F480901

General Info

Members Datasets Scaffolds Average Seq Length
789 330 789 253

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10009448|Ga0157371_100094482
Length 282
Sequence VGGKRRPEDQAGADVSAPEVRPAAAQTTNMTTVAKAVAWRSIHNFLTNPAFLVPALVFPLFFFVSFAGGLSAIENVPGFDFPTGYTAFQFVFVLLQSAAFGGVFTGFGIARDFETGFARRYLLAASNRSGIVAGYAIAALIRAFVTWTVLTTVALVAGMNIGGSGGEIVALYALAILVNVAATMWSAGVAMRVRSIQGGPLMQFPTFLILFLAPVYVPLTLLSGWIHAVASINPVTALLEAGRGFISGDPTVVVLAFAIAFALPLIFALWARSGLRRAEAAG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
175 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
176 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
180 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
181 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
270 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
271 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
295 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
307 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
320 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
321 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
322 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
323 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
324 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
325 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
326 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
327 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
328 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
329 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
330 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 12.55
Rhizosphere 83.27
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10040957 3300005327 Bacteria 3737
2 Ga0070658_10144314 3300005327 Bacteria 1990
3 Ga0070683_100000793 3300005329 Bacteria 23313
4 Ga0070683_100001714 3300005329 Bacteria 17052
5 Ga0070683_100013143 3300005329 Bacteria 7208
6 Ga0070683_100043303 3300005329 Bacteria 4149
7 Ga0070683_100108431 3300005329 Bacteria 2619
8 Ga0070670_100044615 3300005331 Bacteria 3812
9 Ga0070677_10000003 3300005333 Bacteria 81204
10 Ga0068869_100342532 3300005334 Bacteria 1217
11 Ga0070666_10003293 3300005335 Bacteria 9802
12 Ga0070666_10085528 3300005335 Bacteria 2160
13 Ga0070680_100065864 3300005336 Bacteria 2969
14 Ga0070680_100220226 3300005336 Bacteria 1602
15 Ga0070682_100000080 3300005337 Bacteria 85683
16 Ga0070682_100000102 3300005337 Bacteria 76457
17 Ga0070682_100172182 3300005337 Bacteria 1505
18 Ga0070682_100255499 3300005337 Bacteria 1265
19 Ga0068868_100000095 3300005338 Bacteria 54537
20 Ga0070660_100078256 3300005339 Bacteria 2593
21 Ga0070689_100072593 3300005340 Bacteria 2690
22 Ga0070689_100505377 3300005340 Unclassified 1036
23 Ga0070691_10000054 3300005341 Bacteria 32149
24 Ga0070691_10008984 3300005341 Bacteria 4572
25 Ga0070661_100000005 3300005344 Bacteria 220455
26 Ga0070668_100008119 3300005347 Bacteria 7797
27 Ga0070668_100148348 3300005347 Bacteria 1895
28 Ga0070675_100000058 3300005354 Bacteria 66874
29 Ga0070674_100000003 3300005356 Bacteria 258221
30 Ga0070674_100000020 3300005356 Bacteria 88217
31 Ga0070674_100023772 3300005356 Bacteria 3971
32 Ga0070673_100013844 3300005364 Bacteria 5598
33 Ga0070688_100000333 3300005365 Bacteria 24059
34 Ga0070688_100002793 3300005365 Bacteria 8872
35 Ga0070688_100396145 3300005365 Bacteria 1021
36 Ga0070688_100486515 3300005365 Bacteria 928
37 Ga0070667_100007958 3300005367 Bacteria 8790
38 Ga0070667_100223189 3300005367 Unclassified 1678
39 Ga0070714_100000243 3300005435 Bacteria 42598
40 Ga0070714_100199562 3300005435 Bacteria 1829
41 Ga0070713_100000138 3300005436 Bacteria 48026
42 Ga0070713_100015507 3300005436 Bacteria 5702
43 Ga0070713_100374734 3300005436 Bacteria 1325
44 Ga0070710_10017787 3300005437 Bacteria 3646
45 Ga0070710_10164320 3300005437 Bacteria 1379
46 Ga0070710_10245347 3300005437 Bacteria 1149
47 Ga0070711_100008345 3300005439 Bacteria 6342
48 Ga0070711_100043089 3300005439 Bacteria 3055
49 Ga0070711_100252527 3300005439 Bacteria 1384
50 Ga0070694_100034592 3300005444 Bacteria 3333
51 Ga0070708_100025820 3300005445 Bacteria 5023
52 Ga0070663_100085873 3300005455 Bacteria 2323
53 Ga0070678_100004162 3300005456 Bacteria 8159
54 Ga0070662_100000363 3300005457 Bacteria 27116
55 Ga0070681_10005901 3300005458 Bacteria 11857
56 Ga0070681_10034745 3300005458 Bacteria 5062
57 Ga0070681_10040325 3300005458 Bacteria 4678
58 Ga0070681_10084225 3300005458 Bacteria 3132
59 Ga0068867_100000179 3300005459 Bacteria 41694
60 Ga0070685_10000293 3300005466 Bacteria 31562
61 Ga0070706_100099695 3300005467 Bacteria 2699
62 Ga0070698_100008430 3300005471 Bacteria 11141
63 Ga0070699_100691064 3300005518 Unclassified 932
64 Ga0070679_100000537 3300005530 Bacteria 32232
65 Ga0070679_100048185 3300005530 Bacteria 4246
66 Ga0070679_100126520 3300005530 Bacteria 2538
67 Ga0070684_100003511 3300005535 Bacteria 11778
68 Ga0070684_100163543 3300005535 Bacteria 2020
69 Ga0070684_100223350 3300005535 Unclassified 1719
70 Ga0070684_100424822 3300005535 Bacteria 1227
71 Ga0070697_100114251 3300005536 Bacteria 2253
72 Ga0068853_100002080 3300005539 Bacteria 14840
73 Ga0068853_100483223 3300005539 Bacteria 1168
74 Ga0070672_100000004 3300005543 Bacteria 129970
75 Ga0070696_100084495 3300005546 Bacteria 2252
76 Ga0070696_100577520 3300005546 Bacteria 904
77 Ga0070693_100000833 3300005547 Bacteria 13687
78 Ga0070693_100016010 3300005547 Bacteria 3874
79 Ga0070693_100146483 3300005547 Unclassified 1492
80 Ga0070665_100000159 3300005548 Bacteria 122613
81 Ga0070665_100002822 3300005548 Bacteria 18813
82 Ga0070665_100219516 3300005548 Unclassified 1901
83 Ga0070665_100579522 3300005548 Bacteria 1135
84 Ga0070665_100685624 3300005548 Bacteria 1038
85 Ga0070665_100765282 3300005548 Unclassified 979
86 Ga0068855_100060814 3300005563 Bacteria 4415
87 Ga0068854_100006423 3300005578 Bacteria 7476
88 Ga0068854_100012863 3300005578 Bacteria 5482
89 Ga0068854_100324349 3300005578 Bacteria 1253
90 Ga0068854_100327648 3300005578 Bacteria 1247
91 Ga0068854_100589319 3300005578 Unclassified 948
92 Ga0068856_100018421 3300005614 Bacteria 6768
93 Ga0068856_100023907 3300005614 Bacteria 5944
94 Ga0068856_100074113 3300005614 Bacteria 3370
95 Ga0068856_100074564 3300005614 Bacteria 3360
96 Ga0068856_100395026 3300005614 Bacteria 1402
97 Ga0068852_100000012 3300005616 Bacteria 140734
98 Ga0068859_100808532 3300005617 Unclassified 1025
99 Ga0068864_100026224 3300005618 Bacteria 4914
100 Ga0068866_10000002 3300005718 Bacteria 394090
101 Ga0068866_10000019 3300005718 Bacteria 64778
102 Ga0068851_10002153 3300005834 Bacteria 8660
103 Ga0068870_10066166 3300005840 Bacteria 1957
104 Ga0068863_100000032 3300005841 Bacteria 172402
105 Ga0068858_100000049 3300005842 Bacteria 122693
106 Ga0068858_100006307 3300005842 Bacteria 11549
107 Ga0068858_100049480 3300005842 Bacteria 3893
108 Ga0068858_100239891 3300005842 Bacteria 1720
109 Ga0068862_100002825 3300005844 Bacteria 15226
110 Ga0081455_10009498 3300005937 Bacteria 9996
111 Ga0081538_10081463 3300005981 Bacteria 1721
112 Ga0081540_1000006 3300005983 Bacteria 208724
113 Ga0081539_10000473 3300005985 Bacteria 85174
114 Ga0081539_10002242 3300005985 Bacteria 28126
115 Ga0081539_10119888 3300005985 Bacteria 1309
116 Ga0070717_10075881 3300006028 Unclassified 2812
117 Ga0075363_100299345 3300006048 Bacteria 933
118 Ga0070715_10000012 3300006163 Bacteria 173731
119 Ga0070715_10064513 3300006163 Bacteria 1618
120 Ga0070715_10103001 3300006163 Bacteria 1335
121 Ga0070715_10228858 3300006163 Bacteria 960
122 Ga0070716_100146589 3300006173 Bacteria 1513
123 Ga0070712_100000777 3300006175 Bacteria 18846
124 Ga0070712_100100853 3300006175 Bacteria 2134
125 Ga0070712_100404597 3300006175 Bacteria 1128
126 Ga0075428_100021945 3300006844 Bacteria 7071
127 Ga0075430_100027536 3300006846 Bacteria 4828
128 Ga0075431_100036575 3300006847 Bacteria 5057
129 Ga0075431_100065779 3300006847 Bacteria 3743
130 Ga0075433_10027284 3300006852 Bacteria 4841
131 Ga0075433_10037865 3300006852 Bacteria 4162
132 Ga0075433_10075025 3300006852 Bacteria 2976
133 Ga0075433_10243789 3300006852 Bacteria 1595
134 Ga0075434_100007144 3300006871 Bacteria 10320
135 Ga0075434_100191835 3300006871 Bacteria 2064
136 Ga0075434_100370372 3300006871 Unclassified 1453
137 Ga0075436_100043703 3300006914 Bacteria 3089
138 Ga0075436_100047633 3300006914 Bacteria 2956
139 Ga0075436_100219177 3300006914 Bacteria 1350
140 Ga0075436_100448620 3300006914 Bacteria 939
141 Ga0097620_100808453 3300006931 Unclassified 1025
142 Ga0075435_100007136 3300007076 Bacteria 7939
143 Ga0075435_100037060 3300007076 Bacteria 3881
144 Ga0075435_100171504 3300007076 Bacteria 1830
145 Ga0075435_100447733 3300007076 Bacteria 1113
146 Ga0111539_10057025 3300009094 Bacteria 4640
147 Ga0111539_10242677 3300009094 Bacteria 2097
148 Ga0111539_10331616 3300009094 Bacteria 1771
149 Ga0105245_10000056 3300009098 Bacteria 124109
150 Ga0105245_10000290 3300009098 Bacteria 47991
151 Ga0105245_10001677 3300009098 Bacteria 20157
152 Ga0105245_10003691 3300009098 Bacteria 13667
153 Ga0105245_10359013 3300009098 Bacteria 1446
154 Ga0105247_10000202 3300009101 Bacteria 58345
155 Ga0105247_10109935 3300009101 Bacteria 1773
156 Ga0105247_10272342 3300009101 Bacteria 1165
157 Ga0105247_10409945 3300009101 Unclassified 968
158 Ga0114129_10001119 3300009147 Bacteria 35383
159 Ga0114129_10013663 3300009147 Bacteria 11570
160 Ga0114129_10029165 3300009147 Bacteria 7817
161 Ga0114129_10467965 3300009147 Unclassified 1651
162 Ga0105243_10285969 3300009148 Bacteria 1488
163 Ga0105243_10345353 3300009148 Bacteria 1365
164 Ga0105241_10081860 3300009174 Bacteria 2530
165 Ga0105241_10189587 3300009174 Bacteria 1711
166 Ga0105242_10016975 3300009176 Bacteria 5667
167 Ga0105242_10051900 3300009176 Bacteria 3344
168 Ga0105242_10068974 3300009176 Bacteria 2927
169 Ga0105248_10000032 3300009177 Bacteria 201114
170 Ga0105238_10670934 3300009551 Bacteria 1048
171 Ga0105249_10000073 3300009553 Bacteria 145660
172 Ga0105249_10020406 3300009553 Bacteria 5925
173 Ga0157371_10009448 3300013102 Bacteria 7674
174 Ga0157370_10005853 3300013104 Bacteria 13734
175 Ga0157370_10007615 3300013104 Bacteria 11762
176 Ga0157369_10000099 3300013105 Bacteria 120032
177 Ga0157369_10068684 3300013105 Bacteria 3807
178 Ga0157374_10571808 3300013296 Bacteria 1139
179 Ga0157378_10010497 3300013297 Bacteria 8091
180 Ga0157378_10016775 3300013297 Bacteria 6418
181 Ga0157378_10074162 3300013297 Bacteria 3061
182 Ga0157378_10461332 3300013297 Bacteria 1262
183 Ga0163162_10081431 3300013306 Bacteria 3308
184 Ga0157372_10365990 3300013307 Bacteria 1680
185 Ga0157375_10000707 3300013308 Bacteria 29426
186 Ga0157375_10539542 3300013308 Bacteria 1329
187 Ga0163163_10119806 3300014325 Bacteria 2665
188 Ga0157380_10000219 3300014326 Bacteria 34156
189 Ga0157380_10003655 3300014326 Bacteria 10579
190 Ga0157380_10052162 3300014326 Bacteria 3237
191 Ga0157379_10040899 3300014968 Bacteria 4138
192 Ga0157379_10346924 3300014968 Bacteria 1358
193 Ga0157376_10121124 3300014969 Bacteria 2319
194 Ga0157376_10643395 3300014969 Bacteria 1060
195 Ga0157376_10767140 3300014969 Unclassified 975
196 Ga0163161_10000058 3300017792 Bacteria 114035
197 Ga0163161_10014924 3300017792 Bacteria 5411
198 Ga0206356_10933897 3300020070 Unclassified 1875
199 Ga0206353_11051550 3300020082 Bacteria 1498
200 Ga0213876_10098728 3300021384 Unclassified 1548
201 Ga0213875_10000468 3300021388 Bacteria 34648
202 Ga0207656_10032149 3300025321 Bacteria 2178
203 Ga0207682_10000052 3300025893 Bacteria 49191
204 Ga0207692_10040358 3300025898 Bacteria 2303
205 Ga0207692_10052115 3300025898 Unclassified 2078
206 Ga0207642_10000001 3300025899 Bacteria 714030
207 Ga0207642_10000003 3300025899 Bacteria 650651
208 Ga0207642_10000004 3300025899 Bacteria 407822
209 Ga0207642_10000017 3300025899 Bacteria 64774
210 Ga0207710_10000369 3300025900 Bacteria 31539
211 Ga0207680_10002430 3300025903 Bacteria 8684
212 Ga0207680_10166999 3300025903 Bacteria 1480
213 Ga0207685_10112614 3300025905 Bacteria 1182
214 Ga0207705_10049419 3300025909 Bacteria 3027
215 Ga0207705_10094717 3300025909 Bacteria 2190
216 Ga0207654_10079660 3300025911 Bacteria 1968
217 Ga0207654_10121817 3300025911 Bacteria 1639
218 Ga0207707_10092802 3300025912 Bacteria 2637
219 Ga0207707_10122363 3300025912 Bacteria 2275
220 Ga0207695_10560577 3300025913 Bacteria 1024
221 Ga0207693_10008860 3300025915 Bacteria 8219
222 Ga0207693_10043531 3300025915 Bacteria 3532
223 Ga0207693_10053039 3300025915 Bacteria 3181
224 Ga0207693_10093503 3300025915 Bacteria 2357
225 Ga0207693_10245339 3300025915 Bacteria 1406
226 Ga0207663_10031736 3300025916 Bacteria 3130
227 Ga0207663_10099496 3300025916 Bacteria 1949
228 Ga0207660_10067787 3300025917 Bacteria 2586
229 Ga0207660_10123298 3300025917 Bacteria 1965
230 Ga0207660_10311908 3300025917 Bacteria 1254
231 Ga0207657_10082913 3300025919 Bacteria 2690
232 Ga0207649_10000005 3300025920 Bacteria 356179
233 Ga0207652_10000631 3300025921 Bacteria 34868
234 Ga0207646_10060981 3300025922 Bacteria 3367
235 Ga0207646_10315543 3300025922 Bacteria 1412
236 Ga0207650_10025386 3300025925 Bacteria 4221
237 Ga0207659_10000020 3300025926 Bacteria 151552
238 Ga0207687_10000007 3300025927 Bacteria 604185
239 Ga0207687_10000012 3300025927 Bacteria 370729
240 Ga0207687_10000646 3300025927 Bacteria 23464
241 Ga0207687_10000970 3300025927 Bacteria 19492
242 Ga0207687_10084136 3300025927 Bacteria 2305
243 Ga0207700_10000008 3300025928 Bacteria 341717
244 Ga0207700_10000016 3300025928 Bacteria 202434
245 Ga0207700_10086661 3300025928 Bacteria 2461
246 Ga0207700_10207811 3300025928 Unclassified 1653
247 Ga0207700_10397504 3300025928 Bacteria 1207
248 Ga0207664_10000013 3300025929 Bacteria 260716
249 Ga0207664_10110118 3300025929 Bacteria 2289
250 Ga0207664_10154503 3300025929 Bacteria 1952
251 Ga0207644_10123003 3300025931 Bacteria 1978
252 Ga0207690_10008415 3300025932 Bacteria 6126
253 Ga0207706_10000006 3300025933 Bacteria 216994
254 Ga0207686_10006424 3300025934 Bacteria 6327
255 Ga0207686_10024357 3300025934 Bacteria 3507
256 Ga0207670_10259273 3300025936 Unclassified 1347
257 Ga0207669_10000016 3300025937 Bacteria 124532
258 Ga0207669_10000036 3300025937 Bacteria 78568
259 Ga0207665_10020351 3300025939 Bacteria 4359
260 Ga0207665_10182274 3300025939 Bacteria 1521
261 Ga0207691_10000020 3300025940 Bacteria 133465
262 Ga0207711_10000020 3300025941 Bacteria 363325
263 Ga0207689_10264829 3300025942 Bacteria 1422
264 Ga0207661_10001238 3300025944 Bacteria 17056
265 Ga0207661_10001949 3300025944 Bacteria 14185
266 Ga0207661_10008416 3300025944 Bacteria 7373
267 Ga0207661_10030009 3300025944 Bacteria 4182
268 Ga0207661_10062095 3300025944 Bacteria 3022
269 Ga0207679_10025975 3300025945 Bacteria 4034
270 Ga0207667_10611451 3300025949 Unclassified 1098
271 Ga0207651_10008445 3300025960 Bacteria 5563
272 Ga0207651_10041883 3300025960 Bacteria 3044
273 Ga0207712_10000003 3300025961 Bacteria 615314
274 Ga0207712_10235415 3300025961 Bacteria 1472
275 Ga0207712_10331831 3300025961 Bacteria 1258
276 Ga0207668_10044746 3300025972 Bacteria 3014
277 Ga0207640_10000285 3300025981 Bacteria 33957
278 Ga0207640_10002518 3300025981 Bacteria 9823
279 Ga0207640_10168323 3300025981 Bacteria 1630
280 Ga0207677_10001435 3300026023 Bacteria 12669
281 Ga0207703_10000053 3300026035 Bacteria 143924
282 Ga0207703_10000067 3300026035 Bacteria 125623
283 Ga0207703_10073601 3300026035 Bacteria 2827
284 Ga0207703_10109546 3300026035 Bacteria 2354
285 Ga0207639_10001671 3300026041 Bacteria 14960
286 Ga0207678_10063204 3300026067 Bacteria 3181
287 Ga0207708_10514108 3300026075 Bacteria 1005
288 Ga0207702_10000016 3300026078 Bacteria 226633
289 Ga0207702_10003815 3300026078 Bacteria 13603
290 Ga0207702_10060671 3300026078 Bacteria 3224
291 Ga0207702_10192541 3300026078 Bacteria 1885
292 Ga0207641_10000071 3300026088 Bacteria 151812
293 Ga0207641_10008529 3300026088 Bacteria 8466
294 Ga0207648_10000228 3300026089 Bacteria 60032
295 Ga0207676_10194051 3300026095 Bacteria 1789
296 Ga0207674_10275630 3300026116 Bacteria 1630
297 Ga0207683_10006404 3300026121 Bacteria 10083
298 Ga0207683_10297110 3300026121 Bacteria 1477
299 Ga0207698_10000012 3300026142 Bacteria 260061
300 Ga0207428_10076863 3300027907 Bacteria 2614
301 Ga0207428_10181623 3300027907 Bacteria 1589
302 Ga0268266_10000023 3300028379 Bacteria 501899
303 Ga0268266_10000553 3300028379 Bacteria 52199
304 Ga0268266_10002681 3300028379 Bacteria 18711
305 Ga0268266_10513070 3300028379 Unclassified 1145
306 Ga0268265_10011815 3300028380 Bacteria 5903
307 Ga0268264_10007216 3300028381 Bacteria 9306
308 Ga0265338_10058061 3300028800 Bacteria 3419
309 Ga0307406_10536645 3300031901 Unclassified 955
310 Ga0307415_100000648 3300032126 Bacteria 15309
311 Ga0373926_0071554 3300035083 Bacteria 1275
312 Ga0373944_0016363 3300035089 Bacteria 2090
313 Ga0373945_0004604 3300035116 Bacteria 4390
314 Ga0373943_0000090 3300035170 Bacteria 33196
315 Ga0373943_0007558 3300035170 Bacteria 4881
316 Ga0373946_0007850 3300035171 Bacteria 3916
317 Ga0373946_0013315 3300035171 Bacteria 3091
318 Ga0373927_0074898 3300035695 Bacteria 2192
319 Ga0373947_0000266 3300035725 Bacteria 29609
320 Ga0373947_0001538 3300035725 Bacteria 14146
321 Ga0373925_0001866 3300037068 Bacteria 17533
322 Ga0373925_0215933 3300037068 Bacteria 1529
323 Ga0395899_0001477 3300037312 Bacteria 20007
324 Ga0395899_0107394 3300037312 Bacteria 2009
325 Ga0395900_0014343 3300037418 Bacteria 8091
326 Ga0395900_0186535 3300037418 Unclassified 2105
327 Ga0395900_0252312 3300037418 Bacteria 1765
328 Ga0395898_0019644 3300037466 Bacteria 6872
329 Ga0395898_0036814 3300037466 Bacteria 4856
330 Ga0395905_0020023 3300037471 Bacteria 6339
331 Ga0395905_0025788 3300037471 Bacteria 5542
332 Ga0395905_0186330 3300037471 Bacteria 1948
333 Ga0436364_0309695 3300037853 Bacteria 1589
334 Ga0436364_1031907 3300037853 Bacteria 102112
335 Ga0436364_1133006 3300037853 Bacteria 892
336 Ga0395901_0000856 3300038443 Bacteria 33489
337 Ga0395901_0011639 3300038443 Bacteria 8909
338 Ga0395901_0024834 3300038443 Bacteria 6151
339 Ga0395901_0153898 3300038443 Unclassified 2415
340 Ga0436365_0328253 3300039437 Unclassified 1843
341 Ga0436365_0329149 3300039437 Bacteria 12480
342 Ga0436362_0533856 3300039453 Unclassified 1238
343 Ga0451789_0027790 3300041443 Bacteria 2341
344 Ga0451791_1163314 3300041451 Bacteria 1404
345 Ga0451793_0300818 3300041452 Bacteria 2035
346 Ga0451807_2280868 3300041486 Bacteria 2010
347 Ga0451853_0384465 3300041512 Bacteria 6514
348 Ga0451853_1991254 3300041512 Unclassified 1239
349 Ga0451853_2081083 3300041512 Bacteria 1700
350 Ga0439431_0025850 3300041997 Bacteria 1436
351 Ga0439433_0006334 3300041999 Bacteria 2547
352 Ga0439462_0004636 3300042015 Bacteria 3362
353 Ga0439446_0000927 3300042156 Bacteria 6339
354 Ga0466966_0208199 3300044684 Unclassified 1182
355 Ga0466961_0338983 3300044693 Bacteria 916
356 Ga0466961_0350564 3300044693 Bacteria 898
357 Ga0466963_0000070 3300044694 Bacteria 35676
358 Ga0466963_0079187 3300044694 Bacteria 2223
359 Ga0466963_0207075 3300044694 Unclassified 1372
360 Ga0466964_0174965 3300044706 Bacteria 1014
361 Ga0466957_0003681 3300044842 Bacteria 8460
362 Ga0466960_0226618 3300044901 Bacteria 1030
363 Ga0466959_0252775 3300045049 Bacteria 1215
364 Ga0466958_0112295 3300045836 Bacteria 1701
365 Ga0466967_0000046 3300045976 Bacteria 43911
366 Ga0466967_0261967 3300045976 Bacteria 1654
367 Ga0466967_0738415 3300045976 Bacteria 976
368 Ga0495592_0000621 3300046454 Bacteria 24971
369 Ga0495592_0164449 3300046454 Unclassified 1524
370 Ga0495592_0213460 3300046454 Bacteria 1295
371 Ga0495603_0001473 3300046455 Bacteria 13710
372 Ga0495603_0003021 3300046455 Bacteria 9967
373 Ga0495603_0077607 3300046455 Bacteria 1948
374 Ga0495629_0002088 3300046459 Bacteria 15500
375 Ga0495629_0005520 3300046459 Bacteria 9437
376 Ga0495629_0007647 3300046459 Bacteria 7957
377 Ga0495629_0019746 3300046459 Bacteria 4810
378 Ga0495629_0088279 3300046459 Bacteria 2163
379 Ga0495629_0129808 3300046459 Bacteria 1755
380 Ga0495638_0009398 3300046460 Bacteria 6872
381 Ga0495641_0003321 3300046461 Bacteria 12113
382 Ga0495641_0005538 3300046461 Bacteria 8483
383 Ga0495641_0015104 3300046461 Bacteria 4144
384 Ga0495641_0082409 3300046461 Bacteria 1440
385 Ga0495651_0004887 3300046462 Bacteria 10251
386 Ga0495651_0024849 3300046462 Bacteria 4661
387 Ga0495651_0192164 3300046462 Bacteria 1436
388 Ga0495653_0010741 3300046463 Bacteria 7498
389 Ga0495653_0032140 3300046463 Bacteria 4170
390 Ga0495653_0099929 3300046463 Bacteria 2104
391 Ga0495580_0022051 3300046472 Bacteria 4693
392 Ga0495582_0000005 3300046473 Bacteria 156170
393 Ga0495582_0000801 3300046473 Bacteria 17458
394 Ga0495582_0037719 3300046473 Bacteria 2658
395 Ga0495582_0113618 3300046473 Bacteria 1522
396 Ga0495582_0116493 3300046473 Bacteria 1503
397 Ga0495639_0002081 3300046475 Bacteria 8857
398 Ga0495639_0058412 3300046475 Bacteria 1764
399 Ga0495639_0138624 3300046475 Bacteria 1168
400 Ga0495662_0000022 3300046476 Bacteria 54342
401 Ga0495662_0000984 3300046476 Bacteria 13942
402 Ga0495664_0000012 3300046477 Bacteria 226118
403 Ga0495664_0052360 3300046477 Bacteria 2425
404 Ga0495584_0163949 3300046491 Bacteria 1130
405 Ga0495584_0225562 3300046491 Bacteria 952
406 Ga0495594_0000013 3300046499 Bacteria 103201
407 Ga0495594_0000157 3300046499 Bacteria 32522
408 Ga0495594_0027397 3300046499 Bacteria 3071
409 Ga0495606_0000211 3300046507 Bacteria 103386
410 Ga0495608_0000031 3300046511 Bacteria 145255
411 Ga0495608_0000406 3300046511 Bacteria 30178
412 Ga0495608_0010782 3300046511 Bacteria 6370
413 Ga0495608_0019149 3300046511 Bacteria 4717
414 Ga0495608_0107463 3300046511 Bacteria 1795
415 Ga0495608_0265658 3300046511 Unclassified 1067
416 Ga0495618_0000068 3300046514 Bacteria 74614
417 Ga0495620_0000315 3300046515 Bacteria 34463
418 Ga0495628_0000323 3300046516 Bacteria 43212
419 Ga0495628_0036648 3300046516 Bacteria 3935
420 Ga0495628_0039578 3300046516 Bacteria 3770
421 Ga0495628_0069964 3300046516 Bacteria 2736
422 Ga0495628_0073094 3300046516 Bacteria 2672
423 Ga0495628_0172280 3300046516 Bacteria 1641
424 Ga0495628_0188052 3300046516 Bacteria 1560
425 Ga0495628_0247640 3300046516 Bacteria 1331
426 Ga0495630_0000018 3300046517 Bacteria 186064
427 Ga0495630_0005899 3300046517 Bacteria 8659
428 Ga0495630_0020993 3300046517 Bacteria 4821
429 Ga0495630_0064242 3300046517 Bacteria 2757
430 Ga0495630_0318177 3300046517 Bacteria 1189
431 Ga0495644_0000954 3300046523 Bacteria 11954
432 Ga0495666_0016257 3300046526 Bacteria 3706
433 Ga0495666_0047579 3300046526 Bacteria 2066
434 Ga0495652_0000003 3300046529 Bacteria 597094
435 Ga0495652_0147980 3300046529 Bacteria 1838
436 Ga0495652_0168788 3300046529 Bacteria 1691
437 Ga0495652_0317936 3300046529 Bacteria 1126
438 Ga0495665_0000215 3300046531 Bacteria 29257
439 Ga0495640_0001520 3300046533 Bacteria 18268
440 Ga0495640_0047817 3300046533 Bacteria 2959
441 Ga0495640_0114688 3300046533 Bacteria 1756
442 Ga0495640_0121419 3300046533 Bacteria 1698
443 Ga0495586_0000527 3300046535 Bacteria 22292
444 Ga0495586_0031050 3300046535 Bacteria 2860
445 Ga0495587_0001970 3300046536 Bacteria 13697
446 Ga0495587_0054503 3300046536 Bacteria 2356
447 Ga0495587_0208484 3300046536 Bacteria 1104
448 Ga0495587_0265446 3300046536 Bacteria 964
449 Ga0495621_0002083 3300046539 Bacteria 5297
450 Ga0495645_0061651 3300046543 Bacteria 2717
451 Ga0495645_0205758 3300046543 Bacteria 1332
452 Ga0495622_0000014 3300046557 Bacteria 182142
453 Ga0495667_0004189 3300046559 Bacteria 9713
454 Ga0495667_0064213 3300046559 Bacteria 2401
455 Ga0495667_0082143 3300046559 Bacteria 2094
456 Ga0495656_0078619 3300046615 Bacteria 1483
457 Ga0495668_0031957 3300046616 Bacteria 2964
458 Ga0495634_0000024 3300046642 Bacteria 116230
459 Ga0495634_0026899 3300046642 Bacteria 4010
460 Ga0495625_0000029 3300046660 Bacteria 244646
461 Ga0495625_0257297 3300046660 Unclassified 1131
462 Ga0495635_0000009 3300046663 Bacteria 259024
463 Ga0495635_0037192 3300046663 Bacteria 3370
464 Ga0495635_0076575 3300046663 Bacteria 2292
465 Ga0495588_0000198 3300046674 Bacteria 60956
466 Ga0495588_0010582 3300046674 Bacteria 4296
467 Ga0495588_0020730 3300046674 Bacteria 3235
468 Ga0495657_0000024 3300046675 Bacteria 145255
469 Ga0495657_0004915 3300046675 Bacteria 10635
470 Ga0495657_0079758 3300046675 Bacteria 2119
471 Ga0495657_0181127 3300046675 Unclassified 1293
472 Ga0495657_0213593 3300046675 Unclassified 1172
473 Ga0495599_0031412 3300046678 Bacteria 3333
474 Ga0495599_0193580 3300046678 Bacteria 1250
475 Ga0495623_0109015 3300046679 Unclassified 1680
476 Ga0495646_0021230 3300046680 Bacteria 4105
477 Ga0495647_0000037 3300046681 Bacteria 42482
478 Ga0495647_0000293 3300046681 Bacteria 13969
479 Ga0495647_0002559 3300046681 Bacteria 5763
480 Ga0495647_0004495 3300046681 Bacteria 4534
481 Ga0495647_0026359 3300046681 Bacteria 2129
482 Ga0495658_0000019 3300046683 Bacteria 91606
483 Ga0495658_0001056 3300046683 Bacteria 14543
484 Ga0495658_0002471 3300046683 Bacteria 9310
485 Ga0495658_0228514 3300046683 Bacteria 1166
486 Ga0495669_0000562 3300046684 Bacteria 16446
487 Ga0495613_0000249 3300046689 Bacteria 50975
488 Ga0495613_0000309 3300046689 Bacteria 44163
489 Ga0495613_0003963 3300046689 Bacteria 11089
490 Ga0495613_0057044 3300046689 Bacteria 2867
491 Ga0495613_0318942 3300046689 Bacteria 1073
492 Ga0495624_0000028 3300046690 Bacteria 93474
493 Ga0495624_0012694 3300046690 Bacteria 5754
494 Ga0495624_0066552 3300046690 Bacteria 2249
495 Ga0495670_0017148 3300046691 Bacteria 3563
496 Ga0495670_0122393 3300046691 Bacteria 1352
497 Ga0495649_0015920 3300046694 Bacteria 4271
498 Ga0495600_0003314 3300046809 Bacteria 9451
499 Ga0495600_0010047 3300046809 Bacteria 5867
500 Ga0495600_0041968 3300046809 Bacteria 2982
501 Ga0495600_0043498 3300046809 Bacteria 2929
502 Ga0495581_0038723 3300047315 Bacteria 2759
503 Ga0495581_0069066 3300047315 Bacteria 2043
504 Ga0495581_0222299 3300047315 Bacteria 1104
505 Ga0495604_0000056 3300047317 Bacteria 100110
506 Ga0495604_0000190 3300047317 Bacteria 55090
507 Ga0495604_0003466 3300047317 Bacteria 12570
508 Ga0495604_0006459 3300047317 Bacteria 9300
509 Ga0495604_0049521 3300047317 Bacteria 3264
510 Ga0495604_0087982 3300047317 Bacteria 2312
511 Ga0495674_0000042 3300047319 Bacteria 94820
512 Ga0495674_0007533 3300047319 Bacteria 10396
513 Ga0495674_0034205 3300047319 Bacteria 4596
514 Ga0495674_0124032 3300047319 Bacteria 2180
515 Ga0495674_0137328 3300047319 Bacteria 2056
516 Ga0495676_0000646 3300047321 Bacteria 28924
517 Ga0495676_0001001 3300047321 Bacteria 23792
518 Ga0495676_0005236 3300047321 Bacteria 11864
519 Ga0495676_0014558 3300047321 Bacteria 7037
520 Ga0495676_0038393 3300047321 Bacteria 3977
521 Ga0495676_0138941 3300047321 Bacteria 1743
522 Ga0495680_0000023 3300047322 Bacteria 116444
523 Ga0495680_0000421 3300047322 Bacteria 47432
524 Ga0495680_0003583 3300047322 Bacteria 15204
525 Ga0495680_0005597 3300047322 Bacteria 11781
526 Ga0495680_0013355 3300047322 Bacteria 7170
527 Ga0495680_0061884 3300047322 Bacteria 2878
528 Ga0495675_0000209 3300047444 Bacteria 42691
529 Ga0495685_019250 3300047447 Bacteria 2345
530 Ga0495673_0029664 3300047469 Bacteria 2579
531 Ga0495684_0006596 3300047471 Bacteria 9002
532 Ga0495684_0010019 3300047471 Bacteria 7327
533 Ga0495593_0001317 3300047673 Bacteria 14550
534 Ga0495593_0053085 3300047673 Bacteria 2140
535 Ga0495602_0000228 3300048088 Bacteria 52649
536 Ga0495602_0169060 3300048088 Bacteria 1698
537 Ga0495602_0178666 3300048088 Unclassified 1640
538 Ga0495614_0004961 3300048089 Bacteria 6006
539 Ga0496100_0000038 3300048903 Bacteria 94110
540 Ga0496100_0000116 3300048903 Bacteria 45781
541 Ga0496100_0010105 3300048903 Bacteria 5332
542 Ga0496100_0041580 3300048903 Bacteria 2931
543 Ga0496100_0161150 3300048903 Bacteria 1608
544 Ga0496101_0000003 3300048904 Bacteria 406565
545 Ga0496101_0000010 3300048904 Bacteria 281990
546 Ga0496101_0008537 3300048904 Bacteria 6696
547 Ga0496101_0008544 3300048904 Bacteria 6691
548 Ga0496101_0346868 3300048904 Bacteria 1166
549 Ga0496102_0000027 3300048905 Bacteria 225466
550 Ga0496102_0027850 3300048905 Bacteria 5047
551 Ga0496102_0051948 3300048905 Bacteria 3734
552 Ga0496102_0058954 3300048905 Bacteria 3509
553 Ga0496102_0077064 3300048905 Bacteria 3068
554 Ga0496102_0130941 3300048905 Bacteria 2348
555 Ga0496102_0136102 3300048905 Bacteria 2302
556 Ga0496102_0177626 3300048905 Unclassified 2005
557 Ga0496103_0000155 3300048906 Bacteria 72091
558 Ga0496103_0021878 3300048906 Bacteria 3848
559 Ga0496103_0036541 3300048906 Bacteria 3008
560 Ga0496103_0129794 3300048906 Unclassified 1609
561 Ga0496103_0205169 3300048906 Bacteria 1268
562 Ga0496103_0252865 3300048906 Bacteria 1134
563 Ga0496104_0000002 3300048907 Bacteria 686017
564 Ga0496104_0000003 3300048907 Bacteria 669219
565 Ga0496104_0000576 3300048907 Bacteria 31360
566 Ga0496104_0001562 3300048907 Bacteria 19718
567 Ga0496104_0007540 3300048907 Bacteria 9621
568 Ga0496104_0017150 3300048907 Bacteria 6588
569 Ga0496104_0020399 3300048907 Bacteria 6074
570 Ga0496104_0061986 3300048907 Bacteria 3545
571 Ga0496104_0310719 3300048907 Bacteria 1489
572 Ga0496105_0000001 3300048908 Bacteria 1328178
573 Ga0496105_0000008 3300048908 Bacteria 335652
574 Ga0496105_0000313 3300048908 Bacteria 31795
575 Ga0496105_0001400 3300048908 Bacteria 16942
576 Ga0496105_0008480 3300048908 Bacteria 7986
577 Ga0496105_0009052 3300048908 Bacteria 7768
578 Ga0496106_0000013 3300048909 Bacteria 202263
579 Ga0496106_0000018 3300048909 Bacteria 175028
580 Ga0496106_0000177 3300048909 Bacteria 45808
581 Ga0496106_0011021 3300048909 Bacteria 6683
582 Ga0496106_0062443 3300048909 Bacteria 2828
583 Ga0496107_0000032 3300048910 Bacteria 99848
584 Ga0496107_0000081 3300048910 Bacteria 45824
585 Ga0496107_0120084 3300048910 Bacteria 1936
586 Ga0496107_0378038 3300048910 Unclassified 1054
587 Ga0496108_0000002 3300048911 Bacteria 700890
588 Ga0496108_0000045 3300048911 Bacteria 137416
589 Ga0496108_0000631 3300048911 Bacteria 27478
590 Ga0496108_0008008 3300048911 Bacteria 8574
591 Ga0496108_0017482 3300048911 Bacteria 5867
592 Ga0496108_0112187 3300048911 Bacteria 2332
593 Ga0496109_0000001 3300048912 Bacteria 700852
594 Ga0496109_0000028 3300048912 Bacteria 168138
595 Ga0496109_0000032 3300048912 Bacteria 162984
596 Ga0496109_0000085 3300048912 Bacteria 95437
597 Ga0496109_0001462 3300048912 Bacteria 19603
598 Ga0496109_0001613 3300048912 Bacteria 18839
599 Ga0496109_0125780 3300048912 Bacteria 2390
600 Ga0496109_0228633 3300048912 Bacteria 1750
601 Ga0496109_0302392 3300048912 Bacteria 1508
602 Ga0496109_0327012 3300048912 Bacteria 1447
603 Ga0496110_0000033 3300048913 Bacteria 65539
604 Ga0496110_0001879 3300048913 Bacteria 15501
605 Ga0496110_0017994 3300048913 Bacteria 5919
606 Ga0496110_0024705 3300048913 Bacteria 5124
607 Ga0496110_0126042 3300048913 Bacteria 2310
608 Ga0496110_0129358 3300048913 Bacteria 2279
609 Ga0496111_0000560 3300048914 Bacteria 19358
610 Ga0496111_0001844 3300048914 Bacteria 12488
611 Ga0496111_0005648 3300048914 Bacteria 8051
612 Ga0496111_0125039 3300048914 Bacteria 1901
613 Ga0496112_0000002 3300048915 Bacteria 782039
614 Ga0496112_0001813 3300048915 Bacteria 16810
615 Ga0496112_0016767 3300048915 Bacteria 6870
616 Ga0496112_0017217 3300048915 Bacteria 6785
617 Ga0496112_0026222 3300048915 Bacteria 5605
618 Ga0496112_0051598 3300048915 Bacteria 4034
619 Ga0496113_0000007 3300048916 Bacteria 95884
620 Ga0496113_0000240 3300048916 Bacteria 25763
621 Ga0496113_0002837 3300048916 Bacteria 10193
622 Ga0496113_0024435 3300048916 Bacteria 4295
623 Ga0496113_0161716 3300048916 Unclassified 1770
624 Ga0496113_0290973 3300048916 Bacteria 1307
625 Ga0496114_0009484 3300048917 Bacteria 7727
626 Ga0496114_0009498 3300048917 Bacteria 7719
627 Ga0496114_0490237 3300048917 Bacteria 1087
628 Ga0496114_0587247 3300048917 Unclassified 983
629 Ga0496115_0000020 3300048918 Bacteria 171995
630 Ga0496115_0005222 3300048918 Bacteria 9440
631 Ga0496115_0006918 3300048918 Bacteria 8332
632 Ga0496115_0008785 3300048918 Bacteria 7489
633 Ga0496115_0105769 3300048918 Bacteria 2310
634 Ga0496116_0000780 3300048919 Bacteria 40473
635 Ga0496117_0015033 3300048920 Bacteria 6631
636 Ga0496118_0000174 3300048921 Bacteria 115950
637 Ga0496118_0088493 3300048921 Bacteria 2142
638 Ga0496119_0004215 3300048922 Bacteria 14439
639 Ga0496119_0021993 3300048922 Bacteria 4585
640 Ga0496119_0026047 3300048922 Bacteria 4066
641 Ga0496120_0053857 3300048923 Bacteria 2284
642 Ga0496121_0005891 3300048924 Bacteria 15512
643 Ga0496121_0016585 3300048924 Bacteria 7593
644 Ga0496121_0082402 3300048924 Unclassified 2543
645 Ga0496121_0086517 3300048924 Bacteria 2463
646 Ga0496124_0115152 3300048927 Bacteria 2158
647 Ga0496124_0116434 3300048927 Bacteria 2143
648 Ga0496125_0013994 3300048928 Bacteria 7845
649 Ga0496125_0289604 3300048928 Unclassified 1009
650 Ga0496126_0029904 3300048929 Bacteria 5170
651 Ga0496126_0099256 3300048929 Bacteria 2550
652 Ga0501031_0000445 3300049568 Bacteria 23857
653 Ga0501031_0065331 3300049568 Bacteria 2370
654 Ga0501032_0000876 3300049569 Bacteria 24428
655 Ga0501033_0000294 3300049570 Bacteria 47989
656 Ga0501034_0065214 3300049571 Bacteria 3654
657 Ga0501036_0005562 3300049572 Bacteria 10223
658 Ga0501036_0135273 3300049572 Bacteria 2080
659 Ga0501037_0000378 3300049573 Bacteria 37014
660 Ga0501037_0005716 3300049573 Bacteria 9075
661 Ga0501038_0000087 3300049574 Bacteria 78741
662 Ga0501039_0001020 3300049575 Bacteria 20404
663 Ga0501039_0003991 3300049575 Bacteria 11095
664 Ga0501039_0107426 3300049575 Bacteria 2180
665 Ga0501040_0000007 3300049576 Bacteria 90368
666 Ga0501040_0000954 3300049576 Bacteria 18260
667 Ga0501040_0017844 3300049576 Bacteria 4711
668 Ga0501040_0058110 3300049576 Bacteria 2656
669 Ga0501040_0710312 3300049576 Bacteria 727
670 Ga0501041_0000005 3300049577 Bacteria 75426
671 Ga0501041_0001093 3300049577 Bacteria 14842
672 Ga0501041_0040749 3300049577 Bacteria 2820
673 Ga0501042_0003216 3300049578 Bacteria 10205
674 Ga0501042_0003964 3300049578 Bacteria 9370
675 Ga0501043_0000998 3300049579 Bacteria 24892
676 Ga0501043_0093174 3300049579 Bacteria 2368
677 Ga0501043_0371369 3300049579 Bacteria 1084
678 Ga0501046_0001278 3300049580 Bacteria 24362
679 Ga0501046_0028136 3300049580 Bacteria 4580
680 Ga0501046_0053780 3300049580 Bacteria 3169
681 Ga0501047_0000592 3300049581 Bacteria 38584
682 Ga0501047_0009620 3300049581 Bacteria 9141
683 Ga0501048_0000018 3300049582 Bacteria 72234
684 Ga0501048_0001926 3300049582 Bacteria 15771
685 Ga0501048_0071099 3300049582 Bacteria 2457
686 Ga0501048_0184813 3300049582 Bacteria 1477
687 Ga0501067_0009559 3300049583 Bacteria 5372
688 Ga0501068_0000134 3300049584 Bacteria 33588
689 Ga0501068_0011873 3300049584 Bacteria 4924
690 Ga0501068_0018498 3300049584 Bacteria 4035
691 Ga0501069_0000426 3300049585 Bacteria 19142
692 Ga0501069_0077986 3300049585 Bacteria 1863
693 Ga0501070_0004569 3300049586 Bacteria 11863
694 Ga0501070_0005855 3300049586 Bacteria 10483
695 Ga0501070_0009281 3300049586 Bacteria 8320
696 Ga0501071_0000005 3300049587 Bacteria 78747
697 Ga0501071_0001995 3300049587 Bacteria 12192
698 Ga0501071_0014797 3300049587 Bacteria 5343
699 Ga0501072_0000269 3300049588 Bacteria 37902
700 Ga0501072_0004831 3300049588 Bacteria 10263
701 Ga0501072_0092159 3300049588 Bacteria 2406
702 Ga0501072_0152356 3300049588 Bacteria 1843
703 Ga0501073_0001327 3300049589 Bacteria 18226
704 Ga0501073_0033451 3300049589 Bacteria 3660
705 Ga0501073_0178046 3300049589 Unclassified 1472
706 Ga0501074_0001138 3300049590 Bacteria 17415
707 Ga0501074_0044985 3300049590 Bacteria 3194
708 Ga0501074_0075006 3300049590 Bacteria 2428
709 Ga0501074_0261410 3300049590 Bacteria 1230
710 Ga0501075_0000009 3300049591 Bacteria 97052
711 Ga0501075_0000193 3300049591 Bacteria 31987
712 Ga0501075_0099979 3300049591 Bacteria 2203
713 Ga0501075_0114929 3300049591 Bacteria 2046
714 Ga0501076_0000028 3300049592 Bacteria 76828
715 Ga0501076_0001292 3300049592 Bacteria 16692
716 Ga0501076_0090419 3300049592 Bacteria 2462
717 Ga0501076_0187905 3300049592 Bacteria 1686
718 Ga0501077_0000006 3300049593 Bacteria 119936
719 Ga0501077_0001176 3300049593 Bacteria 15828
720 Ga0501077_0112680 3300049593 Bacteria 1724
721 Ga0501079_0000881 3300049741 Bacteria 20585
722 Ga0501079_0025921 3300049741 Bacteria 4497
723 Ga0501079_0171082 3300049741 Bacteria 1694
724 Ga0501079_0255159 3300049741 Bacteria 1371
725 Ga0501080_0000626 3300049742 Bacteria 28026
726 Ga0501080_0032292 3300049742 Bacteria 4881
727 Ga0501081_0000003 3300049743 Bacteria 97558
728 Ga0501081_0000159 3300049743 Bacteria 31036
729 Ga0501081_0145654 3300049743 Bacteria 1699
730 Ga0501083_0001673 3300049744 Bacteria 15132
731 Ga0501083_0008047 3300049744 Bacteria 7457
732 Ga0501083_0021756 3300049744 Bacteria 4454
733 Ga0501083_0372292 3300049744 Bacteria 929
734 Ga0501035_0000175 3300049822 Bacteria 78747
735 Ga0501044_0006303 3300049823 Bacteria 13113
736 Ga0501044_0065287 3300049823 Bacteria 3712
737 Ga0501045_0000009 3300049824 Bacteria 75255
738 Ga0501045_0002161 3300049824 Bacteria 13314
739 Ga0501045_0075570 3300049824 Bacteria 2481
740 Ga0501045_0653959 3300049824 Bacteria 777
741 nmdc:mga05p37_62567_c1 3300050507 Bacteria 4580
742 nmdc:mga05p37_8447_c1 3300050507 Bacteria 12180
743 nmdc:mga06r32_504525_c1 3300050510 Unclassified 1186
744 nmdc:mga08y16_287973_c1 3300050511 Bacteria 1694
745 nmdc:mga08y16_55458_c1 3300050511 Bacteria 4141
746 nmdc:mga08y16_567673_c1 3300050511 Bacteria 1147
747 nmdc:mga0n895_108290_c1 3300050512 Bacteria 2793
748 nmdc:mga0n895_468709_c1 3300050512 Bacteria 1271
749 nmdc:mga0n895_599926_c1 3300050512 Bacteria 1104
750 nmdc:mga0rr50_148702_c1 3300050513 Bacteria 1891
751 nmdc:mga0rr50_372931_c1 3300050513 Unclassified 1203
752 nmdc:mga0rr50_76361_c1 3300050513 Bacteria 2572
753 nmdc:mga08x19_198354_c1 3300050514 Bacteria 1375
754 nmdc:mga08x19_383629_c1 3300050514 Bacteria 984
755 nmdc:mga0a205_193953_c1 3300050515 Bacteria 1923
756 nmdc:mga0a205_54850_c1 3300050515 Bacteria 2996
757 nmdc:mga0a205_65733_c1 3300050515 Bacteria 3505
758 Ga0495601_0000086 3300053077 Bacteria 50421
759 Ga0495601_0000097 3300053077 Bacteria 48380
760 Ga0495601_0003248 3300053077 Bacteria 9287
761 Ga0495601_0008176 3300053077 Bacteria 6169
762 Ga0495601_0059411 3300053077 Bacteria 2424
763 Ga0495601_0139304 3300053077 Bacteria 1582
764 Ga0495612_0005844 3300053078 Bacteria 5082
765 Ga0495655_0001313 3300053083 Bacteria 3825
766 Ga0495595_0000014 3300053084 Bacteria 145255
767 Ga0495595_0000109 3300053084 Bacteria 37617
768 Ga0495595_0006454 3300053084 Bacteria 4785
769 Ga0495619_0000022 3300053085 Bacteria 184144
770 Ga0495619_0000024 3300053085 Bacteria 180821
771 Ga0495619_0000319 3300053085 Bacteria 33678
772 Ga0495619_0004791 3300053085 Bacteria 8599
773 Ga0495619_0069309 3300053085 Bacteria 2357
774 Ga0495619_0309197 3300053085 Bacteria 1095
775 Ga0500566_0005120 3300053094 Bacteria 7815
776 Ga0500641_0002398 3300053096 Bacteria 6646
777 Ga0500595_039603 3300053119 Bacteria 1524
778 Ga0500614_004265 3300053123 Bacteria 3034
779 Ga0501084_0001358 3300054114 Bacteria 19353
780 Ga0501084_0005874 3300054114 Bacteria 10101
781 Ga0501084_0065108 3300054114 Bacteria 3049
782 Ga0501084_0396990 3300054114 Bacteria 1165
783 Ga0501082_0000063 3300060353 Bacteria 76891
784 Ga0501082_0001009 3300060353 Bacteria 24886
785 Ga0501082_0237725 3300060353 Bacteria 1585
786 Ga0466962_0049559 3300061719 Bacteria 2007
787 Ga0530510_0000014 3300061734 Bacteria 106661
788 Ga0530510_0001148 3300061734 Bacteria 17568
789 Ga0530510_0079218 3300061734 Bacteria 2389

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100008119 Ga0070668_10000811910 214
2 3300005367 Ga0070667_100007958 Ga0070667_10000795810 214
3 3300005842 Ga0068858_100239891 Ga0068858_1002398912 214
4 3300005844 Ga0068862_100002825 Ga0068862_1000028251 214
5 3300009553 Ga0105249_10020406 Ga0105249_100204066 214
6 3300026035 Ga0207703_10109546 Ga0207703_101095463 214
7 3300028379 Ga0268266_10513070 Ga0268266_105130701 214
8 3300028380 Ga0268265_10011815 Ga0268265_100118158 214
9 3300026075 Ga0207708_10514108 Ga0207708_105141081 217
10 3300046680 Ga0495646_0021230 Ga0495646_0021230_1405_2196 218
11 3300047317 Ga0495604_0000190 Ga0495604_0000190_26152_26943 218
12 3300005341 Ga0070691_10000054 Ga0070691_100000548 219
13 3300048907 Ga0496104_0000002 Ga0496104_0000002_641324_642109 221
14 3300048908 Ga0496105_0000001 Ga0496105_0000001_686070_686855 221
15 3300048922 Ga0496119_0026047 Ga0496119_0026047_2641_3426 221
16 3300048923 Ga0496120_0053857 Ga0496120_0053857_428_1213 221
17 3300009551 Ga0105238_10670934 Ga0105238_106709341 222
18 3300005543 Ga0070672_100000004 Ga0070672_10000000482 223
19 3300005937 Ga0081455_10009498 Ga0081455_100094984 223
20 3300025940 Ga0207691_10000020 Ga0207691_1000002044 223
21 3300005548 Ga0070665_100765282 Ga0070665_1007652822 224
22 3300005617 Ga0068859_100808532 Ga0068859_1008085321 224
23 3300006931 Ga0097620_100808453 Ga0097620_1008084531 224
24 3300046473 Ga0495582_0116493 Ga0495582_0116493_243_1019 224
25 3300045976 Ga0466967_0261967 Ga0466967_0261967_10_780 225
26 3300005842 Ga0068858_100006307 Ga0068858_10000630714 227
27 3300026035 Ga0207703_10000053 Ga0207703_1000005314 227
28 3300005329 Ga0070683_100108431 Ga0070683_1001084312 228
29 3300005535 Ga0070684_100163543 Ga0070684_1001635431 228
30 3300014326 Ga0157380_10000219 Ga0157380_1000021922 228
31 3300025944 Ga0207661_10062095 Ga0207661_100620952 228
32 3300048912 Ga0496109_0327012 Ga0496109_0327012_237_1007 228
33 3300005548 Ga0070665_100002822 Ga0070665_10000282213 230
34 3300009176 Ga0105242_10016975 Ga0105242_100169756 230
35 3300013308 Ga0157375_10539542 Ga0157375_105395422 230
36 3300025934 Ga0207686_10024357 Ga0207686_100243574 230
37 3300046615 Ga0495656_0078619 Ga0495656_0078619_223_990 230
38 3300049576 Ga0501040_0710312 Ga0501040_0710312_16_714 232
39 3300049824 Ga0501045_0653959 Ga0501045_0653959_34_732 232
40 3300005548 Ga0070665_100579522 Ga0070665_1005795222 233
41 3300006846 Ga0075430_100027536 Ga0075430_1000275362 233
42 3300013306 Ga0163162_10081431 Ga0163162_100814313 234
43 3300050507 nmdc:mga05p37_8447_c1 nmdc:mga05p37_8447_c1_889_1647 235
44 3300005354 Ga0070675_100000058 Ga0070675_10000005848 236
45 3300005985 Ga0081539_10002242 Ga0081539_1000224218 236
46 3300006048 Ga0075363_100299345 Ga0075363_1002993452 236
47 3300006847 Ga0075431_100036575 Ga0075431_1000365752 236
48 3300006852 Ga0075433_10027284 Ga0075433_100272842 236
49 3300006871 Ga0075434_100007144 Ga0075434_1000071446 236
50 3300006914 Ga0075436_100043703 Ga0075436_1000437033 236
51 3300007076 Ga0075435_100007136 Ga0075435_1000071362 236
52 3300009147 Ga0114129_10001119 Ga0114129_1000111915 236
53 3300014968 Ga0157379_10346924 Ga0157379_103469241 236
54 3300025926 Ga0207659_10000020 Ga0207659_1000002058 236
55 3300046491 Ga0495584_0225562 Ga0495584_0225562_20_790 236
56 3300050512 nmdc:mga0n895_599926_c1 nmdc:mga0n895_599926_c1_270_1040 236
57 3300050513 nmdc:mga0rr50_76361_c1 nmdc:mga0rr50_76361_c1_935_1705 236
58 3300005981 Ga0081538_10081463 Ga0081538_100814631 237
59 3300025942 Ga0207689_10264829 Ga0207689_102648292 237
60 3300031901 Ga0307406_10536645 Ga0307406_105366451 237
61 3300037312 Ga0395899_0001477 Ga0395899_0001477_12238_13005 237
62 3300037418 Ga0395900_0014343 Ga0395900_0014343_3129_3896 237
63 3300037466 Ga0395898_0036814 Ga0395898_0036814_2960_3727 237
64 3300037471 Ga0395905_0020023 Ga0395905_0020023_1282_2049 237
65 3300038443 Ga0395901_0011639 Ga0395901_0011639_3301_4068 237
66 3300041443 Ga0451789_0027790 Ga0451789_0027790_258_1058 237
67 3300041452 Ga0451793_0300818 Ga0451793_0300818_173_973 237
68 3300041512 Ga0451853_2081083 Ga0451853_2081083_798_1571 237
69 3300046674 Ga0495588_0020730 Ga0495588_0020730_952_1722 237
70 3300048911 Ga0496108_0008008 Ga0496108_0008008_2519_3283 237
71 3300048912 Ga0496109_0125780 Ga0496109_0125780_567_1331 237
72 3300048916 Ga0496113_0002837 Ga0496113_0002837_4173_4937 237
73 3300005367 Ga0070667_100223189 Ga0070667_1002231891 238
74 3300046689 Ga0495613_0318942 Ga0495613_0318942_234_1001 238
75 3300048911 Ga0496108_0112187 Ga0496108_0112187_42_758 238
76 3300005334 Ga0068869_100342532 Ga0068869_1003425322 239
77 3300005336 Ga0070680_100065864 Ga0070680_1000658643 239
78 3300005337 Ga0070682_100172182 Ga0070682_1001721821 239
79 3300005365 Ga0070688_100486515 Ga0070688_1004865151 239
80 3300005458 Ga0070681_10040325 Ga0070681_100403252 239
81 3300005530 Ga0070679_100048185 Ga0070679_1000481852 239
82 3300005578 Ga0068854_100324349 Ga0068854_1003243492 239
83 3300005614 Ga0068856_100395026 Ga0068856_1003950262 239
84 3300006852 Ga0075433_10243789 Ga0075433_102437892 239
85 3300007076 Ga0075435_100447733 Ga0075435_1004477331 239
86 3300009094 Ga0111539_10331616 Ga0111539_103316162 239
87 3300009148 Ga0105243_10285969 Ga0105243_102859691 239
88 3300025911 Ga0207654_10079660 Ga0207654_100796602 239
89 3300025917 Ga0207660_10067787 Ga0207660_100677871 239
90 3300025927 Ga0207687_10084136 Ga0207687_100841362 239
91 3300027907 Ga0207428_10181623 Ga0207428_101816232 239
92 3300032126 Ga0307415_100000648 Ga0307415_10000064816 239
93 3300045976 Ga0466967_0000046 Ga0466967_0000046_12807_13598 239
94 3300048904 Ga0496101_0346868 Ga0496101_0346868_128_895 239
95 3300048905 Ga0496102_0051948 Ga0496102_0051948_1062_1838 239
96 3300048905 Ga0496102_0058954 Ga0496102_0058954_1276_2046 239
97 3300048906 Ga0496103_0205169 Ga0496103_0205169_134_904 239
98 3300048907 Ga0496104_0061986 Ga0496104_0061986_2540_3307 239
99 3300048908 Ga0496105_0008480 Ga0496105_0008480_7000_7767 239
100 3300048910 Ga0496107_0120084 Ga0496107_0120084_1062_1829 239
101 3300048910 Ga0496107_0378038 Ga0496107_0378038_13_783 239
102 3300048911 Ga0496108_0017482 Ga0496108_0017482_2670_3437 239
103 3300048912 Ga0496109_0302392 Ga0496109_0302392_497_1264 239
104 3300048913 Ga0496110_0024705 Ga0496110_0024705_2843_3610 239
105 3300048914 Ga0496111_0005648 Ga0496111_0005648_6855_7622 239
106 3300048916 Ga0496113_0024435 Ga0496113_0024435_3376_4143 239
107 3300048917 Ga0496114_0490237 Ga0496114_0490237_169_936 239
108 3300048929 Ga0496126_0029904 Ga0496126_0029904_1281_2090 239
109 3300050511 nmdc:mga08y16_287973_c1 nmdc:mga08y16_287973_c1_376_1143 239
110 3300050512 nmdc:mga0n895_468709_c1 nmdc:mga0n895_468709_c1_127_894 239
111 3300050513 nmdc:mga0rr50_148702_c1 nmdc:mga0rr50_148702_c1_571_1338 239
112 3300050515 nmdc:mga0a205_193953_c1 nmdc:mga0a205_193953_c1_438_1205 239
113 3300005439 Ga0070711_100252527 Ga0070711_1002525271 240
114 3300005546 Ga0070696_100084495 Ga0070696_1000844953 240
115 3300005841 Ga0068863_100000032 Ga0068863_10000003213 240
116 3300013307 Ga0157372_10365990 Ga0157372_103659902 240
117 3300025898 Ga0207692_10040358 Ga0207692_100403583 240
118 3300025915 Ga0207693_10053039 Ga0207693_100530391 240
119 3300026088 Ga0207641_10000071 Ga0207641_1000007114 240
120 3300046462 Ga0495651_0192164 Ga0495651_0192164_577_1347 240
121 3300046539 Ga0495621_0002083 Ga0495621_0002083_1516_2313 240
122 3300046642 Ga0495634_0000024 Ga0495634_0000024_104615_105379 240
123 3300053077 Ga0495601_0000086 Ga0495601_0000086_33064_33861 240
124 3300005365 Ga0070688_100396145 Ga0070688_1003961451 241
125 3300005618 Ga0068864_100026224 Ga0068864_1000262242 241
126 3300006173 Ga0070716_100146589 Ga0070716_1001465892 241
127 3300013297 Ga0157378_10010497 Ga0157378_100104975 241
128 3300014325 Ga0163163_10119806 Ga0163163_101198062 241
129 3300025939 Ga0207665_10182274 Ga0207665_101822742 241
130 3300025960 Ga0207651_10041883 Ga0207651_100418832 241
131 3300026095 Ga0207676_10194051 Ga0207676_101940512 241
132 3300028800 Ga0265338_10058061 Ga0265338_100580612 241
133 3300037853 Ga0436364_0309695 Ga0436364_0309695_191_961 241
134 3300037853 Ga0436364_1133006 Ga0436364_1133006_79_873 241
135 3300039437 Ga0436365_0329149 Ga0436365_0329149_10836_11606 241
136 3300041997 Ga0439431_0025850 Ga0439431_0025850_413_1171 241
137 3300041999 Ga0439433_0006334 Ga0439433_0006334_1331_2089 241
138 3300042015 Ga0439462_0004636 Ga0439462_0004636_298_1056 241
139 3300042156 Ga0439446_0000927 Ga0439446_0000927_3394_4152 241
140 3300046473 Ga0495582_0113618 Ga0495582_0113618_588_1355 241
141 3300046475 Ga0495639_0058412 Ga0495639_0058412_353_1120 241
142 3300046511 Ga0495608_0010782 Ga0495608_0010782_4011_4775 241
143 3300046674 Ga0495588_0000198 Ga0495588_0000198_80_862 241
144 3300046681 Ga0495647_0000293 Ga0495647_0000293_8068_8853 241
145 3300047321 Ga0495676_0038393 Ga0495676_0038393_1917_2684 241
146 3300048903 Ga0496100_0041580 Ga0496100_0041580_1574_2341 241
147 3300048905 Ga0496102_0136102 Ga0496102_0136102_669_1436 241
148 3300048907 Ga0496104_0001562 Ga0496104_0001562_8597_9364 241
149 3300048908 Ga0496105_0000313 Ga0496105_0000313_28581_29348 241
150 3300048912 Ga0496109_0001462 Ga0496109_0001462_10121_10888 241
151 3300048913 Ga0496110_0001879 Ga0496110_0001879_4507_5274 241
152 3300048914 Ga0496111_0000560 Ga0496111_0000560_8671_9438 241
153 3300048915 Ga0496112_0001813 Ga0496112_0001813_2581_3348 241
154 3300048916 Ga0496113_0000240 Ga0496113_0000240_5786_6553 241
155 3300048917 Ga0496114_0009484 Ga0496114_0009484_3532_4299 241
156 3300048918 Ga0496115_0008785 Ga0496115_0008785_543_1310 241
157 3300048929 Ga0496126_0099256 Ga0496126_0099256_201_926 241
158 3300049568 Ga0501031_0065331 Ga0501031_0065331_646_1416 241
159 3300049571 Ga0501034_0065214 Ga0501034_0065214_1390_2148 241
160 3300049572 Ga0501036_0135273 Ga0501036_0135273_285_1055 241
161 3300049575 Ga0501039_0107426 Ga0501039_0107426_641_1411 241
162 3300049576 Ga0501040_0017844 Ga0501040_0017844_3189_3959 241
163 3300049577 Ga0501041_0040749 Ga0501041_0040749_1439_2209 241
164 3300049579 Ga0501043_0093174 Ga0501043_0093174_618_1388 241
165 3300049580 Ga0501046_0053780 Ga0501046_0053780_1006_1776 241
166 3300049582 Ga0501048_0184813 Ga0501048_0184813_77_847 241
167 3300049588 Ga0501072_0092159 Ga0501072_0092159_1400_2170 241
168 3300049590 Ga0501074_0075006 Ga0501074_0075006_1395_2165 241
169 3300049591 Ga0501075_0114929 Ga0501075_0114929_92_862 241
170 3300049592 Ga0501076_0187905 Ga0501076_0187905_744_1514 241
171 3300049593 Ga0501077_0112680 Ga0501077_0112680_604_1374 241
172 3300049741 Ga0501079_0025921 Ga0501079_0025921_1440_2210 241
173 3300049743 Ga0501081_0145654 Ga0501081_0145654_682_1452 241
174 3300049824 Ga0501045_0075570 Ga0501045_0075570_1088_1858 241
175 3300054114 Ga0501084_0065108 Ga0501084_0065108_1109_1879 241
176 3300060353 Ga0501082_0237725 Ga0501082_0237725_540_1310 241
177 3300061734 Ga0530510_0079218 Ga0530510_0079218_1041_1811 241
178 3300006914 Ga0075436_100219177 Ga0075436_1002191772 242
179 3300009101 Ga0105247_10109935 Ga0105247_101099352 242
180 3300014969 Ga0157376_10121124 Ga0157376_101211243 242
181 3300026116 Ga0207674_10275630 Ga0207674_102756302 242
182 3300044706 Ga0466964_0174965 Ga0466964_0174965_29_757 242
183 3300044901 Ga0466960_0226618 Ga0466960_0226618_207_935 242
184 3300045976 Ga0466967_0738415 Ga0466967_0738415_215_943 242
185 3300046499 Ga0495594_0000013 Ga0495594_0000013_61520_62347 242
186 3300046660 Ga0495625_0257297 Ga0495625_0257297_205_999 242
187 3300048088 Ga0495602_0000228 Ga0495602_0000228_21720_22508 242
188 3300048088 Ga0495602_0169060 Ga0495602_0169060_843_1640 242
189 3300049568 Ga0501031_0000445 Ga0501031_0000445_1943_2713 242
190 3300049569 Ga0501032_0000876 Ga0501032_0000876_21097_21867 242
191 3300049570 Ga0501033_0000294 Ga0501033_0000294_6667_7437 242
192 3300049572 Ga0501036_0005562 Ga0501036_0005562_2008_2778 242
193 3300049573 Ga0501037_0000378 Ga0501037_0000378_19568_20338 242
194 3300049573 Ga0501037_0005716 Ga0501037_0005716_6124_6894 242
195 3300049574 Ga0501038_0000087 Ga0501038_0000087_7452_8222 242
196 3300049575 Ga0501039_0001020 Ga0501039_0001020_12968_13738 242
197 3300049575 Ga0501039_0003991 Ga0501039_0003991_8511_9281 242
198 3300049576 Ga0501040_0000007 Ga0501040_0000007_19073_19843 242
199 3300049576 Ga0501040_0000954 Ga0501040_0000954_8431_9201 242
200 3300049577 Ga0501041_0000005 Ga0501041_0000005_59888_60658 242
201 3300049577 Ga0501041_0001093 Ga0501041_0001093_6124_6894 242
202 3300049578 Ga0501042_0003216 Ga0501042_0003216_2008_2778 242
203 3300049578 Ga0501042_0003964 Ga0501042_0003964_5689_6459 242
204 3300049579 Ga0501043_0000998 Ga0501043_0000998_16677_17447 242
205 3300049580 Ga0501046_0001278 Ga0501046_0001278_16798_17568 242
206 3300049580 Ga0501046_0028136 Ga0501046_0028136_1481_2251 242
207 3300049581 Ga0501047_0000592 Ga0501047_0000592_16788_17558 242
208 3300049582 Ga0501048_0000018 Ga0501048_0000018_70526_71296 242
209 3300049582 Ga0501048_0001926 Ga0501048_0001926_8778_9548 242
210 3300049583 Ga0501067_0009559 Ga0501067_0009559_803_1573 242
211 3300049584 Ga0501068_0000134 Ga0501068_0000134_21035_21805 242
212 3300049584 Ga0501068_0011873 Ga0501068_0011873_2674_3444 242
213 3300049585 Ga0501069_0000426 Ga0501069_0000426_7435_8205 242
214 3300049586 Ga0501070_0004569 Ga0501070_0004569_1366_2136 242
215 3300049586 Ga0501070_0005855 Ga0501070_0005855_132_902 242
216 3300049587 Ga0501071_0000005 Ga0501071_0000005_70526_71296 242
217 3300049587 Ga0501071_0001995 Ga0501071_0001995_8511_9281 242
218 3300049588 Ga0501072_0000269 Ga0501072_0000269_20584_21354 242
219 3300049588 Ga0501072_0004831 Ga0501072_0004831_6124_6894 242
220 3300049589 Ga0501073_0001327 Ga0501073_0001327_10039_10809 242
221 3300049589 Ga0501073_0033451 Ga0501073_0033451_811_1581 242
222 3300049589 Ga0501073_0178046 Ga0501073_0178046_28_828 242
223 3300049590 Ga0501074_0001138 Ga0501074_0001138_9851_10621 242
224 3300049591 Ga0501075_0000009 Ga0501075_0000009_11489_12259 242
225 3300049591 Ga0501075_0000193 Ga0501075_0000193_16287_17057 242
226 3300049591 Ga0501075_0099979 Ga0501075_0099979_799_1572 242
227 3300049592 Ga0501076_0000028 Ga0501076_0000028_7452_8222 242
228 3300049592 Ga0501076_0001292 Ga0501076_0001292_6421_7191 242
229 3300049593 Ga0501077_0000006 Ga0501077_0000006_40553_41323 242
230 3300049593 Ga0501077_0001176 Ga0501077_0001176_3040_3810 242
231 3300049741 Ga0501079_0000881 Ga0501079_0000881_1880_2650 242
232 3300049742 Ga0501080_0000626 Ga0501080_0000626_21097_21867 242
233 3300049742 Ga0501080_0032292 Ga0501080_0032292_961_1731 242
234 3300049743 Ga0501081_0000003 Ga0501081_0000003_20584_21354 242
235 3300049743 Ga0501081_0000159 Ga0501081_0000159_27721_28491 242
236 3300049744 Ga0501083_0001673 Ga0501083_0001673_11853_12623 242
237 3300049744 Ga0501083_0008047 Ga0501083_0008047_5877_6647 242
238 3300049822 Ga0501035_0000175 Ga0501035_0000175_7452_8222 242
239 3300049823 Ga0501044_0006303 Ga0501044_0006303_2499_3269 242
240 3300049824 Ga0501045_0000009 Ga0501045_0000009_19072_19842 242
241 3300049824 Ga0501045_0002161 Ga0501045_0002161_6124_6894 242
242 3300050514 nmdc:mga08x19_198354_c1 nmdc:mga08x19_198354_c1_95_892 242
243 3300054114 Ga0501084_0001358 Ga0501084_0001358_2912_3682 242
244 3300054114 Ga0501084_0005874 Ga0501084_0005874_7452_8222 242
245 3300060353 Ga0501082_0000063 Ga0501082_0000063_60685_61455 242
246 3300060353 Ga0501082_0001009 Ga0501082_0001009_8815_9585 242
247 3300061734 Ga0530510_0000014 Ga0530510_0000014_86052_86822 242
248 3300061734 Ga0530510_0001148 Ga0530510_0001148_811_1581 242
249 3300035116 Ga0373945_0004604 Ga0373945_0004604_1184_1951 243
250 3300035170 Ga0373943_0007558 Ga0373943_0007558_1454_2221 243
251 3300035171 Ga0373946_0013315 Ga0373946_0013315_424_1191 243
252 3300035725 Ga0373947_0001538 Ga0373947_0001538_9026_9793 243
253 3300037068 Ga0373925_0215933 Ga0373925_0215933_735_1502 243
254 3300046455 Ga0495603_0001473 Ga0495603_0001473_12326_13093 243
255 3300046461 Ga0495641_0003321 Ga0495641_0003321_2774_3541 243
256 3300046472 Ga0495580_0022051 Ga0495580_0022051_1663_2430 243
257 3300046473 Ga0495582_0037719 Ga0495582_0037719_984_1751 243
258 3300046475 Ga0495639_0138624 Ga0495639_0138624_246_1013 243
259 3300046499 Ga0495594_0000157 Ga0495594_0000157_27548_28315 243
260 3300046516 Ga0495628_0172280 Ga0495628_0172280_306_1082 243
261 3300046529 Ga0495652_0317936 Ga0495652_0317936_182_958 243
262 3300046535 Ga0495586_0000527 Ga0495586_0000527_5267_6061 243
263 3300046536 Ga0495587_0054503 Ga0495587_0054503_1149_1946 243
264 3300046674 Ga0495588_0010582 Ga0495588_0010582_2974_3741 243
265 3300046681 Ga0495647_0026359 Ga0495647_0026359_881_1648 243
266 3300046683 Ga0495658_0228514 Ga0495658_0228514_290_1057 243
267 3300047315 Ga0495581_0222299 Ga0495581_0222299_24_791 243
268 3300047321 Ga0495676_0014558 Ga0495676_0014558_4081_4848 243
269 3300053085 Ga0495619_0000024 Ga0495619_0000024_46642_47406 243
270 3300005329 Ga0070683_100000793 Ga0070683_10000079324 244
271 3300005985 Ga0081539_10000473 Ga0081539_1000047355 244
272 3300025944 Ga0207661_10001949 Ga0207661_1000194911 244
273 3300044694 Ga0466963_0207075 Ga0466963_0207075_254_1045 244
274 3300047469 Ga0495673_0029664 Ga0495673_0029664_64_849 244
275 3300048909 Ga0496106_0000013 Ga0496106_0000013_168174_168971 244
276 3300005329 Ga0070683_100043303 Ga0070683_1000433034 245
277 3300005459 Ga0068867_100000179 Ga0068867_10000017931 245
278 3300005535 Ga0070684_100003511 Ga0070684_1000035111 245
279 3300009176 Ga0105242_10068974 Ga0105242_100689743 245
280 3300025934 Ga0207686_10006424 Ga0207686_100064243 245
281 3300025944 Ga0207661_10030009 Ga0207661_100300095 245
282 3300026089 Ga0207648_10000228 Ga0207648_1000022830 245
283 3300046523 Ga0495644_0000954 Ga0495644_0000954_2655_3446 245
284 3300005331 Ga0070670_100044615 Ga0070670_1000446152 246
285 3300005364 Ga0070673_100013844 Ga0070673_1000138445 246
286 3300025925 Ga0207650_10025386 Ga0207650_100253862 246
287 3300025960 Ga0207651_10008445 Ga0207651_100084452 246
288 3300005356 Ga0070674_100000020 Ga0070674_10000002016 247
289 3300005718 Ga0068866_10000019 Ga0068866_1000001980 247
290 3300009148 Ga0105243_10345353 Ga0105243_103453532 247
291 3300025899 Ga0207642_10000017 Ga0207642_1000001778 247
292 3300025937 Ga0207669_10000016 Ga0207669_10000016132 247
293 3300014326 Ga0157380_10052162 Ga0157380_100521623 248
294 3300046459 Ga0495629_0129808 Ga0495629_0129808_589_1335 248
295 3300009098 Ga0105245_10359013 Ga0105245_103590132 249
296 3300014969 Ga0157376_10767140 Ga0157376_107671402 249
297 3300035083 Ga0373926_0071554 Ga0373926_0071554_271_1020 249
298 3300035089 Ga0373944_0016363 Ga0373944_0016363_765_1514 249
299 3300035170 Ga0373943_0000090 Ga0373943_0000090_16345_17094 249
300 3300035171 Ga0373946_0007850 Ga0373946_0007850_1835_2584 249
301 3300035695 Ga0373927_0074898 Ga0373927_0074898_513_1262 249
302 3300035725 Ga0373947_0000266 Ga0373947_0000266_15915_16664 249
303 3300037068 Ga0373925_0001866 Ga0373925_0001866_4029_4778 249
304 3300046454 Ga0495592_0164449 Ga0495592_0164449_655_1404 249
305 3300046459 Ga0495629_0002088 Ga0495629_0002088_10318_11067 249
306 3300046461 Ga0495641_0005538 Ga0495641_0005538_638_1387 249
307 3300046462 Ga0495651_0024849 Ga0495651_0024849_2272_3021 249
308 3300046463 Ga0495653_0032140 Ga0495653_0032140_2539_3288 249
309 3300046473 Ga0495582_0000801 Ga0495582_0000801_16072_16821 249
310 3300046475 Ga0495639_0002081 Ga0495639_0002081_937_1686 249
311 3300046476 Ga0495662_0000984 Ga0495662_0000984_12057_12806 249
312 3300046477 Ga0495664_0000012 Ga0495664_0000012_164149_164898 249
313 3300046477 Ga0495664_0052360 Ga0495664_0052360_859_1608 249
314 3300046499 Ga0495594_0027397 Ga0495594_0027397_1463_2212 249
315 3300046511 Ga0495608_0265658 Ga0495608_0265658_254_1003 249
316 3300046516 Ga0495628_0039578 Ga0495628_0039578_2702_3451 249
317 3300046517 Ga0495630_0005899 Ga0495630_0005899_766_1515 249
318 3300046526 Ga0495666_0016257 Ga0495666_0016257_1769_2518 249
319 3300046529 Ga0495652_0147980 Ga0495652_0147980_190_939 249
320 3300046531 Ga0495665_0000215 Ga0495665_0000215_1575_2324 249
321 3300046533 Ga0495640_0114688 Ga0495640_0114688_189_938 249
322 3300046533 Ga0495640_0121419 Ga0495640_0121419_831_1580 249
323 3300046535 Ga0495586_0031050 Ga0495586_0031050_2029_2778 249
324 3300046559 Ga0495667_0064213 Ga0495667_0064213_1047_1796 249
325 3300046663 Ga0495635_0037192 Ga0495635_0037192_294_1043 249
326 3300046663 Ga0495635_0076575 Ga0495635_0076575_1380_2129 249
327 3300046679 Ga0495623_0109015 Ga0495623_0109015_371_1120 249
328 3300046681 Ga0495647_0002559 Ga0495647_0002559_3458_4207 249
329 3300046683 Ga0495658_0002471 Ga0495658_0002471_1921_2670 249
330 3300046689 Ga0495613_0003963 Ga0495613_0003963_7951_8700 249
331 3300046690 Ga0495624_0012694 Ga0495624_0012694_4801_5550 249
332 3300046809 Ga0495600_0043498 Ga0495600_0043498_834_1583 249
333 3300047315 Ga0495581_0038723 Ga0495581_0038723_1373_2122 249
334 3300047319 Ga0495674_0034205 Ga0495674_0034205_3337_4086 249
335 3300047319 Ga0495674_0137328 Ga0495674_0137328_587_1336 249
336 3300047321 Ga0495676_0001001 Ga0495676_0001001_21906_22655 249
337 3300047322 Ga0495680_0005597 Ga0495680_0005597_8014_8763 249
338 3300047322 Ga0495680_0013355 Ga0495680_0013355_4445_5194 249
339 3300047471 Ga0495684_0006596 Ga0495684_0006596_8073_8822 249
340 3300047471 Ga0495684_0010019 Ga0495684_0010019_3930_4679 249
341 3300047673 Ga0495593_0001317 Ga0495593_0001317_12436_13185 249
342 3300048089 Ga0495614_0004961 Ga0495614_0004961_2417_3166 249
343 3300048905 Ga0496102_0000027 Ga0496102_0000027_159053_159802 249
344 3300048906 Ga0496103_0000155 Ga0496103_0000155_18516_19265 249
345 3300053077 Ga0495601_0059411 Ga0495601_0059411_259_1008 249
346 3300053084 Ga0495595_0006454 Ga0495595_0006454_3054_3803 249
347 3300053085 Ga0495619_0004791 Ga0495619_0004791_1023_1772 249
348 3300041486 Ga0451807_2280868 Ga0451807_2280868_733_1485 250
349 3300046681 Ga0495647_0004495 Ga0495647_0004495_1314_2066 250
350 3300049744 Ga0501083_0372292 Ga0501083_0372292_22_837 250
351 3300005329 Ga0070683_100001714 Ga0070683_10000171414 251
352 3300005335 Ga0070666_10085528 Ga0070666_100855281 251
353 3300005365 Ga0070688_100000333 Ga0070688_10000033319 251
354 3300005435 Ga0070714_100000243 Ga0070714_10000024314 251
355 3300005435 Ga0070714_100199562 Ga0070714_1001995622 251
356 3300005437 Ga0070710_10017787 Ga0070710_100177872 251
357 3300005445 Ga0070708_100025820 Ga0070708_1000258204 251
358 3300005466 Ga0070685_10000293 Ga0070685_1000029326 251
359 3300005467 Ga0070706_100099695 Ga0070706_1000996953 251
360 3300005471 Ga0070698_100008430 Ga0070698_1000084308 251
361 3300005518 Ga0070699_100691064 Ga0070699_1006910641 251
362 3300005536 Ga0070697_100114251 Ga0070697_1001142512 251
363 3300005539 Ga0068853_100483223 Ga0068853_1004832231 251
364 3300005546 Ga0070696_100577520 Ga0070696_1005775201 251
365 3300005614 Ga0068856_100018421 Ga0068856_1000184216 251
366 3300006163 Ga0070715_10064513 Ga0070715_100645132 251
367 3300006175 Ga0070712_100100853 Ga0070712_1001008532 251
368 3300006844 Ga0075428_100021945 Ga0075428_1000219454 251
369 3300006847 Ga0075431_100065779 Ga0075431_1000657792 251
370 3300006852 Ga0075433_10037865 Ga0075433_100378653 251
371 3300006871 Ga0075434_100370372 Ga0075434_1003703722 251
372 3300006914 Ga0075436_100047633 Ga0075436_1000476334 251
373 3300007076 Ga0075435_100171504 Ga0075435_1001715043 251
374 3300009094 Ga0111539_10057025 Ga0111539_100570253 251
375 3300009098 Ga0105245_10000056 Ga0105245_100000569 251
376 3300009101 Ga0105247_10272342 Ga0105247_102723422 251
377 3300009147 Ga0114129_10467965 Ga0114129_104679652 251
378 3300009177 Ga0105248_10000032 Ga0105248_10000032111 251
379 3300013104 Ga0157370_10007615 Ga0157370_100076158 251
380 3300013105 Ga0157369_10000099 Ga0157369_1000009929 251
381 3300025903 Ga0207680_10166999 Ga0207680_101669992 251
382 3300025905 Ga0207685_10112614 Ga0207685_101126142 251
383 3300025915 Ga0207693_10043531 Ga0207693_100435313 251
384 3300025922 Ga0207646_10315543 Ga0207646_103155432 251
385 3300025927 Ga0207687_10000007 Ga0207687_10000007113 251
386 3300025928 Ga0207700_10086661 Ga0207700_100866613 251
387 3300025928 Ga0207700_10397504 Ga0207700_103975042 251
388 3300025929 Ga0207664_10000013 Ga0207664_10000013161 251
389 3300025929 Ga0207664_10154503 Ga0207664_101545032 251
390 3300025939 Ga0207665_10020351 Ga0207665_100203515 251
391 3300025941 Ga0207711_10000020 Ga0207711_10000020263 251
392 3300025944 Ga0207661_10001238 Ga0207661_1000123814 251
393 3300026078 Ga0207702_10003815 Ga0207702_100038158 251
394 3300027907 Ga0207428_10076863 Ga0207428_100768632 251
395 3300037418 Ga0395900_0252312 Ga0395900_0252312_111_881 251
396 3300038443 Ga0395901_0000856 Ga0395901_0000856_25748_26518 251
397 3300044842 Ga0466957_0003681 Ga0466957_0003681_4255_5046 251
398 3300046459 Ga0495629_0005520 Ga0495629_0005520_1494_2279 251
399 3300046683 Ga0495658_0001056 Ga0495658_0001056_959_1750 251
400 3300048911 Ga0496108_0000045 Ga0496108_0000045_114925_115716 251
401 3300048912 Ga0496109_0000028 Ga0496109_0000028_155849_156610 251
402 3300048912 Ga0496109_0000032 Ga0496109_0000032_21710_22501 251
403 3300048913 Ga0496110_0126042 Ga0496110_0126042_126_896 251
404 3300048916 Ga0496113_0161716 Ga0496113_0161716_36_827 251
405 3300050507 nmdc:mga05p37_62567_c1 nmdc:mga05p37_62567_c1_540_1310 251
406 3300050511 nmdc:mga08y16_55458_c1 nmdc:mga08y16_55458_c1_1711_2481 251
407 3300050513 nmdc:mga0rr50_372931_c1 nmdc:mga0rr50_372931_c1_414_1184 251
408 3300050515 nmdc:mga0a205_65733_c1 nmdc:mga0a205_65733_c1_920_1690 251
409 3300053077 Ga0495601_0003248 Ga0495601_0003248_7130_8080 251
410 3300053085 Ga0495619_0309197 Ga0495619_0309197_204_977 251
411 3300005327 Ga0070658_10144314 Ga0070658_101443142 252
412 3300005329 Ga0070683_100013143 Ga0070683_1000131435 252
413 3300005333 Ga0070677_10000003 Ga0070677_1000000363 252
414 3300005335 Ga0070666_10003293 Ga0070666_100032932 252
415 3300005337 Ga0070682_100000080 Ga0070682_10000008058 252
416 3300005337 Ga0070682_100000102 Ga0070682_10000010276 252
417 3300005337 Ga0070682_100255499 Ga0070682_1002554992 252
418 3300005338 Ga0068868_100000095 Ga0068868_10000009554 252
419 3300005340 Ga0070689_100072593 Ga0070689_1000725933 252
420 3300005340 Ga0070689_100505377 Ga0070689_1005053771 252
421 3300005341 Ga0070691_10008984 Ga0070691_100089842 252
422 3300005344 Ga0070661_100000005 Ga0070661_100000005205 252
423 3300005347 Ga0070668_100148348 Ga0070668_1001483482 252
424 3300005356 Ga0070674_100000003 Ga0070674_100000003192 252
425 3300005356 Ga0070674_100023772 Ga0070674_1000237723 252
426 3300005365 Ga0070688_100002793 Ga0070688_1000027936 252
427 3300005436 Ga0070713_100000138 Ga0070713_1000001388 252
428 3300005436 Ga0070713_100015507 Ga0070713_1000155073 252
429 3300005437 Ga0070710_10164320 Ga0070710_101643201 252
430 3300005437 Ga0070710_10245347 Ga0070710_102453472 252
431 3300005439 Ga0070711_100008345 Ga0070711_1000083454 252
432 3300005439 Ga0070711_100043089 Ga0070711_1000430893 252
433 3300005455 Ga0070663_100085873 Ga0070663_1000858732 252
434 3300005456 Ga0070678_100004162 Ga0070678_10000416210 252
435 3300005457 Ga0070662_100000363 Ga0070662_10000036315 252
436 3300005458 Ga0070681_10005901 Ga0070681_100059019 252
437 3300005530 Ga0070679_100000537 Ga0070679_10000053714 252
438 3300005535 Ga0070684_100223350 Ga0070684_1002233503 252
439 3300005539 Ga0068853_100002080 Ga0068853_1000020803 252
440 3300005547 Ga0070693_100000833 Ga0070693_10000083313 252
441 3300005547 Ga0070693_100016010 Ga0070693_1000160103 252
442 3300005548 Ga0070665_100000159 Ga0070665_100000159125 252
443 3300005548 Ga0070665_100219516 Ga0070665_1002195161 252
444 3300005548 Ga0070665_100685624 Ga0070665_1006856241 252
445 3300005578 Ga0068854_100006423 Ga0068854_1000064232 252
446 3300005578 Ga0068854_100012863 Ga0068854_1000128633 252
447 3300005578 Ga0068854_100327648 Ga0068854_1003276482 252
448 3300005578 Ga0068854_100589319 Ga0068854_1005893192 252
449 3300005614 Ga0068856_100023907 Ga0068856_1000239071 252
450 3300005614 Ga0068856_100074564 Ga0068856_1000745643 252
451 3300005616 Ga0068852_100000012 Ga0068852_100000012116 252
452 3300005718 Ga0068866_10000002 Ga0068866_10000002218 252
453 3300005834 Ga0068851_10002153 Ga0068851_100021532 252
454 3300005840 Ga0068870_10066166 Ga0068870_100661661 252
455 3300005842 Ga0068858_100000049 Ga0068858_10000004918 252
456 3300005842 Ga0068858_100049480 Ga0068858_1000494803 252
457 3300005983 Ga0081540_1000006 Ga0081540_100000672 252
458 3300005985 Ga0081539_10119888 Ga0081539_101198882 252
459 3300006028 Ga0070717_10075881 Ga0070717_100758813 252
460 3300006163 Ga0070715_10000012 Ga0070715_1000001255 252
461 3300006163 Ga0070715_10103001 Ga0070715_101030011 252
462 3300006175 Ga0070712_100000777 Ga0070712_10000077719 252
463 3300009094 Ga0111539_10242677 Ga0111539_102426772 252
464 3300009098 Ga0105245_10000290 Ga0105245_1000029052 252
465 3300009098 Ga0105245_10001677 Ga0105245_100016779 252
466 3300009098 Ga0105245_10003691 Ga0105245_1000369111 252
467 3300009101 Ga0105247_10000202 Ga0105247_1000020210 252
468 3300009101 Ga0105247_10409945 Ga0105247_104099451 252
469 3300009147 Ga0114129_10029165 Ga0114129_100291656 252
470 3300009174 Ga0105241_10081860 Ga0105241_100818602 252
471 3300009553 Ga0105249_10000073 Ga0105249_10000073113 252
472 3300013102 Ga0157371_10009448 Ga0157371_100094482 252
473 3300013104 Ga0157370_10005853 Ga0157370_100058534 252
474 3300013297 Ga0157378_10016775 Ga0157378_1001677510 252
475 3300013297 Ga0157378_10074162 Ga0157378_100741623 252
476 3300013308 Ga0157375_10000707 Ga0157375_1000070716 252
477 3300014326 Ga0157380_10003655 Ga0157380_100036558 252
478 3300014968 Ga0157379_10040899 Ga0157379_100408993 252
479 3300014969 Ga0157376_10643395 Ga0157376_106433952 252
480 3300017792 Ga0163161_10000058 Ga0163161_1000005844 252
481 3300017792 Ga0163161_10014924 Ga0163161_100149247 252
482 3300021384 Ga0213876_10098728 Ga0213876_100987281 252
483 3300021388 Ga0213875_10000468 Ga0213875_1000046811 252
484 3300025321 Ga0207656_10032149 Ga0207656_100321492 252
485 3300025893 Ga0207682_10000052 Ga0207682_1000005222 252
486 3300025898 Ga0207692_10052115 Ga0207692_100521152 252
487 3300025899 Ga0207642_10000001 Ga0207642_10000001396 252
488 3300025899 Ga0207642_10000003 Ga0207642_10000003396 252
489 3300025899 Ga0207642_10000004 Ga0207642_10000004396 252
490 3300025900 Ga0207710_10000369 Ga0207710_1000036923 252
491 3300025903 Ga0207680_10002430 Ga0207680_100024303 252
492 3300025909 Ga0207705_10049419 Ga0207705_100494193 252
493 3300025911 Ga0207654_10121817 Ga0207654_101218172 252
494 3300025913 Ga0207695_10560577 Ga0207695_105605772 252
495 3300025915 Ga0207693_10008860 Ga0207693_100088602 252
496 3300025916 Ga0207663_10031736 Ga0207663_100317363 252
497 3300025917 Ga0207660_10123298 Ga0207660_101232982 252
498 3300025920 Ga0207649_10000005 Ga0207649_10000005348 252
499 3300025921 Ga0207652_10000631 Ga0207652_1000063116 252
500 3300025927 Ga0207687_10000012 Ga0207687_1000001213 252
501 3300025927 Ga0207687_10000646 Ga0207687_1000064612 252
502 3300025927 Ga0207687_10000970 Ga0207687_1000097020 252
503 3300025928 Ga0207700_10000008 Ga0207700_10000008339 252
504 3300025928 Ga0207700_10000016 Ga0207700_100000168 252
505 3300025928 Ga0207700_10207811 Ga0207700_102078112 252
506 3300025929 Ga0207664_10110118 Ga0207664_101101181 252
507 3300025931 Ga0207644_10123003 Ga0207644_101230033 252
508 3300025932 Ga0207690_10008415 Ga0207690_100084152 252
509 3300025933 Ga0207706_10000006 Ga0207706_1000000616 252
510 3300025936 Ga0207670_10259273 Ga0207670_102592732 252
511 3300025937 Ga0207669_10000036 Ga0207669_1000003628 252
512 3300025944 Ga0207661_10008416 Ga0207661_100084165 252
513 3300025945 Ga0207679_10025975 Ga0207679_100259754 252
514 3300025961 Ga0207712_10000003 Ga0207712_10000003470 252
515 3300025961 Ga0207712_10235415 Ga0207712_102354152 252
516 3300025961 Ga0207712_10331831 Ga0207712_103318312 252
517 3300025972 Ga0207668_10044746 Ga0207668_100447463 252
518 3300025981 Ga0207640_10000285 Ga0207640_100002856 252
519 3300025981 Ga0207640_10002518 Ga0207640_1000251810 252
520 3300025981 Ga0207640_10168323 Ga0207640_101683232 252
521 3300026023 Ga0207677_10001435 Ga0207677_100014357 252
522 3300026035 Ga0207703_10000067 Ga0207703_1000006716 252
523 3300026035 Ga0207703_10073601 Ga0207703_100736013 252
524 3300026041 Ga0207639_10001671 Ga0207639_100016713 252
525 3300026067 Ga0207678_10063204 Ga0207678_100632043 252
526 3300026078 Ga0207702_10000016 Ga0207702_10000016104 252
527 3300026078 Ga0207702_10192541 Ga0207702_101925412 252
528 3300026088 Ga0207641_10008529 Ga0207641_100085293 252
529 3300026121 Ga0207683_10006404 Ga0207683_100064043 252
530 3300026121 Ga0207683_10297110 Ga0207683_102971101 252
531 3300026142 Ga0207698_10000012 Ga0207698_10000012235 252
532 3300028379 Ga0268266_10000023 Ga0268266_10000023345 252
533 3300028379 Ga0268266_10000553 Ga0268266_1000055331 252
534 3300028379 Ga0268266_10002681 Ga0268266_1000268119 252
535 3300028381 Ga0268264_10007216 Ga0268264_100072168 252
536 3300037853 Ga0436364_1031907 Ga0436364_1031907_58036_58806 252
537 3300039437 Ga0436365_0328253 Ga0436365_0328253_684_1454 252
538 3300039453 Ga0436362_0533856 Ga0436362_0533856_178_948 252
539 3300041451 Ga0451791_1163314 Ga0451791_1163314_347_1132 252
540 3300041512 Ga0451853_0384465 Ga0451853_0384465_1062_1859 252
541 3300041512 Ga0451853_1991254 Ga0451853_1991254_395_1180 252
542 3300044684 Ga0466966_0208199 Ga0466966_0208199_127_897 252
543 3300044693 Ga0466961_0338983 Ga0466961_0338983_80_850 252
544 3300044693 Ga0466961_0350564 Ga0466961_0350564_101_871 252
545 3300044694 Ga0466963_0000070 Ga0466963_0000070_28113_28910 252
546 3300044694 Ga0466963_0079187 Ga0466963_0079187_115_885 252
547 3300045049 Ga0466959_0252775 Ga0466959_0252775_256_1026 252
548 3300045836 Ga0466958_0112295 Ga0466958_0112295_80_850 252
549 3300046454 Ga0495592_0000621 Ga0495592_0000621_3543_4337 252
550 3300046454 Ga0495592_0213460 Ga0495592_0213460_339_1124 252
551 3300046455 Ga0495603_0003021 Ga0495603_0003021_8248_9045 252
552 3300046455 Ga0495603_0077607 Ga0495603_0077607_24_794 252
553 3300046459 Ga0495629_0007647 Ga0495629_0007647_7088_7873 252
554 3300046459 Ga0495629_0019746 Ga0495629_0019746_3309_4094 252
555 3300046460 Ga0495638_0009398 Ga0495638_0009398_1380_2168 252
556 3300046461 Ga0495641_0015104 Ga0495641_0015104_2451_3245 252
557 3300046463 Ga0495653_0099929 Ga0495653_0099929_913_1677 252
558 3300046473 Ga0495582_0000005 Ga0495582_0000005_108844_109638 252
559 3300046476 Ga0495662_0000022 Ga0495662_0000022_18025_18822 252
560 3300046491 Ga0495584_0163949 Ga0495584_0163949_40_810 252
561 3300046507 Ga0495606_0000211 Ga0495606_0000211_60853_61638 252
562 3300046511 Ga0495608_0000031 Ga0495608_0000031_10117_10902 252
563 3300046511 Ga0495608_0000406 Ga0495608_0000406_14412_15209 252
564 3300046511 Ga0495608_0107463 Ga0495608_0107463_281_1075 252
565 3300046514 Ga0495618_0000068 Ga0495618_0000068_68923_69717 252
566 3300046515 Ga0495620_0000315 Ga0495620_0000315_29536_30306 252
567 3300046516 Ga0495628_0000323 Ga0495628_0000323_7238_8023 252
568 3300046516 Ga0495628_0036648 Ga0495628_0036648_1855_2652 252
569 3300046516 Ga0495628_0069964 Ga0495628_0069964_951_1715 252
570 3300046516 Ga0495628_0188052 Ga0495628_0188052_28_792 252
571 3300046517 Ga0495630_0000018 Ga0495630_0000018_12_797 252
572 3300046517 Ga0495630_0020993 Ga0495630_0020993_1220_2017 252
573 3300046517 Ga0495630_0064242 Ga0495630_0064242_1472_2269 252
574 3300046529 Ga0495652_0000003 Ga0495652_0000003_35360_36145 252
575 3300046533 Ga0495640_0047817 Ga0495640_0047817_2000_2797 252
576 3300046536 Ga0495587_0001970 Ga0495587_0001970_5625_6452 252
577 3300046536 Ga0495587_0265446 Ga0495587_0265446_127_918 252
578 3300046543 Ga0495645_0205758 Ga0495645_0205758_332_1117 252
579 3300046557 Ga0495622_0000014 Ga0495622_0000014_125583_126410 252
580 3300046559 Ga0495667_0082143 Ga0495667_0082143_978_1742 252
581 3300046616 Ga0495668_0031957 Ga0495668_0031957_301_1095 252
582 3300046642 Ga0495634_0026899 Ga0495634_0026899_2769_3566 252
583 3300046660 Ga0495625_0000029 Ga0495625_0000029_4364_5155 252
584 3300046663 Ga0495635_0000009 Ga0495635_0000009_241116_241913 252
585 3300046675 Ga0495657_0000024 Ga0495657_0000024_10117_10902 252
586 3300046675 Ga0495657_0004915 Ga0495657_0004915_4397_5191 252
587 3300046675 Ga0495657_0213593 Ga0495657_0213593_199_969 252
588 3300046678 Ga0495599_0031412 Ga0495599_0031412_80_877 252
589 3300046681 Ga0495647_0000037 Ga0495647_0000037_13393_14193 252
590 3300046683 Ga0495658_0000019 Ga0495658_0000019_46543_47337 252
591 3300046684 Ga0495669_0000562 Ga0495669_0000562_773_1567 252
592 3300046689 Ga0495613_0000249 Ga0495613_0000249_17791_18585 252
593 3300046689 Ga0495613_0000309 Ga0495613_0000309_7067_7855 252
594 3300046690 Ga0495624_0000028 Ga0495624_0000028_25129_25926 252
595 3300046690 Ga0495624_0066552 Ga0495624_0066552_1159_1956 252
596 3300046691 Ga0495670_0017148 Ga0495670_0017148_1036_1836 252
597 3300046694 Ga0495649_0015920 Ga0495649_0015920_44_841 252
598 3300046809 Ga0495600_0003314 Ga0495600_0003314_4877_5665 252
599 3300046809 Ga0495600_0010047 Ga0495600_0010047_2447_3241 252
600 3300046809 Ga0495600_0041968 Ga0495600_0041968_890_1687 252
601 3300047315 Ga0495581_0069066 Ga0495581_0069066_662_1459 252
602 3300047317 Ga0495604_0000056 Ga0495604_0000056_21199_21996 252
603 3300047317 Ga0495604_0003466 Ga0495604_0003466_4902_5690 252
604 3300047317 Ga0495604_0006459 Ga0495604_0006459_4173_4961 252
605 3300047319 Ga0495674_0000042 Ga0495674_0000042_16175_16960 252
606 3300047321 Ga0495676_0000646 Ga0495676_0000646_1205_2002 252
607 3300047321 Ga0495676_0005236 Ga0495676_0005236_1424_2209 252
608 3300047321 Ga0495676_0138941 Ga0495676_0138941_62_856 252
609 3300047322 Ga0495680_0000023 Ga0495680_0000023_32462_33259 252
610 3300047322 Ga0495680_0000421 Ga0495680_0000421_23674_24468 252
611 3300047322 Ga0495680_0061884 Ga0495680_0061884_1030_1827 252
612 3300047444 Ga0495675_0000209 Ga0495675_0000209_10120_10905 252
613 3300047447 Ga0495685_019250 Ga0495685_019250_604_1401 252
614 3300047673 Ga0495593_0053085 Ga0495593_0053085_70_891 252
615 3300048903 Ga0496100_0000038 Ga0496100_0000038_83599_84384 252
616 3300048903 Ga0496100_0000116 Ga0496100_0000116_42074_42862 252
617 3300048903 Ga0496100_0161150 Ga0496100_0161150_173_943 252
618 3300048904 Ga0496101_0000003 Ga0496101_0000003_402858_403646 252
619 3300048904 Ga0496101_0000010 Ga0496101_0000010_14515_15300 252
620 3300048904 Ga0496101_0008544 Ga0496101_0008544_4361_5119 252
621 3300048905 Ga0496102_0027850 Ga0496102_0027850_717_1487 252
622 3300048905 Ga0496102_0130941 Ga0496102_0130941_1527_2297 252
623 3300048905 Ga0496102_0177626 Ga0496102_0177626_1076_1861 252
624 3300048906 Ga0496103_0036541 Ga0496103_0036541_327_1085 252
625 3300048906 Ga0496103_0129794 Ga0496103_0129794_652_1458 252
626 3300048906 Ga0496103_0252865 Ga0496103_0252865_276_1070 252
627 3300048907 Ga0496104_0000003 Ga0496104_0000003_177933_178727 252
628 3300048907 Ga0496104_0000576 Ga0496104_0000576_17579_18364 252
629 3300048907 Ga0496104_0007540 Ga0496104_0007540_7275_8033 252
630 3300048907 Ga0496104_0017150 Ga0496104_0017150_4365_5135 252
631 3300048907 Ga0496104_0020399 Ga0496104_0020399_298_1083 252
632 3300048907 Ga0496104_0310719 Ga0496104_0310719_684_1454 252
633 3300048908 Ga0496105_0000008 Ga0496105_0000008_294140_294934 252
634 3300048908 Ga0496105_0001400 Ga0496105_0001400_5753_6511 252
635 3300048908 Ga0496105_0009052 Ga0496105_0009052_2594_3379 252
636 3300048909 Ga0496106_0000018 Ga0496106_0000018_57979_58764 252
637 3300048909 Ga0496106_0000177 Ga0496106_0000177_2920_3708 252
638 3300048909 Ga0496106_0062443 Ga0496106_0062443_377_1135 252
639 3300048910 Ga0496107_0000032 Ga0496107_0000032_84597_85382 252
640 3300048910 Ga0496107_0000081 Ga0496107_0000081_2920_3708 252
641 3300048911 Ga0496108_0000002 Ga0496108_0000002_260550_261341 252
642 3300048911 Ga0496108_0000631 Ga0496108_0000631_22278_23042 252
643 3300048912 Ga0496109_0000001 Ga0496109_0000001_260512_261303 252
644 3300048912 Ga0496109_0000085 Ga0496109_0000085_94212_94976 252
645 3300048912 Ga0496109_0001613 Ga0496109_0001613_9644_10402 252
646 3300048912 Ga0496109_0228633 Ga0496109_0228633_298_1092 252
647 3300048913 Ga0496110_0000033 Ga0496110_0000033_64084_64881 252
648 3300048913 Ga0496110_0017994 Ga0496110_0017994_224_1018 252
649 3300048913 Ga0496110_0129358 Ga0496110_0129358_76_891 252
650 3300048914 Ga0496111_0001844 Ga0496111_0001844_10005_10802 252
651 3300048915 Ga0496112_0000002 Ga0496112_0000002_614192_614989 252
652 3300048915 Ga0496112_0017217 Ga0496112_0017217_69_872 252
653 3300048916 Ga0496113_0000007 Ga0496113_0000007_94973_95818 252
654 3300048917 Ga0496114_0009498 Ga0496114_0009498_476_1234 252
655 3300048917 Ga0496114_0587247 Ga0496114_0587247_94_879 252
656 3300048918 Ga0496115_0000020 Ga0496115_0000020_54582_55367 252
657 3300048918 Ga0496115_0005222 Ga0496115_0005222_1656_2414 252
658 3300048918 Ga0496115_0006918 Ga0496115_0006918_537_1307 252
659 3300048919 Ga0496116_0000780 Ga0496116_0000780_7798_8568 252
660 3300048920 Ga0496117_0015033 Ga0496117_0015033_2077_2847 252
661 3300048921 Ga0496118_0000174 Ga0496118_0000174_113271_114041 252
662 3300048921 Ga0496118_0088493 Ga0496118_0088493_661_1431 252
663 3300048922 Ga0496119_0004215 Ga0496119_0004215_7779_8549 252
664 3300048922 Ga0496119_0021993 Ga0496119_0021993_2984_3754 252
665 3300048924 Ga0496121_0005891 Ga0496121_0005891_4404_5198 252
666 3300048924 Ga0496121_0016585 Ga0496121_0016585_6221_6991 252
667 3300048924 Ga0496121_0082402 Ga0496121_0082402_1167_1964 252
668 3300048924 Ga0496121_0086517 Ga0496121_0086517_1477_2313 252
669 3300048927 Ga0496124_0115152 Ga0496124_0115152_1242_2039 252
670 3300048927 Ga0496124_0116434 Ga0496124_0116434_578_1384 252
671 3300048928 Ga0496125_0013994 Ga0496125_0013994_5356_6150 252
672 3300048928 Ga0496125_0289604 Ga0496125_0289604_219_989 252
673 3300049576 Ga0501040_0058110 Ga0501040_0058110_1346_2113 252
674 3300049579 Ga0501043_0371369 Ga0501043_0371369_224_994 252
675 3300049581 Ga0501047_0009620 Ga0501047_0009620_1895_2701 252
676 3300049582 Ga0501048_0071099 Ga0501048_0071099_719_1486 252
677 3300049584 Ga0501068_0018498 Ga0501068_0018498_127_894 252
678 3300049585 Ga0501069_0077986 Ga0501069_0077986_675_1442 252
679 3300049586 Ga0501070_0009281 Ga0501070_0009281_349_1164 252
680 3300049587 Ga0501071_0014797 Ga0501071_0014797_3106_3873 252
681 3300049588 Ga0501072_0152356 Ga0501072_0152356_266_1033 252
682 3300049590 Ga0501074_0044985 Ga0501074_0044985_61_858 252
683 3300049590 Ga0501074_0261410 Ga0501074_0261410_125_892 252
684 3300049592 Ga0501076_0090419 Ga0501076_0090419_589_1356 252
685 3300049741 Ga0501079_0171082 Ga0501079_0171082_416_1198 252
686 3300049741 Ga0501079_0255159 Ga0501079_0255159_265_1029 252
687 3300049744 Ga0501083_0021756 Ga0501083_0021756_2352_3158 252
688 3300049823 Ga0501044_0065287 Ga0501044_0065287_2695_3483 252
689 3300050511 nmdc:mga08y16_567673_c1 nmdc:mga08y16_567673_c1_55_843 252
690 3300053077 Ga0495601_0000097 Ga0495601_0000097_15837_16625 252
691 3300053077 Ga0495601_0008176 Ga0495601_0008176_3717_4502 252
692 3300053078 Ga0495612_0005844 Ga0495612_0005844_1814_2611 252
693 3300053084 Ga0495595_0000014 Ga0495595_0000014_134354_135139 252
694 3300053084 Ga0495595_0000109 Ga0495595_0000109_25877_26674 252
695 3300053085 Ga0495619_0000022 Ga0495619_0000022_127186_127986 252
696 3300053085 Ga0495619_0000319 Ga0495619_0000319_22777_23562 252
697 3300053094 Ga0500566_0005120 Ga0500566_0005120_3946_4731 252
698 3300053096 Ga0500641_0002398 Ga0500641_0002398_4369_5166 252
699 3300053119 Ga0500595_039603 Ga0500595_039603_232_1044 252
700 3300053123 Ga0500614_004265 Ga0500614_004265_1345_2139 252
701 3300054114 Ga0501084_0396990 Ga0501084_0396990_77_844 252
702 3300061719 Ga0466962_0049559 Ga0466962_0049559_1212_1982 252
703 3300005327 Ga0070658_10040957 Ga0070658_100409575 253
704 3300005336 Ga0070680_100220226 Ga0070680_1002202262 253
705 3300005339 Ga0070660_100078256 Ga0070660_1000782562 253
706 3300005436 Ga0070713_100374734 Ga0070713_1003747342 253
707 3300005444 Ga0070694_100034592 Ga0070694_1000345923 253
708 3300005458 Ga0070681_10034745 Ga0070681_100347455 253
709 3300005458 Ga0070681_10084225 Ga0070681_100842254 253
710 3300005530 Ga0070679_100126520 Ga0070679_1001265202 253
711 3300005535 Ga0070684_100424822 Ga0070684_1004248222 253
712 3300005547 Ga0070693_100146483 Ga0070693_1001464832 253
713 3300005563 Ga0068855_100060814 Ga0068855_1000608144 253
714 3300005614 Ga0068856_100074113 Ga0068856_1000741132 253
715 3300006163 Ga0070715_10228858 Ga0070715_102288581 253
716 3300006175 Ga0070712_100404597 Ga0070712_1004045972 253
717 3300006852 Ga0075433_10075025 Ga0075433_100750254 253
718 3300006871 Ga0075434_100191835 Ga0075434_1001918353 253
719 3300006914 Ga0075436_100448620 Ga0075436_1004486202 253
720 3300007076 Ga0075435_100037060 Ga0075435_1000370603 253
721 3300009147 Ga0114129_10013663 Ga0114129_1001366310 253
722 3300009174 Ga0105241_10189587 Ga0105241_101895872 253
723 3300009176 Ga0105242_10051900 Ga0105242_100519002 253
724 3300013105 Ga0157369_10068684 Ga0157369_100686843 253
725 3300013296 Ga0157374_10571808 Ga0157374_105718082 253
726 3300013297 Ga0157378_10461332 Ga0157378_104613322 253
727 3300020070 Ga0206356_10933897 Ga0206356_109338972 253
728 3300020082 Ga0206353_11051550 Ga0206353_110515502 253
729 3300025909 Ga0207705_10094717 Ga0207705_100947173 253
730 3300025912 Ga0207707_10092802 Ga0207707_100928023 253
731 3300025912 Ga0207707_10122363 Ga0207707_101223633 253
732 3300025915 Ga0207693_10093503 Ga0207693_100935032 253
733 3300025915 Ga0207693_10245339 Ga0207693_102453392 253
734 3300025916 Ga0207663_10099496 Ga0207663_100994962 253
735 3300025917 Ga0207660_10311908 Ga0207660_103119082 253
736 3300025919 Ga0207657_10082913 Ga0207657_100829134 253
737 3300025922 Ga0207646_10060981 Ga0207646_100609812 253
738 3300025949 Ga0207667_10611451 Ga0207667_106114512 253
739 3300026078 Ga0207702_10060671 Ga0207702_100606714 253
740 3300037312 Ga0395899_0107394 Ga0395899_0107394_1012_1782 253
741 3300037418 Ga0395900_0186535 Ga0395900_0186535_639_1409 253
742 3300037466 Ga0395898_0019644 Ga0395898_0019644_5221_5991 253
743 3300037471 Ga0395905_0025788 Ga0395905_0025788_2426_3196 253
744 3300037471 Ga0395905_0186330 Ga0395905_0186330_549_1325 253
745 3300038443 Ga0395901_0024834 Ga0395901_0024834_5346_6116 253
746 3300038443 Ga0395901_0153898 Ga0395901_0153898_855_1628 253
747 3300046459 Ga0495629_0088279 Ga0495629_0088279_542_1315 253
748 3300046461 Ga0495641_0082409 Ga0495641_0082409_94_867 253
749 3300046462 Ga0495651_0004887 Ga0495651_0004887_8156_8926 253
750 3300046463 Ga0495653_0010741 Ga0495653_0010741_2550_3323 253
751 3300046511 Ga0495608_0019149 Ga0495608_0019149_3732_4505 253
752 3300046516 Ga0495628_0073094 Ga0495628_0073094_121_891 253
753 3300046516 Ga0495628_0247640 Ga0495628_0247640_158_928 253
754 3300046517 Ga0495630_0318177 Ga0495630_0318177_188_961 253
755 3300046526 Ga0495666_0047579 Ga0495666_0047579_1069_1839 253
756 3300046529 Ga0495652_0168788 Ga0495652_0168788_372_1142 253
757 3300046533 Ga0495640_0001520 Ga0495640_0001520_9030_9803 253
758 3300046536 Ga0495587_0208484 Ga0495587_0208484_223_993 253
759 3300046543 Ga0495645_0061651 Ga0495645_0061651_1273_2043 253
760 3300046559 Ga0495667_0004189 Ga0495667_0004189_492_1265 253
761 3300046675 Ga0495657_0079758 Ga0495657_0079758_930_1703 253
762 3300046675 Ga0495657_0181127 Ga0495657_0181127_81_851 253
763 3300046678 Ga0495599_0193580 Ga0495599_0193580_42_815 253
764 3300046689 Ga0495613_0057044 Ga0495613_0057044_992_1765 253
765 3300046691 Ga0495670_0122393 Ga0495670_0122393_297_1073 253
766 3300047317 Ga0495604_0049521 Ga0495604_0049521_92_862 253
767 3300047317 Ga0495604_0087982 Ga0495604_0087982_1386_2159 253
768 3300047319 Ga0495674_0007533 Ga0495674_0007533_1191_1964 253
769 3300047319 Ga0495674_0124032 Ga0495674_0124032_1012_1782 253
770 3300047322 Ga0495680_0003583 Ga0495680_0003583_6776_7549 253
771 3300048088 Ga0495602_0178666 Ga0495602_0178666_543_1316 253
772 3300048903 Ga0496100_0010105 Ga0496100_0010105_3156_3920 253
773 3300048904 Ga0496101_0008537 Ga0496101_0008537_5599_6363 253
774 3300048905 Ga0496102_0077064 Ga0496102_0077064_603_1364 253
775 3300048906 Ga0496103_0021878 Ga0496103_0021878_2145_2906 253
776 3300048909 Ga0496106_0011021 Ga0496106_0011021_1244_2008 253
777 3300048914 Ga0496111_0125039 Ga0496111_0125039_511_1290 253
778 3300048915 Ga0496112_0016767 Ga0496112_0016767_2611_3372 253
779 3300048915 Ga0496112_0026222 Ga0496112_0026222_1997_2758 253
780 3300048915 Ga0496112_0051598 Ga0496112_0051598_2368_3129 253
781 3300048916 Ga0496113_0290973 Ga0496113_0290973_345_1106 253
782 3300048918 Ga0496115_0105769 Ga0496115_0105769_177_950 253
783 3300050510 nmdc:mga06r32_504525_c1 nmdc:mga06r32_504525_c1_24_797 253
784 3300050512 nmdc:mga0n895_108290_c1 nmdc:mga0n895_108290_c1_1387_2148 253
785 3300050514 nmdc:mga08x19_383629_c1 nmdc:mga08x19_383629_c1_140_901 253
786 3300050515 nmdc:mga0a205_54850_c1 nmdc:mga0a205_54850_c1_1391_2152 253
787 3300053077 Ga0495601_0139304 Ga0495601_0139304_385_1155 253
788 3300053083 Ga0495655_0001313 Ga0495655_0001313_812_1573 253
789 3300053085 Ga0495619_0069309 Ga0495619_0069309_28_801 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

32

246

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5njg-assembly1.cif.gz_B structure of an abc transporter: part of the structure that could be built de novo 0.6988 3 253
6hbu-assembly1.cif.gz_A cryo-em structure of the abcg2 e211q mutant bound to atp and magnesium 0.6944 4 246
5njg-assembly1.cif.gz_B structure of an abc transporter: part of the structure that could be built de novo 0.6924 3 253
8p8j-assembly1.cif.gz_B structure of 5d3-fab and nanobody(nb96)-bound abcg2 0.6863 4 246
5nj3-assembly1.cif.gz_A structure of an abc transporter: complete structure 0.682 3 253
ID Description Score Start End Superfamily
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7962 48 244 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.778 34 246 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7569 31 246 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6626 34 246 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6534 31 246 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A538ENL9-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9911 2 253 GO:0043190
GO:0140359
AF-A0A538CUW8-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9872 2 253 GO:0016020
GO:0140359
AF-A0A7V9D1C1-F1-model_v4 ABC transporter permease 0.9871 2 253 GO:0043190
GO:0140359
AF-A0A538CAD6-F1-model_v4 ABC transporter permease 0.9847 2 253 GO:0016020
GO:0140359
AF-A0A7K0RK29-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9834 2 252 GO:0043190
GO:0140359

Feature Viewer

pLDDT pTM Quality
92.55 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map