F481012

General Info

Members Datasets Scaffolds Average Seq Length
792 264 790 232

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10098438|Ga0070709_100984383
Length 226
Sequence MREIVFDTETTGLNPLGGDRMVEIGCIEIINRVETGRHFHAYFYPEREMPFEAEMVHGLTNAFLSDKPLFAEKAEELIENASFDFGFLNHELERCGRPGVPMSRMVDTLTLARSRHPGAKHSLDALCMRFGIDRSHRVKHGALLDAQLLAQVYVELTGGRQIGLGLVADAGTISVAQSTGPIIIRERRPPRPHAPLAEELERHRAFIAKLVNPIWERFAPHHQGVG

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
163 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
164 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
165 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
166 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
193 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
202 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
203 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
204 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
244 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
248 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
249 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
250 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
253 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
254 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
255 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
256 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
257 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
260 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
261 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
262 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
263 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 2.78
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000066 3300001904 Bacteria 17179
2 JGI24736J21556_1000114 3300001904 Bacteria 13747
3 JGI24741J21665_1003089 3300001915 Bacteria 4095
4 JGI24740J21852_10004210 3300001979 Bacteria 6212
5 JGI24739J22299_10008994 3300001989 Bacteria 3728
6 JGI24737J22298_10001822 3300001990 Bacteria 7629
7 JGI24735J21928_10009963 3300002067 Bacteria 3043
8 JGI24735J21928_10025273 3300002067 Bacteria 1793
9 JGI24745J21846_1005029 3300002073 Bacteria 1431
10 JGI24738J21930_10000704 3300002075 Bacteria 9639
11 Ga0065715_10000565 3300005293 Bacteria 10505
12 Ga0065715_10166590 3300005293 Bacteria 1557
13 Ga0070658_10000177 3300005327 Bacteria 56043
14 Ga0070658_10030017 3300005327 Bacteria 4368
15 Ga0070658_10055314 3300005327 Bacteria 3224
16 Ga0070658_10060673 3300005327 Bacteria 3080
17 Ga0070658_10076279 3300005327 Bacteria 2749
18 Ga0070658_10770909 3300005327 Bacteria 835
19 Ga0070676_10042193 3300005328 Bacteria 2648
20 Ga0070676_10050997 3300005328 Bacteria 2428
21 Ga0070676_10069490 3300005328 Bacteria 2111
22 Ga0070676_10113685 3300005328 Bacteria 1689
23 Ga0070683_100002630 3300005329 Bacteria 14354
24 Ga0070683_100004360 3300005329 Bacteria 11644
25 Ga0070683_100010738 3300005329 Bacteria 7878
26 Ga0070683_100036480 3300005329 Bacteria 4498
27 Ga0070683_100040449 3300005329 Bacteria 4287
28 Ga0070670_100007610 3300005331 Bacteria 9199
29 Ga0070670_100014078 3300005331 Bacteria 6862
30 Ga0070670_100064639 3300005331 Bacteria 3139
31 Ga0070670_100075622 3300005331 Bacteria 2893
32 Ga0070677_10005158 3300005333 Bacteria 4293
33 Ga0070677_10121833 3300005333 Bacteria 1179
34 Ga0068869_100153426 3300005334 Bacteria 1788
35 Ga0070666_10000205 3300005335 Bacteria 40586
36 Ga0070666_10002806 3300005335 Bacteria 10520
37 Ga0070666_10200552 3300005335 Bacteria 1404
38 Ga0070682_100032930 3300005337 Bacteria 3146
39 Ga0068868_100001585 3300005338 Bacteria 15507
40 Ga0068868_100382456 3300005338 Bacteria 1211
41 Ga0068868_100512449 3300005338 Bacteria 1052
42 Ga0070660_100000065 3300005339 Bacteria 61999
43 Ga0070660_100005580 3300005339 Bacteria 8722
44 Ga0070660_100030157 3300005339 Bacteria 4067
45 Ga0070660_100056680 3300005339 Bacteria 3032
46 Ga0070660_100056812 3300005339 Bacteria 3029
47 Ga0070660_100272161 3300005339 Bacteria 1384
48 Ga0070660_100382842 3300005339 Bacteria 1161
49 Ga0070689_100138728 3300005340 Bacteria 1954
50 Ga0070689_100207404 3300005340 Bacteria 1603
51 Ga0070691_10044907 3300005341 Bacteria 2096
52 Ga0070661_100000084 3300005344 Bacteria 74971
53 Ga0070661_100007237 3300005344 Bacteria 7654
54 Ga0070661_100013518 3300005344 Bacteria 5732
55 Ga0070661_100015630 3300005344 Bacteria 5357
56 Ga0070661_100059608 3300005344 Bacteria 2800
57 Ga0070661_100073642 3300005344 Bacteria 2515
58 Ga0070661_100136002 3300005344 Bacteria 1849
59 Ga0070661_100224446 3300005344 Bacteria 1442
60 Ga0070692_10003068 3300005345 Bacteria 6675
61 Ga0070692_10017116 3300005345 Bacteria 3460
62 Ga0070668_100007118 3300005347 Bacteria 8289
63 Ga0070668_100251930 3300005347 Bacteria 1466
64 Ga0070669_100005425 3300005353 Bacteria 9200
65 Ga0070669_100036160 3300005353 Bacteria 3577
66 Ga0070669_100117379 3300005353 Bacteria 2026
67 Ga0070669_100125866 3300005353 Bacteria 1961
68 Ga0070675_100005450 3300005354 Bacteria 9731
69 Ga0070675_100016431 3300005354 Bacteria 5874
70 Ga0070675_100063724 3300005354 Bacteria 3048
71 Ga0070675_100184831 3300005354 Bacteria 1803
72 Ga0070671_100005160 3300005355 Bacteria 10397
73 Ga0070671_100011633 3300005355 Bacteria 7077
74 Ga0070671_100022991 3300005355 Bacteria 5094
75 Ga0070671_100034473 3300005355 Bacteria 4190
76 Ga0070671_100039621 3300005355 Bacteria 3911
77 Ga0070671_100072955 3300005355 Bacteria 2867
78 Ga0070674_100009250 3300005356 Bacteria 5897
79 Ga0070674_100076178 3300005356 Bacteria 2384
80 Ga0070673_100000376 3300005364 Bacteria 23364
81 Ga0070673_100003783 3300005364 Bacteria 9492
82 Ga0070673_100019485 3300005364 Bacteria 4870
83 Ga0070673_100173546 3300005364 Bacteria 1841
84 Ga0070659_100001520 3300005366 Bacteria 16726
85 Ga0070659_100056006 3300005366 Bacteria 3108
86 Ga0070659_100090297 3300005366 Bacteria 2455
87 Ga0070659_100120609 3300005366 Bacteria 2123
88 Ga0070659_100278025 3300005366 Bacteria 1392
89 Ga0070667_100001373 3300005367 Bacteria 21792
90 Ga0070667_100003791 3300005367 Bacteria 12860
91 Ga0070667_100005308 3300005367 Bacteria 10765
92 Ga0070667_100119477 3300005367 Bacteria 2292
93 Ga0070667_100125820 3300005367 Bacteria 2233
94 Ga0070667_100712950 3300005367 Bacteria 929
95 Ga0070709_10098438 3300005434 Bacteria 1944
96 Ga0070714_100020576 3300005435 Bacteria 5391
97 Ga0070714_100046589 3300005435 Bacteria 3679
98 Ga0070713_100255994 3300005436 Bacteria 1598
99 Ga0070700_100008201 3300005441 Bacteria 5684
100 Ga0070663_100001477 3300005455 Bacteria 12918
101 Ga0070663_100006039 3300005455 Bacteria 7248
102 Ga0070663_100081532 3300005455 Bacteria 2378
103 Ga0070663_100086544 3300005455 Bacteria 2314
104 Ga0070663_100130633 3300005455 Bacteria 1907
105 Ga0070678_100000919 3300005456 Bacteria 15133
106 Ga0070678_100039998 3300005456 Bacteria 3314
107 Ga0070678_100062596 3300005456 Bacteria 2748
108 Ga0070678_100593207 3300005456 Bacteria 988
109 Ga0070662_100000017 3300005457 Bacteria 105478
110 Ga0070662_100000350 3300005457 Bacteria 27678
111 Ga0070662_100200557 3300005457 Bacteria 1583
112 Ga0070681_10276098 3300005458 Bacteria 1592
113 Ga0070681_10277224 3300005458 Bacteria 1588
114 Ga0070681_10498269 3300005458 Bacteria 1131
115 Ga0068867_100017538 3300005459 Bacteria 5084
116 Ga0068867_100364543 3300005459 Bacteria 1209
117 Ga0070679_100551324 3300005530 Bacteria 1096
118 Ga0070684_100015289 3300005535 Bacteria 6245
119 Ga0070684_100020259 3300005535 Bacteria 5517
120 Ga0070684_100042518 3300005535 Bacteria 3923
121 Ga0068853_100000703 3300005539 Bacteria 23188
122 Ga0068853_100008841 3300005539 Bacteria 8102
123 Ga0068853_100061639 3300005539 Bacteria 3245
124 Ga0068853_100149179 3300005539 Bacteria 2104
125 Ga0068853_100157526 3300005539 Bacteria 2047
126 Ga0068853_100169151 3300005539 Bacteria 1977
127 Ga0068853_100830510 3300005539 Bacteria 886
128 Ga0070672_100001101 3300005543 Bacteria 16486
129 Ga0070672_100004066 3300005543 Bacteria 9547
130 Ga0070672_100107798 3300005543 Bacteria 2267
131 Ga0070695_100248198 3300005545 Bacteria 1294
132 Ga0070696_100385711 3300005546 Bacteria 1093
133 Ga0070693_100009123 3300005547 Bacteria 4924
134 Ga0070693_100520703 3300005547 Bacteria 847
135 Ga0070665_100005491 3300005548 Bacteria 13062
136 Ga0070665_100009518 3300005548 Bacteria 9828
137 Ga0070665_100124648 3300005548 Bacteria 2578
138 Ga0070665_100300473 3300005548 Bacteria 1608
139 Ga0070665_100301553 3300005548 Bacteria 1605
140 Ga0068855_100000194 3300005563 Bacteria 78505
141 Ga0068855_100108475 3300005563 Bacteria 3189
142 Ga0068855_100298274 3300005563 Bacteria 1785
143 Ga0068855_100310890 3300005563 Bacteria 1743
144 Ga0068855_100433979 3300005563 Bacteria 1435
145 Ga0068855_100617221 3300005563 Bacteria 1168
146 Ga0068855_100977069 3300005563 Bacteria 891
147 Ga0070664_100000098 3300005564 Bacteria 55907
148 Ga0070664_100005544 3300005564 Bacteria 10133
149 Ga0070664_100006436 3300005564 Bacteria 9475
150 Ga0070664_100022619 3300005564 Bacteria 5183
151 Ga0070664_100040999 3300005564 Bacteria 3905
152 Ga0070664_100097212 3300005564 Bacteria 2556
153 Ga0070664_100397886 3300005564 Bacteria 1259
154 Ga0068857_100032846 3300005577 Bacteria 4587
155 Ga0068857_100056063 3300005577 Bacteria 3497
156 Ga0068857_100073498 3300005577 Bacteria 3046
157 Ga0068857_100509632 3300005577 Bacteria 1130
158 Ga0068854_100002764 3300005578 Bacteria 10898
159 Ga0068854_100003023 3300005578 Bacteria 10451
160 Ga0068854_100014664 3300005578 Bacteria 5170
161 Ga0068854_100025478 3300005578 Bacteria 4059
162 Ga0068854_100041472 3300005578 Bacteria 3252
163 Ga0068854_100071312 3300005578 Bacteria 2541
164 Ga0068856_100000098 3300005614 Bacteria 83221
165 Ga0068856_100027857 3300005614 Bacteria 5512
166 Ga0068856_100054691 3300005614 Bacteria 3938
167 Ga0068856_100474565 3300005614 Bacteria 1272
168 Ga0068852_100000440 3300005616 Bacteria 27519
169 Ga0068852_100006849 3300005616 Bacteria 8280
170 Ga0068852_100031098 3300005616 Bacteria 4401
171 Ga0068852_100062797 3300005616 Bacteria 3232
172 Ga0068852_100068109 3300005616 Bacteria 3114
173 Ga0068852_100166314 3300005616 Bacteria 2064
174 Ga0068852_100318068 3300005616 Bacteria 1511
175 Ga0068859_100001231 3300005617 Bacteria 26157
176 Ga0068859_100005659 3300005617 Bacteria 12722
177 Ga0068859_100010321 3300005617 Bacteria 9401
178 Ga0068859_100030121 3300005617 Bacteria 5445
179 Ga0068864_100000145 3300005618 Bacteria 68040
180 Ga0068864_100000953 3300005618 Bacteria 24235
181 Ga0068864_100010591 3300005618 Bacteria 7624
182 Ga0068866_10124001 3300005718 Bacteria 1460
183 Ga0068861_100304065 3300005719 Bacteria 1383
184 Ga0068870_10011657 3300005840 Bacteria 4085
185 Ga0068863_100000027 3300005841 Bacteria 181884
186 Ga0068863_100002810 3300005841 Bacteria 17249
187 Ga0068863_100003718 3300005841 Bacteria 15092
188 Ga0068863_100008708 3300005841 Bacteria 9912
189 Ga0068863_100467445 3300005841 Bacteria 1239
190 Ga0068858_100000268 3300005842 Bacteria 55747
191 Ga0068858_100000695 3300005842 Bacteria 35157
192 Ga0068858_100003129 3300005842 Bacteria 16562
193 Ga0068858_100009018 3300005842 Bacteria 9539
194 Ga0068858_100032317 3300005842 Bacteria 4861
195 Ga0068858_100115549 3300005842 Bacteria 2508
196 Ga0068860_100000391 3300005843 Bacteria 57332
197 Ga0068860_100020638 3300005843 Bacteria 6382
198 Ga0068860_100064679 3300005843 Bacteria 3474
199 Ga0068862_100000014 3300005844 Bacteria 251552
200 Ga0068862_100007629 3300005844 Bacteria 8958
201 Ga0068862_100011300 3300005844 Bacteria 7372
202 Ga0068862_100011857 3300005844 Bacteria 7198
203 Ga0068862_100044826 3300005844 Bacteria 3773
204 Ga0070717_10082997 3300006028 Bacteria 2694
205 Ga0070716_100115373 3300006173 Bacteria 1671
206 Ga0070712_100270517 3300006175 Bacteria 1365
207 Ga0097621_100132707 3300006237 Bacteria 2121
208 Ga0097621_100153930 3300006237 Bacteria 1973
209 Ga0097621_100352120 3300006237 Bacteria 1310
210 Ga0097621_100361544 3300006237 Bacteria 1293
211 Ga0075370_10005349 3300006353 Bacteria 6370
212 Ga0068871_100069014 3300006358 Unclassified 2902
213 Ga0068871_100244330 3300006358 Bacteria 1562
214 Ga0068871_100259245 3300006358 Bacteria 1516
215 Ga0068865_100647686 3300006881 Bacteria 898
216 Ga0097620_100001231 3300006931 Bacteria 26157
217 Ga0097620_100005660 3300006931 Bacteria 12722
218 Ga0097620_100010321 3300006931 Bacteria 9401
219 Ga0097620_100023168 3300006931 Bacteria 6229
220 Ga0097620_100030122 3300006931 Bacteria 5445
221 Ga0105250_10017407 3300009092 Bacteria 2922
222 Ga0105240_10012132 3300009093 Bacteria 11930
223 Ga0105240_10045839 3300009093 Bacteria 5545
224 Ga0105240_10105813 3300009093 Bacteria 3414
225 Ga0105245_10042402 3300009098 Bacteria 4061
226 Ga0105247_10003692 3300009101 Bacteria 9932
227 Ga0105243_10131029 3300009148 Bacteria 2127
228 Ga0105241_10022968 3300009174 Bacteria 4625
229 Ga0105248_10000184 3300009177 Bacteria 72728
230 Ga0105248_10000390 3300009177 Bacteria 50573
231 Ga0105248_10000444 3300009177 Bacteria 47003
232 Ga0105248_10001388 3300009177 Bacteria 26986
233 Ga0105248_10009540 3300009177 Bacteria 10681
234 Ga0105248_10021785 3300009177 Bacteria 7102
235 Ga0105248_10509186 3300009177 Bacteria 1357
236 Ga0105237_10016649 3300009545 Bacteria 7635
237 Ga0105238_10027588 3300009551 Bacteria 5787
238 Ga0105238_10031317 3300009551 Bacteria 5413
239 Ga0105238_10039780 3300009551 Bacteria 4767
240 Ga0105249_10000002 3300009553 Bacteria 376207
241 Ga0105249_10001466 3300009553 Bacteria 20693
242 Ga0105249_10046397 3300009553 Bacteria 3954
243 Ga0105249_10089940 3300009553 Bacteria 2870
244 Ga0105239_10195634 3300010375 Bacteria 2264
245 Ga0157373_10007297 3300013100 Bacteria 8232
246 Ga0157373_10019148 3300013100 Bacteria 4984
247 Ga0157373_10025832 3300013100 Bacteria 4246
248 Ga0157373_10098826 3300013100 Bacteria 2054
249 Ga0157371_10002003 3300013102 Bacteria 20140
250 Ga0157371_10012251 3300013102 Bacteria 6566
251 Ga0157371_10017812 3300013102 Bacteria 5267
252 Ga0157371_10025908 3300013102 Bacteria 4267
253 Ga0157371_10069359 3300013102 Bacteria 2496
254 Ga0157371_10078646 3300013102 Bacteria 2336
255 Ga0157371_10095601 3300013102 Bacteria 2105
256 Ga0157371_10099573 3300013102 Bacteria 2061
257 Ga0157371_10136844 3300013102 Bacteria 1744
258 Ga0157371_10197177 3300013102 Bacteria 1443
259 Ga0157371_10208569 3300013102 Bacteria 1402
260 Ga0157371_10604169 3300013102 Bacteria 816
261 Ga0157370_10018639 3300013104 Bacteria 6977
262 Ga0157370_10029172 3300013104 Bacteria 5419
263 Ga0157370_10088851 3300013104 Bacteria 2902
264 Ga0157370_10146539 3300013104 Bacteria 2198
265 Ga0157370_10208742 3300013104 Bacteria 1810
266 Ga0157369_10000043 3300013105 Bacteria 180713
267 Ga0157369_10011088 3300013105 Bacteria 10254
268 Ga0157369_10050600 3300013105 Bacteria 4499
269 Ga0157369_10164786 3300013105 Bacteria 2338
270 Ga0157369_10223324 3300013105 Bacteria 1971
271 Ga0157369_10299393 3300013105 Bacteria 1673
272 Ga0157369_10372078 3300013105 Bacteria 1483
273 Ga0157369_10565593 3300013105 Bacteria 1175
274 Ga0157369_10726542 3300013105 Bacteria 1022
275 Ga0157374_10002141 3300013296 Bacteria 16638
276 Ga0157374_10005411 3300013296 Bacteria 10726
277 Ga0157374_10056025 3300013296 Bacteria 3680
278 Ga0157378_10027473 3300013297 Bacteria 5022
279 Ga0157378_10043077 3300013297 Bacteria 4007
280 Ga0157378_10087449 3300013297 Bacteria 2827
281 Ga0157378_10131937 3300013297 Bacteria 2313
282 Ga0163162_10002668 3300013306 Bacteria 16918
283 Ga0163162_10010851 3300013306 Bacteria 8866
284 Ga0163162_10025560 3300013306 Bacteria 5836
285 Ga0163162_10080689 3300013306 Bacteria 3322
286 Ga0163162_10145637 3300013306 Bacteria 2485
287 Ga0157372_10040729 3300013307 Bacteria 5133
288 Ga0157372_10160734 3300013307 Bacteria 2596
289 Ga0157372_10195058 3300013307 Bacteria 2346
290 Ga0157372_10565954 3300013307 Bacteria 1325
291 Ga0157372_10565955 3300013307 Bacteria 1325
292 Ga0157375_10000709 3300013308 Bacteria 29414
293 Ga0157375_10073585 3300013308 Bacteria 3436
294 Ga0157375_10602527 3300013308 Bacteria 1258
295 Ga0163163_10000131 3300014325 Bacteria 76809
296 Ga0163163_10000169 3300014325 Bacteria 68481
297 Ga0163163_10001864 3300014325 Bacteria 17807
298 Ga0163163_10123122 3300014325 Bacteria 2629
299 Ga0157380_10003743 3300014326 Bacteria 10460
300 Ga0157380_10013753 3300014326 Bacteria 5909
301 Ga0157380_10363241 3300014326 Bacteria 1359
302 Ga0157379_10002480 3300014968 Bacteria 15449
303 Ga0157379_10072765 3300014968 Bacteria 3076
304 Ga0163161_10002075 3300017792 Bacteria 14527
305 Ga0163161_10017590 3300017792 Bacteria 5005
306 Ga0209257_1011481 3300025304 Bacteria 4259
307 Ga0207697_10001895 3300025315 Bacteria 11159
308 Ga0207697_10003663 3300025315 Bacteria 7527
309 Ga0207697_10020945 3300025315 Bacteria 2677
310 Ga0207656_10016654 3300025321 Bacteria 2865
311 Ga0207682_10000923 3300025893 Bacteria 13618
312 Ga0207682_10002958 3300025893 Bacteria 7457
313 Ga0207682_10146431 3300025893 Bacteria 1063
314 Ga0207642_10156191 3300025899 Bacteria 1220
315 Ga0207710_10001762 3300025900 Bacteria 10446
316 Ga0207688_10001410 3300025901 Bacteria 12534
317 Ga0207688_10012090 3300025901 Bacteria 4695
318 Ga0207680_10000773 3300025903 Bacteria 15110
319 Ga0207680_10004223 3300025903 Bacteria 6801
320 Ga0207680_10307194 3300025903 Bacteria 1106
321 Ga0207647_10001558 3300025904 Bacteria 17625
322 Ga0207647_10001741 3300025904 Bacteria 16680
323 Ga0207647_10002702 3300025904 Bacteria 13390
324 Ga0207647_10024301 3300025904 Bacteria 3997
325 Ga0207647_10080968 3300025904 Bacteria 1946
326 Ga0207647_10086117 3300025904 Bacteria 1878
327 Ga0207645_10020408 3300025907 Bacteria 4337
328 Ga0207645_10041026 3300025907 Bacteria 2964
329 Ga0207645_10074916 3300025907 Bacteria 2167
330 Ga0207643_10014049 3300025908 Bacteria 4346
331 Ga0207643_10014539 3300025908 Bacteria 4279
332 Ga0207705_10000033 3300025909 Bacteria 223997
333 Ga0207705_10000137 3300025909 Bacteria 79174
334 Ga0207705_10026528 3300025909 Bacteria 4132
335 Ga0207705_10029445 3300025909 Bacteria 3914
336 Ga0207705_10039655 3300025909 Bacteria 3376
337 Ga0207705_10228182 3300025909 Bacteria 1416
338 Ga0207705_10313718 3300025909 Bacteria 1204
339 Ga0207654_10143916 3300025911 Bacteria 1523
340 Ga0207707_10332381 3300025912 Bacteria 1311
341 Ga0207707_10429724 3300025912 Bacteria 1131
342 Ga0207695_10004868 3300025913 Bacteria 18117
343 Ga0207695_10009667 3300025913 Bacteria 11881
344 Ga0207695_10015000 3300025913 Bacteria 9142
345 Ga0207695_10109640 3300025913 Bacteria 2742
346 Ga0207671_10031351 3300025914 Bacteria 3961
347 Ga0207693_10120832 3300025915 Bacteria 2057
348 Ga0207660_10042494 3300025917 Bacteria 3191
349 Ga0207660_10203210 3300025917 Bacteria 1548
350 Ga0207660_10207722 3300025917 Bacteria 1532
351 Ga0207657_10000508 3300025919 Bacteria 41139
352 Ga0207657_10011576 3300025919 Bacteria 8751
353 Ga0207657_10012396 3300025919 Bacteria 8423
354 Ga0207657_10018979 3300025919 Bacteria 6544
355 Ga0207657_10047588 3300025919 Bacteria 3748
356 Ga0207657_10052117 3300025919 Bacteria 3553
357 Ga0207657_10071420 3300025919 Bacteria 2940
358 Ga0207657_10337718 3300025919 Bacteria 1189
359 Ga0207649_10000186 3300025920 Bacteria 50868
360 Ga0207649_10000737 3300025920 Bacteria 21468
361 Ga0207649_10004832 3300025920 Bacteria 7285
362 Ga0207649_10010259 3300025920 Bacteria 5142
363 Ga0207649_10019101 3300025920 Bacteria 3913
364 Ga0207649_10040201 3300025920 Bacteria 2841
365 Ga0207649_10344647 3300025920 Bacteria 1101
366 Ga0207652_10170400 3300025921 Bacteria 1953
367 Ga0207681_10001743 3300025923 Bacteria 13962
368 Ga0207681_10014834 3300025923 Bacteria 4853
369 Ga0207681_10030797 3300025923 Bacteria 3500
370 Ga0207681_10162280 3300025923 Bacteria 1686
371 Ga0207681_10469491 3300025923 Bacteria 1026
372 Ga0207694_10017707 3300025924 Bacteria 5385
373 Ga0207694_10048271 3300025924 Bacteria 3294
374 Ga0207694_10078157 3300025924 Bacteria 2593
375 Ga0207650_10003361 3300025925 Bacteria 11007
376 Ga0207650_10054914 3300025925 Bacteria 2956
377 Ga0207650_10069691 3300025925 Bacteria 2642
378 Ga0207650_10168456 3300025925 Bacteria 1740
379 Ga0207650_10236162 3300025925 Bacteria 1476
380 Ga0207659_10016247 3300025926 Bacteria 4840
381 Ga0207659_10030808 3300025926 Bacteria 3667
382 Ga0207659_10067735 3300025926 Bacteria 2594
383 Ga0207687_10113697 3300025927 Bacteria 2014
384 Ga0207700_10320486 3300025928 Bacteria 1343
385 Ga0207664_10049541 3300025929 Bacteria 3307
386 Ga0207644_10000111 3300025931 Bacteria 60737
387 Ga0207644_10006549 3300025931 Bacteria 7589
388 Ga0207644_10020946 3300025931 Bacteria 4450
389 Ga0207644_10023264 3300025931 Bacteria 4242
390 Ga0207644_10162201 3300025931 Bacteria 1738
391 Ga0207644_10235809 3300025931 Bacteria 1455
392 Ga0207690_10000108 3300025932 Bacteria 67599
393 Ga0207690_10044417 3300025932 Bacteria 2929
394 Ga0207690_10049401 3300025932 Bacteria 2804
395 Ga0207690_10166930 3300025932 Bacteria 1646
396 Ga0207690_10499985 3300025932 Bacteria 983
397 Ga0207690_10512602 3300025932 Bacteria 971
398 Ga0207706_10000276 3300025933 Bacteria 55889
399 Ga0207706_10000514 3300025933 Bacteria 41167
400 Ga0207706_10001018 3300025933 Bacteria 28609
401 Ga0207706_10047462 3300025933 Bacteria 3799
402 Ga0207706_10099945 3300025933 Bacteria 2552
403 Ga0207706_10400451 3300025933 Bacteria 1190
404 Ga0207706_10435473 3300025933 Bacteria 1135
405 Ga0207670_10038785 3300025936 Bacteria 3114
406 Ga0207669_10002765 3300025937 Bacteria 7524
407 Ga0207669_10008335 3300025937 Bacteria 4859
408 Ga0207704_10603433 3300025938 Bacteria 899
409 Ga0207665_10056891 3300025939 Bacteria 2641
410 Ga0207691_10002752 3300025940 Bacteria 17143
411 Ga0207691_10014857 3300025940 Bacteria 7421
412 Ga0207691_10074127 3300025940 Bacteria 3070
413 Ga0207691_10218948 3300025940 Bacteria 1651
414 Ga0207691_10423090 3300025940 Bacteria 1135
415 Ga0207711_10000105 3300025941 Bacteria 90036
416 Ga0207711_10000190 3300025941 Bacteria 65723
417 Ga0207711_10000413 3300025941 Bacteria 45274
418 Ga0207711_10003775 3300025941 Bacteria 13046
419 Ga0207711_10005548 3300025941 Bacteria 10667
420 Ga0207711_10012443 3300025941 Bacteria 7072
421 Ga0207711_10038564 3300025941 Bacteria 4063
422 Ga0207689_10112929 3300025942 Bacteria 2233
423 Ga0207689_10553909 3300025942 Bacteria 966
424 Ga0207661_10007968 3300025944 Bacteria 7551
425 Ga0207661_10022512 3300025944 Bacteria 4748
426 Ga0207661_10034436 3300025944 Bacteria 3938
427 Ga0207661_10075835 3300025944 Bacteria 2760
428 Ga0207661_10098825 3300025944 Bacteria 2446
429 Ga0207661_10535680 3300025944 Bacteria 1072
430 Ga0207679_10000114 3300025945 Bacteria 64628
431 Ga0207679_10038365 3300025945 Bacteria 3412
432 Ga0207679_10046008 3300025945 Bacteria 3160
433 Ga0207679_10168309 3300025945 Bacteria 1801
434 Ga0207679_10196899 3300025945 Bacteria 1680
435 Ga0207679_10237995 3300025945 Bacteria 1541
436 Ga0207667_10016322 3300025949 Bacteria 8393
437 Ga0207667_10081978 3300025949 Bacteria 3342
438 Ga0207667_10103076 3300025949 Bacteria 2943
439 Ga0207667_10206083 3300025949 Bacteria 2016
440 Ga0207667_10259417 3300025949 Bacteria 1777
441 Ga0207667_10351088 3300025949 Bacteria 1504
442 Ga0207667_10456820 3300025949 Bacteria 1298
443 Ga0207651_10001938 3300025960 Bacteria 9718
444 Ga0207651_10108775 3300025960 Bacteria 2075
445 Ga0207651_10172892 3300025960 Bacteria 1705
446 Ga0207651_10176249 3300025960 Bacteria 1691
447 Ga0207712_10000002 3300025961 Bacteria 706628
448 Ga0207712_10008274 3300025961 Bacteria 6575
449 Ga0207712_10027059 3300025961 Bacteria 3826
450 Ga0207712_10067825 3300025961 Bacteria 2554
451 Ga0207668_10000054 3300025972 Bacteria 95426
452 Ga0207668_10002327 3300025972 Bacteria 11097
453 Ga0207668_10048063 3300025972 Bacteria 2926
454 Ga0207640_10000473 3300025981 Bacteria 24521
455 Ga0207640_10006878 3300025981 Bacteria 6255
456 Ga0207640_10103670 3300025981 Bacteria 2000
457 Ga0207640_10116885 3300025981 Bacteria 1902
458 Ga0207658_10002159 3300025986 Bacteria 14623
459 Ga0207658_10005799 3300025986 Bacteria 8453
460 Ga0207658_10012692 3300025986 Bacteria 5754
461 Ga0207658_10023849 3300025986 Bacteria 4274
462 Ga0207658_10164207 3300025986 Bacteria 1822
463 Ga0207658_10352231 3300025986 Bacteria 1282
464 Ga0207658_10711025 3300025986 Bacteria 908
465 Ga0207677_10000600 3300026023 Bacteria 22226
466 Ga0207677_10067922 3300026023 Bacteria 2499
467 Ga0207703_10000139 3300026035 Bacteria 86495
468 Ga0207703_10000461 3300026035 Bacteria 42797
469 Ga0207703_10004673 3300026035 Bacteria 11183
470 Ga0207703_10005508 3300026035 Bacteria 10174
471 Ga0207639_10000139 3300026041 Bacteria 54240
472 Ga0207639_10003170 3300026041 Bacteria 11066
473 Ga0207639_10045291 3300026041 Bacteria 3312
474 Ga0207639_10119521 3300026041 Bacteria 2163
475 Ga0207639_10176839 3300026041 Bacteria 1812
476 Ga0207678_10000746 3300026067 Bacteria 29716
477 Ga0207678_10005368 3300026067 Bacteria 11477
478 Ga0207678_10006212 3300026067 Bacteria 10615
479 Ga0207678_10019046 3300026067 Bacteria 6028
480 Ga0207678_10023972 3300026067 Bacteria 5334
481 Ga0207708_10069128 3300026075 Bacteria 2703
482 Ga0207708_10240255 3300026075 Bacteria 1457
483 Ga0207702_10001266 3300026078 Bacteria 25382
484 Ga0207702_10012719 3300026078 Bacteria 7003
485 Ga0207702_10013935 3300026078 Bacteria 6679
486 Ga0207702_10021319 3300026078 Bacteria 5363
487 Ga0207702_10586832 3300026078 Bacteria 1093
488 Ga0207702_10712039 3300026078 Bacteria 990
489 Ga0207641_10000045 3300026088 Bacteria 181882
490 Ga0207641_10000172 3300026088 Bacteria 90549
491 Ga0207641_10004364 3300026088 Bacteria 12251
492 Ga0207648_10003539 3300026089 Bacteria 16337
493 Ga0207648_10015998 3300026089 Bacteria 6874
494 Ga0207648_10075650 3300026089 Bacteria 2935
495 Ga0207676_10000072 3300026095 Bacteria 101978
496 Ga0207676_10002758 3300026095 Bacteria 12490
497 Ga0207676_10156502 3300026095 Bacteria 1969
498 Ga0207674_10013020 3300026116 Bacteria 9267
499 Ga0207674_10063263 3300026116 Bacteria 3735
500 Ga0207674_10078211 3300026116 Bacteria 3313
501 Ga0207674_10109713 3300026116 Bacteria 2735
502 Ga0207675_100001317 3300026118 Bacteria 24894
503 Ga0207675_100222537 3300026118 Bacteria 1819
504 Ga0207683_10002199 3300026121 Bacteria 17148
505 Ga0207683_10013394 3300026121 Bacteria 6992
506 Ga0207683_10044948 3300026121 Bacteria 3862
507 Ga0207683_10565818 3300026121 Bacteria 1051
508 Ga0207698_10000598 3300026142 Bacteria 21116
509 Ga0207698_10005864 3300026142 Bacteria 7634
510 Ga0207698_10009468 3300026142 Bacteria 6215
511 Ga0207698_10029422 3300026142 Bacteria 3934
512 Ga0207698_10058247 3300026142 Bacteria 2993
513 Ga0207698_10152943 3300026142 Bacteria 2005
514 Ga0207698_10265868 3300026142 Bacteria 1578
515 Ga0207698_10320895 3300026142 Bacteria 1450
516 Ga0209983_1004501 3300027665 Bacteria 2928
517 Ga0209974_10000990 3300027876 Bacteria 9987
518 Ga0209974_10009484 3300027876 Bacteria 3305
519 Ga0268266_10027905 3300028379 Bacteria 4801
520 Ga0268266_10033207 3300028379 Bacteria 4388
521 Ga0268266_10100141 3300028379 Bacteria 2552
522 Ga0268265_10000607 3300028380 Bacteria 35893
523 Ga0268265_10006136 3300028380 Bacteria 8153
524 Ga0268265_10013973 3300028380 Bacteria 5467
525 Ga0268265_10040240 3300028380 Bacteria 3451
526 Ga0268265_10182082 3300028380 Bacteria 1806
527 Ga0268264_10000634 3300028381 Bacteria 41826
528 Ga0268264_10001019 3300028381 Bacteria 28201
529 Ga0268264_10002547 3300028381 Bacteria 15981
530 Ga0268264_10058285 3300028381 Bacteria 3233
531 Ga0307517_10044322 3300028786 Bacteria 4709
532 Ga0307517_10127210 3300028786 Bacteria 1853
533 Ga0316176_1173477 3300030732 Bacteria 1859
534 Ga0316180_1092407 3300030736 Bacteria 2435
535 Ga0316183_1194200 3300030742 Bacteria 1074
536 Ga0316181_1010522 3300030744 Bacteria 1798
537 Ga0307513_10059999 3300031456 Bacteria 4035
538 Ga0307513_10472561 3300031456 Bacteria 975
539 Ga0307408_100015250 3300031548 Bacteria 5116
540 Ga0307408_100051378 3300031548 Bacteria 2969
541 Ga0307408_100080102 3300031548 Bacteria 2438
542 Ga0307408_100091772 3300031548 Bacteria 2294
543 Ga0307408_100267624 3300031548 Bacteria 1417
544 Ga0307408_100390827 3300031548 Bacteria 1192
545 Ga0307516_10144543 3300031730 Bacteria 2145
546 Ga0307405_10013101 3300031731 Bacteria 4414
547 Ga0307405_10029271 3300031731 Bacteria 3218
548 Ga0307405_10083236 3300031731 Bacteria 2097
549 Ga0307405_10130318 3300031731 Bacteria 1736
550 Ga0307405_10344640 3300031731 Bacteria 1147
551 Ga0307405_10390249 3300031731 Bacteria 1087
552 Ga0307405_10560111 3300031731 Bacteria 926
553 Ga0307413_10006953 3300031824 Bacteria 5211
554 Ga0307413_10023067 3300031824 Bacteria 3367
555 Ga0307413_10045729 3300031824 Bacteria 2597
556 Ga0307413_10156956 3300031824 Unclassified 1593
557 Ga0307410_10001524 3300031852 Bacteria 10547
558 Ga0307410_10002541 3300031852 Bacteria 8833
559 Ga0307410_10006594 3300031852 Bacteria 6277
560 Ga0307410_10010566 3300031852 Bacteria 5237
561 Ga0307410_10013709 3300031852 Bacteria 4740
562 Ga0307410_10036358 3300031852 Bacteria 3206
563 Ga0307410_10043909 3300031852 Bacteria 2965
564 Ga0307410_10045613 3300031852 Bacteria 2920
565 Ga0307410_10252144 3300031852 Bacteria 1372
566 Ga0307406_10033272 3300031901 Bacteria 3154
567 Ga0307406_10062485 3300031901 Bacteria 2409
568 Ga0307406_10094667 3300031901 Bacteria 2019
569 Ga0307406_10097014 3300031901 Bacteria 1998
570 Ga0307406_10146347 3300031901 Bacteria 1679
571 Ga0307406_10256624 3300031901 Bacteria 1320
572 Ga0307406_10265174 3300031901 Bacteria 1302
573 Ga0307406_10300007 3300031901 Bacteria 1234
574 Ga0307406_10320637 3300031901 Bacteria 1198
575 Ga0307406_10525807 3300031901 Bacteria 963
576 Ga0307407_10029956 3300031903 Bacteria 2929
577 Ga0307407_10033216 3300031903 Bacteria 2813
578 Ga0307407_10044587 3300031903 Bacteria 2501
579 Ga0307407_10061890 3300031903 Bacteria 2190
580 Ga0307407_10083516 3300031903 Bacteria 1938
581 Ga0307407_10122908 3300031903 Bacteria 1648
582 Ga0307407_10254322 3300031903 Bacteria 1205
583 Ga0307407_10397299 3300031903 Bacteria 988
584 Ga0307407_10413640 3300031903 Bacteria 970
585 Ga0307412_10002333 3300031911 Bacteria 10511
586 Ga0307412_10003753 3300031911 Bacteria 8444
587 Ga0307412_10019090 3300031911 Bacteria 4141
588 Ga0307412_10056498 3300031911 Bacteria 2616
589 Ga0307412_10083089 3300031911 Bacteria 2219
590 Ga0307412_10086981 3300031911 Bacteria 2176
591 Ga0307412_10170101 3300031911 Bacteria 1628
592 Ga0307412_10234602 3300031911 Bacteria 1415
593 Ga0307412_10315531 3300031911 Bacteria 1241
594 Ga0307412_10566532 3300031911 Bacteria 956
595 Ga0307409_100009382 3300031995 Bacteria 6008
596 Ga0307409_100016968 3300031995 Bacteria 4837
597 Ga0307409_100060305 3300031995 Bacteria 2958
598 Ga0307409_100065443 3300031995 Bacteria 2860
599 Ga0307409_100183528 3300031995 Bacteria 1854
600 Ga0307409_100203812 3300031995 Bacteria 1772
601 Ga0307409_100311378 3300031995 Bacteria 1469
602 Ga0307409_100391245 3300031995 Bacteria 1325
603 Ga0307409_100429147 3300031995 Bacteria 1270
604 Ga0307409_100644293 3300031995 Bacteria 1052
605 Ga0307409_100822869 3300031995 Bacteria 938
606 Ga0307409_100841948 3300031995 Bacteria 927
607 Ga0307416_100010569 3300032002 Bacteria 6105
608 Ga0307416_100043317 3300032002 Bacteria 3523
609 Ga0307416_100089815 3300032002 Bacteria 2632
610 Ga0307416_100169717 3300032002 Bacteria 2029
611 Ga0307416_100181893 3300032002 Bacteria 1971
612 Ga0307416_100259842 3300032002 Bacteria 1696
613 Ga0307416_100311078 3300032002 Bacteria 1572
614 Ga0307416_100346287 3300032002 Bacteria 1501
615 Ga0307416_100535007 3300032002 Bacteria 1242
616 Ga0307414_10007424 3300032004 Bacteria 6157
617 Ga0307414_10074392 3300032004 Bacteria 2461
618 Ga0307414_10077437 3300032004 Bacteria 2420
619 Ga0307414_10087767 3300032004 Bacteria 2300
620 Ga0307414_10109184 3300032004 Bacteria 2101
621 Ga0307414_10112369 3300032004 Bacteria 2076
622 Ga0307414_10144491 3300032004 Bacteria 1867
623 Ga0307414_10174172 3300032004 Bacteria 1723
624 Ga0307414_10188003 3300032004 Bacteria 1668
625 Ga0307414_10238242 3300032004 Bacteria 1504
626 Ga0307414_10766675 3300032004 Bacteria 878
627 Ga0307411_10000518 3300032005 Bacteria 13563
628 Ga0307411_10005481 3300032005 Bacteria 6239
629 Ga0307411_10024776 3300032005 Bacteria 3582
630 Ga0307411_10032304 3300032005 Bacteria 3232
631 Ga0307411_10033608 3300032005 Bacteria 3183
632 Ga0307411_10046369 3300032005 Bacteria 2801
633 Ga0307411_10058003 3300032005 Bacteria 2560
634 Ga0307411_10081614 3300032005 Bacteria 2227
635 Ga0307411_10086504 3300032005 Bacteria 2174
636 Ga0307411_10100317 3300032005 Bacteria 2045
637 Ga0307411_10111180 3300032005 Bacteria 1961
638 Ga0307411_10257057 3300032005 Unclassified 1377
639 Ga0307415_100000171 3300032126 Bacteria 28816
640 Ga0307415_100059574 3300032126 Bacteria 2634
641 Ga0307415_100091983 3300032126 Bacteria 2198
642 Ga0307415_100147335 3300032126 Bacteria 1807
643 Ga0307415_100306690 3300032126 Bacteria 1317
644 Ga0316583_10006180 3300032133 Bacteria 4308
645 Ga0307510_10000369 3300033180 Bacteria 42647
646 Ga0373958_0048274 3300034819 Bacteria 892
647 Ga0373923_0163279 3300035111 Bacteria 1017
648 Ga0373939_0059072 3300035114 Bacteria 1215
649 Ga0373957_0011847 3300035120 Bacteria 2922
650 Ga0373955_0017940 3300035172 Bacteria 3510
651 Ga0373931_0010139 3300035691 Bacteria 4522
652 Ga0373935_0025073 3300035692 Bacteria 3674
653 Ga0373933_0055688 3300035724 Bacteria 2373
654 Ga0373937_0033405 3300036401 Bacteria 4672
655 Ga0316582_0015227 3300036647 Bacteria 4390
656 Ga0316582_0216777 3300036647 Bacteria 1308
657 Ga0316584_0634968 3300036712 Bacteria 737
658 Ga0373925_0634660 3300037068 Bacteria 880
659 Ga0395899_0000129 3300037312 Bacteria 118043
660 Ga0395899_0002708 3300037312 Bacteria 14288
661 Ga0395899_0014549 3300037312 Bacteria 6008
662 Ga0395899_0049098 3300037312 Bacteria 3137
663 Ga0395899_0075048 3300037312 Bacteria 2469
664 Ga0395899_0137130 3300037312 Bacteria 1743
665 Ga0395900_0000468 3300037418 Bacteria 57784
666 Ga0395900_0008602 3300037418 Bacteria 10487
667 Ga0395900_0010815 3300037418 Bacteria 9336
668 Ga0395900_0014984 3300037418 Bacteria 7901
669 Ga0395900_0021957 3300037418 Bacteria 6526
670 Ga0395900_0023328 3300037418 Bacteria 6332
671 Ga0395900_0024082 3300037418 Bacteria 6230
672 Ga0395900_0036992 3300037418 Bacteria 5032
673 Ga0395900_0077876 3300037418 Bacteria 3406
674 Ga0395900_0078105 3300037418 Bacteria 3401
675 Ga0395900_0107872 3300037418 Bacteria 2860
676 Ga0395900_0327208 3300037418 Bacteria 1511
677 Ga0395900_0481325 3300037418 Bacteria 1194
678 Ga0395898_0018728 3300037466 Bacteria 7057
679 Ga0395898_0026615 3300037466 Bacteria 5817
680 Ga0395898_0030537 3300037466 Bacteria 5392
681 Ga0395898_0031474 3300037466 Bacteria 5300
682 Ga0395898_0037775 3300037466 Bacteria 4788
683 Ga0395898_0147662 3300037466 Bacteria 2250
684 Ga0395898_0149228 3300037466 Bacteria 2237
685 Ga0395898_0324907 3300037466 Bacteria 1467
686 Ga0395898_0580358 3300037466 Bacteria 1063
687 Ga0395898_0844297 3300037466 Bacteria 855
688 Ga0395905_0000232 3300037471 Bacteria 84233
689 Ga0395905_0002796 3300037471 Bacteria 19111
690 Ga0395905_0015679 3300037471 Bacteria 7199
691 Ga0395905_0026630 3300037471 Bacteria 5451
692 Ga0395905_0048085 3300037471 Bacteria 3998
693 Ga0395905_0051277 3300037471 Bacteria 3864
694 Ga0395905_0071242 3300037471 Bacteria 3259
695 Ga0395905_0129687 3300037471 Bacteria 2371
696 Ga0316581_0045622 3300037588 Bacteria 1339
697 Ga0395901_0000031 3300038443 Bacteria 241733
698 Ga0395901_0000131 3300038443 Bacteria 96504
699 Ga0395901_0008693 3300038443 Bacteria 10262
700 Ga0395901_0024121 3300038443 Bacteria 6239
701 Ga0395901_0042467 3300038443 Bacteria 4714
702 Ga0395901_0062053 3300038443 Bacteria 3889
703 Ga0395901_0066469 3300038443 Bacteria 3755
704 Ga0395901_0093494 3300038443 Bacteria 3148
705 Ga0395901_0141388 3300038443 Bacteria 2529
706 Ga0395901_0177005 3300038443 Bacteria 2237
707 Ga0395901_0202297 3300038443 Bacteria 2082
708 Ga0395901_0389393 3300038443 Bacteria 1433
709 Ga0439431_0042236 3300041997 Bacteria 1164
710 Ga0439443_016330 3300042003 Bacteria 1133
711 Ga0450920_007031 3300042122 Bacteria 2033
712 Ga0439464_0000427 3300042439 Bacteria 8288
713 Ga0466966_0000021 3300044684 Bacteria 116714
714 Ga0466966_0033906 3300044684 Bacteria 3304
715 Ga0466966_0096905 3300044684 Bacteria 1827
716 Ga0466961_0026586 3300044693 Bacteria 3719
717 Ga0466961_0082147 3300044693 Bacteria 2039
718 Ga0466963_0036592 3300044694 Bacteria 3202
719 Ga0466964_0034342 3300044706 Bacteria 2024
720 Ga0466971_0013190 3300044719 Bacteria 3626
721 Ga0466957_0017966 3300044842 Bacteria 4147
722 Ga0466959_0108427 3300045049 Bacteria 1984
723 Ga0466958_0003833 3300045836 Bacteria 7857
724 Ga0466967_0018938 3300045976 Bacteria 5522
725 Ga0466967_0058953 3300045976 Bacteria 3395
726 Ga0495638_0097754 3300046460 Bacteria 1760
727 Ga0495650_0031267 3300046471 Bacteria 2398
728 Ga0495584_0124321 3300046491 Bacteria 1307
729 Ga0495637_0073734 3300046520 Bacteria 1372
730 Ga0495648_0013722 3300046524 Bacteria 5972
731 Ga0495648_0038706 3300046524 Bacteria 3045
732 Ga0495642_0008044 3300046528 Bacteria 4034
733 Ga0495598_0181488 3300046537 Bacteria 751
734 Ga0495668_0002012 3300046616 Bacteria 17752
735 Ga0495659_0015361 3300046664 Bacteria 2516
736 Ga0495669_0003949 3300046684 Bacteria 6106
737 Ga0495669_0115754 3300046684 Bacteria 1254
738 Ga0495670_0008719 3300046691 Bacteria 4991
739 Ga0495670_0014736 3300046691 Bacteria 3847
740 Ga0495670_0089531 3300046691 Bacteria 1574
741 Ga0495660_0218412 3300046810 Bacteria 900
742 Ga0495677_0003219 3300047445 Bacteria 6369
743 Ga0495602_0054509 3300048088 Bacteria 3529
744 Ga0496100_0544496 3300048903 Bacteria 897
745 Ga0496101_0041166 3300048904 Bacteria 3293
746 Ga0496101_0136335 3300048904 Bacteria 1868
747 Ga0496102_0007003 3300048905 Bacteria 9626
748 Ga0496102_0273733 3300048905 Bacteria 1592
749 Ga0496103_0016842 3300048906 Bacteria 4365
750 Ga0496106_0386033 3300048909 Bacteria 1125
751 Ga0496107_0010812 3300048910 Bacteria 6350
752 Ga0496108_0243655 3300048911 Bacteria 1564
753 Ga0496108_0291198 3300048911 Bacteria 1421
754 Ga0496109_0037244 3300048912 Bacteria 4395
755 Ga0496109_0154762 3300048912 Bacteria 2147
756 Ga0496109_0295348 3300048912 Bacteria 1528
757 Ga0496110_0004899 3300048913 Bacteria 10445
758 Ga0496110_0010491 3300048913 Bacteria 7540
759 Ga0496111_0001883 3300048914 Bacteria 12409
760 Ga0496111_0049638 3300048914 Bacteria 3026
761 Ga0496112_0565932 3300048915 Bacteria 1070
762 Ga0496113_0002116 3300048916 Bacteria 11451
763 Ga0496114_0262924 3300048917 Bacteria 1519
764 Ga0496115_0008793 3300048918 Bacteria 7482
765 Ga0496125_0198494 3300048928 Bacteria 1316
766 Ga0501292_012493 3300049515 Bacteria 1296
767 Ga0501298_007399 3300049521 Bacteria 1820
768 Ga0501070_0166768 3300049586 Bacteria 1815
769 Ga0501071_0071606 3300049587 Bacteria 2528
770 Ga0501235_017511 3300049669 Bacteria 1585
771 Ga0501243_009778 3300049675 Bacteria 1492
772 Ga0501249_004088 3300049679 Bacteria 2952
773 Ga0501225_0042682 3300049705 Bacteria 1253
774 Ga0501080_0371850 3300049742 Bacteria 1289
775 Ga0501263_002294 3300049760 Bacteria 1934
776 Ga0501266_011983 3300049763 Bacteria 1115
777 Ga0501268_006179 3300049765 Bacteria 1748
778 Ga0501268_010692 3300049765 Bacteria 1434
779 Ga0501272_008243 3300049769 Bacteria 1141
780 Ga0501273_018358 3300049770 Bacteria 930
781 Ga0501280_000314 3300049776 Bacteria 12170
782 Ga0500643_000096 3300053087 Bacteria 92125
783 Ga0500643_001035 3300053087 Bacteria 16912
784 Ga0500646_0125306 3300053090 Bacteria 830
785 Ga0500647_0008473 3300053091 Bacteria 4464
786 Ga0500618_006614 3300053125 Bacteria 3384
787 Ga0500658_0000032 3300053134 Bacteria 90863
788 Ga0500636_0136298 3300053177 Bacteria 1363
789 Ga0466962_0077696 3300061719 Bacteria 1587
790 Ga0466962_0202747 3300061719 Bacteria 969

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0844297 Ga0395898_0844297_11_649 198
2 3300025944 Ga0207661_10535680 Ga0207661_105356802 207
3 3300032005 Ga0307411_10081614 Ga0307411_100816142 211
4 3300005344 Ga0070661_100224446 Ga0070661_1002244462 212
5 3300005563 Ga0068855_100310890 Ga0068855_1003108903 212
6 3300005578 Ga0068854_100014664 Ga0068854_1000146645 212
7 3300005616 Ga0068852_100006849 Ga0068852_10000684910 212
8 3300009551 Ga0105238_10031317 Ga0105238_100313175 212
9 3300013102 Ga0157371_10069359 Ga0157371_100693594 212
10 3300013102 Ga0157371_10604169 Ga0157371_106041691 212
11 3300025913 Ga0207695_10109640 Ga0207695_101096403 212
12 3300025924 Ga0207694_10048271 Ga0207694_100482713 212
13 3300025949 Ga0207667_10206083 Ga0207667_102060833 212
14 3300026142 Ga0207698_10152943 Ga0207698_101529431 212
15 3300025919 Ga0207657_10337718 Ga0207657_103377182 213
16 3300005546 Ga0070696_100385711 Ga0070696_1003857112 215
17 3300013102 Ga0157371_10197177 Ga0157371_101971772 216
18 3300031901 Ga0307406_10300007 Ga0307406_103000072 216
19 3300005339 Ga0070660_100382842 Ga0070660_1003828421 217
20 3300005434 Ga0070709_10098438 Ga0070709_100984383 217
21 3300005435 Ga0070714_100046589 Ga0070714_1000465896 217
22 3300005436 Ga0070713_100255994 Ga0070713_1002559942 217
23 3300005539 Ga0068853_100061639 Ga0068853_1000616393 217
24 3300005614 Ga0068856_100027857 Ga0068856_1000278573 217
25 3300005614 Ga0068856_100474565 Ga0068856_1004745652 217
26 3300006028 Ga0070717_10082997 Ga0070717_100829974 217
27 3300006173 Ga0070716_100115373 Ga0070716_1001153732 217
28 3300006175 Ga0070712_100270517 Ga0070712_1002705172 217
29 3300013102 Ga0157371_10012251 Ga0157371_100122518 217
30 3300013104 Ga0157370_10018639 Ga0157370_100186397 217
31 3300013104 Ga0157370_10146539 Ga0157370_101465392 217
32 3300013105 Ga0157369_10050600 Ga0157369_100506002 217
33 3300013307 Ga0157372_10195058 Ga0157372_101950584 217
34 3300025915 Ga0207693_10120832 Ga0207693_101208322 217
35 3300025917 Ga0207660_10207722 Ga0207660_102077222 217
36 3300025919 Ga0207657_10018979 Ga0207657_100189796 217
37 3300025928 Ga0207700_10320486 Ga0207700_103204862 217
38 3300025929 Ga0207664_10049541 Ga0207664_100495414 217
39 3300025939 Ga0207665_10056891 Ga0207665_100568914 217
40 3300025940 Ga0207691_10218948 Ga0207691_102189482 217
41 3300026041 Ga0207639_10176839 Ga0207639_101768391 217
42 3300026078 Ga0207702_10021319 Ga0207702_100213194 217
43 3300026078 Ga0207702_10586832 Ga0207702_105868322 217
44 3300035111 Ga0373923_0163279 Ga0373923_0163279_153_863 217
45 3300035120 Ga0373957_0011847 Ga0373957_0011847_1169_1867 217
46 3300035172 Ga0373955_0017940 Ga0373955_0017940_2378_3076 217
47 3300035692 Ga0373935_0025073 Ga0373935_0025073_1041_1751 217
48 3300035724 Ga0373933_0055688 Ga0373933_0055688_618_1316 217
49 3300036401 Ga0373937_0033405 Ga0373937_0033405_2135_2833 217
50 3300048088 Ga0495602_0054509 Ga0495602_0054509_1172_1870 217
51 3300002073 JGI24745J21846_1005029 JGI24745J21846_10050292 218
52 3300005293 Ga0065715_10166590 Ga0065715_101665902 218
53 3300005328 Ga0070676_10050997 Ga0070676_100509972 218
54 3300005328 Ga0070676_10113685 Ga0070676_101136852 218
55 3300005331 Ga0070670_100014078 Ga0070670_1000140782 218
56 3300005337 Ga0070682_100032930 Ga0070682_1000329302 218
57 3300005338 Ga0068868_100382456 Ga0068868_1003824562 218
58 3300005339 Ga0070660_100056812 Ga0070660_1000568122 218
59 3300005344 Ga0070661_100136002 Ga0070661_1001360022 218
60 3300005354 Ga0070675_100184831 Ga0070675_1001848313 218
61 3300005355 Ga0070671_100039621 Ga0070671_1000396215 218
62 3300005356 Ga0070674_100076178 Ga0070674_1000761782 218
63 3300005364 Ga0070673_100173546 Ga0070673_1001735462 218
64 3300005455 Ga0070663_100086544 Ga0070663_1000865441 218
65 3300005456 Ga0070678_100062596 Ga0070678_1000625962 218
66 3300005459 Ga0068867_100364543 Ga0068867_1003645431 218
67 3300005539 Ga0068853_100830510 Ga0068853_1008305101 218
68 3300005543 Ga0070672_100107798 Ga0070672_1001077983 218
69 3300005547 Ga0070693_100520703 Ga0070693_1005207031 218
70 3300005564 Ga0070664_100097212 Ga0070664_1000972122 218
71 3300005578 Ga0068854_100071312 Ga0068854_1000713122 218
72 3300005719 Ga0068861_100304065 Ga0068861_1003040652 218
73 3300006358 Ga0068871_100244330 Ga0068871_1002443302 218
74 3300009098 Ga0105245_10042402 Ga0105245_100424023 218
75 3300013297 Ga0157378_10027473 Ga0157378_100274732 218
76 3300025315 Ga0207697_10001895 Ga0207697_100018958 218
77 3300025893 Ga0207682_10002958 Ga0207682_100029582 218
78 3300025901 Ga0207688_10001410 Ga0207688_100014109 218
79 3300025904 Ga0207647_10080968 Ga0207647_100809682 218
80 3300025907 Ga0207645_10074916 Ga0207645_100749163 218
81 3300025908 Ga0207643_10014049 Ga0207643_100140496 218
82 3300025919 Ga0207657_10012396 Ga0207657_1001239610 218
83 3300025926 Ga0207659_10030808 Ga0207659_100308084 218
84 3300025927 Ga0207687_10113697 Ga0207687_101136973 218
85 3300025932 Ga0207690_10499985 Ga0207690_104999851 218
86 3300025932 Ga0207690_10512602 Ga0207690_105126022 218
87 3300025933 Ga0207706_10099945 Ga0207706_100999455 218
88 3300025937 Ga0207669_10002765 Ga0207669_100027652 218
89 3300025940 Ga0207691_10074127 Ga0207691_100741272 218
90 3300025942 Ga0207689_10112929 Ga0207689_101129293 218
91 3300025942 Ga0207689_10553909 Ga0207689_105539092 218
92 3300025945 Ga0207679_10046008 Ga0207679_100460085 218
93 3300025960 Ga0207651_10172892 Ga0207651_101728922 218
94 3300026023 Ga0207677_10067922 Ga0207677_100679222 218
95 3300026089 Ga0207648_10003539 Ga0207648_1000353914 218
96 3300026095 Ga0207676_10156502 Ga0207676_101565022 218
97 3300026118 Ga0207675_100222537 Ga0207675_1002225372 218
98 3300026121 Ga0207683_10013394 Ga0207683_100133943 218
99 3300037418 Ga0395900_0327208 Ga0395900_0327208_593_1291 218
100 3300037471 Ga0395905_0129687 Ga0395905_0129687_87_785 218
101 3300038443 Ga0395901_0042467 Ga0395901_0042467_847_1545 218
102 3300048905 Ga0496102_0273733 Ga0496102_0273733_872_1570 218
103 3300048906 Ga0496103_0016842 Ga0496103_0016842_2371_3069 218
104 3300048912 Ga0496109_0295348 Ga0496109_0295348_533_1231 218
105 3300049776 Ga0501280_000314 Ga0501280_000314_6060_6770 218
106 3300006353 Ga0075370_10005349 Ga0075370_1000534911 220
107 3300025304 Ga0209257_1011481 Ga0209257_10114817 220
108 3300025917 Ga0207660_10203210 Ga0207660_102032103 220
109 3300013102 Ga0157371_10025908 Ga0157371_100259082 221
110 3300013307 Ga0157372_10160734 Ga0157372_101607342 221
111 iso_pu_bacteria 2599185354 2600203099 221
112 3300005353 Ga0070669_100125866 Ga0070669_1001258662 222
113 3300005841 Ga0068863_100002810 Ga0068863_10000281016 222
114 3300005843 Ga0068860_100000391 Ga0068860_10000039127 222
115 3300005844 Ga0068862_100000014 Ga0068862_100000014124 222
116 3300006931 Ga0097620_100023168 Ga0097620_1000231685 222
117 3300009101 Ga0105247_10003692 Ga0105247_100036923 222
118 3300009553 Ga0105249_10000002 Ga0105249_10000002274 222
119 3300014326 Ga0157380_10363241 Ga0157380_103632412 222
120 3300025900 Ga0207710_10001762 Ga0207710_1000176210 222
121 3300025923 Ga0207681_10162280 Ga0207681_101622802 222
122 3300025961 Ga0207712_10000002 Ga0207712_10000002645 222
123 3300026075 Ga0207708_10240255 Ga0207708_102402553 222
124 3300026088 Ga0207641_10004364 Ga0207641_1000436415 222
125 3300028380 Ga0268265_10000607 Ga0268265_100006078 222
126 3300028381 Ga0268264_10000634 Ga0268264_100006343 222
127 3300031731 Ga0307405_10390249 Ga0307405_103902492 222
128 3300031911 Ga0307412_10234602 Ga0307412_102346022 222
129 3300032133 Ga0316583_10006180 Ga0316583_100061805 222
130 3300036647 Ga0316582_0015227 Ga0316582_0015227_422_1105 222
131 3300036647 Ga0316582_0216777 Ga0316582_0216777_29_712 222
132 3300036712 Ga0316584_0634968 Ga0316584_0634968_26_712 222
133 3300037588 Ga0316581_0045622 Ga0316581_0045622_181_864 222
134 3300038443 Ga0395901_0177005 Ga0395901_0177005_332_1033 222
135 3300041997 Ga0439431_0042236 Ga0439431_0042236_33_716 222
136 3300042003 Ga0439443_016330 Ga0439443_016330_362_1045 222
137 3300048905 Ga0496102_0007003 Ga0496102_0007003_3083_3778 222
138 3300005353 Ga0070669_100036160 Ga0070669_1000361605 223
139 3300005578 Ga0068854_100041472 Ga0068854_1000414725 223
140 3300014325 Ga0163163_10123122 Ga0163163_101231222 223
141 3300025923 Ga0207681_10030797 Ga0207681_100307971 223
142 3300025981 Ga0207640_10006878 Ga0207640_100068783 223
143 3300026116 Ga0207674_10109713 Ga0207674_101097134 223
144 3300031548 Ga0307408_100267624 Ga0307408_1002676242 223
145 3300031548 Ga0307408_100390827 Ga0307408_1003908272 223
146 3300031731 Ga0307405_10344640 Ga0307405_103446402 223
147 3300031852 Ga0307410_10013709 Ga0307410_100137093 223
148 3300031901 Ga0307406_10062485 Ga0307406_100624852 223
149 3300031903 Ga0307407_10044587 Ga0307407_100445874 223
150 3300031903 Ga0307407_10254322 Ga0307407_102543222 223
151 3300031911 Ga0307412_10056498 Ga0307412_100564982 223
152 3300031995 Ga0307409_100016968 Ga0307409_1000169683 223
153 3300031995 Ga0307409_100391245 Ga0307409_1003912451 223
154 3300032002 Ga0307416_100010569 Ga0307416_1000105695 223
155 3300032002 Ga0307416_100089815 Ga0307416_1000898154 223
156 3300032005 Ga0307411_10046369 Ga0307411_100463691 223
157 3300032126 Ga0307415_100059574 Ga0307415_1000595743 223
158 3300005327 Ga0070658_10055314 Ga0070658_100553143 224
159 3300005327 Ga0070658_10060673 Ga0070658_100606733 224
160 3300005327 Ga0070658_10770909 Ga0070658_107709091 224
161 3300005329 Ga0070683_100036480 Ga0070683_1000364801 224
162 3300005339 Ga0070660_100272161 Ga0070660_1002721612 224
163 3300005344 Ga0070661_100015630 Ga0070661_1000156304 224
164 3300005345 Ga0070692_10017116 Ga0070692_100171163 224
165 3300005366 Ga0070659_100120609 Ga0070659_1001206093 224
166 3300005455 Ga0070663_100081532 Ga0070663_1000815322 224
167 3300005458 Ga0070681_10277224 Ga0070681_102772242 224
168 3300005530 Ga0070679_100551324 Ga0070679_1005513242 224
169 3300005535 Ga0070684_100020259 Ga0070684_1000202596 224
170 3300005548 Ga0070665_100301553 Ga0070665_1003015533 224
171 3300005563 Ga0068855_100108475 Ga0068855_1001084753 224
172 3300005563 Ga0068855_100617221 Ga0068855_1006172212 224
173 3300005563 Ga0068855_100977069 Ga0068855_1009770692 224
174 3300005616 Ga0068852_100166314 Ga0068852_1001663143 224
175 3300005618 Ga0068864_100000145 Ga0068864_10000014552 224
176 3300005842 Ga0068858_100000268 Ga0068858_1000002686 224
177 3300009177 Ga0105248_10021785 Ga0105248_100217852 224
178 3300013102 Ga0157371_10017812 Ga0157371_100178122 224
179 3300013102 Ga0157371_10095601 Ga0157371_100956012 224
180 3300013104 Ga0157370_10088851 Ga0157370_100888514 224
181 3300013104 Ga0157370_10208742 Ga0157370_102087423 224
182 3300013105 Ga0157369_10011088 Ga0157369_1001108810 224
183 3300013105 Ga0157369_10565593 Ga0157369_105655931 224
184 3300013296 Ga0157374_10056025 Ga0157374_100560252 224
185 3300013306 Ga0163162_10010851 Ga0163162_100108518 224
186 3300025315 Ga0207697_10003663 Ga0207697_100036633 224
187 3300025904 Ga0207647_10024301 Ga0207647_100243013 224
188 3300025909 Ga0207705_10026528 Ga0207705_100265286 224
189 3300025909 Ga0207705_10029445 Ga0207705_100294453 224
190 3300025909 Ga0207705_10039655 Ga0207705_100396553 224
191 3300025912 Ga0207707_10332381 Ga0207707_103323812 224
192 3300025919 Ga0207657_10052117 Ga0207657_100521172 224
193 3300025920 Ga0207649_10019101 Ga0207649_100191013 224
194 3300025921 Ga0207652_10170400 Ga0207652_101704003 224
195 3300025941 Ga0207711_10003775 Ga0207711_100037758 224
196 3300025944 Ga0207661_10022512 Ga0207661_100225123 224
197 3300025949 Ga0207667_10081978 Ga0207667_100819784 224
198 3300026035 Ga0207703_10000139 Ga0207703_1000013934 224
199 3300026067 Ga0207678_10005368 Ga0207678_100053684 224
200 3300026095 Ga0207676_10000072 Ga0207676_1000007280 224
201 3300026121 Ga0207683_10565818 Ga0207683_105658181 224
202 3300026142 Ga0207698_10320895 Ga0207698_103208952 224
203 3300028786 Ga0307517_10127210 Ga0307517_101272103 224
204 3300031456 Ga0307513_10059999 Ga0307513_100599997 224
205 3300031852 Ga0307410_10010566 Ga0307410_100105664 224
206 3300031901 Ga0307406_10265174 Ga0307406_102651742 224
207 3300031903 Ga0307407_10413640 Ga0307407_104136402 224
208 3300032005 Ga0307411_10032304 Ga0307411_100323043 224
209 3300032126 Ga0307415_100147335 Ga0307415_1001473352 224
210 3300033180 Ga0307510_10000369 Ga0307510_1000036917 224
211 3300037068 Ga0373925_0634660 Ga0373925_0634660_40_729 224
212 3300037312 Ga0395899_0049098 Ga0395899_0049098_1866_2555 224
213 3300037418 Ga0395900_0008602 Ga0395900_0008602_6409_7098 224
214 3300037466 Ga0395898_0580358 Ga0395898_0580358_299_988 224
215 3300038443 Ga0395901_0008693 Ga0395901_0008693_3165_3854 224
216 3300046460 Ga0495638_0097754 Ga0495638_0097754_640_1350 224
217 3300046524 Ga0495648_0038706 Ga0495648_0038706_859_1569 224
218 3300046810 Ga0495660_0218412 Ga0495660_0218412_20_709 224
219 3300047445 Ga0495677_0003219 Ga0495677_0003219_270_980 224
220 3300053087 Ga0500643_001035 Ga0500643_001035_3874_4584 224
221 3300053090 Ga0500646_0125306 Ga0500646_0125306_67_777 224
222 3300005335 Ga0070666_10200552 Ga0070666_102005522 225
223 3300013297 Ga0157378_10043077 Ga0157378_100430776 225
224 3300025903 Ga0207680_10307194 Ga0207680_103071942 225
225 3300028786 Ga0307517_10044322 Ga0307517_100443227 225
226 3300046471 Ga0495650_0031267 Ga0495650_0031267_1318_2010 225
227 3300046524 Ga0495648_0013722 Ga0495648_0013722_5248_5940 225
228 3300048928 Ga0496125_0198494 Ga0496125_0198494_68_763 225
229 3300001989 JGI24739J22299_10008994 JGI24739J22299_100089944 226
230 3300001990 JGI24737J22298_10001822 JGI24737J22298_100018226 226
231 3300002075 JGI24738J21930_10000704 JGI24738J21930_100007046 226
232 3300005327 Ga0070658_10000177 Ga0070658_1000017730 226
233 3300005329 Ga0070683_100004360 Ga0070683_1000043604 226
234 3300005331 Ga0070670_100064639 Ga0070670_1000646394 226
235 3300005335 Ga0070666_10002806 Ga0070666_1000280610 226
236 3300005338 Ga0068868_100512449 Ga0068868_1005124491 226
237 3300005339 Ga0070660_100000065 Ga0070660_10000006529 226
238 3300005344 Ga0070661_100000084 Ga0070661_10000008411 226
239 3300005355 Ga0070671_100034473 Ga0070671_1000344736 226
240 3300005366 Ga0070659_100001520 Ga0070659_10000152011 226
241 3300005367 Ga0070667_100003791 Ga0070667_1000037911 226
242 3300005455 Ga0070663_100001477 Ga0070663_10000147713 226
243 3300005457 Ga0070662_100000017 Ga0070662_10000001764 226
244 3300005458 Ga0070681_10498269 Ga0070681_104982692 226
245 3300005535 Ga0070684_100042518 Ga0070684_1000425185 226
246 3300005539 Ga0068853_100000703 Ga0068853_10000070323 226
247 3300005547 Ga0070693_100009123 Ga0070693_1000091234 226
248 3300005548 Ga0070665_100009518 Ga0070665_1000095182 226
249 3300005563 Ga0068855_100000194 Ga0068855_10000019458 226
250 3300005564 Ga0070664_100000098 Ga0070664_10000009829 226
251 3300005614 Ga0068856_100000098 Ga0068856_10000009862 226
252 3300005616 Ga0068852_100000440 Ga0068852_10000044010 226
253 3300005842 Ga0068858_100032317 Ga0068858_1000323176 226
254 3300006237 Ga0097621_100132707 Ga0097621_1001327072 226
255 3300006358 Ga0068871_100259245 Ga0068871_1002592452 226
256 3300009174 Ga0105241_10022968 Ga0105241_100229683 226
257 3300009177 Ga0105248_10000444 Ga0105248_100004449 226
258 3300013100 Ga0157373_10019148 Ga0157373_100191486 226
259 3300013102 Ga0157371_10002003 Ga0157371_100020039 226
260 3300013105 Ga0157369_10299393 Ga0157369_102993932 226
261 3300013296 Ga0157374_10005411 Ga0157374_1000541113 226
262 3300014325 Ga0163163_10000169 Ga0163163_1000016962 226
263 3300025903 Ga0207680_10004223 Ga0207680_100042236 226
264 3300025904 Ga0207647_10002702 Ga0207647_1000270215 226
265 3300025909 Ga0207705_10000137 Ga0207705_1000013746 226
266 3300025911 Ga0207654_10143916 Ga0207654_101439162 226
267 3300025912 Ga0207707_10429724 Ga0207707_104297242 226
268 3300025919 Ga0207657_10000508 Ga0207657_1000050816 226
269 3300025920 Ga0207649_10000186 Ga0207649_100001867 226
270 3300025924 Ga0207694_10017707 Ga0207694_100177074 226
271 3300025925 Ga0207650_10054914 Ga0207650_100549145 226
272 3300025931 Ga0207644_10023264 Ga0207644_100232642 226
273 3300025932 Ga0207690_10000108 Ga0207690_1000010817 226
274 3300025933 Ga0207706_10000514 Ga0207706_1000051429 226
275 3300025941 Ga0207711_10005548 Ga0207711_100055481 226
276 3300025944 Ga0207661_10098825 Ga0207661_100988254 226
277 3300025945 Ga0207679_10000114 Ga0207679_1000011421 226
278 3300025949 Ga0207667_10016322 Ga0207667_100163225 226
279 3300025986 Ga0207658_10005799 Ga0207658_100057992 226
280 3300026035 Ga0207703_10005508 Ga0207703_1000550811 226
281 3300026041 Ga0207639_10000139 Ga0207639_1000013922 226
282 3300026067 Ga0207678_10006212 Ga0207678_1000621214 226
283 3300026078 Ga0207702_10001266 Ga0207702_1000126610 226
284 3300026142 Ga0207698_10000598 Ga0207698_1000059816 226
285 3300028379 Ga0268266_10033207 Ga0268266_100332072 226
286 3300031911 Ga0307412_10002333 Ga0307412_100023335 226
287 3300032004 Ga0307414_10087767 Ga0307414_100877672 226
288 3300032004 Ga0307414_10188003 Ga0307414_101880033 226
289 3300034819 Ga0373958_0048274 Ga0373958_0048274_79_774 226
290 3300035114 Ga0373939_0059072 Ga0373939_0059072_338_1033 226
291 3300035691 Ga0373931_0010139 Ga0373931_0010139_906_1601 226
292 3300037418 Ga0395900_0021957 Ga0395900_0021957_4214_4909 226
293 3300037418 Ga0395900_0036992 Ga0395900_0036992_2746_3441 226
294 3300037471 Ga0395905_0000232 Ga0395905_0000232_26498_27193 226
295 3300037471 Ga0395905_0048085 Ga0395905_0048085_3168_3863 226
296 3300045976 Ga0466967_0058953 Ga0466967_0058953_2017_2712 226
297 3300046491 Ga0495584_0124321 Ga0495584_0124321_63_779 226
298 3300046528 Ga0495642_0008044 Ga0495642_0008044_595_1311 226
299 3300046664 Ga0495659_0015361 Ga0495659_0015361_885_1601 226
300 3300046684 Ga0495669_0003949 Ga0495669_0003949_4341_5057 226
301 3300046691 Ga0495670_0008719 Ga0495670_0008719_2319_3035 226
302 3300046691 Ga0495670_0014736 Ga0495670_0014736_46_762 226
303 3300002067 JGI24735J21928_10009963 JGI24735J21928_100099633 227
304 3300002067 JGI24735J21928_10025273 JGI24735J21928_100252733 227
305 3300005293 Ga0065715_10000565 Ga0065715_100005658 227
306 3300005327 Ga0070658_10030017 Ga0070658_100300175 227
307 3300005328 Ga0070676_10042193 Ga0070676_100421933 227
308 3300005328 Ga0070676_10069490 Ga0070676_100694902 227
309 3300005329 Ga0070683_100002630 Ga0070683_10000263010 227
310 3300005331 Ga0070670_100007610 Ga0070670_1000076106 227
311 3300005331 Ga0070670_100075622 Ga0070670_1000756224 227
312 3300005333 Ga0070677_10005158 Ga0070677_100051583 227
313 3300005333 Ga0070677_10121833 Ga0070677_101218332 227
314 3300005334 Ga0068869_100153426 Ga0068869_1001534261 227
315 3300005335 Ga0070666_10000205 Ga0070666_100002059 227
316 3300005338 Ga0068868_100001585 Ga0068868_10000158516 227
317 3300005339 Ga0070660_100030157 Ga0070660_1000301573 227
318 3300005339 Ga0070660_100056680 Ga0070660_1000566805 227
319 3300005340 Ga0070689_100138728 Ga0070689_1001387282 227
320 3300005340 Ga0070689_100207404 Ga0070689_1002074041 227
321 3300005341 Ga0070691_10044907 Ga0070691_100449073 227
322 3300005344 Ga0070661_100007237 Ga0070661_1000072376 227
323 3300005344 Ga0070661_100059608 Ga0070661_1000596082 227
324 3300005344 Ga0070661_100073642 Ga0070661_1000736422 227
325 3300005347 Ga0070668_100007118 Ga0070668_1000071186 227
326 3300005347 Ga0070668_100251930 Ga0070668_1002519303 227
327 3300005353 Ga0070669_100005425 Ga0070669_1000054259 227
328 3300005353 Ga0070669_100117379 Ga0070669_1001173792 227
329 3300005354 Ga0070675_100005450 Ga0070675_1000054506 227
330 3300005354 Ga0070675_100016431 Ga0070675_1000164314 227
331 3300005354 Ga0070675_100063724 Ga0070675_1000637242 227
332 3300005355 Ga0070671_100005160 Ga0070671_1000051603 227
333 3300005355 Ga0070671_100022991 Ga0070671_1000229917 227
334 3300005355 Ga0070671_100072955 Ga0070671_1000729552 227
335 3300005356 Ga0070674_100009250 Ga0070674_1000092506 227
336 3300005364 Ga0070673_100000376 Ga0070673_10000037614 227
337 3300005364 Ga0070673_100003783 Ga0070673_10000378310 227
338 3300005364 Ga0070673_100019485 Ga0070673_1000194853 227
339 3300005366 Ga0070659_100056006 Ga0070659_1000560063 227
340 3300005366 Ga0070659_100278025 Ga0070659_1002780252 227
341 3300005367 Ga0070667_100001373 Ga0070667_10000137310 227
342 3300005367 Ga0070667_100005308 Ga0070667_1000053082 227
343 3300005367 Ga0070667_100119477 Ga0070667_1001194772 227
344 3300005367 Ga0070667_100125820 Ga0070667_1001258203 227
345 3300005367 Ga0070667_100712950 Ga0070667_1007129502 227
346 3300005441 Ga0070700_100008201 Ga0070700_1000082014 227
347 3300005455 Ga0070663_100130633 Ga0070663_1001306332 227
348 3300005456 Ga0070678_100000919 Ga0070678_10000091918 227
349 3300005456 Ga0070678_100039998 Ga0070678_1000399985 227
350 3300005456 Ga0070678_100593207 Ga0070678_1005932071 227
351 3300005457 Ga0070662_100000350 Ga0070662_1000003506 227
352 3300005457 Ga0070662_100200557 Ga0070662_1002005571 227
353 3300005458 Ga0070681_10276098 Ga0070681_102760982 227
354 3300005459 Ga0068867_100017538 Ga0068867_1000175386 227
355 3300005535 Ga0070684_100015289 Ga0070684_1000152895 227
356 3300005539 Ga0068853_100008841 Ga0068853_1000088416 227
357 3300005539 Ga0068853_100149179 Ga0068853_1001491792 227
358 3300005539 Ga0068853_100169151 Ga0068853_1001691512 227
359 3300005543 Ga0070672_100001101 Ga0070672_1000011015 227
360 3300005543 Ga0070672_100004066 Ga0070672_10000406612 227
361 3300005545 Ga0070695_100248198 Ga0070695_1002481982 227
362 3300005548 Ga0070665_100005491 Ga0070665_10000549115 227
363 3300005548 Ga0070665_100300473 Ga0070665_1003004732 227
364 3300005563 Ga0068855_100298274 Ga0068855_1002982742 227
365 3300005563 Ga0068855_100433979 Ga0068855_1004339792 227
366 3300005564 Ga0070664_100005544 Ga0070664_1000055443 227
367 3300005564 Ga0070664_100006436 Ga0070664_1000064369 227
368 3300005564 Ga0070664_100022619 Ga0070664_1000226197 227
369 3300005564 Ga0070664_100040999 Ga0070664_1000409994 227
370 3300005564 Ga0070664_100397886 Ga0070664_1003978862 227
371 3300005577 Ga0068857_100032846 Ga0068857_1000328464 227
372 3300005577 Ga0068857_100056063 Ga0068857_1000560633 227
373 3300005577 Ga0068857_100509632 Ga0068857_1005096322 227
374 3300005578 Ga0068854_100002764 Ga0068854_1000027646 227
375 3300005614 Ga0068856_100054691 Ga0068856_1000546913 227
376 3300005616 Ga0068852_100031098 Ga0068852_1000310982 227
377 3300005616 Ga0068852_100062797 Ga0068852_1000627973 227
378 3300005616 Ga0068852_100068109 Ga0068852_1000681092 227
379 3300005616 Ga0068852_100318068 Ga0068852_1003180681 227
380 3300005617 Ga0068859_100001231 Ga0068859_10000123115 227
381 3300005617 Ga0068859_100005659 Ga0068859_1000056599 227
382 3300005617 Ga0068859_100030121 Ga0068859_1000301216 227
383 3300005618 Ga0068864_100000953 Ga0068864_10000095314 227
384 3300005618 Ga0068864_100010591 Ga0068864_1000105914 227
385 3300005718 Ga0068866_10124001 Ga0068866_101240012 227
386 3300005840 Ga0068870_10011657 Ga0068870_100116574 227
387 3300005841 Ga0068863_100003718 Ga0068863_10000371813 227
388 3300005841 Ga0068863_100008708 Ga0068863_1000087083 227
389 3300005841 Ga0068863_100467445 Ga0068863_1004674452 227
390 3300005842 Ga0068858_100000695 Ga0068858_10000069531 227
391 3300005842 Ga0068858_100003129 Ga0068858_10000312915 227
392 3300005842 Ga0068858_100009018 Ga0068858_1000090189 227
393 3300005842 Ga0068858_100115549 Ga0068858_1001155494 227
394 3300005843 Ga0068860_100020638 Ga0068860_1000206383 227
395 3300005843 Ga0068860_100064679 Ga0068860_1000646792 227
396 3300005844 Ga0068862_100007629 Ga0068862_1000076296 227
397 3300005844 Ga0068862_100011300 Ga0068862_1000113006 227
398 3300005844 Ga0068862_100044826 Ga0068862_1000448264 227
399 3300006237 Ga0097621_100153930 Ga0097621_1001539303 227
400 3300006237 Ga0097621_100352120 Ga0097621_1003521202 227
401 3300006237 Ga0097621_100361544 Ga0097621_1003615442 227
402 3300006358 Ga0068871_100069014 Ga0068871_1000690143 227
403 3300006881 Ga0068865_100647686 Ga0068865_1006476862 227
404 3300006931 Ga0097620_100001231 Ga0097620_10000123116 227
405 3300006931 Ga0097620_100005660 Ga0097620_1000056609 227
406 3300006931 Ga0097620_100030122 Ga0097620_1000301224 227
407 3300009092 Ga0105250_10017407 Ga0105250_100174075 227
408 3300009093 Ga0105240_10045839 Ga0105240_100458395 227
409 3300009148 Ga0105243_10131029 Ga0105243_101310293 227
410 3300009177 Ga0105248_10000184 Ga0105248_1000018428 227
411 3300009177 Ga0105248_10000390 Ga0105248_1000039017 227
412 3300009177 Ga0105248_10001388 Ga0105248_100013889 227
413 3300009177 Ga0105248_10009540 Ga0105248_100095406 227
414 3300009177 Ga0105248_10509186 Ga0105248_105091862 227
415 3300009545 Ga0105237_10016649 Ga0105237_1001664910 227
416 3300009551 Ga0105238_10027588 Ga0105238_100275885 227
417 3300009553 Ga0105249_10046397 Ga0105249_100463973 227
418 3300009553 Ga0105249_10089940 Ga0105249_100899405 227
419 3300013100 Ga0157373_10025832 Ga0157373_100258325 227
420 3300013100 Ga0157373_10098826 Ga0157373_100988262 227
421 3300013102 Ga0157371_10078646 Ga0157371_100786464 227
422 3300013104 Ga0157370_10029172 Ga0157370_100291726 227
423 3300013105 Ga0157369_10372078 Ga0157369_103720782 227
424 3300013296 Ga0157374_10002141 Ga0157374_100021416 227
425 3300013297 Ga0157378_10087449 Ga0157378_100874494 227
426 3300013297 Ga0157378_10131937 Ga0157378_101319372 227
427 3300013306 Ga0163162_10002668 Ga0163162_100026685 227
428 3300013306 Ga0163162_10025560 Ga0163162_100255602 227
429 3300013306 Ga0163162_10080689 Ga0163162_100806892 227
430 3300013306 Ga0163162_10145637 Ga0163162_101456373 227
431 3300013307 Ga0157372_10040729 Ga0157372_100407295 227
432 3300013308 Ga0157375_10000709 Ga0157375_1000070933 227
433 3300013308 Ga0157375_10073585 Ga0157375_100735854 227
434 3300013308 Ga0157375_10602527 Ga0157375_106025271 227
435 3300014325 Ga0163163_10000131 Ga0163163_1000013120 227
436 3300014325 Ga0163163_10001864 Ga0163163_1000186418 227
437 3300014326 Ga0157380_10003743 Ga0157380_100037433 227
438 3300014326 Ga0157380_10013753 Ga0157380_100137539 227
439 3300014968 Ga0157379_10002480 Ga0157379_100024804 227
440 3300014968 Ga0157379_10072765 Ga0157379_100727654 227
441 3300017792 Ga0163161_10002075 Ga0163161_1000207510 227
442 3300017792 Ga0163161_10017590 Ga0163161_100175902 227
443 3300025315 Ga0207697_10020945 Ga0207697_100209452 227
444 3300025321 Ga0207656_10016654 Ga0207656_100166543 227
445 3300025893 Ga0207682_10000923 Ga0207682_1000092310 227
446 3300025893 Ga0207682_10146431 Ga0207682_101464311 227
447 3300025899 Ga0207642_10156191 Ga0207642_101561911 227
448 3300025901 Ga0207688_10012090 Ga0207688_100120905 227
449 3300025903 Ga0207680_10000773 Ga0207680_100007734 227
450 3300025904 Ga0207647_10001741 Ga0207647_100017416 227
451 3300025907 Ga0207645_10020408 Ga0207645_100204082 227
452 3300025907 Ga0207645_10041026 Ga0207645_100410263 227
453 3300025908 Ga0207643_10014539 Ga0207643_100145394 227
454 3300025909 Ga0207705_10228182 Ga0207705_102281822 227
455 3300025913 Ga0207695_10009667 Ga0207695_1000966710 227
456 3300025914 Ga0207671_10031351 Ga0207671_100313515 227
457 3300025917 Ga0207660_10042494 Ga0207660_100424943 227
458 3300025919 Ga0207657_10011576 Ga0207657_100115769 227
459 3300025919 Ga0207657_10047588 Ga0207657_100475885 227
460 3300025920 Ga0207649_10004832 Ga0207649_100048328 227
461 3300025920 Ga0207649_10010259 Ga0207649_100102597 227
462 3300025920 Ga0207649_10040201 Ga0207649_100402012 227
463 3300025923 Ga0207681_10001743 Ga0207681_1000174310 227
464 3300025923 Ga0207681_10014834 Ga0207681_100148348 227
465 3300025923 Ga0207681_10469491 Ga0207681_104694912 227
466 3300025924 Ga0207694_10078157 Ga0207694_100781573 227
467 3300025925 Ga0207650_10003361 Ga0207650_100033615 227
468 3300025925 Ga0207650_10069691 Ga0207650_100696914 227
469 3300025925 Ga0207650_10168456 Ga0207650_101684562 227
470 3300025925 Ga0207650_10236162 Ga0207650_102361622 227
471 3300025926 Ga0207659_10016247 Ga0207659_100162475 227
472 3300025926 Ga0207659_10067735 Ga0207659_100677352 227
473 3300025931 Ga0207644_10006549 Ga0207644_1000654910 227
474 3300025931 Ga0207644_10020946 Ga0207644_100209465 227
475 3300025931 Ga0207644_10162201 Ga0207644_101622011 227
476 3300025931 Ga0207644_10235809 Ga0207644_102358093 227
477 3300025932 Ga0207690_10044417 Ga0207690_100444175 227
478 3300025932 Ga0207690_10049401 Ga0207690_100494013 227
479 3300025933 Ga0207706_10000276 Ga0207706_1000027623 227
480 3300025933 Ga0207706_10001018 Ga0207706_1000101816 227
481 3300025933 Ga0207706_10047462 Ga0207706_100474624 227
482 3300025933 Ga0207706_10400451 Ga0207706_104004512 227
483 3300025933 Ga0207706_10435473 Ga0207706_104354732 227
484 3300025936 Ga0207670_10038785 Ga0207670_100387852 227
485 3300025937 Ga0207669_10008335 Ga0207669_100083356 227
486 3300025938 Ga0207704_10603433 Ga0207704_106034331 227
487 3300025940 Ga0207691_10002752 Ga0207691_100027526 227
488 3300025940 Ga0207691_10014857 Ga0207691_1001485710 227
489 3300025940 Ga0207691_10423090 Ga0207691_104230902 227
490 3300025941 Ga0207711_10000105 Ga0207711_1000010585 227
491 3300025941 Ga0207711_10000190 Ga0207711_1000019050 227
492 3300025941 Ga0207711_10000413 Ga0207711_1000041327 227
493 3300025941 Ga0207711_10012443 Ga0207711_100124439 227
494 3300025941 Ga0207711_10038564 Ga0207711_100385644 227
495 3300025944 Ga0207661_10075835 Ga0207661_100758354 227
496 3300025945 Ga0207679_10038365 Ga0207679_100383655 227
497 3300025945 Ga0207679_10168309 Ga0207679_101683093 227
498 3300025945 Ga0207679_10196899 Ga0207679_101968992 227
499 3300025945 Ga0207679_10237995 Ga0207679_102379952 227
500 3300025949 Ga0207667_10351088 Ga0207667_103510882 227
501 3300025949 Ga0207667_10456820 Ga0207667_104568201 227
502 3300025960 Ga0207651_10001938 Ga0207651_100019387 227
503 3300025960 Ga0207651_10108775 Ga0207651_101087753 227
504 3300025960 Ga0207651_10176249 Ga0207651_101762492 227
505 3300025961 Ga0207712_10027059 Ga0207712_100270593 227
506 3300025961 Ga0207712_10067825 Ga0207712_100678254 227
507 3300025972 Ga0207668_10002327 Ga0207668_100023275 227
508 3300025972 Ga0207668_10048063 Ga0207668_100480632 227
509 3300025981 Ga0207640_10103670 Ga0207640_101036702 227
510 3300025986 Ga0207658_10002159 Ga0207658_1000215912 227
511 3300025986 Ga0207658_10012692 Ga0207658_100126922 227
512 3300025986 Ga0207658_10023849 Ga0207658_100238496 227
513 3300025986 Ga0207658_10164207 Ga0207658_101642072 227
514 3300025986 Ga0207658_10352231 Ga0207658_103522312 227
515 3300025986 Ga0207658_10711025 Ga0207658_107110251 227
516 3300026023 Ga0207677_10000600 Ga0207677_1000060018 227
517 3300026035 Ga0207703_10000461 Ga0207703_1000046119 227
518 3300026035 Ga0207703_10004673 Ga0207703_1000467314 227
519 3300026041 Ga0207639_10003170 Ga0207639_100031708 227
520 3300026041 Ga0207639_10045291 Ga0207639_100452912 227
521 3300026067 Ga0207678_10023972 Ga0207678_100239725 227
522 3300026075 Ga0207708_10069128 Ga0207708_100691283 227
523 3300026078 Ga0207702_10012719 Ga0207702_100127195 227
524 3300026088 Ga0207641_10000172 Ga0207641_1000017210 227
525 3300026089 Ga0207648_10015998 Ga0207648_1001599811 227
526 3300026089 Ga0207648_10075650 Ga0207648_100756503 227
527 3300026095 Ga0207676_10002758 Ga0207676_1000275812 227
528 3300026116 Ga0207674_10013020 Ga0207674_1001302010 227
529 3300026116 Ga0207674_10063263 Ga0207674_100632633 227
530 3300026118 Ga0207675_100001317 Ga0207675_10000131713 227
531 3300026121 Ga0207683_10002199 Ga0207683_1000219916 227
532 3300026121 Ga0207683_10044948 Ga0207683_100449482 227
533 3300026142 Ga0207698_10005864 Ga0207698_100058646 227
534 3300026142 Ga0207698_10009468 Ga0207698_100094685 227
535 3300026142 Ga0207698_10029422 Ga0207698_100294224 227
536 3300026142 Ga0207698_10265868 Ga0207698_102658683 227
537 3300027665 Ga0209983_1004501 Ga0209983_10045013 227
538 3300027876 Ga0209974_10000990 Ga0209974_100009906 227
539 3300027876 Ga0209974_10009484 Ga0209974_100094842 227
540 3300028379 Ga0268266_10027905 Ga0268266_100279054 227
541 3300028380 Ga0268265_10006136 Ga0268265_1000613610 227
542 3300028380 Ga0268265_10040240 Ga0268265_100402401 227
543 3300028380 Ga0268265_10182082 Ga0268265_101820822 227
544 3300028381 Ga0268264_10001019 Ga0268264_100010194 227
545 3300028381 Ga0268264_10058285 Ga0268264_100582855 227
546 3300030732 Ga0316176_1173477 Ga0316176_11734773 227
547 3300030736 Ga0316180_1092407 Ga0316180_10924073 227
548 3300030742 Ga0316183_1194200 Ga0316183_11942002 227
549 3300030744 Ga0316181_1010522 Ga0316181_10105223 227
550 3300031456 Ga0307513_10472561 Ga0307513_104725611 227
551 3300031548 Ga0307408_100015250 Ga0307408_1000152505 227
552 3300031548 Ga0307408_100080102 Ga0307408_1000801023 227
553 3300031548 Ga0307408_100091772 Ga0307408_1000917722 227
554 3300031730 Ga0307516_10144543 Ga0307516_101445433 227
555 3300031731 Ga0307405_10013101 Ga0307405_100131015 227
556 3300031731 Ga0307405_10029271 Ga0307405_100292712 227
557 3300031731 Ga0307405_10083236 Ga0307405_100832362 227
558 3300031731 Ga0307405_10130318 Ga0307405_101303183 227
559 3300031824 Ga0307413_10006953 Ga0307413_100069533 227
560 3300031824 Ga0307413_10023067 Ga0307413_100230672 227
561 3300031824 Ga0307413_10045729 Ga0307413_100457292 227
562 3300031852 Ga0307410_10001524 Ga0307410_100015248 227
563 3300031852 Ga0307410_10002541 Ga0307410_100025419 227
564 3300031852 Ga0307410_10006594 Ga0307410_100065943 227
565 3300031852 Ga0307410_10036358 Ga0307410_100363582 227
566 3300031852 Ga0307410_10045613 Ga0307410_100456132 227
567 3300031852 Ga0307410_10252144 Ga0307410_102521442 227
568 3300031901 Ga0307406_10033272 Ga0307406_100332721 227
569 3300031901 Ga0307406_10094667 Ga0307406_100946673 227
570 3300031901 Ga0307406_10097014 Ga0307406_100970142 227
571 3300031901 Ga0307406_10146347 Ga0307406_101463471 227
572 3300031901 Ga0307406_10256624 Ga0307406_102566242 227
573 3300031901 Ga0307406_10320637 Ga0307406_103206372 227
574 3300031901 Ga0307406_10525807 Ga0307406_105258072 227
575 3300031903 Ga0307407_10029956 Ga0307407_100299564 227
576 3300031903 Ga0307407_10033216 Ga0307407_100332163 227
577 3300031903 Ga0307407_10083516 Ga0307407_100835163 227
578 3300031903 Ga0307407_10122908 Ga0307407_101229083 227
579 3300031903 Ga0307407_10397299 Ga0307407_103972992 227
580 3300031911 Ga0307412_10003753 Ga0307412_100037535 227
581 3300031911 Ga0307412_10019090 Ga0307412_100190904 227
582 3300031911 Ga0307412_10083089 Ga0307412_100830893 227
583 3300031911 Ga0307412_10086981 Ga0307412_100869813 227
584 3300031911 Ga0307412_10170101 Ga0307412_101701012 227
585 3300031911 Ga0307412_10315531 Ga0307412_103155312 227
586 3300031911 Ga0307412_10566532 Ga0307412_105665321 227
587 3300031995 Ga0307409_100009382 Ga0307409_1000093826 227
588 3300031995 Ga0307409_100060305 Ga0307409_1000603053 227
589 3300031995 Ga0307409_100065443 Ga0307409_1000654433 227
590 3300031995 Ga0307409_100183528 Ga0307409_1001835282 227
591 3300031995 Ga0307409_100203812 Ga0307409_1002038122 227
592 3300031995 Ga0307409_100311378 Ga0307409_1003113782 227
593 3300031995 Ga0307409_100429147 Ga0307409_1004291472 227
594 3300031995 Ga0307409_100644293 Ga0307409_1006442932 227
595 3300031995 Ga0307409_100822869 Ga0307409_1008228692 227
596 3300032002 Ga0307416_100043317 Ga0307416_1000433172 227
597 3300032002 Ga0307416_100181893 Ga0307416_1001818932 227
598 3300032002 Ga0307416_100311078 Ga0307416_1003110782 227
599 3300032002 Ga0307416_100346287 Ga0307416_1003462872 227
600 3300032002 Ga0307416_100535007 Ga0307416_1005350072 227
601 3300032004 Ga0307414_10007424 Ga0307414_100074244 227
602 3300032004 Ga0307414_10074392 Ga0307414_100743923 227
603 3300032004 Ga0307414_10077437 Ga0307414_100774373 227
604 3300032004 Ga0307414_10112369 Ga0307414_101123691 227
605 3300032004 Ga0307414_10144491 Ga0307414_101444913 227
606 3300032004 Ga0307414_10174172 Ga0307414_101741722 227
607 3300032004 Ga0307414_10238242 Ga0307414_102382422 227
608 3300032004 Ga0307414_10766675 Ga0307414_107666752 227
609 3300032005 Ga0307411_10000518 Ga0307411_100005182 227
610 3300032005 Ga0307411_10005481 Ga0307411_100054815 227
611 3300032005 Ga0307411_10024776 Ga0307411_100247763 227
612 3300032005 Ga0307411_10033608 Ga0307411_100336085 227
613 3300032005 Ga0307411_10058003 Ga0307411_100580032 227
614 3300032005 Ga0307411_10086504 Ga0307411_100865042 227
615 3300032005 Ga0307411_10100317 Ga0307411_101003173 227
616 3300032005 Ga0307411_10111180 Ga0307411_101111802 227
617 3300032126 Ga0307415_100000171 Ga0307415_10000017114 227
618 3300032126 Ga0307415_100091983 Ga0307415_1000919834 227
619 3300032126 Ga0307415_100306690 Ga0307415_1003066902 227
620 3300037312 Ga0395899_0075048 Ga0395899_0075048_1496_2194 227
621 3300037312 Ga0395899_0137130 Ga0395899_0137130_256_954 227
622 3300037418 Ga0395900_0010815 Ga0395900_0010815_4942_5640 227
623 3300037418 Ga0395900_0014984 Ga0395900_0014984_2260_2958 227
624 3300037418 Ga0395900_0077876 Ga0395900_0077876_2134_2832 227
625 3300037418 Ga0395900_0481325 Ga0395900_0481325_11_709 227
626 3300037466 Ga0395898_0031474 Ga0395898_0031474_1516_2214 227
627 3300037466 Ga0395898_0037775 Ga0395898_0037775_1373_2071 227
628 3300037471 Ga0395905_0002796 Ga0395905_0002796_18135_18833 227
629 3300037471 Ga0395905_0015679 Ga0395905_0015679_4370_5068 227
630 3300037471 Ga0395905_0026630 Ga0395905_0026630_3607_4305 227
631 3300038443 Ga0395901_0000131 Ga0395901_0000131_42_740 227
632 3300038443 Ga0395901_0024121 Ga0395901_0024121_3281_3979 227
633 3300038443 Ga0395901_0062053 Ga0395901_0062053_2679_3377 227
634 3300038443 Ga0395901_0202297 Ga0395901_0202297_139_837 227
635 3300038443 Ga0395901_0389393 Ga0395901_0389393_483_1181 227
636 3300042122 Ga0450920_007031 Ga0450920_007031_917_1618 227
637 3300042439 Ga0439464_0000427 Ga0439464_0000427_1998_2696 227
638 3300044684 Ga0466966_0033906 Ga0466966_0033906_1909_2607 227
639 3300044684 Ga0466966_0096905 Ga0466966_0096905_529_1227 227
640 3300044693 Ga0466961_0082147 Ga0466961_0082147_1267_1965 227
641 3300044694 Ga0466963_0036592 Ga0466963_0036592_545_1243 227
642 3300045976 Ga0466967_0018938 Ga0466967_0018938_735_1433 227
643 3300046537 Ga0495598_0181488 Ga0495598_0181488_23_721 227
644 3300046616 Ga0495668_0002012 Ga0495668_0002012_13021_13719 227
645 3300046684 Ga0495669_0115754 Ga0495669_0115754_25_723 227
646 3300046691 Ga0495670_0089531 Ga0495670_0089531_718_1416 227
647 3300048903 Ga0496100_0544496 Ga0496100_0544496_116_814 227
648 3300048904 Ga0496101_0041166 Ga0496101_0041166_253_951 227
649 3300048904 Ga0496101_0136335 Ga0496101_0136335_264_962 227
650 3300048909 Ga0496106_0386033 Ga0496106_0386033_139_837 227
651 3300048910 Ga0496107_0010812 Ga0496107_0010812_924_1622 227
652 3300048911 Ga0496108_0243655 Ga0496108_0243655_31_729 227
653 3300048911 Ga0496108_0291198 Ga0496108_0291198_151_849 227
654 3300048912 Ga0496109_0037244 Ga0496109_0037244_237_935 227
655 3300048912 Ga0496109_0154762 Ga0496109_0154762_396_1094 227
656 3300048913 Ga0496110_0004899 Ga0496110_0004899_7044_7742 227
657 3300048913 Ga0496110_0010491 Ga0496110_0010491_3239_3937 227
658 3300048914 Ga0496111_0001883 Ga0496111_0001883_10169_10867 227
659 3300048914 Ga0496111_0049638 Ga0496111_0049638_116_814 227
660 3300048915 Ga0496112_0565932 Ga0496112_0565932_274_972 227
661 3300048916 Ga0496113_0002116 Ga0496113_0002116_9927_10625 227
662 3300048917 Ga0496114_0262924 Ga0496114_0262924_573_1271 227
663 3300048918 Ga0496115_0008793 Ga0496115_0008793_3773_4471 227
664 3300049515 Ga0501292_012493 Ga0501292_012493_555_1274 227
665 3300049521 Ga0501298_007399 Ga0501298_007399_23_742 227
666 3300049586 Ga0501070_0166768 Ga0501070_0166768_804_1502 227
667 3300049587 Ga0501071_0071606 Ga0501071_0071606_418_1116 227
668 3300049669 Ga0501235_017511 Ga0501235_017511_189_908 227
669 3300049675 Ga0501243_009778 Ga0501243_009778_627_1346 227
670 3300049679 Ga0501249_004088 Ga0501249_004088_1135_1854 227
671 3300049705 Ga0501225_0042682 Ga0501225_0042682_74_793 227
672 3300049742 Ga0501080_0371850 Ga0501080_0371850_322_1020 227
673 3300049760 Ga0501263_002294 Ga0501263_002294_237_956 227
674 3300049763 Ga0501266_011983 Ga0501266_011983_52_771 227
675 3300049765 Ga0501268_006179 Ga0501268_006179_220_939 227
676 3300049765 Ga0501268_010692 Ga0501268_010692_292_990 227
677 3300049769 Ga0501272_008243 Ga0501272_008243_424_1122 227
678 3300049770 Ga0501273_018358 Ga0501273_018358_155_874 227
679 3300053134 Ga0500658_0000032 Ga0500658_0000032_22120_22818 227
680 3300061719 Ga0466962_0077696 Ga0466962_0077696_824_1522 227
681 3300032002 Ga0307416_100169717 Ga0307416_1001697172 228
682 iso_pu_bacteria 2582581305 2585261820 228
683 3300005355 Ga0070671_100011633 Ga0070671_1000116334 229
684 3300005548 Ga0070665_100124648 Ga0070665_1001246482 229
685 3300005617 Ga0068859_100010321 Ga0068859_10001032110 229
686 3300005841 Ga0068863_100000027 Ga0068863_10000002741 229
687 3300005844 Ga0068862_100011857 Ga0068862_10001185711 229
688 3300006931 Ga0097620_100010321 Ga0097620_10001032110 229
689 3300009553 Ga0105249_10001466 Ga0105249_100014668 229
690 3300025931 Ga0207644_10000111 Ga0207644_1000011144 229
691 3300025961 Ga0207712_10008274 Ga0207712_100082748 229
692 3300025972 Ga0207668_10000054 Ga0207668_1000005460 229
693 3300026088 Ga0207641_10000045 Ga0207641_10000045134 229
694 3300028379 Ga0268266_10100141 Ga0268266_101001412 229
695 3300028380 Ga0268265_10013973 Ga0268265_100139733 229
696 3300028381 Ga0268264_10002547 Ga0268264_100025479 229
697 3300046520 Ga0495637_0073734 Ga0495637_0073734_655_1362 229
698 3300053087 Ga0500643_000096 Ga0500643_000096_12926_13633 229
699 3300053091 Ga0500647_0008473 Ga0500647_0008473_2055_2762 229
700 3300053125 Ga0500618_006614 Ga0500618_006614_2141_2848 229
701 3300053177 Ga0500636_0136298 Ga0500636_0136298_194_901 229
702 3300005327 Ga0070658_10076279 Ga0070658_100762794 230
703 3300005329 Ga0070683_100040449 Ga0070683_1000404493 230
704 3300005345 Ga0070692_10003068 Ga0070692_100030685 230
705 3300005366 Ga0070659_100090297 Ga0070659_1000902972 230
706 3300005455 Ga0070663_100006039 Ga0070663_1000060396 230
707 3300013102 Ga0157371_10208569 Ga0157371_102085691 230
708 3300025904 Ga0207647_10086117 Ga0207647_100861172 230
709 3300025909 Ga0207705_10313718 Ga0207705_103137182 230
710 3300025932 Ga0207690_10166930 Ga0207690_101669302 230
711 3300025944 Ga0207661_10007968 Ga0207661_100079686 230
712 3300026067 Ga0207678_10000746 Ga0207678_1000074620 230
713 3300037312 Ga0395899_0000129 Ga0395899_0000129_21297_21995 230
714 3300037418 Ga0395900_0000468 Ga0395900_0000468_40103_40801 230
715 3300037418 Ga0395900_0023328 Ga0395900_0023328_2837_3535 230
716 3300037466 Ga0395898_0018728 Ga0395898_0018728_2025_2723 230
717 3300037466 Ga0395898_0324907 Ga0395898_0324907_212_910 230
718 3300037471 Ga0395905_0051277 Ga0395905_0051277_1130_1828 230
719 3300037471 Ga0395905_0071242 Ga0395905_0071242_1492_2190 230
720 3300038443 Ga0395901_0000031 Ga0395901_0000031_215211_215909 230
721 3300038443 Ga0395901_0093494 Ga0395901_0093494_1978_2676 230
722 3300001904 JGI24736J21556_1000066 JGI24736J21556_100006618 231
723 3300001904 JGI24736J21556_1000114 JGI24736J21556_10001142 231
724 3300001915 JGI24741J21665_1003089 JGI24741J21665_10030895 231
725 3300001979 JGI24740J21852_10004210 JGI24740J21852_100042109 231
726 3300005329 Ga0070683_100010738 Ga0070683_1000107383 231
727 3300005339 Ga0070660_100005580 Ga0070660_10000558010 231
728 3300005344 Ga0070661_100013518 Ga0070661_1000135186 231
729 3300005435 Ga0070714_100020576 Ga0070714_1000205762 231
730 3300005539 Ga0068853_100157526 Ga0068853_1001575262 231
731 3300005577 Ga0068857_100073498 Ga0068857_1000734984 231
732 3300005578 Ga0068854_100003023 Ga0068854_1000030231 231
733 3300005578 Ga0068854_100025478 Ga0068854_1000254782 231
734 3300009093 Ga0105240_10012132 Ga0105240_1001213213 231
735 3300009093 Ga0105240_10105813 Ga0105240_101058132 231
736 3300009551 Ga0105238_10039780 Ga0105238_100397802 231
737 3300010375 Ga0105239_10195634 Ga0105239_101956342 231
738 3300013100 Ga0157373_10007297 Ga0157373_100072977 231
739 3300013102 Ga0157371_10099573 Ga0157371_100995732 231
740 3300013102 Ga0157371_10136844 Ga0157371_101368441 231
741 3300013105 Ga0157369_10000043 Ga0157369_1000004387 231
742 3300013105 Ga0157369_10164786 Ga0157369_101647863 231
743 3300013105 Ga0157369_10223324 Ga0157369_102233241 231
744 3300013105 Ga0157369_10726542 Ga0157369_107265422 231
745 3300013307 Ga0157372_10565954 Ga0157372_105659542 231
746 3300013307 Ga0157372_10565955 Ga0157372_105659552 231
747 3300025904 Ga0207647_10001558 Ga0207647_1000155821 231
748 3300025909 Ga0207705_10000033 Ga0207705_10000033152 231
749 3300025913 Ga0207695_10004868 Ga0207695_1000486818 231
750 3300025913 Ga0207695_10015000 Ga0207695_1001500010 231
751 3300025919 Ga0207657_10071420 Ga0207657_100714203 231
752 3300025920 Ga0207649_10000737 Ga0207649_1000073718 231
753 3300025920 Ga0207649_10344647 Ga0207649_103446472 231
754 3300025944 Ga0207661_10034436 Ga0207661_100344361 231
755 3300025949 Ga0207667_10103076 Ga0207667_101030764 231
756 3300025949 Ga0207667_10259417 Ga0207667_102594172 231
757 3300025981 Ga0207640_10000473 Ga0207640_100004732 231
758 3300025981 Ga0207640_10116885 Ga0207640_101168852 231
759 3300026041 Ga0207639_10119521 Ga0207639_101195213 231
760 3300026067 Ga0207678_10019046 Ga0207678_100190469 231
761 3300026078 Ga0207702_10013935 Ga0207702_100139358 231
762 3300026078 Ga0207702_10712039 Ga0207702_107120391 231
763 3300026116 Ga0207674_10078211 Ga0207674_100782114 231
764 3300026142 Ga0207698_10058247 Ga0207698_100582474 231
765 3300031548 Ga0307408_100051378 Ga0307408_1000513784 231
766 3300031731 Ga0307405_10560111 Ga0307405_105601112 231
767 3300031824 Ga0307413_10156956 Ga0307413_101569563 231
768 3300031852 Ga0307410_10043909 Ga0307410_100439094 231
769 3300031903 Ga0307407_10061890 Ga0307407_100618902 231
770 3300031995 Ga0307409_100841948 Ga0307409_1008419482 231
771 3300032002 Ga0307416_100259842 Ga0307416_1002598422 231
772 3300032004 Ga0307414_10109184 Ga0307414_101091842 231
773 3300032005 Ga0307411_10257057 Ga0307411_102570572 231
774 3300037312 Ga0395899_0002708 Ga0395899_0002708_10820_11515 231
775 3300037312 Ga0395899_0014549 Ga0395899_0014549_3660_4355 231
776 3300037418 Ga0395900_0024082 Ga0395900_0024082_3055_3750 231
777 3300037418 Ga0395900_0078105 Ga0395900_0078105_1287_1988 231
778 3300037418 Ga0395900_0107872 Ga0395900_0107872_1072_1767 231
779 3300037466 Ga0395898_0026615 Ga0395898_0026615_3152_3847 231
780 3300037466 Ga0395898_0030537 Ga0395898_0030537_3119_3814 231
781 3300037466 Ga0395898_0147662 Ga0395898_0147662_1402_2097 231
782 3300037466 Ga0395898_0149228 Ga0395898_0149228_1524_2219 231
783 3300038443 Ga0395901_0066469 Ga0395901_0066469_1666_2361 231
784 3300038443 Ga0395901_0141388 Ga0395901_0141388_182_877 231
785 3300044684 Ga0466966_0000021 Ga0466966_0000021_95534_96229 231
786 3300044693 Ga0466961_0026586 Ga0466961_0026586_1665_2390 231
787 3300044706 Ga0466964_0034342 Ga0466964_0034342_741_1436 231
788 3300044719 Ga0466971_0013190 Ga0466971_0013190_188_913 231
789 3300044842 Ga0466957_0017966 Ga0466957_0017966_3248_3943 231
790 3300045049 Ga0466959_0108427 Ga0466959_0108427_152_847 231
791 3300045836 Ga0466958_0003833 Ga0466958_0003833_6897_7622 231
792 3300061719 Ga0466962_0202747 Ga0466962_0202747_141_941 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00929

RNase_T

Exonuclease

4

153

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j53-assembly1.cif.gz_A structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5 0.9582 3 168
2ido-assembly1.cif.gz_A structure of the e. coli pol iii epsilon-hot proofreading complex 0.9347 1 168
1j53-assembly1.cif.gz_A structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5 0.9101 3 168
2ido-assembly1.cif.gz_A structure of the e. coli pol iii epsilon-hot proofreading complex 0.9084 1 168
8h2f-assembly1.cif.gz_A crystal structure of dnaq domain in complex witn tmp of streptococcus thermophilus strain dgcc 7710 0.8997 2 169
ID Description Score Start End Superfamily
1j54A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9575 3 168 3.30.420.10
af_B0G161_292_467_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9544 2 166 3.30.420.10
af_Q2G1Z8_409_554_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.932 1 138 3.30.420.10
af_Q2FYH5_2_169_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9303 1 169 3.30.420.10
af_Q4E271_32_219_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.925 36 168 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A3B9EG13-F1-model_v4 DNA polymerase III subunit epsilon (EC 2.7.7.7) 0.9943 1 154 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004
AF-A0A3B8QYK5-F1-model_v4 DNA polymerase III subunit epsilon 0.9917 1 86 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004
AF-A0A455U836-F1-model_v4 Exonuclease domain-containing protein 0.9903 1 80 GO:0003676
GO:0005829
GO:0008408
GO:0016779
GO:0045004
AF-A0A3C1BQI7-F1-model_v4 DNA polymerase III subunit epsilon (EC 2.7.7.7) 0.9897 1 142 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004
AF-A0A4Q2LD84-F1-model_v4 deleted 0.9889 12 105

Feature Viewer

pLDDT pTM Quality
85.2 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map