 | Bacteria | 6008 |
| 596 | Ga0307409_100016968 | 3300031995 | Bacteria | 4837 |
| 597 | Ga0307409_100060305 | 3300031995 | Bacteria | 2958 |
| 598 | Ga0307409_100065443 | 3300031995 | Bacteria | 2860 |
| 599 | Ga0307409_100183528 | 3300031995 | Bacteria | 1854 |
| 600 | Ga0307409_100203812 | 3300031995 | Bacteria | 1772 |
| 601 | Ga0307409_100311378 | 3300031995 | Bacteria | 1469 |
| 602 | Ga0307409_100391245 | 3300031995 | Bacteria | 1325 |
| 603 | Ga0307409_100429147 | 3300031995 | Bacteria | 1270 |
| 604 | Ga0307409_100644293 | 3300031995 | Bacteria | 1052 |
| 605 | Ga0307409_100822869 | 3300031995 | Bacteria | 938 |
| 606 | Ga0307409_100841948 | 3300031995 | Bacteria | 927 |
| 607 | Ga0307416_100010569 | 3300032002 | Bacteria | 6105 |
| 608 | Ga0307416_100043317 | 3300032002 | Bacteria | 3523 |
| 609 | Ga0307416_100089815 | 3300032002 | Bacteria | 2632 |
| 610 | Ga0307416_100169717 | 3300032002 | Bacteria | 2029 |
| 611 | Ga0307416_100181893 | 3300032002 | Bacteria | 1971 |
| 612 | Ga0307416_100259842 | 3300032002 | Bacteria | 1696 |
| 613 | Ga0307416_100311078 | 3300032002 | Bacteria | 1572 |
| 614 | Ga0307416_100346287 | 3300032002 | Bacteria | 1501 |
| 615 | Ga0307416_100535007 | 3300032002 | Bacteria | 1242 |
| 616 | Ga0307414_10007424 | 3300032004 | Bacteria | 6157 |
| 617 | Ga0307414_10074392 | 3300032004 | Bacteria | 2461 |
| 618 | Ga0307414_10077437 | 3300032004 | Bacteria | 2420 |
| 619 | Ga0307414_10087767 | 3300032004 | Bacteria | 2300 |
| 620 | Ga0307414_10109184 | 3300032004 | Bacteria | 2101 |
| 621 | Ga0307414_10112369 | 3300032004 | Bacteria | 2076 |
| 622 | Ga0307414_10144491 | 3300032004 | Bacteria | 1867 |
| 623 | Ga0307414_10174172 | 3300032004 | Bacteria | 1723 |
| 624 | Ga0307414_10188003 | 3300032004 | Bacteria | 1668 |
| 625 | Ga0307414_10238242 | 3300032004 | Bacteria | 1504 |
| 626 | Ga0307414_10766675 | 3300032004 | Bacteria | 878 |
| 627 | Ga0307411_10000518 | 3300032005 | Bacteria | 13563 |
| 628 | Ga0307411_10005481 | 3300032005 | Bacteria | 6239 |
| 629 | Ga0307411_10024776 | 3300032005 | Bacteria | 3582 |
| 630 | Ga0307411_10032304 | 3300032005 | Bacteria | 3232 |
| 631 | Ga0307411_10033608 | 3300032005 | Bacteria | 3183 |
| 632 | Ga0307411_10046369 | 3300032005 | Bacteria | 2801 |
| 633 | Ga0307411_10058003 | 3300032005 | Bacteria | 2560 |
| 634 | Ga0307411_10081614 | 3300032005 | Bacteria | 2227 |
| 635 | Ga0307411_10086504 | 3300032005 | Bacteria | 2174 |
| 636 | Ga0307411_10100317 | 3300032005 | Bacteria | 2045 |
| 637 | Ga0307411_10111180 | 3300032005 | Bacteria | 1961 |
| 638 | Ga0307411_10257057 | 3300032005 | Unclassified | 1377 |
| 639 | Ga0307415_100000171 | 3300032126 | Bacteria | 28816 |
| 640 | Ga0307415_100059574 | 3300032126 | Bacteria | 2634 |
| 641 | Ga0307415_100091983 | 3300032126 | Bacteria | 2198 |
| 642 | Ga0307415_100147335 | 3300032126 | Bacteria | 1807 |
| 643 | Ga0307415_100306690 | 3300032126 | Bacteria | 1317 |
| 644 | Ga0316583_10006180 | 3300032133 | Bacteria | 4308 |
| 645 | Ga0307510_10000369 | 3300033180 | Bacteria | 42647 |
| 646 | Ga0373958_0048274 | 3300034819 | Bacteria | 892 |
| 647 | Ga0373923_0163279 | 3300035111 | Bacteria | 1017 |
| 648 | Ga0373939_0059072 | 3300035114 | Bacteria | 1215 |
| 649 | Ga0373957_0011847 | 3300035120 | Bacteria | 2922 |
| 650 | Ga0373955_0017940 | 3300035172 | Bacteria | 3510 |
| 651 | Ga0373931_0010139 | 3300035691 | Bacteria | 4522 |
| 652 | Ga0373935_0025073 | 3300035692 | Bacteria | 3674 |
| 653 | Ga0373933_0055688 | 3300035724 | Bacteria | 2373 |
| 654 | Ga0373937_0033405 | 3300036401 | Bacteria | 4672 |
| 655 | Ga0316582_0015227 | 3300036647 | Bacteria | 4390 |
| 656 | Ga0316582_0216777 | 3300036647 | Bacteria | 1308 |
| 657 | Ga0316584_0634968 | 3300036712 | Bacteria | 737 |
| 658 | Ga0373925_0634660 | 3300037068 | Bacteria | 880 |
| 659 | Ga0395899_0000129 | 3300037312 | Bacteria | 118043 |
| 660 | Ga0395899_0002708 | 3300037312 | Bacteria | 14288 |
| 661 | Ga0395899_0014549 | 3300037312 | Bacteria | 6008 |
| 662 | Ga0395899_0049098 | 3300037312 | Bacteria | 3137 |
| 663 | Ga0395899_0075048 | 3300037312 | Bacteria | 2469 |
| 664 | Ga0395899_0137130 | 3300037312 | Bacteria | 1743 |
| 665 | Ga0395900_0000468 | 3300037418 | Bacteria | 57784 |
| 666 | Ga0395900_0008602 | 3300037418 | Bacteria | 10487 |
| 667 | Ga0395900_0010815 | 3300037418 | Bacteria | 9336 |
| 668 | Ga0395900_0014984 | 3300037418 | Bacteria | 7901 |
| 669 | Ga0395900_0021957 | 3300037418 | Bacteria | 6526 |
| 670 | Ga0395900_0023328 | 3300037418 | Bacteria | 6332 |
| 671 | Ga0395900_0024082 | 3300037418 | Bacteria | 6230 |
| 672 | Ga0395900_0036992 | 3300037418 | Bacteria | 5032 |
| 673 | Ga0395900_0077876 | 3300037418 | Bacteria | 3406 |
| 674 | Ga0395900_0078105 | 3300037418 | Bacteria | 3401 |
| 675 | Ga0395900_0107872 | 3300037418 | Bacteria | 2860 |
| 676 | Ga0395900_0327208 | 3300037418 | Bacteria | 1511 |
| 677 | Ga0395900_0481325 | 3300037418 | Bacteria | 1194 |
| 678 | Ga0395898_0018728 | 3300037466 | Bacteria | 7057 |
| 679 | Ga0395898_0026615 | 3300037466 | Bacteria | 5817 |
| 680 | Ga0395898_0030537 | 3300037466 | Bacteria | 5392 |
| 681 | Ga0395898_0031474 | 3300037466 | Bacteria | 5300 |
| 682 | Ga0395898_0037775 | 3300037466 | Bacteria | 4788 |
| 683 | Ga0395898_0147662 | 3300037466 | Bacteria | 2250 |
| 684 | Ga0395898_0149228 | 3300037466 | Bacteria | 2237 |
| 685 | Ga0395898_0324907 | 3300037466 | Bacteria | 1467 |
| 686 | Ga0395898_0580358 | 3300037466 | Bacteria | 1063 |
| 687 | Ga0395898_0844297 | 3300037466 | Bacteria | 855 |
| 688 | Ga0395905_0000232 | 3300037471 | Bacteria | 84233 |
| 689 | Ga0395905_0002796 | 3300037471 | Bacteria | 19111 |
| 690 | Ga0395905_0015679 | 3300037471 | Bacteria | 7199 |
| 691 | Ga0395905_0026630 | 3300037471 | Bacteria | 5451 |
| 692 | Ga0395905_0048085 | 3300037471 | Bacteria | 3998 |
| 693 | Ga0395905_0051277 | 3300037471 | Bacteria | 3864 |
| 694 | Ga0395905_0071242 | 3300037471 | Bacteria | 3259 |
| 695 | Ga0395905_0129687 | 3300037471 | Bacteria | 2371 |
| 696 | Ga0316581_0045622 | 3300037588 | Bacteria | 1339 |
| 697 | Ga0395901_0000031 | 3300038443 | Bacteria | 241733 |
| 698 | Ga0395901_0000131 | 3300038443 | Bacteria | 96504 |
| 699 | Ga0395901_0008693 | 3300038443 | Bacteria | 10262 |
| 700 | Ga0395901_0024121 | 3300038443 | Bacteria | 6239 |
| 701 | Ga0395901_0042467 | 3300038443 | Bacteria | 4714 |
| 702 | Ga0395901_0062053 | 3300038443 | Bacteria | 3889 |
| 703 | Ga0395901_0066469 | 3300038443 | Bacteria | 3755 |
| 704 | Ga0395901_0093494 | 3300038443 | Bacteria | 3148 |
| 705 | Ga0395901_0141388 | 3300038443 | Bacteria | 2529 |
| 706 | Ga0395901_0177005 | 3300038443 | Bacteria | 2237 |
| 707 | Ga0395901_0202297 | 3300038443 | Bacteria | 2082 |
| 708 | Ga0395901_0389393 | 3300038443 | Bacteria | 1433 |
| 709 | Ga0439431_0042236 | 3300041997 | Bacteria | 1164 |
| 710 | Ga0439443_016330 | 3300042003 | Bacteria | 1133 |
| 711 | Ga0450920_007031 | 3300042122 | Bacteria | 2033 |
| 712 | Ga0439464_0000427 | 3300042439 | Bacteria | 8288 |
| 713 | Ga0466966_0000021 | 3300044684 | Bacteria | 116714 |
| 714 | Ga0466966_0033906 | 3300044684 | Bacteria | 3304 |
| 715 | Ga0466966_0096905 | 3300044684 | Bacteria | 1827 |
| 716 | Ga0466961_0026586 | 3300044693 | Bacteria | 3719 |
| 717 | Ga0466961_0082147 | 3300044693 | Bacteria | 2039 |
| 718 | Ga0466963_0036592 | 3300044694 | Bacteria | 3202 |
| 719 | Ga0466964_0034342 | 3300044706 | Bacteria | 2024 |
| 720 | Ga0466971_0013190 | 3300044719 | Bacteria | 3626 |
| 721 | Ga0466957_0017966 | 3300044842 | Bacteria | 4147 |
| 722 | Ga0466959_0108427 | 3300045049 | Bacteria | 1984 |
| 723 | Ga0466958_0003833 | 3300045836 | Bacteria | 7857 |
| 724 | Ga0466967_0018938 | 3300045976 | Bacteria | 5522 |
| 725 | Ga0466967_0058953 | 3300045976 | Bacteria | 3395 |
| 726 | Ga0495638_0097754 | 3300046460 | Bacteria | 1760 |
| 727 | Ga0495650_0031267 | 3300046471 | Bacteria | 2398 |
| 728 | Ga0495584_0124321 | 3300046491 | Bacteria | 1307 |
| 729 | Ga0495637_0073734 | 3300046520 | Bacteria | 1372 |
| 730 | Ga0495648_0013722 | 3300046524 | Bacteria | 5972 |
| 731 | Ga0495648_0038706 | 3300046524 | Bacteria | 3045 |
| 732 | Ga0495642_0008044 | 3300046528 | Bacteria | 4034 |
| 733 | Ga0495598_0181488 | 3300046537 | Bacteria | 751 |
| 734 | Ga0495668_0002012 | 3300046616 | Bacteria | 17752 |
| 735 | Ga0495659_0015361 | 3300046664 | Bacteria | 2516 |
| 736 | Ga0495669_0003949 | 3300046684 | Bacteria | 6106 |
| 737 | Ga0495669_0115754 | 3300046684 | Bacteria | 1254 |
| 738 | Ga0495670_0008719 | 3300046691 | Bacteria | 4991 |
| 739 | Ga0495670_0014736 | 3300046691 | Bacteria | 3847 |
| 740 | Ga0495670_0089531 | 3300046691 | Bacteria | 1574 |
| 741 | Ga0495660_0218412 | 3300046810 | Bacteria | 900 |
| 742 | Ga0495677_0003219 | 3300047445 | Bacteria | 6369 |
| 743 | Ga0495602_0054509 | 3300048088 | Bacteria | 3529 |
| 744 | Ga0496100_0544496 | 3300048903 | Bacteria | 897 |
| 745 | Ga0496101_0041166 | 3300048904 | Bacteria | 3293 |
| 746 | Ga0496101_0136335 | 3300048904 | Bacteria | 1868 |
| 747 | Ga0496102_0007003 | 3300048905 | Bacteria | 9626 |
| 748 | Ga0496102_0273733 | 3300048905 | Bacteria | 1592 |
| 749 | Ga0496103_0016842 | 3300048906 | Bacteria | 4365 |
| 750 | Ga0496106_0386033 | 3300048909 | Bacteria | 1125 |
| 751 | Ga0496107_0010812 | 3300048910 | Bacteria | 6350 |
| 752 | Ga0496108_0243655 | 3300048911 | Bacteria | 1564 |
| 753 | Ga0496108_0291198 | 3300048911 | Bacteria | 1421 |
| 754 | Ga0496109_0037244 | 3300048912 | Bacteria | 4395 |
| 755 | Ga0496109_0154762 | 3300048912 | Bacteria | 2147 |
| 756 | Ga0496109_0295348 | 3300048912 | Bacteria | 1528 |
| 757 | Ga0496110_0004899 | 3300048913 | Bacteria | 10445 |
| 758 | Ga0496110_0010491 | 3300048913 | Bacteria | 7540 |
| 759 | Ga0496111_0001883 | 3300048914 | Bacteria | 12409 |
| 760 | Ga0496111_0049638 | 3300048914 | Bacteria | 3026 |
| 761 | Ga0496112_0565932 | 3300048915 | Bacteria | 1070 |
| 762 | Ga0496113_0002116 | 3300048916 | Bacteria | 11451 |
| 763 | Ga0496114_0262924 | 3300048917 | Bacteria | 1519 |
| 764 | Ga0496115_0008793 | 3300048918 | Bacteria | 7482 |
| 765 | Ga0496125_0198494 | 3300048928 | Bacteria | 1316 |
| 766 | Ga0501292_012493 | 3300049515 | Bacteria | 1296 |
| 767 | Ga0501298_007399 | 3300049521 | Bacteria | 1820 |
| 768 | Ga0501070_0166768 | 3300049586 | Bacteria | 1815 |
| 769 | Ga0501071_0071606 | 3300049587 | Bacteria | 2528 |
| 770 | Ga0501235_017511 | 3300049669 | Bacteria | 1585 |
| 771 | Ga0501243_009778 | 3300049675 | Bacteria | 1492 |
| 772 | Ga0501249_004088 | 3300049679 | Bacteria | 2952 |
| 773 | Ga0501225_0042682 | 3300049705 | Bacteria | 1253 |
| 774 | Ga0501080_0371850 | 3300049742 | Bacteria | 1289 |
| 775 | Ga0501263_002294 | 3300049760 | Bacteria | 1934 |
| 776 | Ga0501266_011983 | 3300049763 | Bacteria | 1115 |
| 777 | Ga0501268_006179 | 3300049765 | Bacteria | 1748 |
| 778 | Ga0501268_010692 | 3300049765 | Bacteria | 1434 |
| 779 | Ga0501272_008243 | 3300049769 | Bacteria | 1141 |
| 780 | Ga0501273_018358 | 3300049770 | Bacteria | 930 |
| 781 | Ga0501280_000314 | 3300049776 | Bacteria | 12170 |
| 782 | Ga0500643_000096 | 3300053087 | Bacteria | 92125 |
| 783 | Ga0500643_001035 | 3300053087 | Bacteria | 16912 |
| 784 | Ga0500646_0125306 | 3300053090 | Bacteria | 830 |
| 785 | Ga0500647_0008473 | 3300053091 | Bacteria | 4464 |
| 786 | Ga0500618_006614 | 3300053125 | Bacteria | 3384 |
| 787 | Ga0500658_0000032 | 3300053134 | Bacteria | 90863 |
| 788 | Ga0500636_0136298 | 3300053177 | Bacteria | 1363 |
| 789 | Ga0466962_0077696 | 3300061719 | Bacteria | 1587 |
| 790 | Ga0466962_0202747 | 3300061719 | Bacteria | 969 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037466 | Ga0395898_0844297 | Ga0395898_0844297_11_649 | 198 |
| 2 | 3300025944 | Ga0207661_10535680 | Ga0207661_105356802 | 207 |
| 3 | 3300032005 | Ga0307411_10081614 | Ga0307411_100816142 | 211 |
| 4 | 3300005344 | Ga0070661_100224446 | Ga0070661_1002244462 | 212 |
| 5 | 3300005563 | Ga0068855_100310890 | Ga0068855_1003108903 | 212 |
| 6 | 3300005578 | Ga0068854_100014664 | Ga0068854_1000146645 | 212 |
| 7 | 3300005616 | Ga0068852_100006849 | Ga0068852_10000684910 | 212 |
| 8 | 3300009551 | Ga0105238_10031317 | Ga0105238_100313175 | 212 |
| 9 | 3300013102 | Ga0157371_10069359 | Ga0157371_100693594 | 212 |
| 10 | 3300013102 | Ga0157371_10604169 | Ga0157371_106041691 | 212 |
| 11 | 3300025913 | Ga0207695_10109640 | Ga0207695_101096403 | 212 |
| 12 | 3300025924 | Ga0207694_10048271 | Ga0207694_100482713 | 212 |
| 13 | 3300025949 | Ga0207667_10206083 | Ga0207667_102060833 | 212 |
| 14 | 3300026142 | Ga0207698_10152943 | Ga0207698_101529431 | 212 |
| 15 | 3300025919 | Ga0207657_10337718 | Ga0207657_103377182 | 213 |
| 16 | 3300005546 | Ga0070696_100385711 | Ga0070696_1003857112 | 215 |
| 17 | 3300013102 | Ga0157371_10197177 | Ga0157371_101971772 | 216 |
| 18 | 3300031901 | Ga0307406_10300007 | Ga0307406_103000072 | 216 |
| 19 | 3300005339 | Ga0070660_100382842 | Ga0070660_1003828421 | 217 |
| 20 | 3300005434 | Ga0070709_10098438 | Ga0070709_100984383 | 217 |
| 21 | 3300005435 | Ga0070714_100046589 | Ga0070714_1000465896 | 217 |
| 22 | 3300005436 | Ga0070713_100255994 | Ga0070713_1002559942 | 217 |
| 23 | 3300005539 | Ga0068853_100061639 | Ga0068853_1000616393 | 217 |
| 24 | 3300005614 | Ga0068856_100027857 | Ga0068856_1000278573 | 217 |
| 25 | 3300005614 | Ga0068856_100474565 | Ga0068856_1004745652 | 217 |
| 26 | 3300006028 | Ga0070717_10082997 | Ga0070717_100829974 | 217 |
| 27 | 3300006173 | Ga0070716_100115373 | Ga0070716_1001153732 | 217 |
| 28 | 3300006175 | Ga0070712_100270517 | Ga0070712_1002705172 | 217 |
| 29 | 3300013102 | Ga0157371_10012251 | Ga0157371_100122518 | 217 |
| 30 | 3300013104 | Ga0157370_10018639 | Ga0157370_100186397 | 217 |
| 31 | 3300013104 | Ga0157370_10146539 | Ga0157370_101465392 | 217 |
| 32 | 3300013105 | Ga0157369_10050600 | Ga0157369_100506002 | 217 |
| 33 | 3300013307 | Ga0157372_10195058 | Ga0157372_101950584 | 217 |
| 34 | 3300025915 | Ga0207693_10120832 | Ga0207693_101208322 | 217 |
| 35 | 3300025917 | Ga0207660_10207722 | Ga0207660_102077222 | 217 |
| 36 | 3300025919 | Ga0207657_10018979 | Ga0207657_100189796 | 217 |
| 37 | 3300025928 | Ga0207700_10320486 | Ga0207700_103204862 | 217 |
| 38 | 3300025929 | Ga0207664_10049541 | Ga0207664_100495414 | 217 |
| 39 | 3300025939 | Ga0207665_10056891 | Ga0207665_100568914 | 217 |
| 40 | 3300025940 | Ga0207691_10218948 | Ga0207691_102189482 | 217 |
| 41 | 3300026041 | Ga0207639_10176839 | Ga0207639_101768391 | 217 |
| 42 | 3300026078 | Ga0207702_10021319 | Ga0207702_100213194 | 217 |
| 43 | 3300026078 | Ga0207702_10586832 | Ga0207702_105868322 | 217 |
| 44 | 3300035111 | Ga0373923_0163279 | Ga0373923_0163279_153_863 | 217 |
| 45 | 3300035120 | Ga0373957_0011847 | Ga0373957_0011847_1169_1867 | 217 |
| 46 | 3300035172 | Ga0373955_0017940 | Ga0373955_0017940_2378_3076 | 217 |
| 47 | 3300035692 | Ga0373935_0025073 | Ga0373935_0025073_1041_1751 | 217 |
| 48 | 3300035724 | Ga0373933_0055688 | Ga0373933_0055688_618_1316 | 217 |
| 49 | 3300036401 | Ga0373937_0033405 | Ga0373937_0033405_2135_2833 | 217 |
| 50 | 3300048088 | Ga0495602_0054509 | Ga0495602_0054509_1172_1870 | 217 |
| 51 | 3300002073 | JGI24745J21846_1005029 | JGI24745J21846_10050292 | 218 |
| 52 | 3300005293 | Ga0065715_10166590 | Ga0065715_101665902 | 218 |
| 53 | 3300005328 | Ga0070676_10050997 | Ga0070676_100509972 | 218 |
| 54 | 3300005328 | Ga0070676_10113685 | Ga0070676_101136852 | 218 |
| 55 | 3300005331 | Ga0070670_100014078 | Ga0070670_1000140782 | 218 |
| 56 | 3300005337 | Ga0070682_100032930 | Ga0070682_1000329302 | 218 |
| 57 | 3300005338 | Ga0068868_100382456 | Ga0068868_1003824562 | 218 |
| 58 | 3300005339 | Ga0070660_100056812 | Ga0070660_1000568122 | 218 |
| 59 | 3300005344 | Ga0070661_100136002 | Ga0070661_1001360022 | 218 |
| 60 | 3300005354 | Ga0070675_100184831 | Ga0070675_1001848313 | 218 |
| 61 | 3300005355 | Ga0070671_100039621 | Ga0070671_1000396215 | 218 |
| 62 | 3300005356 | Ga0070674_100076178 | Ga0070674_1000761782 | 218 |
| 63 | 3300005364 | Ga0070673_100173546 | Ga0070673_1001735462 | 218 |
| 64 | 3300005455 | Ga0070663_100086544 | Ga0070663_1000865441 | 218 |
| 65 | 3300005456 | Ga0070678_100062596 | Ga0070678_1000625962 | 218 |
| 66 | 3300005459 | Ga0068867_100364543 | Ga0068867_1003645431 | 218 |
| 67 | 3300005539 | Ga0068853_100830510 | Ga0068853_1008305101 | 218 |
| 68 | 3300005543 | Ga0070672_100107798 | Ga0070672_1001077983 | 218 |
| 69 | 3300005547 | Ga0070693_100520703 | Ga0070693_1005207031 | 218 |
| 70 | 3300005564 | Ga0070664_100097212 | Ga0070664_1000972122 | 218 |
| 71 | 3300005578 | Ga0068854_100071312 | Ga0068854_1000713122 | 218 |
| 72 | 3300005719 | Ga0068861_100304065 | Ga0068861_1003040652 | 218 |
| 73 | 3300006358 | Ga0068871_100244330 | Ga0068871_1002443302 | 218 |
| 74 | 3300009098 | Ga0105245_10042402 | Ga0105245_100424023 | 218 |
| 75 | 3300013297 | Ga0157378_10027473 | Ga0157378_100274732 | 218 |
| 76 | 3300025315 | Ga0207697_10001895 | Ga0207697_100018958 | 218 |
| 77 | 3300025893 | Ga0207682_10002958 | Ga0207682_100029582 | 218 |
| 78 | 3300025901 | Ga0207688_10001410 | Ga0207688_100014109 | 218 |
| 79 | 3300025904 | Ga0207647_10080968 | Ga0207647_100809682 | 218 |
| 80 | 3300025907 | Ga0207645_10074916 | Ga0207645_100749163 | 218 |
| 81 | 3300025908 | Ga0207643_10014049 | Ga0207643_100140496 | 218 |
| 82 | 3300025919 | Ga0207657_10012396 | Ga0207657_1001239610 | 218 |
| 83 | 3300025926 | Ga0207659_10030808 | Ga0207659_100308084 | 218 |
| 84 | 3300025927 | Ga0207687_10113697 | Ga0207687_101136973 | 218 |
| 85 | 3300025932 | Ga0207690_10499985 | Ga0207690_104999851 | 218 |
| 86 | 3300025932 | Ga0207690_10512602 | Ga0207690_105126022 | 218 |
| 87 | 3300025933 | Ga0207706_10099945 | Ga0207706_100999455 | 218 |
| 88 | 3300025937 | Ga0207669_10002765 | Ga0207669_100027652 | 218 |
| 89 | 3300025940 | Ga0207691_10074127 | Ga0207691_100741272 | 218 |
| 90 | 3300025942 | Ga0207689_10112929 | Ga0207689_101129293 | 218 |
| 91 | 3300025942 | Ga0207689_10553909 | Ga0207689_105539092 | 218 |
| 92 | 3300025945 | Ga0207679_10046008 | Ga0207679_100460085 | 218 |
| 93 | 3300025960 | Ga0207651_10172892 | Ga0207651_101728922 | 218 |
| 94 | 3300026023 | Ga0207677_10067922 | Ga0207677_100679222 | 218 |
| 95 | 3300026089 | Ga0207648_10003539 | Ga0207648_1000353914 | 218 |
| 96 | 3300026095 | Ga0207676_10156502 | Ga0207676_101565022 | 218 |
| 97 | 3300026118 | Ga0207675_100222537 | Ga0207675_1002225372 | 218 |
| 98 | 3300026121 | Ga0207683_10013394 | Ga0207683_100133943 | 218 |
| 99 | 3300037418 | Ga0395900_0327208 | Ga0395900_0327208_593_1291 | 218 |
| 100 | 3300037471 | Ga0395905_0129687 | Ga0395905_0129687_87_785 | 218 |
| 101 | 3300038443 | Ga0395901_0042467 | Ga0395901_0042467_847_1545 | 218 |
| 102 | 3300048905 | Ga0496102_0273733 | Ga0496102_0273733_872_1570 | 218 |
| 103 | 3300048906 | Ga0496103_0016842 | Ga0496103_0016842_2371_3069 | 218 |
| 104 | 3300048912 | Ga0496109_0295348 | Ga0496109_0295348_533_1231 | 218 |
| 105 | 3300049776 | Ga0501280_000314 | Ga0501280_000314_6060_6770 | 218 |
| 106 | 3300006353 | Ga0075370_10005349 | Ga0075370_1000534911 | 220 |
| 107 | 3300025304 | Ga0209257_1011481 | Ga0209257_10114817 | 220 |
| 108 | 3300025917 | Ga0207660_10203210 | Ga0207660_102032103 | 220 |
| 109 | 3300013102 | Ga0157371_10025908 | Ga0157371_100259082 | 221 |
| 110 | 3300013307 | Ga0157372_10160734 | Ga0157372_101607342 | 221 |
| 111 | iso_pu_bacteria | 2599185354 | 2600203099 | 221 |
| 112 | 3300005353 | Ga0070669_100125866 | Ga0070669_1001258662 | 222 |
| 113 | 3300005841 | Ga0068863_100002810 | Ga0068863_10000281016 | 222 |
| 114 | 3300005843 | Ga0068860_100000391 | Ga0068860_10000039127 | 222 |
| 115 | 3300005844 | Ga0068862_100000014 | Ga0068862_100000014124 | 222 |
| 116 | 3300006931 | Ga0097620_100023168 | Ga0097620_1000231685 | 222 |
| 117 | 3300009101 | Ga0105247_10003692 | Ga0105247_100036923 | 222 |
| 118 | 3300009553 | Ga0105249_10000002 | Ga0105249_10000002274 | 222 |
| 119 | 3300014326 | Ga0157380_10363241 | Ga0157380_103632412 | 222 |
| 120 | 3300025900 | Ga0207710_10001762 | Ga0207710_1000176210 | 222 |
| 121 | 3300025923 | Ga0207681_10162280 | Ga0207681_101622802 | 222 |
| 122 | 3300025961 | Ga0207712_10000002 | Ga0207712_10000002645 | 222 |
| 123 | 3300026075 | Ga0207708_10240255 | Ga0207708_102402553 | 222 |
| 124 | 3300026088 | Ga0207641_10004364 | Ga0207641_1000436415 | 222 |
| 125 | 3300028380 | Ga0268265_10000607 | Ga0268265_100006078 | 222 |
| 126 | 3300028381 | Ga0268264_10000634 | Ga0268264_100006343 | 222 |
| 127 | 3300031731 | Ga0307405_10390249 | Ga0307405_103902492 | 222 |
| 128 | 3300031911 | Ga0307412_10234602 | Ga0307412_102346022 | 222 |
| 129 | 3300032133 | Ga0316583_10006180 | Ga0316583_100061805 | 222 |
| 130 | 3300036647 | Ga0316582_0015227 | Ga0316582_0015227_422_1105 | 222 |
| 131 | 3300036647 | Ga0316582_0216777 | Ga0316582_0216777_29_712 | 222 |
| 132 | 3300036712 | Ga0316584_0634968 | Ga0316584_0634968_26_712 | 222 |
| 133 | 3300037588 | Ga0316581_0045622 | Ga0316581_0045622_181_864 | 222 |
| 134 | 3300038443 | Ga0395901_0177005 | Ga0395901_0177005_332_1033 | 222 |
| 135 | 3300041997 | Ga0439431_0042236 | Ga0439431_0042236_33_716 | 222 |
| 136 | 3300042003 | Ga0439443_016330 | Ga0439443_016330_362_1045 | 222 |
| 137 | 3300048905 | Ga0496102_0007003 | Ga0496102_0007003_3083_3778 | 222 |
| 138 | 3300005353 | Ga0070669_100036160 | Ga0070669_1000361605 | 223 |
| 139 | 3300005578 | Ga0068854_100041472 | Ga0068854_1000414725 | 223 |
| 140 | 3300014325 | Ga0163163_10123122 | Ga0163163_101231222 | 223 |
| 141 | 3300025923 | Ga0207681_10030797 | Ga0207681_100307971 | 223 |
| 142 | 3300025981 | Ga0207640_10006878 | Ga0207640_100068783 | 223 |
| 143 | 3300026116 | Ga0207674_10109713 | Ga0207674_101097134 | 223 |
| 144 | 3300031548 | Ga0307408_100267624 | Ga0307408_1002676242 | 223 |
| 145 | 3300031548 | Ga0307408_100390827 | Ga0307408_1003908272 | 223 |
| 146 | 3300031731 | Ga0307405_10344640 | Ga0307405_103446402 | 223 |
| 147 | 3300031852 | Ga0307410_10013709 | Ga0307410_100137093 | 223 |
| 148 | 3300031901 | Ga0307406_10062485 | Ga0307406_100624852 | 223 |
| 149 | 3300031903 | Ga0307407_10044587 | Ga0307407_100445874 | 223 |
| 150 | 3300031903 | Ga0307407_10254322 | Ga0307407_102543222 | 223 |
| 151 | 3300031911 | Ga0307412_10056498 | Ga0307412_100564982 | 223 |
| 152 | 3300031995 | Ga0307409_100016968 | Ga0307409_1000169683 | 223 |
| 153 | 3300031995 | Ga0307409_100391245 | Ga0307409_1003912451 | 223 |
| 154 | 3300032002 | Ga0307416_100010569 | Ga0307416_1000105695 | 223 |
| 155 | 3300032002 | Ga0307416_100089815 | Ga0307416_1000898154 | 223 |
| 156 | 3300032005 | Ga0307411_10046369 | Ga0307411_100463691 | 223 |
| 157 | 3300032126 | Ga0307415_100059574 | Ga0307415_1000595743 | 223 |
| 158 | 3300005327 | Ga0070658_10055314 | Ga0070658_100553143 | 224 |
| 159 | 3300005327 | Ga0070658_10060673 | Ga0070658_100606733 | 224 |
| 160 | 3300005327 | Ga0070658_10770909 | Ga0070658_107709091 | 224 |
| 161 | 3300005329 | Ga0070683_100036480 | Ga0070683_1000364801 | 224 |
| 162 | 3300005339 | Ga0070660_100272161 | Ga0070660_1002721612 | 224 |
| 163 | 3300005344 | Ga0070661_100015630 | Ga0070661_1000156304 | 224 |
| 164 | 3300005345 | Ga0070692_10017116 | Ga0070692_100171163 | 224 |
| 165 | 3300005366 | Ga0070659_100120609 | Ga0070659_1001206093 | 224 |
| 166 | 3300005455 | Ga0070663_100081532 | Ga0070663_1000815322 | 224 |
| 167 | 3300005458 | Ga0070681_10277224 | Ga0070681_102772242 | 224 |
| 168 | 3300005530 | Ga0070679_100551324 | Ga0070679_1005513242 | 224 |
| 169 | 3300005535 | Ga0070684_100020259 | Ga0070684_1000202596 | 224 |
| 170 | 3300005548 | Ga0070665_100301553 | Ga0070665_1003015533 | 224 |
| 171 | 3300005563 | Ga0068855_100108475 | Ga0068855_1001084753 | 224 |
| 172 | 3300005563 | Ga0068855_100617221 | Ga0068855_1006172212 | 224 |
| 173 | 3300005563 | Ga0068855_100977069 | Ga0068855_1009770692 | 224 |
| 174 | 3300005616 | Ga0068852_100166314 | Ga0068852_1001663143 | 224 |
| 175 | 3300005618 | Ga0068864_100000145 | Ga0068864_10000014552 | 224 |
| 176 | 3300005842 | Ga0068858_100000268 | Ga0068858_1000002686 | 224 |
| 177 | 3300009177 | Ga0105248_10021785 | Ga0105248_100217852 | 224 |
| 178 | 3300013102 | Ga0157371_10017812 | Ga0157371_100178122 | 224 |
| 179 | 3300013102 | Ga0157371_10095601 | Ga0157371_100956012 | 224 |
| 180 | 3300013104 | Ga0157370_10088851 | Ga0157370_100888514 | 224 |
| 181 | 3300013104 | Ga0157370_10208742 | Ga0157370_102087423 | 224 |
| 182 | 3300013105 | Ga0157369_10011088 | Ga0157369_1001108810 | 224 |
| 183 | 3300013105 | Ga0157369_10565593 | Ga0157369_105655931 | 224 |
| 184 | 3300013296 | Ga0157374_10056025 | Ga0157374_100560252 | 224 |
| 185 | 3300013306 | Ga0163162_10010851 | Ga0163162_100108518 | 224 |
| 186 | 3300025315 | Ga0207697_10003663 | Ga0207697_100036633 | 224 |
| 187 | 3300025904 | Ga0207647_10024301 | Ga0207647_100243013 | 224 |
| 188 | 3300025909 | Ga0207705_10026528 | Ga0207705_100265286 | 224 |
| 189 | 3300025909 | Ga0207705_10029445 | Ga0207705_100294453 | 224 |
| 190 | 3300025909 | Ga0207705_10039655 | Ga0207705_100396553 | 224 |
| 191 | 3300025912 | Ga0207707_10332381 | Ga0207707_103323812 | 224 |
| 192 | 3300025919 | Ga0207657_10052117 | Ga0207657_100521172 | 224 |
| 193 | 3300025920 | Ga0207649_10019101 | Ga0207649_100191013 | 224 |
| 194 | 3300025921 | Ga0207652_10170400 | Ga0207652_101704003 | 224 |
| 195 | 3300025941 | Ga0207711_10003775 | Ga0207711_100037758 | 224 |
| 196 | 3300025944 | Ga0207661_10022512 | Ga0207661_100225123 | 224 |
| 197 | 3300025949 | Ga0207667_10081978 | Ga0207667_100819784 | 224 |
| 198 | 3300026035 | Ga0207703_10000139 | Ga0207703_1000013934 | 224 |
| 199 | 3300026067 | Ga0207678_10005368 | Ga0207678_100053684 | 224 |
| 200 | 3300026095 | Ga0207676_10000072 | Ga0207676_1000007280 | 224 |
| 201 | 3300026121 | Ga0207683_10565818 | Ga0207683_105658181 | 224 |
| 202 | 3300026142 | Ga0207698_10320895 | Ga0207698_103208952 | 224 |
| 203 | 3300028786 | Ga0307517_10127210 | Ga0307517_101272103 | 224 |
| 204 | 3300031456 | Ga0307513_10059999 | Ga0307513_100599997 | 224 |
| 205 | 3300031852 | Ga0307410_10010566 | Ga0307410_100105664 | 224 |
| 206 | 3300031901 | Ga0307406_10265174 | Ga0307406_102651742 | 224 |
| 207 | 3300031903 | Ga0307407_10413640 | Ga0307407_104136402 | 224 |
| 208 | 3300032005 | Ga0307411_10032304 | Ga0307411_100323043 | 224 |
| 209 | 3300032126 | Ga0307415_100147335 | Ga0307415_1001473352 | 224 |
| 210 | 3300033180 | Ga0307510_10000369 | Ga0307510_1000036917 | 224 |
| 211 | 3300037068 | Ga0373925_0634660 | Ga0373925_0634660_40_729 | 224 |
| 212 | 3300037312 | Ga0395899_0049098 | Ga0395899_0049098_1866_2555 | 224 |
| 213 | 3300037418 | Ga0395900_0008602 | Ga0395900_0008602_6409_7098 | 224 |
| 214 | 3300037466 | Ga0395898_0580358 | Ga0395898_0580358_299_988 | 224 |
| 215 | 3300038443 | Ga0395901_0008693 | Ga0395901_0008693_3165_3854 | 224 |
| 216 | 3300046460 | Ga0495638_0097754 | Ga0495638_0097754_640_1350 | 224 |
| 217 | 3300046524 | Ga0495648_0038706 | Ga0495648_0038706_859_1569 | 224 |
| 218 | 3300046810 | Ga0495660_0218412 | Ga0495660_0218412_20_709 | 224 |
| 219 | 3300047445 | Ga0495677_0003219 | Ga0495677_0003219_270_980 | 224 |
| 220 | 3300053087 | Ga0500643_001035 | Ga0500643_001035_3874_4584 | 224 |
| 221 | 3300053090 | Ga0500646_0125306 | Ga0500646_0125306_67_777 | 224 |
| 222 | 3300005335 | Ga0070666_10200552 | Ga0070666_102005522 | 225 |
| 223 | 3300013297 | Ga0157378_10043077 | Ga0157378_100430776 | 225 |
| 224 | 3300025903 | Ga0207680_10307194 | Ga0207680_103071942 | 225 |
| 225 | 3300028786 | Ga0307517_10044322 | Ga0307517_100443227 | 225 |
| 226 | 3300046471 | Ga0495650_0031267 | Ga0495650_0031267_1318_2010 | 225 |
| 227 | 3300046524 | Ga0495648_0013722 | Ga0495648_0013722_5248_5940 | 225 |
| 228 | 3300048928 | Ga0496125_0198494 | Ga0496125_0198494_68_763 | 225 |
| 229 | 3300001989 | JGI24739J22299_10008994 | JGI24739J22299_100089944 | 226 |
| 230 | 3300001990 | JGI24737J22298_10001822 | JGI24737J22298_100018226 | 226 |
| 231 | 3300002075 | JGI24738J21930_10000704 | JGI24738J21930_100007046 | 226 |
| 232 | 3300005327 | Ga0070658_10000177 | Ga0070658_1000017730 | 226 |
| 233 | 3300005329 | Ga0070683_100004360 | Ga0070683_1000043604 | 226 |
| 234 | 3300005331 | Ga0070670_100064639 | Ga0070670_1000646394 | 226 |
| 235 | 3300005335 | Ga0070666_10002806 | Ga0070666_1000280610 | 226 |
| 236 | 3300005338 | Ga0068868_100512449 | Ga0068868_1005124491 | 226 |
| 237 | 3300005339 | Ga0070660_100000065 | Ga0070660_10000006529 | 226 |
| 238 | 3300005344 | Ga0070661_100000084 | Ga0070661_10000008411 | 226 |
| 239 | 3300005355 | Ga0070671_100034473 | Ga0070671_1000344736 | 226 |
| 240 | 3300005366 | Ga0070659_100001520 | Ga0070659_10000152011 | 226 |
| 241 | 3300005367 | Ga0070667_100003791 | Ga0070667_1000037911 | 226 |
| 242 | 3300005455 | Ga0070663_100001477 | Ga0070663_10000147713 | 226 |
| 243 | 3300005457 | Ga0070662_100000017 | Ga0070662_10000001764 | 226 |
| 244 | 3300005458 | Ga0070681_10498269 | Ga0070681_104982692 | 226 |
| 245 | 3300005535 | Ga0070684_100042518 | Ga0070684_1000425185 | 226 |
| 246 | 3300005539 | Ga0068853_100000703 | Ga0068853_10000070323 | 226 |
| 247 | 3300005547 | Ga0070693_100009123 | Ga0070693_1000091234 | 226 |
| 248 | 3300005548 | Ga0070665_100009518 | Ga0070665_1000095182 | 226 |
| 249 | 3300005563 | Ga0068855_100000194 | Ga0068855_10000019458 | 226 |
| 250 | 3300005564 | Ga0070664_100000098 | Ga0070664_10000009829 | 226 |
| 251 | 3300005614 | Ga0068856_100000098 | Ga0068856_10000009862 | 226 |
| 252 | 3300005616 | Ga0068852_100000440 | Ga0068852_10000044010 | 226 |
| 253 | 3300005842 | Ga0068858_100032317 | Ga0068858_1000323176 | 226 |
| 254 | 3300006237 | Ga0097621_100132707 | Ga0097621_1001327072 | 226 |
| 255 | 3300006358 | Ga0068871_100259245 | Ga0068871_1002592452 | 226 |
| 256 | 3300009174 | Ga0105241_10022968 | Ga0105241_100229683 | 226 |
| 257 | 3300009177 | Ga0105248_10000444 | Ga0105248_100004449 | 226 |
| 258 | 3300013100 | Ga0157373_10019148 | Ga0157373_100191486 | 226 |
| 259 | 3300013102 | Ga0157371_10002003 | Ga0157371_100020039 | 226 |
| 260 | 3300013105 | Ga0157369_10299393 | Ga0157369_102993932 | 226 |
| 261 | 3300013296 | Ga0157374_10005411 | Ga0157374_1000541113 | 226 |
| 262 | 3300014325 | Ga0163163_10000169 | Ga0163163_1000016962 | 226 |
| 263 | 3300025903 | Ga0207680_10004223 | Ga0207680_100042236 | 226 |
| 264 | 3300025904 | Ga0207647_10002702 | Ga0207647_1000270215 | 226 |
| 265 | 3300025909 | Ga0207705_10000137 | Ga0207705_1000013746 | 226 |
| 266 | 3300025911 | Ga0207654_10143916 | Ga0207654_101439162 | 226 |
| 267 | 3300025912 | Ga0207707_10429724 | Ga0207707_104297242 | 226 |
| 268 | 3300025919 | Ga0207657_10000508 | Ga0207657_1000050816 | 226 |
| 269 | 3300025920 | Ga0207649_10000186 | Ga0207649_100001867 | 226 |
| 270 | 3300025924 | Ga0207694_10017707 | Ga0207694_100177074 | 226 |
| 271 | 3300025925 | Ga0207650_10054914 | Ga0207650_100549145 | 226 |
| 272 | 3300025931 | Ga0207644_10023264 | Ga0207644_100232642 | 226 |
| 273 | 3300025932 | Ga0207690_10000108 | Ga0207690_1000010817 | 226 |
| 274 | 3300025933 | Ga0207706_10000514 | Ga0207706_1000051429 | 226 |
| 275 | 3300025941 | Ga0207711_10005548 | Ga0207711_100055481 | 226 |
| 276 | 3300025944 | Ga0207661_10098825 | Ga0207661_100988254 | 226 |
| 277 | 3300025945 | Ga0207679_10000114 | Ga0207679_1000011421 | 226 |
| 278 | 3300025949 | Ga0207667_10016322 | Ga0207667_100163225 | 226 |
| 279 | 3300025986 | Ga0207658_10005799 | Ga0207658_100057992 | 226 |
| 280 | 3300026035 | Ga0207703_10005508 | Ga0207703_1000550811 | 226 |
| 281 | 3300026041 | Ga0207639_10000139 | Ga0207639_1000013922 | 226 |
| 282 | 3300026067 | Ga0207678_10006212 | Ga0207678_1000621214 | 226 |
| 283 | 3300026078 | Ga0207702_10001266 | Ga0207702_1000126610 | 226 |
| 284 | 3300026142 | Ga0207698_10000598 | Ga0207698_1000059816 | 226 |
| 285 | 3300028379 | Ga0268266_10033207 | Ga0268266_100332072 | 226 |
| 286 | 3300031911 | Ga0307412_10002333 | Ga0307412_100023335 | 226 |
| 287 | 3300032004 | Ga0307414_10087767 | Ga0307414_100877672 | 226 |
| 288 | 3300032004 | Ga0307414_10188003 | Ga0307414_101880033 | 226 |
| 289 | 3300034819 | Ga0373958_0048274 | Ga0373958_0048274_79_774 | 226 |
| 290 | 3300035114 | Ga0373939_0059072 | Ga0373939_0059072_338_1033 | 226 |
| 291 | 3300035691 | Ga0373931_0010139 | Ga0373931_0010139_906_1601 | 226 |
| 292 | 3300037418 | Ga0395900_0021957 | Ga0395900_0021957_4214_4909 | 226 |
| 293 | 3300037418 | Ga0395900_0036992 | Ga0395900_0036992_2746_3441 | 226 |
| 294 | 3300037471 | Ga0395905_0000232 | Ga0395905_0000232_26498_27193 | 226 |
| 295 | 3300037471 | Ga0395905_0048085 | Ga0395905_0048085_3168_3863 | 226 |
| 296 | 3300045976 | Ga0466967_0058953 | Ga0466967_0058953_2017_2712 | 226 |
| 297 | 3300046491 | Ga0495584_0124321 | Ga0495584_0124321_63_779 | 226 |
| 298 | 3300046528 | Ga0495642_0008044 | Ga0495642_0008044_595_1311 | 226 |
| 299 | 3300046664 | Ga0495659_0015361 | Ga0495659_0015361_885_1601 | 226 |
| 300 | 3300046684 | Ga0495669_0003949 | Ga0495669_0003949_4341_5057 | 226 |
| 301 | 3300046691 | Ga0495670_0008719 | Ga0495670_0008719_2319_3035 | 226 |
| 302 | 3300046691 | Ga0495670_0014736 | Ga0495670_0014736_46_762 | 226 |
| 303 | 3300002067 | JGI24735J21928_10009963 | JGI24735J21928_100099633 | 227 |
| 304 | 3300002067 | JGI24735J21928_10025273 | JGI24735J21928_100252733 | 227 |
| 305 | 3300005293 | Ga0065715_10000565 | Ga0065715_100005658 | 227 |
| 306 | 3300005327 | Ga0070658_10030017 | Ga0070658_100300175 | 227 |
| 307 | 3300005328 | Ga0070676_10042193 | Ga0070676_100421933 | 227 |
| 308 | 3300005328 | Ga0070676_10069490 | Ga0070676_100694902 | 227 |
| 309 | 3300005329 | Ga0070683_100002630 | Ga0070683_10000263010 | 227 |
| 310 | 3300005331 | Ga0070670_100007610 | Ga0070670_1000076106 | 227 |
| 311 | 3300005331 | Ga0070670_100075622 | Ga0070670_1000756224 | 227 |
| 312 | 3300005333 | Ga0070677_10005158 | Ga0070677_100051583 | 227 |
| 313 | 3300005333 | Ga0070677_10121833 | Ga0070677_101218332 | 227 |
| 314 | 3300005334 | Ga0068869_100153426 | Ga0068869_1001534261 | 227 |
| 315 | 3300005335 | Ga0070666_10000205 | Ga0070666_100002059 | 227 |
| 316 | 3300005338 | Ga0068868_100001585 | Ga0068868_10000158516 | 227 |
| 317 | 3300005339 | Ga0070660_100030157 | Ga0070660_1000301573 | 227 |
| 318 | 3300005339 | Ga0070660_100056680 | Ga0070660_1000566805 | 227 |
| 319 | 3300005340 | Ga0070689_100138728 | Ga0070689_1001387282 | 227 |
| 320 | 3300005340 | Ga0070689_100207404 | Ga0070689_1002074041 | 227 |
| 321 | 3300005341 | Ga0070691_10044907 | Ga0070691_100449073 | 227 |
| 322 | 3300005344 | Ga0070661_100007237 | Ga0070661_1000072376 | 227 |
| 323 | 3300005344 | Ga0070661_100059608 | Ga0070661_1000596082 | 227 |
| 324 | 3300005344 | Ga0070661_100073642 | Ga0070661_1000736422 | 227 |
| 325 | 3300005347 | Ga0070668_100007118 | Ga0070668_1000071186 | 227 |
| 326 | 3300005347 | Ga0070668_100251930 | Ga0070668_1002519303 | 227 |
| 327 | 3300005353 | Ga0070669_100005425 | Ga0070669_1000054259 | 227 |
| 328 | 3300005353 | Ga0070669_100117379 | Ga0070669_1001173792 | 227 |
| 329 | 3300005354 | Ga0070675_100005450 | Ga0070675_1000054506 | 227 |
| 330 | 3300005354 | Ga0070675_100016431 | Ga0070675_1000164314 | 227 |
| 331 | 3300005354 | Ga0070675_100063724 | Ga0070675_1000637242 | 227 |
| 332 | 3300005355 | Ga0070671_100005160 | Ga0070671_1000051603 | 227 |
| 333 | 3300005355 | Ga0070671_100022991 | Ga0070671_1000229917 | 227 |
| 334 | 3300005355 | Ga0070671_100072955 | Ga0070671_1000729552 | 227 |
| 335 | 3300005356 | Ga0070674_100009250 | Ga0070674_1000092506 | 227 |
| 336 | 3300005364 | Ga0070673_100000376 | Ga0070673_10000037614 | 227 |
| 337 | 3300005364 | Ga0070673_100003783 | Ga0070673_10000378310 | 227 |
| 338 | 3300005364 | Ga0070673_100019485 | Ga0070673_1000194853 | 227 |
| 339 | 3300005366 | Ga0070659_100056006 | Ga0070659_1000560063 | 227 |
| 340 | 3300005366 | Ga0070659_100278025 | Ga0070659_1002780252 | 227 |
| 341 | 3300005367 | Ga0070667_100001373 | Ga0070667_10000137310 | 227 |
| 342 | 3300005367 | Ga0070667_100005308 | Ga0070667_1000053082 | 227 |
| 343 | 3300005367 | Ga0070667_100119477 | Ga0070667_1001194772 | 227 |
| 344 | 3300005367 | Ga0070667_100125820 | Ga0070667_1001258203 | 227 |
| 345 | 3300005367 | Ga0070667_100712950 | Ga0070667_1007129502 | 227 |
| 346 | 3300005441 | Ga0070700_100008201 | Ga0070700_1000082014 | 227 |
| 347 | 3300005455 | Ga0070663_100130633 | Ga0070663_1001306332 | 227 |
| 348 | 3300005456 | Ga0070678_100000919 | Ga0070678_10000091918 | 227 |
| 349 | 3300005456 | Ga0070678_100039998 | Ga0070678_1000399985 | 227 |
| 350 | 3300005456 | Ga0070678_100593207 | Ga0070678_1005932071 | 227 |
| 351 | 3300005457 | Ga0070662_100000350 | Ga0070662_1000003506 | 227 |
| 352 | 3300005457 | Ga0070662_100200557 | Ga0070662_1002005571 | 227 |
| 353 | 3300005458 | Ga0070681_10276098 | Ga0070681_102760982 | 227 |
| 354 | 3300005459 | Ga0068867_100017538 | Ga0068867_1000175386 | 227 |
| 355 | 3300005535 | Ga0070684_100015289 | Ga0070684_1000152895 | 227 |
| 356 | 3300005539 | Ga0068853_100008841 | Ga0068853_1000088416 | 227 |
| 357 | 3300005539 | Ga0068853_100149179 | Ga0068853_1001491792 | 227 |
| 358 | 3300005539 | Ga0068853_100169151 | Ga0068853_1001691512 | 227 |
| 359 | 3300005543 | Ga0070672_100001101 | Ga0070672_1000011015 | 227 |
| 360 | 3300005543 | Ga0070672_100004066 | Ga0070672_10000406612 | 227 |
| 361 | 3300005545 | Ga0070695_100248198 | Ga0070695_1002481982 | 227 |
| 362 | 3300005548 | Ga0070665_100005491 | Ga0070665_10000549115 | 227 |
| 363 | 3300005548 | Ga0070665_100300473 | Ga0070665_1003004732 | 227 |
| 364 | 3300005563 | Ga0068855_100298274 | Ga0068855_1002982742 | 227 |
| 365 | 3300005563 | Ga0068855_100433979 | Ga0068855_1004339792 | 227 |
| 366 | 3300005564 | Ga0070664_100005544 | Ga0070664_1000055443 | 227 |
| 367 | 3300005564 | Ga0070664_100006436 | Ga0070664_1000064369 | 227 |
| 368 | 3300005564 | Ga0070664_100022619 | Ga0070664_1000226197 | 227 |
| 369 | 3300005564 | Ga0070664_100040999 | Ga0070664_1000409994 | 227 |
| 370 | 3300005564 | Ga0070664_100397886 | Ga0070664_1003978862 | 227 |
| 371 | 3300005577 | Ga0068857_100032846 | Ga0068857_1000328464 | 227 |
| 372 | 3300005577 | Ga0068857_100056063 | Ga0068857_1000560633 | 227 |
| 373 | 3300005577 | Ga0068857_100509632 | Ga0068857_1005096322 | 227 |
| 374 | 3300005578 | Ga0068854_100002764 | Ga0068854_1000027646 | 227 |
| 375 | 3300005614 | Ga0068856_100054691 | Ga0068856_1000546913 | 227 |
| 376 | 3300005616 | Ga0068852_100031098 | Ga0068852_1000310982 | 227 |
| 377 | 3300005616 | Ga0068852_100062797 | Ga0068852_1000627973 | 227 |
| 378 | 3300005616 | Ga0068852_100068109 | Ga0068852_1000681092 | 227 |
| 379 | 3300005616 | Ga0068852_100318068 | Ga0068852_1003180681 | 227 |
| 380 | 3300005617 | Ga0068859_100001231 | Ga0068859_10000123115 | 227 |
| 381 | 3300005617 | Ga0068859_100005659 | Ga0068859_1000056599 | 227 |
| 382 | 3300005617 | Ga0068859_100030121 | Ga0068859_1000301216 | 227 |
| 383 | 3300005618 | Ga0068864_100000953 | Ga0068864_10000095314 | 227 |
| 384 | 3300005618 | Ga0068864_100010591 | Ga0068864_1000105914 | 227 |
| 385 | 3300005718 | Ga0068866_10124001 | Ga0068866_101240012 | 227 |
| 386 | 3300005840 | Ga0068870_10011657 | Ga0068870_100116574 | 227 |
| 387 | 3300005841 | Ga0068863_100003718 | Ga0068863_10000371813 | 227 |
| 388 | 3300005841 | Ga0068863_100008708 | Ga0068863_1000087083 | 227 |
| 389 | 3300005841 | Ga0068863_100467445 | Ga0068863_1004674452 | 227 |
| 390 | 3300005842 | Ga0068858_100000695 | Ga0068858_10000069531 | 227 |
| 391 | 3300005842 | Ga0068858_100003129 | Ga0068858_10000312915 | 227 |
| 392 | 3300005842 | Ga0068858_100009018 | Ga0068858_1000090189 | 227 |
| 393 | 3300005842 | Ga0068858_100115549 | Ga0068858_1001155494 | 227 |
| 394 | 3300005843 | Ga0068860_100020638 | Ga0068860_1000206383 | 227 |
| 395 | 3300005843 | Ga0068860_100064679 | Ga0068860_1000646792 | 227 |
| 396 | 3300005844 | Ga0068862_100007629 | Ga0068862_1000076296 | 227 |
| 397 | 3300005844 | Ga0068862_100011300 | Ga0068862_1000113006 | 227 |
| 398 | 3300005844 | Ga0068862_100044826 | Ga0068862_1000448264 | 227 |
| 399 | 3300006237 | Ga0097621_100153930 | Ga0097621_1001539303 | 227 |
| 400 | 3300006237 | Ga0097621_100352120 | Ga0097621_1003521202 | 227 |
| 401 | 3300006237 | Ga0097621_100361544 | Ga0097621_1003615442 | 227 |
| 402 | 3300006358 | Ga0068871_100069014 | Ga0068871_1000690143 | 227 |
| 403 | 3300006881 | Ga0068865_100647686 | Ga0068865_1006476862 | 227 |
| 404 | 3300006931 | Ga0097620_100001231 | Ga0097620_10000123116 | 227 |
| 405 | 3300006931 | Ga0097620_100005660 | Ga0097620_1000056609 | 227 |
| 406 | 3300006931 | Ga0097620_100030122 | Ga0097620_1000301224 | 227 |
| 407 | 3300009092 | Ga0105250_10017407 | Ga0105250_100174075 | 227 |
| 408 | 3300009093 | Ga0105240_10045839 | Ga0105240_100458395 | 227 |
| 409 | 3300009148 | Ga0105243_10131029 | Ga0105243_101310293 | 227 |
| 410 | 3300009177 | Ga0105248_10000184 | Ga0105248_1000018428 | 227 |
| 411 | 3300009177 | Ga0105248_10000390 | Ga0105248_1000039017 | 227 |
| 412 | 3300009177 | Ga0105248_10001388 | Ga0105248_100013889 | 227 |
| 413 | 3300009177 | Ga0105248_10009540 | Ga0105248_100095406 | 227 |
| 414 | 3300009177 | Ga0105248_10509186 | Ga0105248_105091862 | 227 |
| 415 | 3300009545 | Ga0105237_10016649 | Ga0105237_1001664910 | 227 |
| 416 | 3300009551 | Ga0105238_10027588 | Ga0105238_100275885 | 227 |
| 417 | 3300009553 | Ga0105249_10046397 | Ga0105249_100463973 | 227 |
| 418 | 3300009553 | Ga0105249_10089940 | Ga0105249_100899405 | 227 |
| 419 | 3300013100 | Ga0157373_10025832 | Ga0157373_100258325 | 227 |
| 420 | 3300013100 | Ga0157373_10098826 | Ga0157373_100988262 | 227 |
| 421 | 3300013102 | Ga0157371_10078646 | Ga0157371_100786464 | 227 |
| 422 | 3300013104 | Ga0157370_10029172 | Ga0157370_100291726 | 227 |
| 423 | 3300013105 | Ga0157369_10372078 | Ga0157369_103720782 | 227 |
| 424 | 3300013296 | Ga0157374_10002141 | Ga0157374_100021416 | 227 |
| 425 | 3300013297 | Ga0157378_10087449 | Ga0157378_100874494 | 227 |
| 426 | 3300013297 | Ga0157378_10131937 | Ga0157378_101319372 | 227 |
| 427 | 3300013306 | Ga0163162_10002668 | Ga0163162_100026685 | 227 |
| 428 | 3300013306 | Ga0163162_10025560 | Ga0163162_100255602 | 227 |
| 429 | 3300013306 | Ga0163162_10080689 | Ga0163162_100806892 | 227 |
| 430 | 3300013306 | Ga0163162_10145637 | Ga0163162_101456373 | 227 |
| 431 | 3300013307 | Ga0157372_10040729 | Ga0157372_100407295 | 227 |
| 432 | 3300013308 | Ga0157375_10000709 | Ga0157375_1000070933 | 227 |
| 433 | 3300013308 | Ga0157375_10073585 | Ga0157375_100735854 | 227 |
| 434 | 3300013308 | Ga0157375_10602527 | Ga0157375_106025271 | 227 |
| 435 | 3300014325 | Ga0163163_10000131 | Ga0163163_1000013120 | 227 |
| 436 | 3300014325 | Ga0163163_10001864 | Ga0163163_1000186418 | 227 |
| 437 | 3300014326 | Ga0157380_10003743 | Ga0157380_100037433 | 227 |
| 438 | 3300014326 | Ga0157380_10013753 | Ga0157380_100137539 | 227 |
| 439 | 3300014968 | Ga0157379_10002480 | Ga0157379_100024804 | 227 |
| 440 | 3300014968 | Ga0157379_10072765 | Ga0157379_100727654 | 227 |
| 441 | 3300017792 | Ga0163161_10002075 | Ga0163161_1000207510 | 227 |
| 442 | 3300017792 | Ga0163161_10017590 | Ga0163161_100175902 | 227 |
| 443 | 3300025315 | Ga0207697_10020945 | Ga0207697_100209452 | 227 |
| 444 | 3300025321 | Ga0207656_10016654 | Ga0207656_100166543 | 227 |
| 445 | 3300025893 | Ga0207682_10000923 | Ga0207682_1000092310 | 227 |
| 446 | 3300025893 | Ga0207682_10146431 | Ga0207682_101464311 | 227 |
| 447 | 3300025899 | Ga0207642_10156191 | Ga0207642_101561911 | 227 |
| 448 | 3300025901 | Ga0207688_10012090 | Ga0207688_100120905 | 227 |
| 449 | 3300025903 | Ga0207680_10000773 | Ga0207680_100007734 | 227 |
| 450 | 3300025904 | Ga0207647_10001741 | Ga0207647_100017416 | 227 |
| 451 | 3300025907 | Ga0207645_10020408 | Ga0207645_100204082 | 227 |
| 452 | 3300025907 | Ga0207645_10041026 | Ga0207645_100410263 | 227 |
| 453 | 3300025908 | Ga0207643_10014539 | Ga0207643_100145394 | 227 |
| 454 | 3300025909 | Ga0207705_10228182 | Ga0207705_102281822 | 227 |
| 455 | 3300025913 | Ga0207695_10009667 | Ga0207695_1000966710 | 227 |
| 456 | 3300025914 | Ga0207671_10031351 | Ga0207671_100313515 | 227 |
| 457 | 3300025917 | Ga0207660_10042494 | Ga0207660_100424943 | 227 |
| 458 | 3300025919 | Ga0207657_10011576 | Ga0207657_100115769 | 227 |
| 459 | 3300025919 | Ga0207657_10047588 | Ga0207657_100475885 | 227 |
| 460 | 3300025920 | Ga0207649_10004832 | Ga0207649_100048328 | 227 |
| 461 | 3300025920 | Ga0207649_10010259 | Ga0207649_100102597 | 227 |
| 462 | 3300025920 | Ga0207649_10040201 | Ga0207649_100402012 | 227 |
| 463 | 3300025923 | Ga0207681_10001743 | Ga0207681_1000174310 | 227 |
| 464 | 3300025923 | Ga0207681_10014834 | Ga0207681_100148348 | 227 |
| 465 | 3300025923 | Ga0207681_10469491 | Ga0207681_104694912 | 227 |
| 466 | 3300025924 | Ga0207694_10078157 | Ga0207694_100781573 | 227 |
| 467 | 3300025925 | Ga0207650_10003361 | Ga0207650_100033615 | 227 |
| 468 | 3300025925 | Ga0207650_10069691 | Ga0207650_100696914 | 227 |
| 469 | 3300025925 | Ga0207650_10168456 | Ga0207650_101684562 | 227 |
| 470 | 3300025925 | Ga0207650_10236162 | Ga0207650_102361622 | 227 |
| 471 | 3300025926 | Ga0207659_10016247 | Ga0207659_100162475 | 227 |
| 472 | 3300025926 | Ga0207659_10067735 | Ga0207659_100677352 | 227 |
| 473 | 3300025931 | Ga0207644_10006549 | Ga0207644_1000654910 | 227 |
| 474 | 3300025931 | Ga0207644_10020946 | Ga0207644_100209465 | 227 |
| 475 | 3300025931 | Ga0207644_10162201 | Ga0207644_101622011 | 227 |
| 476 | 3300025931 | Ga0207644_10235809 | Ga0207644_102358093 | 227 |
| 477 | 3300025932 | Ga0207690_10044417 | Ga0207690_100444175 | 227 |
| 478 | 3300025932 | Ga0207690_10049401 | Ga0207690_100494013 | 227 |
| 479 | 3300025933 | Ga0207706_10000276 | Ga0207706_1000027623 | 227 |
| 480 | 3300025933 | Ga0207706_10001018 | Ga0207706_1000101816 | 227 |
| 481 | 3300025933 | Ga0207706_10047462 | Ga0207706_100474624 | 227 |
| 482 | 3300025933 | Ga0207706_10400451 | Ga0207706_104004512 | 227 |
| 483 | 3300025933 | Ga0207706_10435473 | Ga0207706_104354732 | 227 |
| 484 | 3300025936 | Ga0207670_10038785 | Ga0207670_100387852 | 227 |
| 485 | 3300025937 | Ga0207669_10008335 | Ga0207669_100083356 | 227 |
| 486 | 3300025938 | Ga0207704_10603433 | Ga0207704_106034331 | 227 |
| 487 | 3300025940 | Ga0207691_10002752 | Ga0207691_100027526 | 227 |
| 488 | 3300025940 | Ga0207691_10014857 | Ga0207691_1001485710 | 227 |
| 489 | 3300025940 | Ga0207691_10423090 | Ga0207691_104230902 | 227 |
| 490 | 3300025941 | Ga0207711_10000105 | Ga0207711_1000010585 | 227 |
| 491 | 3300025941 | Ga0207711_10000190 | Ga0207711_1000019050 | 227 |
| 492 | 3300025941 | Ga0207711_10000413 | Ga0207711_1000041327 | 227 |
| 493 | 3300025941 | Ga0207711_10012443 | Ga0207711_100124439 | 227 |
| 494 | 3300025941 | Ga0207711_10038564 | Ga0207711_100385644 | 227 |
| 495 | 3300025944 | Ga0207661_10075835 | Ga0207661_100758354 | 227 |
| 496 | 3300025945 | Ga0207679_10038365 | Ga0207679_100383655 | 227 |
| 497 | 3300025945 | Ga0207679_10168309 | Ga0207679_101683093 | 227 |
| 498 | 3300025945 | Ga0207679_10196899 | Ga0207679_101968992 | 227 |
| 499 | 3300025945 | Ga0207679_10237995 | Ga0207679_102379952 | 227 |
| 500 | 3300025949 | Ga0207667_10351088 | Ga0207667_103510882 | 227 |
| 501 | 3300025949 | Ga0207667_10456820 | Ga0207667_104568201 | 227 |
| 502 | 3300025960 | Ga0207651_10001938 | Ga0207651_100019387 | 227 |
| 503 | 3300025960 | Ga0207651_10108775 | Ga0207651_101087753 | 227 |
| 504 | 3300025960 | Ga0207651_10176249 | Ga0207651_101762492 | 227 |
| 505 | 3300025961 | Ga0207712_10027059 | Ga0207712_100270593 | 227 |
| 506 | 3300025961 | Ga0207712_10067825 | Ga0207712_100678254 | 227 |
| 507 | 3300025972 | Ga0207668_10002327 | Ga0207668_100023275 | 227 |
| 508 | 3300025972 | Ga0207668_10048063 | Ga0207668_100480632 | 227 |
| 509 | 3300025981 | Ga0207640_10103670 | Ga0207640_101036702 | 227 |
| 510 | 3300025986 | Ga0207658_10002159 | Ga0207658_1000215912 | 227 |
| 511 | 3300025986 | Ga0207658_10012692 | Ga0207658_100126922 | 227 |
| 512 | 3300025986 | Ga0207658_10023849 | Ga0207658_100238496 | 227 |
| 513 | 3300025986 | Ga0207658_10164207 | Ga0207658_101642072 | 227 |
| 514 | 3300025986 | Ga0207658_10352231 | Ga0207658_103522312 | 227 |
| 515 | 3300025986 | Ga0207658_10711025 | Ga0207658_107110251 | 227 |
| 516 | 3300026023 | Ga0207677_10000600 | Ga0207677_1000060018 | 227 |
| 517 | 3300026035 | Ga0207703_10000461 | Ga0207703_1000046119 | 227 |
| 518 | 3300026035 | Ga0207703_10004673 | Ga0207703_1000467314 | 227 |
| 519 | 3300026041 | Ga0207639_10003170 | Ga0207639_100031708 | 227 |
| 520 | 3300026041 | Ga0207639_10045291 | Ga0207639_100452912 | 227 |
| 521 | 3300026067 | Ga0207678_10023972 | Ga0207678_100239725 | 227 |
| 522 | 3300026075 | Ga0207708_10069128 | Ga0207708_100691283 | 227 |
| 523 | 3300026078 | Ga0207702_10012719 | Ga0207702_100127195 | 227 |
| 524 | 3300026088 | Ga0207641_10000172 | Ga0207641_1000017210 | 227 |
| 525 | 3300026089 | Ga0207648_10015998 | Ga0207648_1001599811 | 227 |
| 526 | 3300026089 | Ga0207648_10075650 | Ga0207648_100756503 | 227 |
| 527 | 3300026095 | Ga0207676_10002758 | Ga0207676_1000275812 | 227 |
| 528 | 3300026116 | Ga0207674_10013020 | Ga0207674_1001302010 | 227 |
| 529 | 3300026116 | Ga0207674_10063263 | Ga0207674_100632633 | 227 |
| 530 | 3300026118 | Ga0207675_100001317 | Ga0207675_10000131713 | 227 |
| 531 | 3300026121 | Ga0207683_10002199 | Ga0207683_1000219916 | 227 |
| 532 | 3300026121 | Ga0207683_10044948 | Ga0207683_100449482 | 227 |
| 533 | 3300026142 | Ga0207698_10005864 | Ga0207698_100058646 | 227 |
| 534 | 3300026142 | Ga0207698_10009468 | Ga0207698_100094685 | 227 |
| 535 | 3300026142 | Ga0207698_10029422 | Ga0207698_100294224 | 227 |
| 536 | 3300026142 | Ga0207698_10265868 | Ga0207698_102658683 | 227 |
| 537 | 3300027665 | Ga0209983_1004501 | Ga0209983_10045013 | 227 |
| 538 | 3300027876 | Ga0209974_10000990 | Ga0209974_100009906 | 227 |
| 539 | 3300027876 | Ga0209974_10009484 | Ga0209974_100094842 | 227 |
| 540 | 3300028379 | Ga0268266_10027905 | Ga0268266_100279054 | 227 |
| 541 | 3300028380 | Ga0268265_10006136 | Ga0268265_1000613610 | 227 |
| 542 | 3300028380 | Ga0268265_10040240 | Ga0268265_100402401 | 227 |
| 543 | 3300028380 | Ga0268265_10182082 | Ga0268265_101820822 | 227 |
| 544 | 3300028381 | Ga0268264_10001019 | Ga0268264_100010194 | 227 |
| 545 | 3300028381 | Ga0268264_10058285 | Ga0268264_100582855 | 227 |
| 546 | 3300030732 | Ga0316176_1173477 | Ga0316176_11734773 | 227 |
| 547 | 3300030736 | Ga0316180_1092407 | Ga0316180_10924073 | 227 |
| 548 | 3300030742 | Ga0316183_1194200 | Ga0316183_11942002 | 227 |
| 549 | 3300030744 | Ga0316181_1010522 | Ga0316181_10105223 | 227 |
| 550 | 3300031456 | Ga0307513_10472561 | Ga0307513_104725611 | 227 |
| 551 | 3300031548 | Ga0307408_100015250 | Ga0307408_1000152505 | 227 |
| 552 | 3300031548 | Ga0307408_100080102 | Ga0307408_1000801023 | 227 |
| 553 | 3300031548 | Ga0307408_100091772 | Ga0307408_1000917722 | 227 |
| 554 | 3300031730 | Ga0307516_10144543 | Ga0307516_101445433 | 227 |
| 555 | 3300031731 | Ga0307405_10013101 | Ga0307405_100131015 | 227 |
| 556 | 3300031731 | Ga0307405_10029271 | Ga0307405_100292712 | 227 |
| 557 | 3300031731 | Ga0307405_10083236 | Ga0307405_100832362 | 227 |
| 558 | 3300031731 | Ga0307405_10130318 | Ga0307405_101303183 | 227 |
| 559 | 3300031824 | Ga0307413_10006953 | Ga0307413_100069533 | 227 |
| 560 | 3300031824 | Ga0307413_10023067 | Ga0307413_100230672 | 227 |
| 561 | 3300031824 | Ga0307413_10045729 | Ga0307413_100457292 | 227 |
| 562 | 3300031852 | Ga0307410_10001524 | Ga0307410_100015248 | 227 |
| 563 | 3300031852 | Ga0307410_10002541 | Ga0307410_100025419 | 227 |
| 564 | 3300031852 | Ga0307410_10006594 | Ga0307410_100065943 | 227 |
| 565 | 3300031852 | Ga0307410_10036358 | Ga0307410_100363582 | 227 |
| 566 | 3300031852 | Ga0307410_10045613 | Ga0307410_100456132 | 227 |
| 567 | 3300031852 | Ga0307410_10252144 | Ga0307410_102521442 | 227 |
| 568 | 3300031901 | Ga0307406_10033272 | Ga0307406_100332721 | 227 |
| 569 | 3300031901 | Ga0307406_10094667 | Ga0307406_100946673 | 227 |
| 570 | 3300031901 | Ga0307406_10097014 | Ga0307406_100970142 | 227 |
| 571 | 3300031901 | Ga0307406_10146347 | Ga0307406_101463471 | 227 |
| 572 | 3300031901 | Ga0307406_10256624 | Ga0307406_102566242 | 227 |
| 573 | 3300031901 | Ga0307406_10320637 | Ga0307406_103206372 | 227 |
| 574 | 3300031901 | Ga0307406_10525807 | Ga0307406_105258072 | 227 |
| 575 | 3300031903 | Ga0307407_10029956 | Ga0307407_100299564 | 227 |
| 576 | 3300031903 | Ga0307407_10033216 | Ga0307407_100332163 | 227 |
| 577 | 3300031903 | Ga0307407_10083516 | Ga0307407_100835163 | 227 |
| 578 | 3300031903 | Ga0307407_10122908 | Ga0307407_101229083 | 227 |
| 579 | 3300031903 | Ga0307407_10397299 | Ga0307407_103972992 | 227 |
| 580 | 3300031911 | Ga0307412_10003753 | Ga0307412_100037535 | 227 |
| 581 | 3300031911 | Ga0307412_10019090 | Ga0307412_100190904 | 227 |
| 582 | 3300031911 | Ga0307412_10083089 | Ga0307412_100830893 | 227 |
| 583 | 3300031911 | Ga0307412_10086981 | Ga0307412_100869813 | 227 |
| 584 | 3300031911 | Ga0307412_10170101 | Ga0307412_101701012 | 227 |
| 585 | 3300031911 | Ga0307412_10315531 | Ga0307412_103155312 | 227 |
| 586 | 3300031911 | Ga0307412_10566532 | Ga0307412_105665321 | 227 |
| 587 | 3300031995 | Ga0307409_100009382 | Ga0307409_1000093826 | 227 |
| 588 | 3300031995 | Ga0307409_100060305 | Ga0307409_1000603053 | 227 |
| 589 | 3300031995 | Ga0307409_100065443 | Ga0307409_1000654433 | 227 |
| 590 | 3300031995 | Ga0307409_100183528 | Ga0307409_1001835282 | 227 |
| 591 | 3300031995 | Ga0307409_100203812 | Ga0307409_1002038122 | 227 |
| 592 | 3300031995 | Ga0307409_100311378 | Ga0307409_1003113782 | 227 |
| 593 | 3300031995 | Ga0307409_100429147 | Ga0307409_1004291472 | 227 |
| 594 | 3300031995 | Ga0307409_100644293 | Ga0307409_1006442932 | 227 |
| 595 | 3300031995 | Ga0307409_100822869 | Ga0307409_1008228692 | 227 |
| 596 | 3300032002 | Ga0307416_100043317 | Ga0307416_1000433172 | 227 |
| 597 | 3300032002 | Ga0307416_100181893 | Ga0307416_1001818932 | 227 |
| 598 | 3300032002 | Ga0307416_100311078 | Ga0307416_1003110782 | 227 |
| 599 | 3300032002 | Ga0307416_100346287 | Ga0307416_1003462872 | 227 |
| 600 | 3300032002 | Ga0307416_100535007 | Ga0307416_1005350072 | 227 |
| 601 | 3300032004 | Ga0307414_10007424 | Ga0307414_100074244 | 227 |
| 602 | 3300032004 | Ga0307414_10074392 | Ga0307414_100743923 | 227 |
| 603 | 3300032004 | Ga0307414_10077437 | Ga0307414_100774373 | 227 |
| 604 | 3300032004 | Ga0307414_10112369 | Ga0307414_101123691 | 227 |
| 605 | 3300032004 | Ga0307414_10144491 | Ga0307414_101444913 | 227 |
| 606 | 3300032004 | Ga0307414_10174172 | Ga0307414_101741722 | 227 |
| 607 | 3300032004 | Ga0307414_10238242 | Ga0307414_102382422 | 227 |
| 608 | 3300032004 | Ga0307414_10766675 | Ga0307414_107666752 | 227 |
| 609 | 3300032005 | Ga0307411_10000518 | Ga0307411_100005182 | 227 |
| 610 | 3300032005 | Ga0307411_10005481 | Ga0307411_100054815 | 227 |
| 611 | 3300032005 | Ga0307411_10024776 | Ga0307411_100247763 | 227 |
| 612 | 3300032005 | Ga0307411_10033608 | Ga0307411_100336085 | 227 |
| 613 | 3300032005 | Ga0307411_10058003 | Ga0307411_100580032 | 227 |
| 614 | 3300032005 | Ga0307411_10086504 | Ga0307411_100865042 | 227 |
| 615 | 3300032005 | Ga0307411_10100317 | Ga0307411_101003173 | 227 |
| 616 | 3300032005 | Ga0307411_10111180 | Ga0307411_101111802 | 227 |
| 617 | 3300032126 | Ga0307415_100000171 | Ga0307415_10000017114 | 227 |
| 618 | 3300032126 | Ga0307415_100091983 | Ga0307415_1000919834 | 227 |
| 619 | 3300032126 | Ga0307415_100306690 | Ga0307415_1003066902 | 227 |
| 620 | 3300037312 | Ga0395899_0075048 | Ga0395899_0075048_1496_2194 | 227 |
| 621 | 3300037312 | Ga0395899_0137130 | Ga0395899_0137130_256_954 | 227 |
| 622 | 3300037418 | Ga0395900_0010815 | Ga0395900_0010815_4942_5640 | 227 |
| 623 | 3300037418 | Ga0395900_0014984 | Ga0395900_0014984_2260_2958 | 227 |
| 624 | 3300037418 | Ga0395900_0077876 | Ga0395900_0077876_2134_2832 | 227 |
| 625 | 3300037418 | Ga0395900_0481325 | Ga0395900_0481325_11_709 | 227 |
| 626 | 3300037466 | Ga0395898_0031474 | Ga0395898_0031474_1516_2214 | 227 |
| 627 | 3300037466 | Ga0395898_0037775 | Ga0395898_0037775_1373_2071 | 227 |
| 628 | 3300037471 | Ga0395905_0002796 | Ga0395905_0002796_18135_18833 | 227 |
| 629 | 3300037471 | Ga0395905_0015679 | Ga0395905_0015679_4370_5068 | 227 |
| 630 | 3300037471 | Ga0395905_0026630 | Ga0395905_0026630_3607_4305 | 227 |
| 631 | 3300038443 | Ga0395901_0000131 | Ga0395901_0000131_42_740 | 227 |
| 632 | 3300038443 | Ga0395901_0024121 | Ga0395901_0024121_3281_3979 | 227 |
| 633 | 3300038443 | Ga0395901_0062053 | Ga0395901_0062053_2679_3377 | 227 |
| 634 | 3300038443 | Ga0395901_0202297 | Ga0395901_0202297_139_837 | 227 |
| 635 | 3300038443 | Ga0395901_0389393 | Ga0395901_0389393_483_1181 | 227 |
| 636 | 3300042122 | Ga0450920_007031 | Ga0450920_007031_917_1618 | 227 |
| 637 | 3300042439 | Ga0439464_0000427 | Ga0439464_0000427_1998_2696 | 227 |
| 638 | 3300044684 | Ga0466966_0033906 | Ga0466966_0033906_1909_2607 | 227 |
| 639 | 3300044684 | Ga0466966_0096905 | Ga0466966_0096905_529_1227 | 227 |
| 640 | 3300044693 | Ga0466961_0082147 | Ga0466961_0082147_1267_1965 | 227 |
| 641 | 3300044694 | Ga0466963_0036592 | Ga0466963_0036592_545_1243 | 227 |
| 642 | 3300045976 | Ga0466967_0018938 | Ga0466967_0018938_735_1433 | 227 |
| 643 | 3300046537 | Ga0495598_0181488 | Ga0495598_0181488_23_721 | 227 |
| 644 | 3300046616 | Ga0495668_0002012 | Ga0495668_0002012_13021_13719 | 227 |
| 645 | 3300046684 | Ga0495669_0115754 | Ga0495669_0115754_25_723 | 227 |
| 646 | 3300046691 | Ga0495670_0089531 | Ga0495670_0089531_718_1416 | 227 |
| 647 | 3300048903 | Ga0496100_0544496 | Ga0496100_0544496_116_814 | 227 |
| 648 | 3300048904 | Ga0496101_0041166 | Ga0496101_0041166_253_951 | 227 |
| 649 | 3300048904 | Ga0496101_0136335 | Ga0496101_0136335_264_962 | 227 |
| 650 | 3300048909 | Ga0496106_0386033 | Ga0496106_0386033_139_837 | 227 |
| 651 | 3300048910 | Ga0496107_0010812 | Ga0496107_0010812_924_1622 | 227 |
| 652 | 3300048911 | Ga0496108_0243655 | Ga0496108_0243655_31_729 | 227 |
| 653 | 3300048911 | Ga0496108_0291198 | Ga0496108_0291198_151_849 | 227 |
| 654 | 3300048912 | Ga0496109_0037244 | Ga0496109_0037244_237_935 | 227 |
| 655 | 3300048912 | Ga0496109_0154762 | Ga0496109_0154762_396_1094 | 227 |
| 656 | 3300048913 | Ga0496110_0004899 | Ga0496110_0004899_7044_7742 | 227 |
| 657 | 3300048913 | Ga0496110_0010491 | Ga0496110_0010491_3239_3937 | 227 |
| 658 | 3300048914 | Ga0496111_0001883 | Ga0496111_0001883_10169_10867 | 227 |
| 659 | 3300048914 | Ga0496111_0049638 | Ga0496111_0049638_116_814 | 227 |
| 660 | 3300048915 | Ga0496112_0565932 | Ga0496112_0565932_274_972 | 227 |
| 661 | 3300048916 | Ga0496113_0002116 | Ga0496113_0002116_9927_10625 | 227 |
| 662 | 3300048917 | Ga0496114_0262924 | Ga0496114_0262924_573_1271 | 227 |
| 663 | 3300048918 | Ga0496115_0008793 | Ga0496115_0008793_3773_4471 | 227 |
| 664 | 3300049515 | Ga0501292_012493 | Ga0501292_012493_555_1274 | 227 |
| 665 | 3300049521 | Ga0501298_007399 | Ga0501298_007399_23_742 | 227 |
| 666 | 3300049586 | Ga0501070_0166768 | Ga0501070_0166768_804_1502 | 227 |
| 667 | 3300049587 | Ga0501071_0071606 | Ga0501071_0071606_418_1116 | 227 |
| 668 | 3300049669 | Ga0501235_017511 | Ga0501235_017511_189_908 | 227 |
| 669 | 3300049675 | Ga0501243_009778 | Ga0501243_009778_627_1346 | 227 |
| 670 | 3300049679 | Ga0501249_004088 | Ga0501249_004088_1135_1854 | 227 |
| 671 | 3300049705 | Ga0501225_0042682 | Ga0501225_0042682_74_793 | 227 |
| 672 | 3300049742 | Ga0501080_0371850 | Ga0501080_0371850_322_1020 | 227 |
| 673 | 3300049760 | Ga0501263_002294 | Ga0501263_002294_237_956 | 227 |
| 674 | 3300049763 | Ga0501266_011983 | Ga0501266_011983_52_771 | 227 |
| 675 | 3300049765 | Ga0501268_006179 | Ga0501268_006179_220_939 | 227 |
| 676 | 3300049765 | Ga0501268_010692 | Ga0501268_010692_292_990 | 227 |
| 677 | 3300049769 | Ga0501272_008243 | Ga0501272_008243_424_1122 | 227 |
| 678 | 3300049770 | Ga0501273_018358 | Ga0501273_018358_155_874 | 227 |
| 679 | 3300053134 | Ga0500658_0000032 | Ga0500658_0000032_22120_22818 | 227 |
| 680 | 3300061719 | Ga0466962_0077696 | Ga0466962_0077696_824_1522 | 227 |
| 681 | 3300032002 | Ga0307416_100169717 | Ga0307416_1001697172 | 228 |
| 682 | iso_pu_bacteria | 2582581305 | 2585261820 | 228 |
| 683 | 3300005355 | Ga0070671_100011633 | Ga0070671_1000116334 | 229 |
| 684 | 3300005548 | Ga0070665_100124648 | Ga0070665_1001246482 | 229 |
| 685 | 3300005617 | Ga0068859_100010321 | Ga0068859_10001032110 | 229 |
| 686 | 3300005841 | Ga0068863_100000027 | Ga0068863_10000002741 | 229 |
| 687 | 3300005844 | Ga0068862_100011857 | Ga0068862_10001185711 | 229 |
| 688 | 3300006931 | Ga0097620_100010321 | Ga0097620_10001032110 | 229 |
| 689 | 3300009553 | Ga0105249_10001466 | Ga0105249_100014668 | 229 |
| 690 | 3300025931 | Ga0207644_10000111 | Ga0207644_1000011144 | 229 |
| 691 | 3300025961 | Ga0207712_10008274 | Ga0207712_100082748 | 229 |
| 692 | 3300025972 | Ga0207668_10000054 | Ga0207668_1000005460 | 229 |
| 693 | 3300026088 | Ga0207641_10000045 | Ga0207641_10000045134 | 229 |
| 694 | 3300028379 | Ga0268266_10100141 | Ga0268266_101001412 | 229 |
| 695 | 3300028380 | Ga0268265_10013973 | Ga0268265_100139733 | 229 |
| 696 | 3300028381 | Ga0268264_10002547 | Ga0268264_100025479 | 229 |
| 697 | 3300046520 | Ga0495637_0073734 | Ga0495637_0073734_655_1362 | 229 |
| 698 | 3300053087 | Ga0500643_000096 | Ga0500643_000096_12926_13633 | 229 |
| 699 | 3300053091 | Ga0500647_0008473 | Ga0500647_0008473_2055_2762 | 229 |
| 700 | 3300053125 | Ga0500618_006614 | Ga0500618_006614_2141_2848 | 229 |
| 701 | 3300053177 | Ga0500636_0136298 | Ga0500636_0136298_194_901 | 229 |
| 702 | 3300005327 | Ga0070658_10076279 | Ga0070658_100762794 | 230 |
| 703 | 3300005329 | Ga0070683_100040449 | Ga0070683_1000404493 | 230 |
| 704 | 3300005345 | Ga0070692_10003068 | Ga0070692_100030685 | 230 |
| 705 | 3300005366 | Ga0070659_100090297 | Ga0070659_1000902972 | 230 |
| 706 | 3300005455 | Ga0070663_100006039 | Ga0070663_1000060396 | 230 |
| 707 | 3300013102 | Ga0157371_10208569 | Ga0157371_102085691 | 230 |
| 708 | 3300025904 | Ga0207647_10086117 | Ga0207647_100861172 | 230 |
| 709 | 3300025909 | Ga0207705_10313718 | Ga0207705_103137182 | 230 |
| 710 | 3300025932 | Ga0207690_10166930 | Ga0207690_101669302 | 230 |
| 711 | 3300025944 | Ga0207661_10007968 | Ga0207661_100079686 | 230 |
| 712 | 3300026067 | Ga0207678_10000746 | Ga0207678_1000074620 | 230 |
| 713 | 3300037312 | Ga0395899_0000129 | Ga0395899_0000129_21297_21995 | 230 |
| 714 | 3300037418 | Ga0395900_0000468 | Ga0395900_0000468_40103_40801 | 230 |
| 715 | 3300037418 | Ga0395900_0023328 | Ga0395900_0023328_2837_3535 | 230 |
| 716 | 3300037466 | Ga0395898_0018728 | Ga0395898_0018728_2025_2723 | 230 |
| 717 | 3300037466 | Ga0395898_0324907 | Ga0395898_0324907_212_910 | 230 |
| 718 | 3300037471 | Ga0395905_0051277 | Ga0395905_0051277_1130_1828 | 230 |
| 719 | 3300037471 | Ga0395905_0071242 | Ga0395905_0071242_1492_2190 | 230 |
| 720 | 3300038443 | Ga0395901_0000031 | Ga0395901_0000031_215211_215909 | 230 |
| 721 | 3300038443 | Ga0395901_0093494 | Ga0395901_0093494_1978_2676 | 230 |
| 722 | 3300001904 | JGI24736J21556_1000066 | JGI24736J21556_100006618 | 231 |
| 723 | 3300001904 | JGI24736J21556_1000114 | JGI24736J21556_10001142 | 231 |
| 724 | 3300001915 | JGI24741J21665_1003089 | JGI24741J21665_10030895 | 231 |
| 725 | 3300001979 | JGI24740J21852_10004210 | JGI24740J21852_100042109 | 231 |
| 726 | 3300005329 | Ga0070683_100010738 | Ga0070683_1000107383 | 231 |
| 727 | 3300005339 | Ga0070660_100005580 | Ga0070660_10000558010 | 231 |
| 728 | 3300005344 | Ga0070661_100013518 | Ga0070661_1000135186 | 231 |
| 729 | 3300005435 | Ga0070714_100020576 | Ga0070714_1000205762 | 231 |
| 730 | 3300005539 | Ga0068853_100157526 | Ga0068853_1001575262 | 231 |
| 731 | 3300005577 | Ga0068857_100073498 | Ga0068857_1000734984 | 231 |
| 732 | 3300005578 | Ga0068854_100003023 | Ga0068854_1000030231 | 231 |
| 733 | 3300005578 | Ga0068854_100025478 | Ga0068854_1000254782 | 231 |
| 734 | 3300009093 | Ga0105240_10012132 | Ga0105240_1001213213 | 231 |
| 735 | 3300009093 | Ga0105240_10105813 | Ga0105240_101058132 | 231 |
| 736 | 3300009551 | Ga0105238_10039780 | Ga0105238_100397802 | 231 |
| 737 | 3300010375 | Ga0105239_10195634 | Ga0105239_101956342 | 231 |
| 738 | 3300013100 | Ga0157373_10007297 | Ga0157373_100072977 | 231 |
| 739 | 3300013102 | Ga0157371_10099573 | Ga0157371_100995732 | 231 |
| 740 | 3300013102 | Ga0157371_10136844 | Ga0157371_101368441 | 231 |
| 741 | 3300013105 | Ga0157369_10000043 | Ga0157369_1000004387 | 231 |
| 742 | 3300013105 | Ga0157369_10164786 | Ga0157369_101647863 | 231 |
| 743 | 3300013105 | Ga0157369_10223324 | Ga0157369_102233241 | 231 |
| 744 | 3300013105 | Ga0157369_10726542 | Ga0157369_107265422 | 231 |
| 745 | 3300013307 | Ga0157372_10565954 | Ga0157372_105659542 | 231 |
| 746 | 3300013307 | Ga0157372_10565955 | Ga0157372_105659552 | 231 |
| 747 | 3300025904 | Ga0207647_10001558 | Ga0207647_1000155821 | 231 |
| 748 | 3300025909 | Ga0207705_10000033 | Ga0207705_10000033152 | 231 |
| 749 | 3300025913 | Ga0207695_10004868 | Ga0207695_1000486818 | 231 |
| 750 | 3300025913 | Ga0207695_10015000 | Ga0207695_1001500010 | 231 |
| 751 | 3300025919 | Ga0207657_10071420 | Ga0207657_100714203 | 231 |
| 752 | 3300025920 | Ga0207649_10000737 | Ga0207649_1000073718 | 231 |
| 753 | 3300025920 | Ga0207649_10344647 | Ga0207649_103446472 | 231 |
| 754 | 3300025944 | Ga0207661_10034436 | Ga0207661_100344361 | 231 |
| 755 | 3300025949 | Ga0207667_10103076 | Ga0207667_101030764 | 231 |
| 756 | 3300025949 | Ga0207667_10259417 | Ga0207667_102594172 | 231 |
| 757 | 3300025981 | Ga0207640_10000473 | Ga0207640_100004732 | 231 |
| 758 | 3300025981 | Ga0207640_10116885 | Ga0207640_101168852 | 231 |
| 759 | 3300026041 | Ga0207639_10119521 | Ga0207639_101195213 | 231 |
| 760 | 3300026067 | Ga0207678_10019046 | Ga0207678_100190469 | 231 |
| 761 | 3300026078 | Ga0207702_10013935 | Ga0207702_100139358 | 231 |
| 762 | 3300026078 | Ga0207702_10712039 | Ga0207702_107120391 | 231 |
| 763 | 3300026116 | Ga0207674_10078211 | Ga0207674_100782114 | 231 |
| 764 | 3300026142 | Ga0207698_10058247 | Ga0207698_100582474 | 231 |
| 765 | 3300031548 | Ga0307408_100051378 | Ga0307408_1000513784 | 231 |
| 766 | 3300031731 | Ga0307405_10560111 | Ga0307405_105601112 | 231 |
| 767 | 3300031824 | Ga0307413_10156956 | Ga0307413_101569563 | 231 |
| 768 | 3300031852 | Ga0307410_10043909 | Ga0307410_100439094 | 231 |
| 769 | 3300031903 | Ga0307407_10061890 | Ga0307407_100618902 | 231 |
| 770 | 3300031995 | Ga0307409_100841948 | Ga0307409_1008419482 | 231 |
| 771 | 3300032002 | Ga0307416_100259842 | Ga0307416_1002598422 | 231 |
| 772 | 3300032004 | Ga0307414_10109184 | Ga0307414_101091842 | 231 |
| 773 | 3300032005 | Ga0307411_10257057 | Ga0307411_102570572 | 231 |
| 774 | 3300037312 | Ga0395899_0002708 | Ga0395899_0002708_10820_11515 | 231 |
| 775 | 3300037312 | Ga0395899_0014549 | Ga0395899_0014549_3660_4355 | 231 |
| 776 | 3300037418 | Ga0395900_0024082 | Ga0395900_0024082_3055_3750 | 231 |
| 777 | 3300037418 | Ga0395900_0078105 | Ga0395900_0078105_1287_1988 | 231 |
| 778 | 3300037418 | Ga0395900_0107872 | Ga0395900_0107872_1072_1767 | 231 |
| 779 | 3300037466 | Ga0395898_0026615 | Ga0395898_0026615_3152_3847 | 231 |
| 780 | 3300037466 | Ga0395898_0030537 | Ga0395898_0030537_3119_3814 | 231 |
| 781 | 3300037466 | Ga0395898_0147662 | Ga0395898_0147662_1402_2097 | 231 |
| 782 | 3300037466 | Ga0395898_0149228 | Ga0395898_0149228_1524_2219 | 231 |
| 783 | 3300038443 | Ga0395901_0066469 | Ga0395901_0066469_1666_2361 | 231 |
| 784 | 3300038443 | Ga0395901_0141388 | Ga0395901_0141388_182_877 | 231 |
| 785 | 3300044684 | Ga0466966_0000021 | Ga0466966_0000021_95534_96229 | 231 |
| 786 | 3300044693 | Ga0466961_0026586 | Ga0466961_0026586_1665_2390 | 231 |
| 787 | 3300044706 | Ga0466964_0034342 | Ga0466964_0034342_741_1436 | 231 |
| 788 | 3300044719 | Ga0466971_0013190 | Ga0466971_0013190_188_913 | 231 |
| 789 | 3300044842 | Ga0466957_0017966 | Ga0466957_0017966_3248_3943 | 231 |
| 790 | 3300045049 | Ga0466959_0108427 | Ga0466959_0108427_152_847 | 231 |
| 791 | 3300045836 | Ga0466958_0003833 | Ga0466958_0003833_6897_7622 | 231 |
| 792 | 3300061719 | Ga0466962_0202747 | Ga0466962_0202747_141_941 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j53-assembly1.cif.gz_A | structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5 | 0.9582 | 3 | 168 |
| 2ido-assembly1.cif.gz_A | structure of the e. coli pol iii epsilon-hot proofreading complex | 0.9347 | 1 | 168 |
| 1j53-assembly1.cif.gz_A | structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5 | 0.9101 | 3 | 168 |
| 2ido-assembly1.cif.gz_A | structure of the e. coli pol iii epsilon-hot proofreading complex | 0.9084 | 1 | 168 |
| 8h2f-assembly1.cif.gz_A | crystal structure of dnaq domain in complex witn tmp of streptococcus thermophilus strain dgcc 7710 | 0.8997 | 2 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j54A00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9575 | 3 | 168 | 3.30.420.10 |
| af_B0G161_292_467_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9544 | 2 | 166 | 3.30.420.10 |
| af_Q2G1Z8_409_554_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.932 | 1 | 138 | 3.30.420.10 |
| af_Q2FYH5_2_169_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9303 | 1 | 169 | 3.30.420.10 |
| af_Q4E271_32_219_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.925 | 36 | 168 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9EG13-F1-model_v4 | DNA polymerase III subunit epsilon (EC 2.7.7.7) | 0.9943 | 1 | 154 |
GO:0003677
GO:0003887 GO:0005829 GO:0008408 GO:0045004 |
| AF-A0A3B8QYK5-F1-model_v4 | DNA polymerase III subunit epsilon | 0.9917 | 1 | 86 |
GO:0003677
GO:0003887 GO:0005829 GO:0008408 GO:0045004 |
| AF-A0A455U836-F1-model_v4 | Exonuclease domain-containing protein | 0.9903 | 1 | 80 |
GO:0003676
GO:0005829 GO:0008408 GO:0016779 GO:0045004 |
| AF-A0A3C1BQI7-F1-model_v4 | DNA polymerase III subunit epsilon (EC 2.7.7.7) | 0.9897 | 1 | 142 |
GO:0003677
GO:0003887 GO:0005829 GO:0008408 GO:0045004 |
| AF-A0A4Q2LD84-F1-model_v4 | deleted | 0.9889 | 12 | 105 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar