F480901
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 789 | 330 | 789 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10009448|Ga0157371_100094482 |
| Length | 282 |
| Sequence | VGGKRRPEDQAGADVSAPEVRPAAAQTTNMTTVAKAVAWRSIHNFLTNPAFLVPALVFPLFFFVSFAGGLSAIENVPGFDFPTGYTAFQFVFVLLQSAAFGGVFTGFGIARDFETGFARRYLLAASNRSGIVAGYAIAALIRAFVTWTVLTTVALVAGMNIGGSGGEIVALYALAILVNVAATMWSAGVAMRVRSIQGGPLMQFPTFLILFLAPVYVPLTLLSGWIHAVASINPVTALLEAGRGFISGDPTVVVLAFAIAFALPLIFALWARSGLRRAEAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 158 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 159 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 171 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 172 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 173 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 174 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 179 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 180 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 181 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 182 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 189 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 190 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 270 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 271 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 272 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 273 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 274 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 275 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 276 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 277 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 278 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 325 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 326 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 327 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 330 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.75 |
| Metatranscriptomes | 0.25 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.63 |
| Nodule | 0 |
| Rhizoplane | 12.55 |
| Rhizosphere | 83.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10040957 | 3300005327 | Bacteria | 3737 |
| 2 | Ga0070658_10144314 | 3300005327 | Bacteria | 1990 |
| 3 | Ga0070683_100000793 | 3300005329 | Bacteria | 23313 |
| 4 | Ga0070683_100001714 | 3300005329 | Bacteria | 17052 |
| 5 | Ga0070683_100013143 | 3300005329 | Bacteria | 7208 |
| 6 | Ga0070683_100043303 | 3300005329 | Bacteria | 4149 |
| 7 | Ga0070683_100108431 | 3300005329 | Bacteria | 2619 |
| 8 | Ga0070670_100044615 | 3300005331 | Bacteria | 3812 |
| 9 | Ga0070677_10000003 | 3300005333 | Bacteria | 81204 |
| 10 | Ga0068869_100342532 | 3300005334 | Bacteria | 1217 |
| 11 | Ga0070666_10003293 | 3300005335 | Bacteria | 9802 |
| 12 | Ga0070666_10085528 | 3300005335 | Bacteria | 2160 |
| 13 | Ga0070680_100065864 | 3300005336 | Bacteria | 2969 |
| 14 | Ga0070680_100220226 | 3300005336 | Bacteria | 1602 |
| 15 | Ga0070682_100000080 | 3300005337 | Bacteria | 85683 |
| 16 | Ga0070682_100000102 | 3300005337 | Bacteria | 76457 |
| 17 | Ga0070682_100172182 | 3300005337 | Bacteria | 1505 |
| 18 | Ga0070682_100255499 | 3300005337 | Bacteria | 1265 |
| 19 | Ga0068868_100000095 | 3300005338 | Bacteria | 54537 |
| 20 | Ga0070660_100078256 | 3300005339 | Bacteria | 2593 |
| 21 | Ga0070689_100072593 | 3300005340 | Bacteria | 2690 |
| 22 | Ga0070689_100505377 | 3300005340 | Unclassified | 1036 |
| 23 | Ga0070691_10000054 | 3300005341 | Bacteria | 32149 |
| 24 | Ga0070691_10008984 | 3300005341 | Bacteria | 4572 |
| 25 | Ga0070661_100000005 | 3300005344 | Bacteria | 220455 |
| 26 | Ga0070668_100008119 | 3300005347 | Bacteria | 7797 |
| 27 | Ga0070668_100148348 | 3300005347 | Bacteria | 1895 |
| 28 | Ga0070675_100000058 | 3300005354 | Bacteria | 66874 |
| 29 | Ga0070674_100000003 | 3300005356 | Bacteria | 258221 |
| 30 | Ga0070674_100000020 | 3300005356 | Bacteria | 88217 |
| 31 | Ga0070674_100023772 | 3300005356 | Bacteria | 3971 |
| 32 | Ga0070673_100013844 | 3300005364 | Bacteria | 5598 |
| 33 | Ga0070688_100000333 | 3300005365 | Bacteria | 24059 |
| 34 | Ga0070688_100002793 | 3300005365 | Bacteria | 8872 |
| 35 | Ga0070688_100396145 | 3300005365 | Bacteria | 1021 |
| 36 | Ga0070688_100486515 | 3300005365 | Bacteria | 928 |
| 37 | Ga0070667_100007958 | 3300005367 | Bacteria | 8790 |
| 38 | Ga0070667_100223189 | 3300005367 | Unclassified | 1678 |
| 39 | Ga0070714_100000243 | 3300005435 | Bacteria | 42598 |
| 40 | Ga0070714_100199562 | 3300005435 | Bacteria | 1829 |
| 41 | Ga0070713_100000138 | 3300005436 | Bacteria | 48026 |
| 42 | Ga0070713_100015507 | 3300005436 | Bacteria | 5702 |
| 43 | Ga0070713_100374734 | 3300005436 | Bacteria | 1325 |
| 44 | Ga0070710_10017787 | 3300005437 | Bacteria | 3646 |
| 45 | Ga0070710_10164320 | 3300005437 | Bacteria | 1379 |
| 46 | Ga0070710_10245347 | 3300005437 | Bacteria | 1149 |
| 47 | Ga0070711_100008345 | 3300005439 | Bacteria | 6342 |
| 48 | Ga0070711_100043089 | 3300005439 | Bacteria | 3055 |
| 49 | Ga0070711_100252527 | 3300005439 | Bacteria | 1384 |
| 50 | Ga0070694_100034592 | 3300005444 | Bacteria | 3333 |
| 51 | Ga0070708_100025820 | 3300005445 | Bacteria | 5023 |
| 52 | Ga0070663_100085873 | 3300005455 | Bacteria | 2323 |
| 53 | Ga0070678_100004162 | 3300005456 | Bacteria | 8159 |
| 54 | Ga0070662_100000363 | 3300005457 | Bacteria | 27116 |
| 55 | Ga0070681_10005901 | 3300005458 | Bacteria | 11857 |
| 56 | Ga0070681_10034745 | 3300005458 | Bacteria | 5062 |
| 57 | Ga0070681_10040325 | 3300005458 | Bacteria | 4678 |
| 58 | Ga0070681_10084225 | 3300005458 | Bacteria | 3132 |
| 59 | Ga0068867_100000179 | 3300005459 | Bacteria | 41694 |
| 60 | Ga0070685_10000293 | 3300005466 | Bacteria | 31562 |
| 61 | Ga0070706_100099695 | 3300005467 | Bacteria | 2699 |
| 62 | Ga0070698_100008430 | 3300005471 | Bacteria | 11141 |
| 63 | Ga0070699_100691064 | 3300005518 | Unclassified | 932 |
| 64 | Ga0070679_100000537 | 3300005530 | Bacteria | 32232 |
| 65 | Ga0070679_100048185 | 3300005530 | Bacteria | 4246 |
| 66 | Ga0070679_100126520 | 3300005530 | Bacteria | 2538 |
| 67 | Ga0070684_100003511 | 3300005535 | Bacteria | 11778 |
| 68 | Ga0070684_100163543 | 3300005535 | Bacteria | 2020 |
| 69 | Ga0070684_100223350 | 3300005535 | Unclassified | 1719 |
| 70 | Ga0070684_100424822 | 3300005535 | Bacteria | 1227 |
| 71 | Ga0070697_100114251 | 3300005536 | Bacteria | 2253 |
| 72 | Ga0068853_100002080 | 3300005539 | Bacteria | 14840 |
| 73 | Ga0068853_100483223 | 3300005539 | Bacteria | 1168 |
| 74 | Ga0070672_100000004 | 3300005543 | Bacteria | 129970 |
| 75 | Ga0070696_100084495 | 3300005546 | Bacteria | 2252 |
| 76 | Ga0070696_100577520 | 3300005546 | Bacteria | 904 |
| 77 | Ga0070693_100000833 | 3300005547 | Bacteria | 13687 |
| 78 | Ga0070693_100016010 | 3300005547 | Bacteria | 3874 |
| 79 | Ga0070693_100146483 | 3300005547 | Unclassified | 1492 |
| 80 | Ga0070665_100000159 | 3300005548 | Bacteria | 122613 |
| 81 | Ga0070665_100002822 | 3300005548 | Bacteria | 18813 |
| 82 | Ga0070665_100219516 | 3300005548 | Unclassified | 1901 |
| 83 | Ga0070665_100579522 | 3300005548 | Bacteria | 1135 |
| 84 | Ga0070665_100685624 | 3300005548 | Bacteria | 1038 |
| 85 | Ga0070665_100765282 | 3300005548 | Unclassified | 979 |
| 86 | Ga0068855_100060814 | 3300005563 | Bacteria | 4415 |
| 87 | Ga0068854_100006423 | 3300005578 | Bacteria | 7476 |
| 88 | Ga0068854_100012863 | 3300005578 | Bacteria | 5482 |
| 89 | Ga0068854_100324349 | 3300005578 | Bacteria | 1253 |
| 90 | Ga0068854_100327648 | 3300005578 | Bacteria | 1247 |
| 91 | Ga0068854_100589319 | 3300005578 | Unclassified | 948 |
| 92 | Ga0068856_100018421 | 3300005614 | Bacteria | 6768 |
| 93 | Ga0068856_100023907 | 3300005614 | Bacteria | 5944 |
| 94 | Ga0068856_100074113 | 3300005614 | Bacteria | 3370 |
| 95 | Ga0068856_100074564 | 3300005614 | Bacteria | 3360 |
| 96 | Ga0068856_100395026 | 3300005614 | Bacteria | 1402 |
| 97 | Ga0068852_100000012 | 3300005616 | Bacteria | 140734 |
| 98 | Ga0068859_100808532 | 3300005617 | Unclassified | 1025 |
| 99 | Ga0068864_100026224 | 3300005618 | Bacteria | 4914 |
| 100 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 101 | Ga0068866_10000019 | 3300005718 | Bacteria | 64778 |
| 102 | Ga0068851_10002153 | 3300005834 | Bacteria | 8660 |
| 103 | Ga0068870_10066166 | 3300005840 | Bacteria | 1957 |
| 104 | Ga0068863_100000032 | 3300005841 | Bacteria | 172402 |
| 105 | Ga0068858_100000049 | 3300005842 | Bacteria | 122693 |
| 106 | Ga0068858_100006307 | 3300005842 | Bacteria | 11549 |
| 107 | Ga0068858_100049480 | 3300005842 | Bacteria | 3893 |
| 108 | Ga0068858_100239891 | 3300005842 | Bacteria | 1720 |
| 109 | Ga0068862_100002825 | 3300005844 | Bacteria | 15226 |
| 110 | Ga0081455_10009498 | 3300005937 | Bacteria | 9996 |
| 111 | Ga0081538_10081463 | 3300005981 | Bacteria | 1721 |
| 112 | Ga0081540_1000006 | 3300005983 | Bacteria | 208724 |
| 113 | Ga0081539_10000473 | 3300005985 | Bacteria | 85174 |
| 114 | Ga0081539_10002242 | 3300005985 | Bacteria | 28126 |
| 115 | Ga0081539_10119888 | 3300005985 | Bacteria | 1309 |
| 116 | Ga0070717_10075881 | 3300006028 | Unclassified | 2812 |
| 117 | Ga0075363_100299345 | 3300006048 | Bacteria | 933 |
| 118 | Ga0070715_10000012 | 3300006163 | Bacteria | 173731 |
| 119 | Ga0070715_10064513 | 3300006163 | Bacteria | 1618 |
| 120 | Ga0070715_10103001 | 3300006163 | Bacteria | 1335 |
| 121 | Ga0070715_10228858 | 3300006163 | Bacteria | 960 |
| 122 | Ga0070716_100146589 | 3300006173 | Bacteria | 1513 |
| 123 | Ga0070712_100000777 | 3300006175 | Bacteria | 18846 |
| 124 | Ga0070712_100100853 | 3300006175 | Bacteria | 2134 |
| 125 | Ga0070712_100404597 | 3300006175 | Bacteria | 1128 |
| 126 | Ga0075428_100021945 | 3300006844 | Bacteria | 7071 |
| 127 | Ga0075430_100027536 | 3300006846 | Bacteria | 4828 |
| 128 | Ga0075431_100036575 | 3300006847 | Bacteria | 5057 |
| 129 | Ga0075431_100065779 | 3300006847 | Bacteria | 3743 |
| 130 | Ga0075433_10027284 | 3300006852 | Bacteria | 4841 |
| 131 | Ga0075433_10037865 | 3300006852 | Bacteria | 4162 |
| 132 | Ga0075433_10075025 | 3300006852 | Bacteria | 2976 |
| 133 | Ga0075433_10243789 | 3300006852 | Bacteria | 1595 |
| 134 | Ga0075434_100007144 | 3300006871 | Bacteria | 10320 |
| 135 | Ga0075434_100191835 | 3300006871 | Bacteria | 2064 |
| 136 | Ga0075434_100370372 | 3300006871 | Unclassified | 1453 |
| 137 | Ga0075436_100043703 | 3300006914 | Bacteria | 3089 |
| 138 | Ga0075436_100047633 | 3300006914 | Bacteria | 2956 |
| 139 | Ga0075436_100219177 | 3300006914 | Bacteria | 1350 |
| 140 | Ga0075436_100448620 | 3300006914 | Bacteria | 939 |
| 141 | Ga0097620_100808453 | 3300006931 | Unclassified | 1025 |
| 142 | Ga0075435_100007136 | 3300007076 | Bacteria | 7939 |
| 143 | Ga0075435_100037060 | 3300007076 | Bacteria | 3881 |
| 144 | Ga0075435_100171504 | 3300007076 | Bacteria | 1830 |
| 145 | Ga0075435_100447733 | 3300007076 | Bacteria | 1113 |
| 146 | Ga0111539_10057025 | 3300009094 | Bacteria | 4640 |
| 147 | Ga0111539_10242677 | 3300009094 | Bacteria | 2097 |
| 148 | Ga0111539_10331616 | 3300009094 | Bacteria | 1771 |
| 149 | Ga0105245_10000056 | 3300009098 | Bacteria | 124109 |
| 150 | Ga0105245_10000290 | 3300009098 | Bacteria | 47991 |
| 151 | Ga0105245_10001677 | 3300009098 | Bacteria | 20157 |
| 152 | Ga0105245_10003691 | 3300009098 | Bacteria | 13667 |
| 153 | Ga0105245_10359013 | 3300009098 | Bacteria | 1446 |
| 154 | Ga0105247_10000202 | 3300009101 | Bacteria | 58345 |
| 155 | Ga0105247_10109935 | 3300009101 | Bacteria | 1773 |
| 156 | Ga0105247_10272342 | 3300009101 | Bacteria | 1165 |
| 157 | Ga0105247_10409945 | 3300009101 | Unclassified | 968 |
| 158 | Ga0114129_10001119 | 3300009147 | Bacteria | 35383 |
| 159 | Ga0114129_10013663 | 3300009147 | Bacteria | 11570 |
| 160 | Ga0114129_10029165 | 3300009147 | Bacteria | 7817 |
| 161 | Ga0114129_10467965 | 3300009147 | Unclassified | 1651 |
| 162 | Ga0105243_10285969 | 3300009148 | Bacteria | 1488 |
| 163 | Ga0105243_10345353 | 3300009148 | Bacteria | 1365 |
| 164 | Ga0105241_10081860 | 3300009174 | Bacteria | 2530 |
| 165 | Ga0105241_10189587 | 3300009174 | Bacteria | 1711 |
| 166 | Ga0105242_10016975 | 3300009176 | Bacteria | 5667 |
| 167 | Ga0105242_10051900 | 3300009176 | Bacteria | 3344 |
| 168 | Ga0105242_10068974 | 3300009176 | Bacteria | 2927 |
| 169 | Ga0105248_10000032 | 3300009177 | Bacteria | 201114 |
| 170 | Ga0105238_10670934 | 3300009551 | Bacteria | 1048 |
| 171 | Ga0105249_10000073 | 3300009553 | Bacteria | 145660 |
| 172 | Ga0105249_10020406 | 3300009553 | Bacteria | 5925 |
| 173 | Ga0157371_10009448 | 3300013102 | Bacteria | 7674 |
| 174 | Ga0157370_10005853 | 3300013104 | Bacteria | 13734 |
| 175 | Ga0157370_10007615 | 3300013104 | Bacteria | 11762 |
| 176 | Ga0157369_10000099 | 3300013105 | Bacteria | 120032 |
| 177 | Ga0157369_10068684 | 3300013105 | Bacteria | 3807 |
| 178 | Ga0157374_10571808 | 3300013296 | Bacteria | 1139 |
| 179 | Ga0157378_10010497 | 3300013297 | Bacteria | 8091 |
| 180 | Ga0157378_10016775 | 3300013297 | Bacteria | 6418 |
| 181 | Ga0157378_10074162 | 3300013297 | Bacteria | 3061 |
| 182 | Ga0157378_10461332 | 3300013297 | Bacteria | 1262 |
| 183 | Ga0163162_10081431 | 3300013306 | Bacteria | 3308 |
| 184 | Ga0157372_10365990 | 3300013307 | Bacteria | 1680 |
| 185 | Ga0157375_10000707 | 3300013308 | Bacteria | 29426 |
| 186 | Ga0157375_10539542 | 3300013308 | Bacteria | 1329 |
| 187 | Ga0163163_10119806 | 3300014325 | Bacteria | 2665 |
| 188 | Ga0157380_10000219 | 3300014326 | Bacteria | 34156 |
| 189 | Ga0157380_10003655 | 3300014326 | Bacteria | 10579 |
| 190 | Ga0157380_10052162 | 3300014326 | Bacteria | 3237 |
| 191 | Ga0157379_10040899 | 3300014968 | Bacteria | 4138 |
| 192 | Ga0157379_10346924 | 3300014968 | Bacteria | 1358 |
| 193 | Ga0157376_10121124 | 3300014969 | Bacteria | 2319 |
| 194 | Ga0157376_10643395 | 3300014969 | Bacteria | 1060 |
| 195 | Ga0157376_10767140 | 3300014969 | Unclassified | 975 |
| 196 | Ga0163161_10000058 | 3300017792 | Bacteria | 114035 |
| 197 | Ga0163161_10014924 | 3300017792 | Bacteria | 5411 |
| 198 | Ga0206356_10933897 | 3300020070 | Unclassified | 1875 |
| 199 | Ga0206353_11051550 | 3300020082 | Bacteria | 1498 |
| 200 | Ga0213876_10098728 | 3300021384 | Unclassified | 1548 |
| 201 | Ga0213875_10000468 | 3300021388 | Bacteria | 34648 |
| 202 | Ga0207656_10032149 | 3300025321 | Bacteria | 2178 |
| 203 | Ga0207682_10000052 | 3300025893 | Bacteria | 49191 |
| 204 | Ga0207692_10040358 | 3300025898 | Bacteria | 2303 |
| 205 | Ga0207692_10052115 | 3300025898 | Unclassified | 2078 |
| 206 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 207 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 208 | Ga0207642_10000004 | 3300025899 | Bacteria | 407822 |
| 209 | Ga0207642_10000017 | 3300025899 | Bacteria | 64774 |
| 210 | Ga0207710_10000369 | 3300025900 | Bacteria | 31539 |
| 211 | Ga0207680_10002430 | 3300025903 | Bacteria | 8684 |
| 212 | Ga0207680_10166999 | 3300025903 | Bacteria | 1480 |
| 213 | Ga0207685_10112614 | 3300025905 | Bacteria | 1182 |
| 214 | Ga0207705_10049419 | 3300025909 | Bacteria | 3027 |
| 215 | Ga0207705_10094717 | 3300025909 | Bacteria | 2190 |
| 216 | Ga0207654_10079660 | 3300025911 | Bacteria | 1968 |
| 217 | Ga0207654_10121817 | 3300025911 | Bacteria | 1639 |
| 218 | Ga0207707_10092802 | 3300025912 | Bacteria | 2637 |
| 219 | Ga0207707_10122363 | 3300025912 | Bacteria | 2275 |
| 220 | Ga0207695_10560577 | 3300025913 | Bacteria | 1024 |
| 221 | Ga0207693_10008860 | 3300025915 | Bacteria | 8219 |
| 222 | Ga0207693_10043531 | 3300025915 | Bacteria | 3532 |
| 223 | Ga0207693_10053039 | 3300025915 | Bacteria | 3181 |
| 224 | Ga0207693_10093503 | 3300025915 | Bacteria | 2357 |
| 225 | Ga0207693_10245339 | 3300025915 | Bacteria | 1406 |
| 226 | Ga0207663_10031736 | 3300025916 | Bacteria | 3130 |
| 227 | Ga0207663_10099496 | 3300025916 | Bacteria | 1949 |
| 228 | Ga0207660_10067787 | 3300025917 | Bacteria | 2586 |
| 229 | Ga0207660_10123298 | 3300025917 | Bacteria | 1965 |
| 230 | Ga0207660_10311908 | 3300025917 | Bacteria | 1254 |
| 231 | Ga0207657_10082913 | 3300025919 | Bacteria | 2690 |
| 232 | Ga0207649_10000005 | 3300025920 | Bacteria | 356179 |
| 233 | Ga0207652_10000631 | 3300025921 | Bacteria | 34868 |
| 234 | Ga0207646_10060981 | 3300025922 | Bacteria | 3367 |
| 235 | Ga0207646_10315543 | 3300025922 | Bacteria | 1412 |
| 236 | Ga0207650_10025386 | 3300025925 | Bacteria | 4221 |
| 237 | Ga0207659_10000020 | 3300025926 | Bacteria | 151552 |
| 238 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 239 | Ga0207687_10000012 | 3300025927 | Bacteria | 370729 |
| 240 | Ga0207687_10000646 | 3300025927 | Bacteria | 23464 |
| 241 | Ga0207687_10000970 | 3300025927 | Bacteria | 19492 |
| 242 | Ga0207687_10084136 | 3300025927 | Bacteria | 2305 |
| 243 | Ga0207700_10000008 | 3300025928 | Bacteria | 341717 |
| 244 | Ga0207700_10000016 | 3300025928 | Bacteria | 202434 |
| 245 | Ga0207700_10086661 | 3300025928 | Bacteria | 2461 |
| 246 | Ga0207700_10207811 | 3300025928 | Unclassified | 1653 |
| 247 | Ga0207700_10397504 | 3300025928 | Bacteria | 1207 |
| 248 | Ga0207664_10000013 | 3300025929 | Bacteria | 260716 |
| 249 | Ga0207664_10110118 | 3300025929 | Bacteria | 2289 |
| 250 | Ga0207664_10154503 | 3300025929 | Bacteria | 1952 |
| 251 | Ga0207644_10123003 | 3300025931 | Bacteria | 1978 |
| 252 | Ga0207690_10008415 | 3300025932 | Bacteria | 6126 |
| 253 | Ga0207706_10000006 | 3300025933 | Bacteria | 216994 |
| 254 | Ga0207686_10006424 | 3300025934 | Bacteria | 6327 |
| 255 | Ga0207686_10024357 | 3300025934 | Bacteria | 3507 |
| 256 | Ga0207670_10259273 | 3300025936 | Unclassified | 1347 |
| 257 | Ga0207669_10000016 | 3300025937 | Bacteria | 124532 |
| 258 | Ga0207669_10000036 | 3300025937 | Bacteria | 78568 |
| 259 | Ga0207665_10020351 | 3300025939 | Bacteria | 4359 |
| 260 | Ga0207665_10182274 | 3300025939 | Bacteria | 1521 |
| 261 | Ga0207691_10000020 | 3300025940 | Bacteria | 133465 |
| 262 | Ga0207711_10000020 | 3300025941 | Bacteria | 363325 |
| 263 | Ga0207689_10264829 | 3300025942 | Bacteria | 1422 |
| 264 | Ga0207661_10001238 | 3300025944 | Bacteria | 17056 |
| 265 | Ga0207661_10001949 | 3300025944 | Bacteria | 14185 |
| 266 | Ga0207661_10008416 | 3300025944 | Bacteria | 7373 |
| 267 | Ga0207661_10030009 | 3300025944 | Bacteria | 4182 |
| 268 | Ga0207661_10062095 | 3300025944 | Bacteria | 3022 |
| 269 | Ga0207679_10025975 | 3300025945 | Bacteria | 4034 |
| 270 | Ga0207667_10611451 | 3300025949 | Unclassified | 1098 |
| 271 | Ga0207651_10008445 | 3300025960 | Bacteria | 5563 |
| 272 | Ga0207651_10041883 | 3300025960 | Bacteria | 3044 |
| 273 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 274 | Ga0207712_10235415 | 3300025961 | Bacteria | 1472 |
| 275 | Ga0207712_10331831 | 3300025961 | Bacteria | 1258 |
| 276 | Ga0207668_10044746 | 3300025972 | Bacteria | 3014 |
| 277 | Ga0207640_10000285 | 3300025981 | Bacteria | 33957 |
| 278 | Ga0207640_10002518 | 3300025981 | Bacteria | 9823 |
| 279 | Ga0207640_10168323 | 3300025981 | Bacteria | 1630 |
| 280 | Ga0207677_10001435 | 3300026023 | Bacteria | 12669 |
| 281 | Ga0207703_10000053 | 3300026035 | Bacteria | 143924 |
| 282 | Ga0207703_10000067 | 3300026035 | Bacteria | 125623 |
| 283 | Ga0207703_10073601 | 3300026035 | Bacteria | 2827 |
| 284 | Ga0207703_10109546 | 3300026035 | Bacteria | 2354 |
| 285 | Ga0207639_10001671 | 3300026041 | Bacteria | 14960 |
| 286 | Ga0207678_10063204 | 3300026067 | Bacteria | 3181 |
| 287 | Ga0207708_10514108 | 3300026075 | Bacteria | 1005 |
| 288 | Ga0207702_10000016 | 3300026078 | Bacteria | 226633 |
| 289 | Ga0207702_10003815 | 3300026078 | Bacteria | 13603 |
| 290 | Ga0207702_10060671 | 3300026078 | Bacteria | 3224 |
| 291 | Ga0207702_10192541 | 3300026078 | Bacteria | 1885 |
| 292 | Ga0207641_10000071 | 3300026088 | Bacteria | 151812 |
| 293 | Ga0207641_10008529 | 3300026088 | Bacteria | 8466 |
| 294 | Ga0207648_10000228 | 3300026089 | Bacteria | 60032 |
| 295 | Ga0207676_10194051 | 3300026095 | Bacteria | 1789 |
| 296 | Ga0207674_10275630 | 3300026116 | Bacteria | 1630 |
| 297 | Ga0207683_10006404 | 3300026121 | Bacteria | 10083 |
| 298 | Ga0207683_10297110 | 3300026121 | Bacteria | 1477 |
| 299 | Ga0207698_10000012 | 3300026142 | Bacteria | 260061 |
| 300 | Ga0207428_10076863 | 3300027907 | Bacteria | 2614 |
| 301 | Ga0207428_10181623 | 3300027907 | Bacteria | 1589 |
| 302 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 303 | Ga0268266_10000553 | 3300028379 | Bacteria | 52199 |
| 304 | Ga0268266_10002681 | 3300028379 | Bacteria | 18711 |
| 305 | Ga0268266_10513070 | 3300028379 | Unclassified | 1145 |
| 306 | Ga0268265_10011815 | 3300028380 | Bacteria | 5903 |
| 307 | Ga0268264_10007216 | 3300028381 | Bacteria | 9306 |
| 308 | Ga0265338_10058061 | 3300028800 | Bacteria | 3419 |
| 309 | Ga0307406_10536645 | 3300031901 | Unclassified | 955 |
| 310 | Ga0307415_100000648 | 3300032126 | Bacteria | 15309 |
| 311 | Ga0373926_0071554 | 3300035083 | Bacteria | 1275 |
| 312 | Ga0373944_0016363 | 3300035089 | Bacteria | 2090 |
| 313 | Ga0373945_0004604 | 3300035116 | Bacteria | 4390 |
| 314 | Ga0373943_0000090 | 3300035170 | Bacteria | 33196 |
| 315 | Ga0373943_0007558 | 3300035170 | Bacteria | 4881 |
| 316 | Ga0373946_0007850 | 3300035171 | Bacteria | 3916 |
| 317 | Ga0373946_0013315 | 3300035171 | Bacteria | 3091 |
| 318 | Ga0373927_0074898 | 3300035695 | Bacteria | 2192 |
| 319 | Ga0373947_0000266 | 3300035725 | Bacteria | 29609 |
| 320 | Ga0373947_0001538 | 3300035725 | Bacteria | 14146 |
| 321 | Ga0373925_0001866 | 3300037068 | Bacteria | 17533 |
| 322 | Ga0373925_0215933 | 3300037068 | Bacteria | 1529 |
| 323 | Ga0395899_0001477 | 3300037312 | Bacteria | 20007 |
| 324 | Ga0395899_0107394 | 3300037312 | Bacteria | 2009 |
| 325 | Ga0395900_0014343 | 3300037418 | Bacteria | 8091 |
| 326 | Ga0395900_0186535 | 3300037418 | Unclassified | 2105 |
| 327 | Ga0395900_0252312 | 3300037418 | Bacteria | 1765 |
| 328 | Ga0395898_0019644 | 3300037466 | Bacteria | 6872 |
| 329 | Ga0395898_0036814 | 3300037466 | Bacteria | 4856 |
| 330 | Ga0395905_0020023 | 3300037471 | Bacteria | 6339 |
| 331 | Ga0395905_0025788 | 3300037471 | Bacteria | 5542 |
| 332 | Ga0395905_0186330 | 3300037471 | Bacteria | 1948 |
| 333 | Ga0436364_0309695 | 3300037853 | Bacteria | 1589 |
| 334 | Ga0436364_1031907 | 3300037853 | Bacteria | 102112 |
| 335 | Ga0436364_1133006 | 3300037853 | Bacteria | 892 |
| 336 | Ga0395901_0000856 | 3300038443 | Bacteria | 33489 |
| 337 | Ga0395901_0011639 | 3300038443 | Bacteria | 8909 |
| 338 | Ga0395901_0024834 | 3300038443 | Bacteria | 6151 |
| 339 | Ga0395901_0153898 | 3300038443 | Unclassified | 2415 |
| 340 | Ga0436365_0328253 | 3300039437 | Unclassified | 1843 |
| 341 | Ga0436365_0329149 | 3300039437 | Bacteria | 12480 |
| 342 | Ga0436362_0533856 | 3300039453 | Unclassified | 1238 |
| 343 | Ga0451789_0027790 | 3300041443 | Bacteria | 2341 |
| 344 | Ga0451791_1163314 | 3300041451 | Bacteria | 1404 |
| 345 | Ga0451793_0300818 | 3300041452 | Bacteria | 2035 |
| 346 | Ga0451807_2280868 | 3300041486 | Bacteria | 2010 |
| 347 | Ga0451853_0384465 | 3300041512 | Bacteria | 6514 |
| 348 | Ga0451853_1991254 | 3300041512 | Unclassified | 1239 |
| 349 | Ga0451853_2081083 | 3300041512 | Bacteria | 1700 |
| 350 | Ga0439431_0025850 | 3300041997 | Bacteria | 1436 |
| 351 | Ga0439433_0006334 | 3300041999 | Bacteria | 2547 |
| 352 | Ga0439462_0004636 | 3300042015 | Bacteria | 3362 |
| 353 | Ga0439446_0000927 | 3300042156 | Bacteria | 6339 |
| 354 | Ga0466966_0208199 | 3300044684 | Unclassified | 1182 |
| 355 | Ga0466961_0338983 | 3300044693 | Bacteria | 916 |
| 356 | Ga0466961_0350564 | 3300044693 | Bacteria | 898 |
| 357 | Ga0466963_0000070 | 3300044694 | Bacteria | 35676 |
| 358 | Ga0466963_0079187 | 3300044694 | Bacteria | 2223 |
| 359 | Ga0466963_0207075 | 3300044694 | Unclassified | 1372 |
| 360 | Ga0466964_0174965 | 3300044706 | Bacteria | 1014 |
| 361 | Ga0466957_0003681 | 3300044842 | Bacteria | 8460 |
| 362 | Ga0466960_0226618 | 3300044901 | Bacteria | 1030 |
| 363 | Ga0466959_0252775 | 3300045049 | Bacteria | 1215 |
| 364 | Ga0466958_0112295 | 3300045836 | Bacteria | 1701 |
| 365 | Ga0466967_0000046 | 3300045976 | Bacteria | 43911 |
| 366 | Ga0466967_0261967 | 3300045976 | Bacteria | 1654 |
| 367 | Ga0466967_0738415 | 3300045976 | Bacteria | 976 |
| 368 | Ga0495592_0000621 | 3300046454 | Bacteria | 24971 |
| 369 | Ga0495592_0164449 | 3300046454 | Unclassified | 1524 |
| 370 | Ga0495592_0213460 | 3300046454 | Bacteria | 1295 |
| 371 | Ga0495603_0001473 | 3300046455 | Bacteria | 13710 |
| 372 | Ga0495603_0003021 | 3300046455 | Bacteria | 9967 |
| 373 | Ga0495603_0077607 | 3300046455 | Bacteria | 1948 |
| 374 | Ga0495629_0002088 | 3300046459 | Bacteria | 15500 |
| 375 | Ga0495629_0005520 | 3300046459 | Bacteria | 9437 |
| 376 | Ga0495629_0007647 | 3300046459 | Bacteria | 7957 |
| 377 | Ga0495629_0019746 | 3300046459 | Bacteria | 4810 |
| 378 | Ga0495629_0088279 | 3300046459 | Bacteria | 2163 |
| 379 | Ga0495629_0129808 | 3300046459 | Bacteria | 1755 |
| 380 | Ga0495638_0009398 | 3300046460 | Bacteria | 6872 |
| 381 | Ga0495641_0003321 | 3300046461 | Bacteria | 12113 |
| 382 | Ga0495641_0005538 | 3300046461 | Bacteria | 8483 |
| 383 | Ga0495641_0015104 | 3300046461 | Bacteria | 4144 |
| 384 | Ga0495641_0082409 | 3300046461 | Bacteria | 1440 |
| 385 | Ga0495651_0004887 | 3300046462 | Bacteria | 10251 |
| 386 | Ga0495651_0024849 | 3300046462 | Bacteria | 4661 |
| 387 | Ga0495651_0192164 | 3300046462 | Bacteria | 1436 |
| 388 | Ga0495653_0010741 | 3300046463 | Bacteria | 7498 |
| 389 | Ga0495653_0032140 | 3300046463 | Bacteria | 4170 |
| 390 | Ga0495653_0099929 | 3300046463 | Bacteria | 2104 |
| 391 | Ga0495580_0022051 | 3300046472 | Bacteria | 4693 |
| 392 | Ga0495582_0000005 | 3300046473 | Bacteria | 156170 |
| 393 | Ga0495582_0000801 | 3300046473 | Bacteria | 17458 |
| 394 | Ga0495582_0037719 | 3300046473 | Bacteria | 2658 |
| 395 | Ga0495582_0113618 | 3300046473 | Bacteria | 1522 |
| 396 | Ga0495582_0116493 | 3300046473 | Bacteria | 1503 |
| 397 | Ga0495639_0002081 | 3300046475 | Bacteria | 8857 |
| 398 | Ga0495639_0058412 | 3300046475 | Bacteria | 1764 |
| 399 | Ga0495639_0138624 | 3300046475 | Bacteria | 1168 |
| 400 | Ga0495662_0000022 | 3300046476 | Bacteria | 54342 |
| 401 | Ga0495662_0000984 | 3300046476 | Bacteria | 13942 |
| 402 | Ga0495664_0000012 | 3300046477 | Bacteria | 226118 |
| 403 | Ga0495664_0052360 | 3300046477 | Bacteria | 2425 |
| 404 | Ga0495584_0163949 | 3300046491 | Bacteria | 1130 |
| 405 | Ga0495584_0225562 | 3300046491 | Bacteria | 952 |
| 406 | Ga0495594_0000013 | 3300046499 | Bacteria | 103201 |
| 407 | Ga0495594_0000157 | 3300046499 | Bacteria | 32522 |
| 408 | Ga0495594_0027397 | 3300046499 | Bacteria | 3071 |
| 409 | Ga0495606_0000211 | 3300046507 | Bacteria | 103386 |
| 410 | Ga0495608_0000031 | 3300046511 | Bacteria | 145255 |
| 411 | Ga0495608_0000406 | 3300046511 | Bacteria | 30178 |
| 412 | Ga0495608_0010782 | 3300046511 | Bacteria | 6370 |
| 413 | Ga0495608_0019149 | 3300046511 | Bacteria | 4717 |
| 414 | Ga0495608_0107463 | 3300046511 | Bacteria | 1795 |
| 415 | Ga0495608_0265658 | 3300046511 | Unclassified | 1067 |
| 416 | Ga0495618_0000068 | 3300046514 | Bacteria | 74614 |
| 417 | Ga0495620_0000315 | 3300046515 | Bacteria | 34463 |
| 418 | Ga0495628_0000323 | 3300046516 | Bacteria | 43212 |
| 419 | Ga0495628_0036648 | 3300046516 | Bacteria | 3935 |
| 420 | Ga0495628_0039578 | 3300046516 | Bacteria | 3770 |
| 421 | Ga0495628_0069964 | 3300046516 | Bacteria | 2736 |
| 422 | Ga0495628_0073094 | 3300046516 | Bacteria | 2672 |
| 423 | Ga0495628_0172280 | 3300046516 | Bacteria | 1641 |
| 424 | Ga0495628_0188052 | 3300046516 | Bacteria | 1560 |
| 425 | Ga0495628_0247640 | 3300046516 | Bacteria | 1331 |
| 426 | Ga0495630_0000018 | 3300046517 | Bacteria | 186064 |
| 427 | Ga0495630_0005899 | 3300046517 | Bacteria | 8659 |
| 428 | Ga0495630_0020993 | 3300046517 | Bacteria | 4821 |
| 429 | Ga0495630_0064242 | 3300046517 | Bacteria | 2757 |
| 430 | Ga0495630_0318177 | 3300046517 | Bacteria | 1189 |
| 431 | Ga0495644_0000954 | 3300046523 | Bacteria | 11954 |
| 432 | Ga0495666_0016257 | 3300046526 | Bacteria | 3706 |
| 433 | Ga0495666_0047579 | 3300046526 | Bacteria | 2066 |
| 434 | Ga0495652_0000003 | 3300046529 | Bacteria | 597094 |
| 435 | Ga0495652_0147980 | 3300046529 | Bacteria | 1838 |
| 436 | Ga0495652_0168788 | 3300046529 | Bacteria | 1691 |
| 437 | Ga0495652_0317936 | 3300046529 | Bacteria | 1126 |
| 438 | Ga0495665_0000215 | 3300046531 | Bacteria | 29257 |
| 439 | Ga0495640_0001520 | 3300046533 | Bacteria | 18268 |
| 440 | Ga0495640_0047817 | 3300046533 | Bacteria | 2959 |
| 441 | Ga0495640_0114688 | 3300046533 | Bacteria | 1756 |
| 442 | Ga0495640_0121419 | 3300046533 | Bacteria | 1698 |
| 443 | Ga0495586_0000527 | 3300046535 | Bacteria | 22292 |
| 444 | Ga0495586_0031050 | 3300046535 | Bacteria | 2860 |
| 445 | Ga0495587_0001970 | 3300046536 | Bacteria | 13697 |
| 446 | Ga0495587_0054503 | 3300046536 | Bacteria | 2356 |
| 447 | Ga0495587_0208484 | 3300046536 | Bacteria | 1104 |
| 448 | Ga0495587_0265446 | 3300046536 | Bacteria | 964 |
| 449 | Ga0495621_0002083 | 3300046539 | Bacteria | 5297 |
| 450 | Ga0495645_0061651 | 3300046543 | Bacteria | 2717 |
| 451 | Ga0495645_0205758 | 3300046543 | Bacteria | 1332 |
| 452 | Ga0495622_0000014 | 3300046557 | Bacteria | 182142 |
| 453 | Ga0495667_0004189 | 3300046559 | Bacteria | 9713 |
| 454 | Ga0495667_0064213 | 3300046559 | Bacteria | 2401 |
| 455 | Ga0495667_0082143 | 3300046559 | Bacteria | 2094 |
| 456 | Ga0495656_0078619 | 3300046615 | Bacteria | 1483 |
| 457 | Ga0495668_0031957 | 3300046616 | Bacteria | 2964 |
| 458 | Ga0495634_0000024 | 3300046642 | Bacteria | 116230 |
| 459 | Ga0495634_0026899 | 3300046642 | Bacteria | 4010 |
| 460 | Ga0495625_0000029 | 3300046660 | Bacteria | 244646 |
| 461 | Ga0495625_0257297 | 3300046660 | Unclassified | 1131 |
| 462 | Ga0495635_0000009 | 3300046663 | Bacteria | 259024 |
| 463 | Ga0495635_0037192 | 3300046663 | Bacteria | 3370 |
| 464 | Ga0495635_0076575 | 3300046663 | Bacteria | 2292 |
| 465 | Ga0495588_0000198 | 3300046674 | Bacteria | 60956 |
| 466 | Ga0495588_0010582 | 3300046674 | Bacteria | 4296 |
| 467 | Ga0495588_0020730 | 3300046674 | Bacteria | 3235 |
| 468 | Ga0495657_0000024 | 3300046675 | Bacteria | 145255 |
| 469 | Ga0495657_0004915 | 3300046675 | Bacteria | 10635 |
| 470 | Ga0495657_0079758 | 3300046675 | Bacteria | 2119 |
| 471 | Ga0495657_0181127 | 3300046675 | Unclassified | 1293 |
| 472 | Ga0495657_0213593 | 3300046675 | Unclassified | 1172 |
| 473 | Ga0495599_0031412 | 3300046678 | Bacteria | 3333 |
| 474 | Ga0495599_0193580 | 3300046678 | Bacteria | 1250 |
| 475 | Ga0495623_0109015 | 3300046679 | Unclassified | 1680 |
| 476 | Ga0495646_0021230 | 3300046680 | Bacteria | 4105 |
| 477 | Ga0495647_0000037 | 3300046681 | Bacteria | 42482 |
| 478 | Ga0495647_0000293 | 3300046681 | Bacteria | 13969 |
| 479 | Ga0495647_0002559 | 3300046681 | Bacteria | 5763 |
| 480 | Ga0495647_0004495 | 3300046681 | Bacteria | 4534 |
| 481 | Ga0495647_0026359 | 3300046681 | Bacteria | 2129 |
| 482 | Ga0495658_0000019 | 3300046683 | Bacteria | 91606 |
| 483 | Ga0495658_0001056 | 3300046683 | Bacteria | 14543 |
| 484 | Ga0495658_0002471 | 3300046683 | Bacteria | 9310 |
| 485 | Ga0495658_0228514 | 3300046683 | Bacteria | 1166 |
| 486 | Ga0495669_0000562 | 3300046684 | Bacteria | 16446 |
| 487 | Ga0495613_0000249 | 3300046689 | Bacteria | 50975 |
| 488 | Ga0495613_0000309 | 3300046689 | Bacteria | 44163 |
| 489 | Ga0495613_0003963 | 3300046689 | Bacteria | 11089 |
| 490 | Ga0495613_0057044 | 3300046689 | Bacteria | 2867 |
| 491 | Ga0495613_0318942 | 3300046689 | Bacteria | 1073 |
| 492 | Ga0495624_0000028 | 3300046690 | Bacteria | 93474 |
| 493 | Ga0495624_0012694 | 3300046690 | Bacteria | 5754 |
| 494 | Ga0495624_0066552 | 3300046690 | Bacteria | 2249 |
| 495 | Ga0495670_0017148 | 3300046691 | Bacteria | 3563 |
| 496 | Ga0495670_0122393 | 3300046691 | Bacteria | 1352 |
| 497 | Ga0495649_0015920 | 3300046694 | Bacteria | 4271 |
| 498 | Ga0495600_0003314 | 3300046809 | Bacteria | 9451 |
| 499 | Ga0495600_0010047 | 3300046809 | Bacteria | 5867 |
| 500 | Ga0495600_0041968 | 3300046809 | Bacteria | 2982 |
| 501 | Ga0495600_0043498 | 3300046809 | Bacteria | 2929 |
| 502 | Ga0495581_0038723 | 3300047315 | Bacteria | 2759 |
| 503 | Ga0495581_0069066 | 3300047315 | Bacteria | 2043 |
| 504 | Ga0495581_0222299 | 3300047315 | Bacteria | 1104 |
| 505 | Ga0495604_0000056 | 3300047317 | Bacteria | 100110 |
| 506 | Ga0495604_0000190 | 3300047317 | Bacteria | 55090 |
| 507 | Ga0495604_0003466 | 3300047317 | Bacteria | 12570 |
| 508 | Ga0495604_0006459 | 3300047317 | Bacteria | 9300 |
| 509 | Ga0495604_0049521 | 3300047317 | Bacteria | 3264 |
| 510 | Ga0495604_0087982 | 3300047317 | Bacteria | 2312 |
| 511 | Ga0495674_0000042 | 3300047319 | Bacteria | 94820 |
| 512 | Ga0495674_0007533 | 3300047319 | Bacteria | 10396 |
| 513 | Ga0495674_0034205 | 3300047319 | Bacteria | 4596 |
| 514 | Ga0495674_0124032 | 3300047319 | Bacteria | 2180 |
| 515 | Ga0495674_0137328 | 3300047319 | Bacteria | 2056 |
| 516 | Ga0495676_0000646 | 3300047321 | Bacteria | 28924 |
| 517 | Ga0495676_0001001 | 3300047321 | Bacteria | 23792 |
| 518 | Ga0495676_0005236 | 3300047321 | Bacteria | 11864 |
| 519 | Ga0495676_0014558 | 3300047321 | Bacteria | 7037 |
| 520 | Ga0495676_0038393 | 3300047321 | Bacteria | 3977 |
| 521 | Ga0495676_0138941 | 3300047321 | Bacteria | 1743 |
| 522 | Ga0495680_0000023 | 3300047322 | Bacteria | 116444 |
| 523 | Ga0495680_0000421 | 3300047322 | Bacteria | 47432 |
| 524 | Ga0495680_0003583 | 3300047322 | Bacteria | 15204 |
| 525 | Ga0495680_0005597 | 3300047322 | Bacteria | 11781 |
| 526 | Ga0495680_0013355 | 3300047322 | Bacteria | 7170 |
| 527 | Ga0495680_0061884 | 3300047322 | Bacteria | 2878 |
| 528 | Ga0495675_0000209 | 3300047444 | Bacteria | 42691 |
| 529 | Ga0495685_019250 | 3300047447 | Bacteria | 2345 |
| 530 | Ga0495673_0029664 | 3300047469 | Bacteria | 2579 |
| 531 | Ga0495684_0006596 | 3300047471 | Bacteria | 9002 |
| 532 | Ga0495684_0010019 | 3300047471 | Bacteria | 7327 |
| 533 | Ga0495593_0001317 | 3300047673 | Bacteria | 14550 |
| 534 | Ga0495593_0053085 | 3300047673 | Bacteria | 2140 |
| 535 | Ga0495602_0000228 | 3300048088 | Bacteria | 52649 |
| 536 | Ga0495602_0169060 | 3300048088 | Bacteria | 1698 |
| 537 | Ga0495602_0178666 | 3300048088 | Unclassified | 1640 |
| 538 | Ga0495614_0004961 | 3300048089 | Bacteria | 6006 |
| 539 | Ga0496100_0000038 | 3300048903 | Bacteria | 94110 |
| 540 | Ga0496100_0000116 | 3300048903 | Bacteria | 45781 |
| 541 | Ga0496100_0010105 | 3300048903 | Bacteria | 5332 |
| 542 | Ga0496100_0041580 | 3300048903 | Bacteria | 2931 |
| 543 | Ga0496100_0161150 | 3300048903 | Bacteria | 1608 |
| 544 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 545 | Ga0496101_0000010 | 3300048904 | Bacteria | 281990 |
| 546 | Ga0496101_0008537 | 3300048904 | Bacteria | 6696 |
| 547 | Ga0496101_0008544 | 3300048904 | Bacteria | 6691 |
| 548 | Ga0496101_0346868 | 3300048904 | Bacteria | 1166 |
| 549 | Ga0496102_0000027 | 3300048905 | Bacteria | 225466 |
| 550 | Ga0496102_0027850 | 3300048905 | Bacteria | 5047 |
| 551 | Ga0496102_0051948 | 3300048905 | Bacteria | 3734 |
| 552 | Ga0496102_0058954 | 3300048905 | Bacteria | 3509 |
| 553 | Ga0496102_0077064 | 3300048905 | Bacteria | 3068 |
| 554 | Ga0496102_0130941 | 3300048905 | Bacteria | 2348 |
| 555 | Ga0496102_0136102 | 3300048905 | Bacteria | 2302 |
| 556 | Ga0496102_0177626 | 3300048905 | Unclassified | 2005 |
| 557 | Ga0496103_0000155 | 3300048906 | Bacteria | 72091 |
| 558 | Ga0496103_0021878 | 3300048906 | Bacteria | 3848 |
| 559 | Ga0496103_0036541 | 3300048906 | Bacteria | 3008 |
| 560 | Ga0496103_0129794 | 3300048906 | Unclassified | 1609 |
| 561 | Ga0496103_0205169 | 3300048906 | Bacteria | 1268 |
| 562 | Ga0496103_0252865 | 3300048906 | Bacteria | 1134 |
| 563 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 564 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 565 | Ga0496104_0000576 | 3300048907 | Bacteria | 31360 |
| 566 | Ga0496104_0001562 | 3300048907 | Bacteria | 19718 |
| 567 | Ga0496104_0007540 | 3300048907 | Bacteria | 9621 |
| 568 | Ga0496104_0017150 | 3300048907 | Bacteria | 6588 |
| 569 | Ga0496104_0020399 | 3300048907 | Bacteria | 6074 |
| 570 | Ga0496104_0061986 | 3300048907 | Bacteria | 3545 |
| 571 | Ga0496104_0310719 | 3300048907 | Bacteria | 1489 |
| 572 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 573 | Ga0496105_0000008 | 3300048908 | Bacteria | 335652 |
| 574 | Ga0496105_0000313 | 3300048908 | Bacteria | 31795 |
| 575 | Ga0496105_0001400 | 3300048908 | Bacteria | 16942 |
| 576 | Ga0496105_0008480 | 3300048908 | Bacteria | 7986 |
| 577 | Ga0496105_0009052 | 3300048908 | Bacteria | 7768 |
| 578 | Ga0496106_0000013 | 3300048909 | Bacteria | 202263 |
| 579 | Ga0496106_0000018 | 3300048909 | Bacteria | 175028 |
| 580 | Ga0496106_0000177 | 3300048909 | Bacteria | 45808 |
| 581 | Ga0496106_0011021 | 3300048909 | Bacteria | 6683 |
| 582 | Ga0496106_0062443 | 3300048909 | Bacteria | 2828 |
| 583 | Ga0496107_0000032 | 3300048910 | Bacteria | 99848 |
| 584 | Ga0496107_0000081 | 3300048910 | Bacteria | 45824 |
| 585 | Ga0496107_0120084 | 3300048910 | Bacteria | 1936 |
| 586 | Ga0496107_0378038 | 3300048910 | Unclassified | 1054 |
| 587 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 588 | Ga0496108_0000045 | 3300048911 | Bacteria | 137416 |
| 589 | Ga0496108_0000631 | 3300048911 | Bacteria | 27478 |
| 590 | Ga0496108_0008008 | 3300048911 | Bacteria | 8574 |
| 591 | Ga0496108_0017482 | 3300048911 | Bacteria | 5867 |
| 592 | Ga0496108_0112187 | 3300048911 | Bacteria | 2332 |
| 593 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 594 | Ga0496109_0000028 | 3300048912 | Bacteria | 168138 |
| 595 | Ga0496109_0000032 | 3300048912 | Bacteria | 162984 |
| 596 | Ga0496109_0000085 | 3300048912 | Bacteria | 95437 |
| 597 | Ga0496109_0001462 | 3300048912 | Bacteria | 19603 |
| 598 | Ga0496109_0001613 | 3300048912 | Bacteria | 18839 |
| 599 | Ga0496109_0125780 | 3300048912 | Bacteria | 2390 |
| 600 | Ga0496109_0228633 | 3300048912 | Bacteria | 1750 |
| 601 | Ga0496109_0302392 | 3300048912 | Bacteria | 1508 |
| 602 | Ga0496109_0327012 | 3300048912 | Bacteria | 1447 |
| 603 | Ga0496110_0000033 | 3300048913 | Bacteria | 65539 |
| 604 | Ga0496110_0001879 | 3300048913 | Bacteria | 15501 |
| 605 | Ga0496110_0017994 | 3300048913 | Bacteria | 5919 |
| 606 | Ga0496110_0024705 | 3300048913 | Bacteria | 5124 |
| 607 | Ga0496110_0126042 | 3300048913 | Bacteria | 2310 |
| 608 | Ga0496110_0129358 | 3300048913 | Bacteria | 2279 |
| 609 | Ga0496111_0000560 | 3300048914 | Bacteria | 19358 |
| 610 | Ga0496111_0001844 | 3300048914 | Bacteria | 12488 |
| 611 | Ga0496111_0005648 | 3300048914 | Bacteria | 8051 |
| 612 | Ga0496111_0125039 | 3300048914 | Bacteria | 1901 |
| 613 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 614 | Ga0496112_0001813 | 3300048915 | Bacteria | 16810 |
| 615 | Ga0496112_0016767 | 3300048915 | Bacteria | 6870 |
| 616 | Ga0496112_0017217 | 3300048915 | Bacteria | 6785 |
| 617 | Ga0496112_0026222 | 3300048915 | Bacteria | 5605 |
| 618 | Ga0496112_0051598 | 3300048915 | Bacteria | 4034 |
| 619 | Ga0496113_0000007 | 3300048916 | Bacteria | 95884 |
| 620 | Ga0496113_0000240 | 3300048916 | Bacteria | 25763 |
| 621 | Ga0496113_0002837 | 3300048916 | Bacteria | 10193 |
| 622 | Ga0496113_0024435 | 3300048916 | Bacteria | 4295 |
| 623 | Ga0496113_0161716 | 3300048916 | Unclassified | 1770 |
| 624 | Ga0496113_0290973 | 3300048916 | Bacteria | 1307 |
| 625 | Ga0496114_0009484 | 3300048917 | Bacteria | 7727 |
| 626 | Ga0496114_0009498 | 3300048917 | Bacteria | 7719 |
| 627 | Ga0496114_0490237 | 3300048917 | Bacteria | 1087 |
| 628 | Ga0496114_0587247 | 3300048917 | Unclassified | 983 |
| 629 | Ga0496115_0000020 | 3300048918 | Bacteria | 171995 |
| 630 | Ga0496115_0005222 | 3300048918 | Bacteria | 9440 |
| 631 | Ga0496115_0006918 | 3300048918 | Bacteria | 8332 |
| 632 | Ga0496115_0008785 | 3300048918 | Bacteria | 7489 |
| 633 | Ga0496115_0105769 | 3300048918 | Bacteria | 2310 |
| 634 | Ga0496116_0000780 | 3300048919 | Bacteria | 40473 |
| 635 | Ga0496117_0015033 | 3300048920 | Bacteria | 6631 |
| 636 | Ga0496118_0000174 | 3300048921 | Bacteria | 115950 |
| 637 | Ga0496118_0088493 | 3300048921 | Bacteria | 2142 |
| 638 | Ga0496119_0004215 | 3300048922 | Bacteria | 14439 |
| 639 | Ga0496119_0021993 | 3300048922 | Bacteria | 4585 |
| 640 | Ga0496119_0026047 | 3300048922 | Bacteria | 4066 |
| 641 | Ga0496120_0053857 | 3300048923 | Bacteria | 2284 |
| 642 | Ga0496121_0005891 | 3300048924 | Bacteria | 15512 |
| 643 | Ga0496121_0016585 | 3300048924 | Bacteria | 7593 |
| 644 | Ga0496121_0082402 | 3300048924 | Unclassified | 2543 |
| 645 | Ga0496121_0086517 | 3300048924 | Bacteria | 2463 |
| 646 | Ga0496124_0115152 | 3300048927 | Bacteria | 2158 |
| 647 | Ga0496124_0116434 | 3300048927 | Bacteria | 2143 |
| 648 | Ga0496125_0013994 | 3300048928 | Bacteria | 7845 |
| 649 | Ga0496125_0289604 | 3300048928 | Unclassified | 1009 |
| 650 | Ga0496126_0029904 | 3300048929 | Bacteria | 5170 |
| 651 | Ga0496126_0099256 | 3300048929 | Bacteria | 2550 |
| 652 | Ga0501031_0000445 | 3300049568 | Bacteria | 23857 |
| 653 | Ga0501031_0065331 | 3300049568 | Bacteria | 2370 |
| 654 | Ga0501032_0000876 | 3300049569 | Bacteria | 24428 |
| 655 | Ga0501033_0000294 | 3300049570 | Bacteria | 47989 |
| 656 | Ga0501034_0065214 | 3300049571 | Bacteria | 3654 |
| 657 | Ga0501036_0005562 | 3300049572 | Bacteria | 10223 |
| 658 | Ga0501036_0135273 | 3300049572 | Bacteria | 2080 |
| 659 | Ga0501037_0000378 | 3300049573 | Bacteria | 37014 |
| 660 | Ga0501037_0005716 | 3300049573 | Bacteria | 9075 |
| 661 | Ga0501038_0000087 | 3300049574 | Bacteria | 78741 |
| 662 | Ga0501039_0001020 | 3300049575 | Bacteria | 20404 |
| 663 | Ga0501039_0003991 | 3300049575 | Bacteria | 11095 |
| 664 | Ga0501039_0107426 | 3300049575 | Bacteria | 2180 |
| 665 | Ga0501040_0000007 | 3300049576 | Bacteria | 90368 |
| 666 | Ga0501040_0000954 | 3300049576 | Bacteria | 18260 |
| 667 | Ga0501040_0017844 | 3300049576 | Bacteria | 4711 |
| 668 | Ga0501040_0058110 | 3300049576 | Bacteria | 2656 |
| 669 | Ga0501040_0710312 | 3300049576 | Bacteria | 727 |
| 670 | Ga0501041_0000005 | 3300049577 | Bacteria | 75426 |
| 671 | Ga0501041_0001093 | 3300049577 | Bacteria | 14842 |
| 672 | Ga0501041_0040749 | 3300049577 | Bacteria | 2820 |
| 673 | Ga0501042_0003216 | 3300049578 | Bacteria | 10205 |
| 674 | Ga0501042_0003964 | 3300049578 | Bacteria | 9370 |
| 675 | Ga0501043_0000998 | 3300049579 | Bacteria | 24892 |
| 676 | Ga0501043_0093174 | 3300049579 | Bacteria | 2368 |
| 677 | Ga0501043_0371369 | 3300049579 | Bacteria | 1084 |
| 678 | Ga0501046_0001278 | 3300049580 | Bacteria | 24362 |
| 679 | Ga0501046_0028136 | 3300049580 | Bacteria | 4580 |
| 680 | Ga0501046_0053780 | 3300049580 | Bacteria | 3169 |
| 681 | Ga0501047_0000592 | 3300049581 | Bacteria | 38584 |
| 682 | Ga0501047_0009620 | 3300049581 | Bacteria | 9141 |
| 683 | Ga0501048_0000018 | 3300049582 | Bacteria | 72234 |
| 684 | Ga0501048_0001926 | 3300049582 | Bacteria | 15771 |
| 685 | Ga0501048_0071099 | 3300049582 | Bacteria | 2457 |
| 686 | Ga0501048_0184813 | 3300049582 | Bacteria | 1477 |
| 687 | Ga0501067_0009559 | 3300049583 | Bacteria | 5372 |
| 688 | Ga0501068_0000134 | 3300049584 | Bacteria | 33588 |
| 689 | Ga0501068_0011873 | 3300049584 | Bacteria | 4924 |
| 690 | Ga0501068_0018498 | 3300049584 | Bacteria | 4035 |
| 691 | Ga0501069_0000426 | 3300049585 | Bacteria | 19142 |
| 692 | Ga0501069_0077986 | 3300049585 | Bacteria | 1863 |
| 693 | Ga0501070_0004569 | 3300049586 | Bacteria | 11863 |
| 694 | Ga0501070_0005855 | 3300049586 | Bacteria | 10483 |
| 695 | Ga0501070_0009281 | 3300049586 | Bacteria | 8320 |
| 696 | Ga0501071_0000005 | 3300049587 | Bacteria | 78747 |
| 697 | Ga0501071_0001995 | 3300049587 | Bacteria | 12192 |
| 698 | Ga0501071_0014797 | 3300049587 | Bacteria | 5343 |
| 699 | Ga0501072_0000269 | 3300049588 | Bacteria | 37902 |
| 700 | Ga0501072_0004831 | 3300049588 | Bacteria | 10263 |
| 701 | Ga0501072_0092159 | 3300049588 | Bacteria | 2406 |
| 702 | Ga0501072_0152356 | 3300049588 | Bacteria | 1843 |
| 703 | Ga0501073_0001327 | 3300049589 | Bacteria | 18226 |
| 704 | Ga0501073_0033451 | 3300049589 | Bacteria | 3660 |
| 705 | Ga0501073_0178046 | 3300049589 | Unclassified | 1472 |
| 706 | Ga0501074_0001138 | 3300049590 | Bacteria | 17415 |
| 707 | Ga0501074_0044985 | 3300049590 | Bacteria | 3194 |
| 708 | Ga0501074_0075006 | 3300049590 | Bacteria | 2428 |
| 709 | Ga0501074_0261410 | 3300049590 | Bacteria | 1230 |
| 710 | Ga0501075_0000009 | 3300049591 | Bacteria | 97052 |
| 711 | Ga0501075_0000193 | 3300049591 | Bacteria | 31987 |
| 712 | Ga0501075_0099979 | 3300049591 | Bacteria | 2203 |
| 713 | Ga0501075_0114929 | 3300049591 | Bacteria | 2046 |
| 714 | Ga0501076_0000028 | 3300049592 | Bacteria | 76828 |
| 715 | Ga0501076_0001292 | 3300049592 | Bacteria | 16692 |
| 716 | Ga0501076_0090419 | 3300049592 | Bacteria | 2462 |
| 717 | Ga0501076_0187905 | 3300049592 | Bacteria | 1686 |
| 718 | Ga0501077_0000006 | 3300049593 | Bacteria | 119936 |
| 719 | Ga0501077_0001176 | 3300049593 | Bacteria | 15828 |
| 720 | Ga0501077_0112680 | 3300049593 | Bacteria | 1724 |
| 721 | Ga0501079_0000881 | 3300049741 | Bacteria | 20585 |
| 722 | Ga0501079_0025921 | 3300049741 | Bacteria | 4497 |
| 723 | Ga0501079_0171082 | 3300049741 | Bacteria | 1694 |
| 724 | Ga0501079_0255159 | 3300049741 | Bacteria | 1371 |
| 725 | Ga0501080_0000626 | 3300049742 | Bacteria | 28026 |
| 726 | Ga0501080_0032292 | 3300049742 | Bacteria | 4881 |
| 727 | Ga0501081_0000003 | 3300049743 | Bacteria | 97558 |
| 728 | Ga0501081_0000159 | 3300049743 | Bacteria | 31036 |
| 729 | Ga0501081_0145654 | 3300049743 | Bacteria | 1699 |
| 730 | Ga0501083_0001673 | 3300049744 | Bacteria | 15132 |
| 731 | Ga0501083_0008047 | 3300049744 | Bacteria | 7457 |
| 732 | Ga0501083_0021756 | 3300049744 | Bacteria | 4454 |
| 733 | Ga0501083_0372292 | 3300049744 | Bacteria | 929 |
| 734 | Ga0501035_0000175 | 3300049822 | Bacteria | 78747 |
| 735 | Ga0501044_0006303 | 3300049823 | Bacteria | 13113 |
| 736 | Ga0501044_0065287 | 3300049823 | Bacteria | 3712 |
| 737 | Ga0501045_0000009 | 3300049824 | Bacteria | 75255 |
| 738 | Ga0501045_0002161 | 3300049824 | Bacteria | 13314 |
| 739 | Ga0501045_0075570 | 3300049824 | Bacteria | 2481 |
| 740 | Ga0501045_0653959 | 3300049824 | Bacteria | 777 |
| 741 | nmdc:mga05p37_62567_c1 | 3300050507 | Bacteria | 4580 |
| 742 | nmdc:mga05p37_8447_c1 | 3300050507 | Bacteria | 12180 |
| 743 | nmdc:mga06r32_504525_c1 | 3300050510 | Unclassified | 1186 |
| 744 | nmdc:mga08y16_287973_c1 | 3300050511 | Bacteria | 1694 |
| 745 | nmdc:mga08y16_55458_c1 | 3300050511 | Bacteria | 4141 |
| 746 | nmdc:mga08y16_567673_c1 | 3300050511 | Bacteria | 1147 |
| 747 | nmdc:mga0n895_108290_c1 | 3300050512 | Bacteria | 2793 |
| 748 | nmdc:mga0n895_468709_c1 | 3300050512 | Bacteria | 1271 |
| 749 | nmdc:mga0n895_599926_c1 | 3300050512 | Bacteria | 1104 |
| 750 | nmdc:mga0rr50_148702_c1 | 3300050513 | Bacteria | 1891 |
| 751 | nmdc:mga0rr50_372931_c1 | 3300050513 | Unclassified | 1203 |
| 752 | nmdc:mga0rr50_76361_c1 | 3300050513 | Bacteria | 2572 |
| 753 | nmdc:mga08x19_198354_c1 | 3300050514 | Bacteria | 1375 |
| 754 | nmdc:mga08x19_383629_c1 | 3300050514 | Bacteria | 984 |
| 755 | nmdc:mga0a205_193953_c1 | 3300050515 | Bacteria | 1923 |
| 756 | nmdc:mga0a205_54850_c1 | 3300050515 | Bacteria | 2996 |
| 757 | nmdc:mga0a205_65733_c1 | 3300050515 | Bacteria | 3505 |
| 758 | Ga0495601_0000086 | 3300053077 | Bacteria | 50421 |
| 759 | Ga0495601_0000097 | 3300053077 | Bacteria | 48380 |
| 760 | Ga0495601_0003248 | 3300053077 | Bacteria | 9287 |
| 761 | Ga0495601_0008176 | 3300053077 | Bacteria | 6169 |
| 762 | Ga0495601_0059411 | 3300053077 | Bacteria | 2424 |
| 763 | Ga0495601_0139304 | 3300053077 | Bacteria | 1582 |
| 764 | Ga0495612_0005844 | 3300053078 | Bacteria | 5082 |
| 765 | Ga0495655_0001313 | 3300053083 | Bacteria | 3825 |
| 766 | Ga0495595_0000014 | 3300053084 | Bacteria | 145255 |
| 767 | Ga0495595_0000109 | 3300053084 | Bacteria | 37617 |
| 768 | Ga0495595_0006454 | 3300053084 | Bacteria | 4785 |
| 769 | Ga0495619_0000022 | 3300053085 | Bacteria | 184144 |
| 770 | Ga0495619_0000024 | 3300053085 | Bacteria | 180821 |
| 771 | Ga0495619_0000319 | 3300053085 | Bacteria | 33678 |
| 772 | Ga0495619_0004791 | 3300053085 | Bacteria | 8599 |
| 773 | Ga0495619_0069309 | 3300053085 | Bacteria | 2357 |
| 774 | Ga0495619_0309197 | 3300053085 | Bacteria | 1095 |
| 775 | Ga0500566_0005120 | 3300053094 | Bacteria | 7815 |
| 776 | Ga0500641_0002398 | 3300053096 | Bacteria | 6646 |
| 777 | Ga0500595_039603 | 3300053119 | Bacteria | 1524 |
| 778 | Ga0500614_004265 | 3300053123 | Bacteria | 3034 |
| 779 | Ga0501084_0001358 | 3300054114 | Bacteria | 19353 |
| 780 | Ga0501084_0005874 | 3300054114 | Bacteria | 10101 |
| 781 | Ga0501084_0065108 | 3300054114 | Bacteria | 3049 |
| 782 | Ga0501084_0396990 | 3300054114 | Bacteria | 1165 |
| 783 | Ga0501082_0000063 | 3300060353 | Bacteria | 76891 |
| 784 | Ga0501082_0001009 | 3300060353 | Bacteria | 24886 |
| 785 | Ga0501082_0237725 | 3300060353 | Bacteria | 1585 |
| 786 | Ga0466962_0049559 | 3300061719 | Bacteria | 2007 |
| 787 | Ga0530510_0000014 | 3300061734 | Bacteria | 106661 |
| 788 | Ga0530510_0001148 | 3300061734 | Bacteria | 17568 |
| 789 | Ga0530510_0079218 | 3300061734 | Bacteria | 2389 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005347 | Ga0070668_100008119 | Ga0070668_10000811910 | 214 |
| 2 | 3300005367 | Ga0070667_100007958 | Ga0070667_10000795810 | 214 |
| 3 | 3300005842 | Ga0068858_100239891 | Ga0068858_1002398912 | 214 |
| 4 | 3300005844 | Ga0068862_100002825 | Ga0068862_1000028251 | 214 |
| 5 | 3300009553 | Ga0105249_10020406 | Ga0105249_100204066 | 214 |
| 6 | 3300026035 | Ga0207703_10109546 | Ga0207703_101095463 | 214 |
| 7 | 3300028379 | Ga0268266_10513070 | Ga0268266_105130701 | 214 |
| 8 | 3300028380 | Ga0268265_10011815 | Ga0268265_100118158 | 214 |
| 9 | 3300026075 | Ga0207708_10514108 | Ga0207708_105141081 | 217 |
| 10 | 3300046680 | Ga0495646_0021230 | Ga0495646_0021230_1405_2196 | 218 |
| 11 | 3300047317 | Ga0495604_0000190 | Ga0495604_0000190_26152_26943 | 218 |
| 12 | 3300005341 | Ga0070691_10000054 | Ga0070691_100000548 | 219 |
| 13 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_641324_642109 | 221 |
| 14 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_686070_686855 | 221 |
| 15 | 3300048922 | Ga0496119_0026047 | Ga0496119_0026047_2641_3426 | 221 |
| 16 | 3300048923 | Ga0496120_0053857 | Ga0496120_0053857_428_1213 | 221 |
| 17 | 3300009551 | Ga0105238_10670934 | Ga0105238_106709341 | 222 |
| 18 | 3300005543 | Ga0070672_100000004 | Ga0070672_10000000482 | 223 |
| 19 | 3300005937 | Ga0081455_10009498 | Ga0081455_100094984 | 223 |
| 20 | 3300025940 | Ga0207691_10000020 | Ga0207691_1000002044 | 223 |
| 21 | 3300005548 | Ga0070665_100765282 | Ga0070665_1007652822 | 224 |
| 22 | 3300005617 | Ga0068859_100808532 | Ga0068859_1008085321 | 224 |
| 23 | 3300006931 | Ga0097620_100808453 | Ga0097620_1008084531 | 224 |
| 24 | 3300046473 | Ga0495582_0116493 | Ga0495582_0116493_243_1019 | 224 |
| 25 | 3300045976 | Ga0466967_0261967 | Ga0466967_0261967_10_780 | 225 |
| 26 | 3300005842 | Ga0068858_100006307 | Ga0068858_10000630714 | 227 |
| 27 | 3300026035 | Ga0207703_10000053 | Ga0207703_1000005314 | 227 |
| 28 | 3300005329 | Ga0070683_100108431 | Ga0070683_1001084312 | 228 |
| 29 | 3300005535 | Ga0070684_100163543 | Ga0070684_1001635431 | 228 |
| 30 | 3300014326 | Ga0157380_10000219 | Ga0157380_1000021922 | 228 |
| 31 | 3300025944 | Ga0207661_10062095 | Ga0207661_100620952 | 228 |
| 32 | 3300048912 | Ga0496109_0327012 | Ga0496109_0327012_237_1007 | 228 |
| 33 | 3300005548 | Ga0070665_100002822 | Ga0070665_10000282213 | 230 |
| 34 | 3300009176 | Ga0105242_10016975 | Ga0105242_100169756 | 230 |
| 35 | 3300013308 | Ga0157375_10539542 | Ga0157375_105395422 | 230 |
| 36 | 3300025934 | Ga0207686_10024357 | Ga0207686_100243574 | 230 |
| 37 | 3300046615 | Ga0495656_0078619 | Ga0495656_0078619_223_990 | 230 |
| 38 | 3300049576 | Ga0501040_0710312 | Ga0501040_0710312_16_714 | 232 |
| 39 | 3300049824 | Ga0501045_0653959 | Ga0501045_0653959_34_732 | 232 |
| 40 | 3300005548 | Ga0070665_100579522 | Ga0070665_1005795222 | 233 |
| 41 | 3300006846 | Ga0075430_100027536 | Ga0075430_1000275362 | 233 |
| 42 | 3300013306 | Ga0163162_10081431 | Ga0163162_100814313 | 234 |
| 43 | 3300050507 | nmdc:mga05p37_8447_c1 | nmdc:mga05p37_8447_c1_889_1647 | 235 |
| 44 | 3300005354 | Ga0070675_100000058 | Ga0070675_10000005848 | 236 |
| 45 | 3300005985 | Ga0081539_10002242 | Ga0081539_1000224218 | 236 |
| 46 | 3300006048 | Ga0075363_100299345 | Ga0075363_1002993452 | 236 |
| 47 | 3300006847 | Ga0075431_100036575 | Ga0075431_1000365752 | 236 |
| 48 | 3300006852 | Ga0075433_10027284 | Ga0075433_100272842 | 236 |
| 49 | 3300006871 | Ga0075434_100007144 | Ga0075434_1000071446 | 236 |
| 50 | 3300006914 | Ga0075436_100043703 | Ga0075436_1000437033 | 236 |
| 51 | 3300007076 | Ga0075435_100007136 | Ga0075435_1000071362 | 236 |
| 52 | 3300009147 | Ga0114129_10001119 | Ga0114129_1000111915 | 236 |
| 53 | 3300014968 | Ga0157379_10346924 | Ga0157379_103469241 | 236 |
| 54 | 3300025926 | Ga0207659_10000020 | Ga0207659_1000002058 | 236 |
| 55 | 3300046491 | Ga0495584_0225562 | Ga0495584_0225562_20_790 | 236 |
| 56 | 3300050512 | nmdc:mga0n895_599926_c1 | nmdc:mga0n895_599926_c1_270_1040 | 236 |
| 57 | 3300050513 | nmdc:mga0rr50_76361_c1 | nmdc:mga0rr50_76361_c1_935_1705 | 236 |
| 58 | 3300005981 | Ga0081538_10081463 | Ga0081538_100814631 | 237 |
| 59 | 3300025942 | Ga0207689_10264829 | Ga0207689_102648292 | 237 |
| 60 | 3300031901 | Ga0307406_10536645 | Ga0307406_105366451 | 237 |
| 61 | 3300037312 | Ga0395899_0001477 | Ga0395899_0001477_12238_13005 | 237 |
| 62 | 3300037418 | Ga0395900_0014343 | Ga0395900_0014343_3129_3896 | 237 |
| 63 | 3300037466 | Ga0395898_0036814 | Ga0395898_0036814_2960_3727 | 237 |
| 64 | 3300037471 | Ga0395905_0020023 | Ga0395905_0020023_1282_2049 | 237 |
| 65 | 3300038443 | Ga0395901_0011639 | Ga0395901_0011639_3301_4068 | 237 |
| 66 | 3300041443 | Ga0451789_0027790 | Ga0451789_0027790_258_1058 | 237 |
| 67 | 3300041452 | Ga0451793_0300818 | Ga0451793_0300818_173_973 | 237 |
| 68 | 3300041512 | Ga0451853_2081083 | Ga0451853_2081083_798_1571 | 237 |
| 69 | 3300046674 | Ga0495588_0020730 | Ga0495588_0020730_952_1722 | 237 |
| 70 | 3300048911 | Ga0496108_0008008 | Ga0496108_0008008_2519_3283 | 237 |
| 71 | 3300048912 | Ga0496109_0125780 | Ga0496109_0125780_567_1331 | 237 |
| 72 | 3300048916 | Ga0496113_0002837 | Ga0496113_0002837_4173_4937 | 237 |
| 73 | 3300005367 | Ga0070667_100223189 | Ga0070667_1002231891 | 238 |
| 74 | 3300046689 | Ga0495613_0318942 | Ga0495613_0318942_234_1001 | 238 |
| 75 | 3300048911 | Ga0496108_0112187 | Ga0496108_0112187_42_758 | 238 |
| 76 | 3300005334 | Ga0068869_100342532 | Ga0068869_1003425322 | 239 |
| 77 | 3300005336 | Ga0070680_100065864 | Ga0070680_1000658643 | 239 |
| 78 | 3300005337 | Ga0070682_100172182 | Ga0070682_1001721821 | 239 |
| 79 | 3300005365 | Ga0070688_100486515 | Ga0070688_1004865151 | 239 |
| 80 | 3300005458 | Ga0070681_10040325 | Ga0070681_100403252 | 239 |
| 81 | 3300005530 | Ga0070679_100048185 | Ga0070679_1000481852 | 239 |
| 82 | 3300005578 | Ga0068854_100324349 | Ga0068854_1003243492 | 239 |
| 83 | 3300005614 | Ga0068856_100395026 | Ga0068856_1003950262 | 239 |
| 84 | 3300006852 | Ga0075433_10243789 | Ga0075433_102437892 | 239 |
| 85 | 3300007076 | Ga0075435_100447733 | Ga0075435_1004477331 | 239 |
| 86 | 3300009094 | Ga0111539_10331616 | Ga0111539_103316162 | 239 |
| 87 | 3300009148 | Ga0105243_10285969 | Ga0105243_102859691 | 239 |
| 88 | 3300025911 | Ga0207654_10079660 | Ga0207654_100796602 | 239 |
| 89 | 3300025917 | Ga0207660_10067787 | Ga0207660_100677871 | 239 |
| 90 | 3300025927 | Ga0207687_10084136 | Ga0207687_100841362 | 239 |
| 91 | 3300027907 | Ga0207428_10181623 | Ga0207428_101816232 | 239 |
| 92 | 3300032126 | Ga0307415_100000648 | Ga0307415_10000064816 | 239 |
| 93 | 3300045976 | Ga0466967_0000046 | Ga0466967_0000046_12807_13598 | 239 |
| 94 | 3300048904 | Ga0496101_0346868 | Ga0496101_0346868_128_895 | 239 |
| 95 | 3300048905 | Ga0496102_0051948 | Ga0496102_0051948_1062_1838 | 239 |
| 96 | 3300048905 | Ga0496102_0058954 | Ga0496102_0058954_1276_2046 | 239 |
| 97 | 3300048906 | Ga0496103_0205169 | Ga0496103_0205169_134_904 | 239 |
| 98 | 3300048907 | Ga0496104_0061986 | Ga0496104_0061986_2540_3307 | 239 |
| 99 | 3300048908 | Ga0496105_0008480 | Ga0496105_0008480_7000_7767 | 239 |
| 100 | 3300048910 | Ga0496107_0120084 | Ga0496107_0120084_1062_1829 | 239 |
| 101 | 3300048910 | Ga0496107_0378038 | Ga0496107_0378038_13_783 | 239 |
| 102 | 3300048911 | Ga0496108_0017482 | Ga0496108_0017482_2670_3437 | 239 |
| 103 | 3300048912 | Ga0496109_0302392 | Ga0496109_0302392_497_1264 | 239 |
| 104 | 3300048913 | Ga0496110_0024705 | Ga0496110_0024705_2843_3610 | 239 |
| 105 | 3300048914 | Ga0496111_0005648 | Ga0496111_0005648_6855_7622 | 239 |
| 106 | 3300048916 | Ga0496113_0024435 | Ga0496113_0024435_3376_4143 | 239 |
| 107 | 3300048917 | Ga0496114_0490237 | Ga0496114_0490237_169_936 | 239 |
| 108 | 3300048929 | Ga0496126_0029904 | Ga0496126_0029904_1281_2090 | 239 |
| 109 | 3300050511 | nmdc:mga08y16_287973_c1 | nmdc:mga08y16_287973_c1_376_1143 | 239 |
| 110 | 3300050512 | nmdc:mga0n895_468709_c1 | nmdc:mga0n895_468709_c1_127_894 | 239 |
| 111 | 3300050513 | nmdc:mga0rr50_148702_c1 | nmdc:mga0rr50_148702_c1_571_1338 | 239 |
| 112 | 3300050515 | nmdc:mga0a205_193953_c1 | nmdc:mga0a205_193953_c1_438_1205 | 239 |
| 113 | 3300005439 | Ga0070711_100252527 | Ga0070711_1002525271 | 240 |
| 114 | 3300005546 | Ga0070696_100084495 | Ga0070696_1000844953 | 240 |
| 115 | 3300005841 | Ga0068863_100000032 | Ga0068863_10000003213 | 240 |
| 116 | 3300013307 | Ga0157372_10365990 | Ga0157372_103659902 | 240 |
| 117 | 3300025898 | Ga0207692_10040358 | Ga0207692_100403583 | 240 |
| 118 | 3300025915 | Ga0207693_10053039 | Ga0207693_100530391 | 240 |
| 119 | 3300026088 | Ga0207641_10000071 | Ga0207641_1000007114 | 240 |
| 120 | 3300046462 | Ga0495651_0192164 | Ga0495651_0192164_577_1347 | 240 |
| 121 | 3300046539 | Ga0495621_0002083 | Ga0495621_0002083_1516_2313 | 240 |
| 122 | 3300046642 | Ga0495634_0000024 | Ga0495634_0000024_104615_105379 | 240 |
| 123 | 3300053077 | Ga0495601_0000086 | Ga0495601_0000086_33064_33861 | 240 |
| 124 | 3300005365 | Ga0070688_100396145 | Ga0070688_1003961451 | 241 |
| 125 | 3300005618 | Ga0068864_100026224 | Ga0068864_1000262242 | 241 |
| 126 | 3300006173 | Ga0070716_100146589 | Ga0070716_1001465892 | 241 |
| 127 | 3300013297 | Ga0157378_10010497 | Ga0157378_100104975 | 241 |
| 128 | 3300014325 | Ga0163163_10119806 | Ga0163163_101198062 | 241 |
| 129 | 3300025939 | Ga0207665_10182274 | Ga0207665_101822742 | 241 |
| 130 | 3300025960 | Ga0207651_10041883 | Ga0207651_100418832 | 241 |
| 131 | 3300026095 | Ga0207676_10194051 | Ga0207676_101940512 | 241 |
| 132 | 3300028800 | Ga0265338_10058061 | Ga0265338_100580612 | 241 |
| 133 | 3300037853 | Ga0436364_0309695 | Ga0436364_0309695_191_961 | 241 |
| 134 | 3300037853 | Ga0436364_1133006 | Ga0436364_1133006_79_873 | 241 |
| 135 | 3300039437 | Ga0436365_0329149 | Ga0436365_0329149_10836_11606 | 241 |
| 136 | 3300041997 | Ga0439431_0025850 | Ga0439431_0025850_413_1171 | 241 |
| 137 | 3300041999 | Ga0439433_0006334 | Ga0439433_0006334_1331_2089 | 241 |
| 138 | 3300042015 | Ga0439462_0004636 | Ga0439462_0004636_298_1056 | 241 |
| 139 | 3300042156 | Ga0439446_0000927 | Ga0439446_0000927_3394_4152 | 241 |
| 140 | 3300046473 | Ga0495582_0113618 | Ga0495582_0113618_588_1355 | 241 |
| 141 | 3300046475 | Ga0495639_0058412 | Ga0495639_0058412_353_1120 | 241 |
| 142 | 3300046511 | Ga0495608_0010782 | Ga0495608_0010782_4011_4775 | 241 |
| 143 | 3300046674 | Ga0495588_0000198 | Ga0495588_0000198_80_862 | 241 |
| 144 | 3300046681 | Ga0495647_0000293 | Ga0495647_0000293_8068_8853 | 241 |
| 145 | 3300047321 | Ga0495676_0038393 | Ga0495676_0038393_1917_2684 | 241 |
| 146 | 3300048903 | Ga0496100_0041580 | Ga0496100_0041580_1574_2341 | 241 |
| 147 | 3300048905 | Ga0496102_0136102 | Ga0496102_0136102_669_1436 | 241 |
| 148 | 3300048907 | Ga0496104_0001562 | Ga0496104_0001562_8597_9364 | 241 |
| 149 | 3300048908 | Ga0496105_0000313 | Ga0496105_0000313_28581_29348 | 241 |
| 150 | 3300048912 | Ga0496109_0001462 | Ga0496109_0001462_10121_10888 | 241 |
| 151 | 3300048913 | Ga0496110_0001879 | Ga0496110_0001879_4507_5274 | 241 |
| 152 | 3300048914 | Ga0496111_0000560 | Ga0496111_0000560_8671_9438 | 241 |
| 153 | 3300048915 | Ga0496112_0001813 | Ga0496112_0001813_2581_3348 | 241 |
| 154 | 3300048916 | Ga0496113_0000240 | Ga0496113_0000240_5786_6553 | 241 |
| 155 | 3300048917 | Ga0496114_0009484 | Ga0496114_0009484_3532_4299 | 241 |
| 156 | 3300048918 | Ga0496115_0008785 | Ga0496115_0008785_543_1310 | 241 |
| 157 | 3300048929 | Ga0496126_0099256 | Ga0496126_0099256_201_926 | 241 |
| 158 | 3300049568 | Ga0501031_0065331 | Ga0501031_0065331_646_1416 | 241 |
| 159 | 3300049571 | Ga0501034_0065214 | Ga0501034_0065214_1390_2148 | 241 |
| 160 | 3300049572 | Ga0501036_0135273 | Ga0501036_0135273_285_1055 | 241 |
| 161 | 3300049575 | Ga0501039_0107426 | Ga0501039_0107426_641_1411 | 241 |
| 162 | 3300049576 | Ga0501040_0017844 | Ga0501040_0017844_3189_3959 | 241 |
| 163 | 3300049577 | Ga0501041_0040749 | Ga0501041_0040749_1439_2209 | 241 |
| 164 | 3300049579 | Ga0501043_0093174 | Ga0501043_0093174_618_1388 | 241 |
| 165 | 3300049580 | Ga0501046_0053780 | Ga0501046_0053780_1006_1776 | 241 |
| 166 | 3300049582 | Ga0501048_0184813 | Ga0501048_0184813_77_847 | 241 |
| 167 | 3300049588 | Ga0501072_0092159 | Ga0501072_0092159_1400_2170 | 241 |
| 168 | 3300049590 | Ga0501074_0075006 | Ga0501074_0075006_1395_2165 | 241 |
| 169 | 3300049591 | Ga0501075_0114929 | Ga0501075_0114929_92_862 | 241 |
| 170 | 3300049592 | Ga0501076_0187905 | Ga0501076_0187905_744_1514 | 241 |
| 171 | 3300049593 | Ga0501077_0112680 | Ga0501077_0112680_604_1374 | 241 |
| 172 | 3300049741 | Ga0501079_0025921 | Ga0501079_0025921_1440_2210 | 241 |
| 173 | 3300049743 | Ga0501081_0145654 | Ga0501081_0145654_682_1452 | 241 |
| 174 | 3300049824 | Ga0501045_0075570 | Ga0501045_0075570_1088_1858 | 241 |
| 175 | 3300054114 | Ga0501084_0065108 | Ga0501084_0065108_1109_1879 | 241 |
| 176 | 3300060353 | Ga0501082_0237725 | Ga0501082_0237725_540_1310 | 241 |
| 177 | 3300061734 | Ga0530510_0079218 | Ga0530510_0079218_1041_1811 | 241 |
| 178 | 3300006914 | Ga0075436_100219177 | Ga0075436_1002191772 | 242 |
| 179 | 3300009101 | Ga0105247_10109935 | Ga0105247_101099352 | 242 |
| 180 | 3300014969 | Ga0157376_10121124 | Ga0157376_101211243 | 242 |
| 181 | 3300026116 | Ga0207674_10275630 | Ga0207674_102756302 | 242 |
| 182 | 3300044706 | Ga0466964_0174965 | Ga0466964_0174965_29_757 | 242 |
| 183 | 3300044901 | Ga0466960_0226618 | Ga0466960_0226618_207_935 | 242 |
| 184 | 3300045976 | Ga0466967_0738415 | Ga0466967_0738415_215_943 | 242 |
| 185 | 3300046499 | Ga0495594_0000013 | Ga0495594_0000013_61520_62347 | 242 |
| 186 | 3300046660 | Ga0495625_0257297 | Ga0495625_0257297_205_999 | 242 |
| 187 | 3300048088 | Ga0495602_0000228 | Ga0495602_0000228_21720_22508 | 242 |
| 188 | 3300048088 | Ga0495602_0169060 | Ga0495602_0169060_843_1640 | 242 |
| 189 | 3300049568 | Ga0501031_0000445 | Ga0501031_0000445_1943_2713 | 242 |
| 190 | 3300049569 | Ga0501032_0000876 | Ga0501032_0000876_21097_21867 | 242 |
| 191 | 3300049570 | Ga0501033_0000294 | Ga0501033_0000294_6667_7437 | 242 |
| 192 | 3300049572 | Ga0501036_0005562 | Ga0501036_0005562_2008_2778 | 242 |
| 193 | 3300049573 | Ga0501037_0000378 | Ga0501037_0000378_19568_20338 | 242 |
| 194 | 3300049573 | Ga0501037_0005716 | Ga0501037_0005716_6124_6894 | 242 |
| 195 | 3300049574 | Ga0501038_0000087 | Ga0501038_0000087_7452_8222 | 242 |
| 196 | 3300049575 | Ga0501039_0001020 | Ga0501039_0001020_12968_13738 | 242 |
| 197 | 3300049575 | Ga0501039_0003991 | Ga0501039_0003991_8511_9281 | 242 |
| 198 | 3300049576 | Ga0501040_0000007 | Ga0501040_0000007_19073_19843 | 242 |
| 199 | 3300049576 | Ga0501040_0000954 | Ga0501040_0000954_8431_9201 | 242 |
| 200 | 3300049577 | Ga0501041_0000005 | Ga0501041_0000005_59888_60658 | 242 |
| 201 | 3300049577 | Ga0501041_0001093 | Ga0501041_0001093_6124_6894 | 242 |
| 202 | 3300049578 | Ga0501042_0003216 | Ga0501042_0003216_2008_2778 | 242 |
| 203 | 3300049578 | Ga0501042_0003964 | Ga0501042_0003964_5689_6459 | 242 |
| 204 | 3300049579 | Ga0501043_0000998 | Ga0501043_0000998_16677_17447 | 242 |
| 205 | 3300049580 | Ga0501046_0001278 | Ga0501046_0001278_16798_17568 | 242 |
| 206 | 3300049580 | Ga0501046_0028136 | Ga0501046_0028136_1481_2251 | 242 |
| 207 | 3300049581 | Ga0501047_0000592 | Ga0501047_0000592_16788_17558 | 242 |
| 208 | 3300049582 | Ga0501048_0000018 | Ga0501048_0000018_70526_71296 | 242 |
| 209 | 3300049582 | Ga0501048_0001926 | Ga0501048_0001926_8778_9548 | 242 |
| 210 | 3300049583 | Ga0501067_0009559 | Ga0501067_0009559_803_1573 | 242 |
| 211 | 3300049584 | Ga0501068_0000134 | Ga0501068_0000134_21035_21805 | 242 |
| 212 | 3300049584 | Ga0501068_0011873 | Ga0501068_0011873_2674_3444 | 242 |
| 213 | 3300049585 | Ga0501069_0000426 | Ga0501069_0000426_7435_8205 | 242 |
| 214 | 3300049586 | Ga0501070_0004569 | Ga0501070_0004569_1366_2136 | 242 |
| 215 | 3300049586 | Ga0501070_0005855 | Ga0501070_0005855_132_902 | 242 |
| 216 | 3300049587 | Ga0501071_0000005 | Ga0501071_0000005_70526_71296 | 242 |
| 217 | 3300049587 | Ga0501071_0001995 | Ga0501071_0001995_8511_9281 | 242 |
| 218 | 3300049588 | Ga0501072_0000269 | Ga0501072_0000269_20584_21354 | 242 |
| 219 | 3300049588 | Ga0501072_0004831 | Ga0501072_0004831_6124_6894 | 242 |
| 220 | 3300049589 | Ga0501073_0001327 | Ga0501073_0001327_10039_10809 | 242 |
| 221 | 3300049589 | Ga0501073_0033451 | Ga0501073_0033451_811_1581 | 242 |
| 222 | 3300049589 | Ga0501073_0178046 | Ga0501073_0178046_28_828 | 242 |
| 223 | 3300049590 | Ga0501074_0001138 | Ga0501074_0001138_9851_10621 | 242 |
| 224 | 3300049591 | Ga0501075_0000009 | Ga0501075_0000009_11489_12259 | 242 |
| 225 | 3300049591 | Ga0501075_0000193 | Ga0501075_0000193_16287_17057 | 242 |
| 226 | 3300049591 | Ga0501075_0099979 | Ga0501075_0099979_799_1572 | 242 |
| 227 | 3300049592 | Ga0501076_0000028 | Ga0501076_0000028_7452_8222 | 242 |
| 228 | 3300049592 | Ga0501076_0001292 | Ga0501076_0001292_6421_7191 | 242 |
| 229 | 3300049593 | Ga0501077_0000006 | Ga0501077_0000006_40553_41323 | 242 |
| 230 | 3300049593 | Ga0501077_0001176 | Ga0501077_0001176_3040_3810 | 242 |
| 231 | 3300049741 | Ga0501079_0000881 | Ga0501079_0000881_1880_2650 | 242 |
| 232 | 3300049742 | Ga0501080_0000626 | Ga0501080_0000626_21097_21867 | 242 |
| 233 | 3300049742 | Ga0501080_0032292 | Ga0501080_0032292_961_1731 | 242 |
| 234 | 3300049743 | Ga0501081_0000003 | Ga0501081_0000003_20584_21354 | 242 |
| 235 | 3300049743 | Ga0501081_0000159 | Ga0501081_0000159_27721_28491 | 242 |
| 236 | 3300049744 | Ga0501083_0001673 | Ga0501083_0001673_11853_12623 | 242 |
| 237 | 3300049744 | Ga0501083_0008047 | Ga0501083_0008047_5877_6647 | 242 |
| 238 | 3300049822 | Ga0501035_0000175 | Ga0501035_0000175_7452_8222 | 242 |
| 239 | 3300049823 | Ga0501044_0006303 | Ga0501044_0006303_2499_3269 | 242 |
| 240 | 3300049824 | Ga0501045_0000009 | Ga0501045_0000009_19072_19842 | 242 |
| 241 | 3300049824 | Ga0501045_0002161 | Ga0501045_0002161_6124_6894 | 242 |
| 242 | 3300050514 | nmdc:mga08x19_198354_c1 | nmdc:mga08x19_198354_c1_95_892 | 242 |
| 243 | 3300054114 | Ga0501084_0001358 | Ga0501084_0001358_2912_3682 | 242 |
| 244 | 3300054114 | Ga0501084_0005874 | Ga0501084_0005874_7452_8222 | 242 |
| 245 | 3300060353 | Ga0501082_0000063 | Ga0501082_0000063_60685_61455 | 242 |
| 246 | 3300060353 | Ga0501082_0001009 | Ga0501082_0001009_8815_9585 | 242 |
| 247 | 3300061734 | Ga0530510_0000014 | Ga0530510_0000014_86052_86822 | 242 |
| 248 | 3300061734 | Ga0530510_0001148 | Ga0530510_0001148_811_1581 | 242 |
| 249 | 3300035116 | Ga0373945_0004604 | Ga0373945_0004604_1184_1951 | 243 |
| 250 | 3300035170 | Ga0373943_0007558 | Ga0373943_0007558_1454_2221 | 243 |
| 251 | 3300035171 | Ga0373946_0013315 | Ga0373946_0013315_424_1191 | 243 |
| 252 | 3300035725 | Ga0373947_0001538 | Ga0373947_0001538_9026_9793 | 243 |
| 253 | 3300037068 | Ga0373925_0215933 | Ga0373925_0215933_735_1502 | 243 |
| 254 | 3300046455 | Ga0495603_0001473 | Ga0495603_0001473_12326_13093 | 243 |
| 255 | 3300046461 | Ga0495641_0003321 | Ga0495641_0003321_2774_3541 | 243 |
| 256 | 3300046472 | Ga0495580_0022051 | Ga0495580_0022051_1663_2430 | 243 |
| 257 | 3300046473 | Ga0495582_0037719 | Ga0495582_0037719_984_1751 | 243 |
| 258 | 3300046475 | Ga0495639_0138624 | Ga0495639_0138624_246_1013 | 243 |
| 259 | 3300046499 | Ga0495594_0000157 | Ga0495594_0000157_27548_28315 | 243 |
| 260 | 3300046516 | Ga0495628_0172280 | Ga0495628_0172280_306_1082 | 243 |
| 261 | 3300046529 | Ga0495652_0317936 | Ga0495652_0317936_182_958 | 243 |
| 262 | 3300046535 | Ga0495586_0000527 | Ga0495586_0000527_5267_6061 | 243 |
| 263 | 3300046536 | Ga0495587_0054503 | Ga0495587_0054503_1149_1946 | 243 |
| 264 | 3300046674 | Ga0495588_0010582 | Ga0495588_0010582_2974_3741 | 243 |
| 265 | 3300046681 | Ga0495647_0026359 | Ga0495647_0026359_881_1648 | 243 |
| 266 | 3300046683 | Ga0495658_0228514 | Ga0495658_0228514_290_1057 | 243 |
| 267 | 3300047315 | Ga0495581_0222299 | Ga0495581_0222299_24_791 | 243 |
| 268 | 3300047321 | Ga0495676_0014558 | Ga0495676_0014558_4081_4848 | 243 |
| 269 | 3300053085 | Ga0495619_0000024 | Ga0495619_0000024_46642_47406 | 243 |
| 270 | 3300005329 | Ga0070683_100000793 | Ga0070683_10000079324 | 244 |
| 271 | 3300005985 | Ga0081539_10000473 | Ga0081539_1000047355 | 244 |
| 272 | 3300025944 | Ga0207661_10001949 | Ga0207661_1000194911 | 244 |
| 273 | 3300044694 | Ga0466963_0207075 | Ga0466963_0207075_254_1045 | 244 |
| 274 | 3300047469 | Ga0495673_0029664 | Ga0495673_0029664_64_849 | 244 |
| 275 | 3300048909 | Ga0496106_0000013 | Ga0496106_0000013_168174_168971 | 244 |
| 276 | 3300005329 | Ga0070683_100043303 | Ga0070683_1000433034 | 245 |
| 277 | 3300005459 | Ga0068867_100000179 | Ga0068867_10000017931 | 245 |
| 278 | 3300005535 | Ga0070684_100003511 | Ga0070684_1000035111 | 245 |
| 279 | 3300009176 | Ga0105242_10068974 | Ga0105242_100689743 | 245 |
| 280 | 3300025934 | Ga0207686_10006424 | Ga0207686_100064243 | 245 |
| 281 | 3300025944 | Ga0207661_10030009 | Ga0207661_100300095 | 245 |
| 282 | 3300026089 | Ga0207648_10000228 | Ga0207648_1000022830 | 245 |
| 283 | 3300046523 | Ga0495644_0000954 | Ga0495644_0000954_2655_3446 | 245 |
| 284 | 3300005331 | Ga0070670_100044615 | Ga0070670_1000446152 | 246 |
| 285 | 3300005364 | Ga0070673_100013844 | Ga0070673_1000138445 | 246 |
| 286 | 3300025925 | Ga0207650_10025386 | Ga0207650_100253862 | 246 |
| 287 | 3300025960 | Ga0207651_10008445 | Ga0207651_100084452 | 246 |
| 288 | 3300005356 | Ga0070674_100000020 | Ga0070674_10000002016 | 247 |
| 289 | 3300005718 | Ga0068866_10000019 | Ga0068866_1000001980 | 247 |
| 290 | 3300009148 | Ga0105243_10345353 | Ga0105243_103453532 | 247 |
| 291 | 3300025899 | Ga0207642_10000017 | Ga0207642_1000001778 | 247 |
| 292 | 3300025937 | Ga0207669_10000016 | Ga0207669_10000016132 | 247 |
| 293 | 3300014326 | Ga0157380_10052162 | Ga0157380_100521623 | 248 |
| 294 | 3300046459 | Ga0495629_0129808 | Ga0495629_0129808_589_1335 | 248 |
| 295 | 3300009098 | Ga0105245_10359013 | Ga0105245_103590132 | 249 |
| 296 | 3300014969 | Ga0157376_10767140 | Ga0157376_107671402 | 249 |
| 297 | 3300035083 | Ga0373926_0071554 | Ga0373926_0071554_271_1020 | 249 |
| 298 | 3300035089 | Ga0373944_0016363 | Ga0373944_0016363_765_1514 | 249 |
| 299 | 3300035170 | Ga0373943_0000090 | Ga0373943_0000090_16345_17094 | 249 |
| 300 | 3300035171 | Ga0373946_0007850 | Ga0373946_0007850_1835_2584 | 249 |
| 301 | 3300035695 | Ga0373927_0074898 | Ga0373927_0074898_513_1262 | 249 |
| 302 | 3300035725 | Ga0373947_0000266 | Ga0373947_0000266_15915_16664 | 249 |
| 303 | 3300037068 | Ga0373925_0001866 | Ga0373925_0001866_4029_4778 | 249 |
| 304 | 3300046454 | Ga0495592_0164449 | Ga0495592_0164449_655_1404 | 249 |
| 305 | 3300046459 | Ga0495629_0002088 | Ga0495629_0002088_10318_11067 | 249 |
| 306 | 3300046461 | Ga0495641_0005538 | Ga0495641_0005538_638_1387 | 249 |
| 307 | 3300046462 | Ga0495651_0024849 | Ga0495651_0024849_2272_3021 | 249 |
| 308 | 3300046463 | Ga0495653_0032140 | Ga0495653_0032140_2539_3288 | 249 |
| 309 | 3300046473 | Ga0495582_0000801 | Ga0495582_0000801_16072_16821 | 249 |
| 310 | 3300046475 | Ga0495639_0002081 | Ga0495639_0002081_937_1686 | 249 |
| 311 | 3300046476 | Ga0495662_0000984 | Ga0495662_0000984_12057_12806 | 249 |
| 312 | 3300046477 | Ga0495664_0000012 | Ga0495664_0000012_164149_164898 | 249 |
| 313 | 3300046477 | Ga0495664_0052360 | Ga0495664_0052360_859_1608 | 249 |
| 314 | 3300046499 | Ga0495594_0027397 | Ga0495594_0027397_1463_2212 | 249 |
| 315 | 3300046511 | Ga0495608_0265658 | Ga0495608_0265658_254_1003 | 249 |
| 316 | 3300046516 | Ga0495628_0039578 | Ga0495628_0039578_2702_3451 | 249 |
| 317 | 3300046517 | Ga0495630_0005899 | Ga0495630_0005899_766_1515 | 249 |
| 318 | 3300046526 | Ga0495666_0016257 | Ga0495666_0016257_1769_2518 | 249 |
| 319 | 3300046529 | Ga0495652_0147980 | Ga0495652_0147980_190_939 | 249 |
| 320 | 3300046531 | Ga0495665_0000215 | Ga0495665_0000215_1575_2324 | 249 |
| 321 | 3300046533 | Ga0495640_0114688 | Ga0495640_0114688_189_938 | 249 |
| 322 | 3300046533 | Ga0495640_0121419 | Ga0495640_0121419_831_1580 | 249 |
| 323 | 3300046535 | Ga0495586_0031050 | Ga0495586_0031050_2029_2778 | 249 |
| 324 | 3300046559 | Ga0495667_0064213 | Ga0495667_0064213_1047_1796 | 249 |
| 325 | 3300046663 | Ga0495635_0037192 | Ga0495635_0037192_294_1043 | 249 |
| 326 | 3300046663 | Ga0495635_0076575 | Ga0495635_0076575_1380_2129 | 249 |
| 327 | 3300046679 | Ga0495623_0109015 | Ga0495623_0109015_371_1120 | 249 |
| 328 | 3300046681 | Ga0495647_0002559 | Ga0495647_0002559_3458_4207 | 249 |
| 329 | 3300046683 | Ga0495658_0002471 | Ga0495658_0002471_1921_2670 | 249 |
| 330 | 3300046689 | Ga0495613_0003963 | Ga0495613_0003963_7951_8700 | 249 |
| 331 | 3300046690 | Ga0495624_0012694 | Ga0495624_0012694_4801_5550 | 249 |
| 332 | 3300046809 | Ga0495600_0043498 | Ga0495600_0043498_834_1583 | 249 |
| 333 | 3300047315 | Ga0495581_0038723 | Ga0495581_0038723_1373_2122 | 249 |
| 334 | 3300047319 | Ga0495674_0034205 | Ga0495674_0034205_3337_4086 | 249 |
| 335 | 3300047319 | Ga0495674_0137328 | Ga0495674_0137328_587_1336 | 249 |
| 336 | 3300047321 | Ga0495676_0001001 | Ga0495676_0001001_21906_22655 | 249 |
| 337 | 3300047322 | Ga0495680_0005597 | Ga0495680_0005597_8014_8763 | 249 |
| 338 | 3300047322 | Ga0495680_0013355 | Ga0495680_0013355_4445_5194 | 249 |
| 339 | 3300047471 | Ga0495684_0006596 | Ga0495684_0006596_8073_8822 | 249 |
| 340 | 3300047471 | Ga0495684_0010019 | Ga0495684_0010019_3930_4679 | 249 |
| 341 | 3300047673 | Ga0495593_0001317 | Ga0495593_0001317_12436_13185 | 249 |
| 342 | 3300048089 | Ga0495614_0004961 | Ga0495614_0004961_2417_3166 | 249 |
| 343 | 3300048905 | Ga0496102_0000027 | Ga0496102_0000027_159053_159802 | 249 |
| 344 | 3300048906 | Ga0496103_0000155 | Ga0496103_0000155_18516_19265 | 249 |
| 345 | 3300053077 | Ga0495601_0059411 | Ga0495601_0059411_259_1008 | 249 |
| 346 | 3300053084 | Ga0495595_0006454 | Ga0495595_0006454_3054_3803 | 249 |
| 347 | 3300053085 | Ga0495619_0004791 | Ga0495619_0004791_1023_1772 | 249 |
| 348 | 3300041486 | Ga0451807_2280868 | Ga0451807_2280868_733_1485 | 250 |
| 349 | 3300046681 | Ga0495647_0004495 | Ga0495647_0004495_1314_2066 | 250 |
| 350 | 3300049744 | Ga0501083_0372292 | Ga0501083_0372292_22_837 | 250 |
| 351 | 3300005329 | Ga0070683_100001714 | Ga0070683_10000171414 | 251 |
| 352 | 3300005335 | Ga0070666_10085528 | Ga0070666_100855281 | 251 |
| 353 | 3300005365 | Ga0070688_100000333 | Ga0070688_10000033319 | 251 |
| 354 | 3300005435 | Ga0070714_100000243 | Ga0070714_10000024314 | 251 |
| 355 | 3300005435 | Ga0070714_100199562 | Ga0070714_1001995622 | 251 |
| 356 | 3300005437 | Ga0070710_10017787 | Ga0070710_100177872 | 251 |
| 357 | 3300005445 | Ga0070708_100025820 | Ga0070708_1000258204 | 251 |
| 358 | 3300005466 | Ga0070685_10000293 | Ga0070685_1000029326 | 251 |
| 359 | 3300005467 | Ga0070706_100099695 | Ga0070706_1000996953 | 251 |
| 360 | 3300005471 | Ga0070698_100008430 | Ga0070698_1000084308 | 251 |
| 361 | 3300005518 | Ga0070699_100691064 | Ga0070699_1006910641 | 251 |
| 362 | 3300005536 | Ga0070697_100114251 | Ga0070697_1001142512 | 251 |
| 363 | 3300005539 | Ga0068853_100483223 | Ga0068853_1004832231 | 251 |
| 364 | 3300005546 | Ga0070696_100577520 | Ga0070696_1005775201 | 251 |
| 365 | 3300005614 | Ga0068856_100018421 | Ga0068856_1000184216 | 251 |
| 366 | 3300006163 | Ga0070715_10064513 | Ga0070715_100645132 | 251 |
| 367 | 3300006175 | Ga0070712_100100853 | Ga0070712_1001008532 | 251 |
| 368 | 3300006844 | Ga0075428_100021945 | Ga0075428_1000219454 | 251 |
| 369 | 3300006847 | Ga0075431_100065779 | Ga0075431_1000657792 | 251 |
| 370 | 3300006852 | Ga0075433_10037865 | Ga0075433_100378653 | 251 |
| 371 | 3300006871 | Ga0075434_100370372 | Ga0075434_1003703722 | 251 |
| 372 | 3300006914 | Ga0075436_100047633 | Ga0075436_1000476334 | 251 |
| 373 | 3300007076 | Ga0075435_100171504 | Ga0075435_1001715043 | 251 |
| 374 | 3300009094 | Ga0111539_10057025 | Ga0111539_100570253 | 251 |
| 375 | 3300009098 | Ga0105245_10000056 | Ga0105245_100000569 | 251 |
| 376 | 3300009101 | Ga0105247_10272342 | Ga0105247_102723422 | 251 |
| 377 | 3300009147 | Ga0114129_10467965 | Ga0114129_104679652 | 251 |
| 378 | 3300009177 | Ga0105248_10000032 | Ga0105248_10000032111 | 251 |
| 379 | 3300013104 | Ga0157370_10007615 | Ga0157370_100076158 | 251 |
| 380 | 3300013105 | Ga0157369_10000099 | Ga0157369_1000009929 | 251 |
| 381 | 3300025903 | Ga0207680_10166999 | Ga0207680_101669992 | 251 |
| 382 | 3300025905 | Ga0207685_10112614 | Ga0207685_101126142 | 251 |
| 383 | 3300025915 | Ga0207693_10043531 | Ga0207693_100435313 | 251 |
| 384 | 3300025922 | Ga0207646_10315543 | Ga0207646_103155432 | 251 |
| 385 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007113 | 251 |
| 386 | 3300025928 | Ga0207700_10086661 | Ga0207700_100866613 | 251 |
| 387 | 3300025928 | Ga0207700_10397504 | Ga0207700_103975042 | 251 |
| 388 | 3300025929 | Ga0207664_10000013 | Ga0207664_10000013161 | 251 |
| 389 | 3300025929 | Ga0207664_10154503 | Ga0207664_101545032 | 251 |
| 390 | 3300025939 | Ga0207665_10020351 | Ga0207665_100203515 | 251 |
| 391 | 3300025941 | Ga0207711_10000020 | Ga0207711_10000020263 | 251 |
| 392 | 3300025944 | Ga0207661_10001238 | Ga0207661_1000123814 | 251 |
| 393 | 3300026078 | Ga0207702_10003815 | Ga0207702_100038158 | 251 |
| 394 | 3300027907 | Ga0207428_10076863 | Ga0207428_100768632 | 251 |
| 395 | 3300037418 | Ga0395900_0252312 | Ga0395900_0252312_111_881 | 251 |
| 396 | 3300038443 | Ga0395901_0000856 | Ga0395901_0000856_25748_26518 | 251 |
| 397 | 3300044842 | Ga0466957_0003681 | Ga0466957_0003681_4255_5046 | 251 |
| 398 | 3300046459 | Ga0495629_0005520 | Ga0495629_0005520_1494_2279 | 251 |
| 399 | 3300046683 | Ga0495658_0001056 | Ga0495658_0001056_959_1750 | 251 |
| 400 | 3300048911 | Ga0496108_0000045 | Ga0496108_0000045_114925_115716 | 251 |
| 401 | 3300048912 | Ga0496109_0000028 | Ga0496109_0000028_155849_156610 | 251 |
| 402 | 3300048912 | Ga0496109_0000032 | Ga0496109_0000032_21710_22501 | 251 |
| 403 | 3300048913 | Ga0496110_0126042 | Ga0496110_0126042_126_896 | 251 |
| 404 | 3300048916 | Ga0496113_0161716 | Ga0496113_0161716_36_827 | 251 |
| 405 | 3300050507 | nmdc:mga05p37_62567_c1 | nmdc:mga05p37_62567_c1_540_1310 | 251 |
| 406 | 3300050511 | nmdc:mga08y16_55458_c1 | nmdc:mga08y16_55458_c1_1711_2481 | 251 |
| 407 | 3300050513 | nmdc:mga0rr50_372931_c1 | nmdc:mga0rr50_372931_c1_414_1184 | 251 |
| 408 | 3300050515 | nmdc:mga0a205_65733_c1 | nmdc:mga0a205_65733_c1_920_1690 | 251 |
| 409 | 3300053077 | Ga0495601_0003248 | Ga0495601_0003248_7130_8080 | 251 |
| 410 | 3300053085 | Ga0495619_0309197 | Ga0495619_0309197_204_977 | 251 |
| 411 | 3300005327 | Ga0070658_10144314 | Ga0070658_101443142 | 252 |
| 412 | 3300005329 | Ga0070683_100013143 | Ga0070683_1000131435 | 252 |
| 413 | 3300005333 | Ga0070677_10000003 | Ga0070677_1000000363 | 252 |
| 414 | 3300005335 | Ga0070666_10003293 | Ga0070666_100032932 | 252 |
| 415 | 3300005337 | Ga0070682_100000080 | Ga0070682_10000008058 | 252 |
| 416 | 3300005337 | Ga0070682_100000102 | Ga0070682_10000010276 | 252 |
| 417 | 3300005337 | Ga0070682_100255499 | Ga0070682_1002554992 | 252 |
| 418 | 3300005338 | Ga0068868_100000095 | Ga0068868_10000009554 | 252 |
| 419 | 3300005340 | Ga0070689_100072593 | Ga0070689_1000725933 | 252 |
| 420 | 3300005340 | Ga0070689_100505377 | Ga0070689_1005053771 | 252 |
| 421 | 3300005341 | Ga0070691_10008984 | Ga0070691_100089842 | 252 |
| 422 | 3300005344 | Ga0070661_100000005 | Ga0070661_100000005205 | 252 |
| 423 | 3300005347 | Ga0070668_100148348 | Ga0070668_1001483482 | 252 |
| 424 | 3300005356 | Ga0070674_100000003 | Ga0070674_100000003192 | 252 |
| 425 | 3300005356 | Ga0070674_100023772 | Ga0070674_1000237723 | 252 |
| 426 | 3300005365 | Ga0070688_100002793 | Ga0070688_1000027936 | 252 |
| 427 | 3300005436 | Ga0070713_100000138 | Ga0070713_1000001388 | 252 |
| 428 | 3300005436 | Ga0070713_100015507 | Ga0070713_1000155073 | 252 |
| 429 | 3300005437 | Ga0070710_10164320 | Ga0070710_101643201 | 252 |
| 430 | 3300005437 | Ga0070710_10245347 | Ga0070710_102453472 | 252 |
| 431 | 3300005439 | Ga0070711_100008345 | Ga0070711_1000083454 | 252 |
| 432 | 3300005439 | Ga0070711_100043089 | Ga0070711_1000430893 | 252 |
| 433 | 3300005455 | Ga0070663_100085873 | Ga0070663_1000858732 | 252 |
| 434 | 3300005456 | Ga0070678_100004162 | Ga0070678_10000416210 | 252 |
| 435 | 3300005457 | Ga0070662_100000363 | Ga0070662_10000036315 | 252 |
| 436 | 3300005458 | Ga0070681_10005901 | Ga0070681_100059019 | 252 |
| 437 | 3300005530 | Ga0070679_100000537 | Ga0070679_10000053714 | 252 |
| 438 | 3300005535 | Ga0070684_100223350 | Ga0070684_1002233503 | 252 |
| 439 | 3300005539 | Ga0068853_100002080 | Ga0068853_1000020803 | 252 |
| 440 | 3300005547 | Ga0070693_100000833 | Ga0070693_10000083313 | 252 |
| 441 | 3300005547 | Ga0070693_100016010 | Ga0070693_1000160103 | 252 |
| 442 | 3300005548 | Ga0070665_100000159 | Ga0070665_100000159125 | 252 |
| 443 | 3300005548 | Ga0070665_100219516 | Ga0070665_1002195161 | 252 |
| 444 | 3300005548 | Ga0070665_100685624 | Ga0070665_1006856241 | 252 |
| 445 | 3300005578 | Ga0068854_100006423 | Ga0068854_1000064232 | 252 |
| 446 | 3300005578 | Ga0068854_100012863 | Ga0068854_1000128633 | 252 |
| 447 | 3300005578 | Ga0068854_100327648 | Ga0068854_1003276482 | 252 |
| 448 | 3300005578 | Ga0068854_100589319 | Ga0068854_1005893192 | 252 |
| 449 | 3300005614 | Ga0068856_100023907 | Ga0068856_1000239071 | 252 |
| 450 | 3300005614 | Ga0068856_100074564 | Ga0068856_1000745643 | 252 |
| 451 | 3300005616 | Ga0068852_100000012 | Ga0068852_100000012116 | 252 |
| 452 | 3300005718 | Ga0068866_10000002 | Ga0068866_10000002218 | 252 |
| 453 | 3300005834 | Ga0068851_10002153 | Ga0068851_100021532 | 252 |
| 454 | 3300005840 | Ga0068870_10066166 | Ga0068870_100661661 | 252 |
| 455 | 3300005842 | Ga0068858_100000049 | Ga0068858_10000004918 | 252 |
| 456 | 3300005842 | Ga0068858_100049480 | Ga0068858_1000494803 | 252 |
| 457 | 3300005983 | Ga0081540_1000006 | Ga0081540_100000672 | 252 |
| 458 | 3300005985 | Ga0081539_10119888 | Ga0081539_101198882 | 252 |
| 459 | 3300006028 | Ga0070717_10075881 | Ga0070717_100758813 | 252 |
| 460 | 3300006163 | Ga0070715_10000012 | Ga0070715_1000001255 | 252 |
| 461 | 3300006163 | Ga0070715_10103001 | Ga0070715_101030011 | 252 |
| 462 | 3300006175 | Ga0070712_100000777 | Ga0070712_10000077719 | 252 |
| 463 | 3300009094 | Ga0111539_10242677 | Ga0111539_102426772 | 252 |
| 464 | 3300009098 | Ga0105245_10000290 | Ga0105245_1000029052 | 252 |
| 465 | 3300009098 | Ga0105245_10001677 | Ga0105245_100016779 | 252 |
| 466 | 3300009098 | Ga0105245_10003691 | Ga0105245_1000369111 | 252 |
| 467 | 3300009101 | Ga0105247_10000202 | Ga0105247_1000020210 | 252 |
| 468 | 3300009101 | Ga0105247_10409945 | Ga0105247_104099451 | 252 |
| 469 | 3300009147 | Ga0114129_10029165 | Ga0114129_100291656 | 252 |
| 470 | 3300009174 | Ga0105241_10081860 | Ga0105241_100818602 | 252 |
| 471 | 3300009553 | Ga0105249_10000073 | Ga0105249_10000073113 | 252 |
| 472 | 3300013102 | Ga0157371_10009448 | Ga0157371_100094482 | 252 |
| 473 | 3300013104 | Ga0157370_10005853 | Ga0157370_100058534 | 252 |
| 474 | 3300013297 | Ga0157378_10016775 | Ga0157378_1001677510 | 252 |
| 475 | 3300013297 | Ga0157378_10074162 | Ga0157378_100741623 | 252 |
| 476 | 3300013308 | Ga0157375_10000707 | Ga0157375_1000070716 | 252 |
| 477 | 3300014326 | Ga0157380_10003655 | Ga0157380_100036558 | 252 |
| 478 | 3300014968 | Ga0157379_10040899 | Ga0157379_100408993 | 252 |
| 479 | 3300014969 | Ga0157376_10643395 | Ga0157376_106433952 | 252 |
| 480 | 3300017792 | Ga0163161_10000058 | Ga0163161_1000005844 | 252 |
| 481 | 3300017792 | Ga0163161_10014924 | Ga0163161_100149247 | 252 |
| 482 | 3300021384 | Ga0213876_10098728 | Ga0213876_100987281 | 252 |
| 483 | 3300021388 | Ga0213875_10000468 | Ga0213875_1000046811 | 252 |
| 484 | 3300025321 | Ga0207656_10032149 | Ga0207656_100321492 | 252 |
| 485 | 3300025893 | Ga0207682_10000052 | Ga0207682_1000005222 | 252 |
| 486 | 3300025898 | Ga0207692_10052115 | Ga0207692_100521152 | 252 |
| 487 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001396 | 252 |
| 488 | 3300025899 | Ga0207642_10000003 | Ga0207642_10000003396 | 252 |
| 489 | 3300025899 | Ga0207642_10000004 | Ga0207642_10000004396 | 252 |
| 490 | 3300025900 | Ga0207710_10000369 | Ga0207710_1000036923 | 252 |
| 491 | 3300025903 | Ga0207680_10002430 | Ga0207680_100024303 | 252 |
| 492 | 3300025909 | Ga0207705_10049419 | Ga0207705_100494193 | 252 |
| 493 | 3300025911 | Ga0207654_10121817 | Ga0207654_101218172 | 252 |
| 494 | 3300025913 | Ga0207695_10560577 | Ga0207695_105605772 | 252 |
| 495 | 3300025915 | Ga0207693_10008860 | Ga0207693_100088602 | 252 |
| 496 | 3300025916 | Ga0207663_10031736 | Ga0207663_100317363 | 252 |
| 497 | 3300025917 | Ga0207660_10123298 | Ga0207660_101232982 | 252 |
| 498 | 3300025920 | Ga0207649_10000005 | Ga0207649_10000005348 | 252 |
| 499 | 3300025921 | Ga0207652_10000631 | Ga0207652_1000063116 | 252 |
| 500 | 3300025927 | Ga0207687_10000012 | Ga0207687_1000001213 | 252 |
| 501 | 3300025927 | Ga0207687_10000646 | Ga0207687_1000064612 | 252 |
| 502 | 3300025927 | Ga0207687_10000970 | Ga0207687_1000097020 | 252 |
| 503 | 3300025928 | Ga0207700_10000008 | Ga0207700_10000008339 | 252 |
| 504 | 3300025928 | Ga0207700_10000016 | Ga0207700_100000168 | 252 |
| 505 | 3300025928 | Ga0207700_10207811 | Ga0207700_102078112 | 252 |
| 506 | 3300025929 | Ga0207664_10110118 | Ga0207664_101101181 | 252 |
| 507 | 3300025931 | Ga0207644_10123003 | Ga0207644_101230033 | 252 |
| 508 | 3300025932 | Ga0207690_10008415 | Ga0207690_100084152 | 252 |
| 509 | 3300025933 | Ga0207706_10000006 | Ga0207706_1000000616 | 252 |
| 510 | 3300025936 | Ga0207670_10259273 | Ga0207670_102592732 | 252 |
| 511 | 3300025937 | Ga0207669_10000036 | Ga0207669_1000003628 | 252 |
| 512 | 3300025944 | Ga0207661_10008416 | Ga0207661_100084165 | 252 |
| 513 | 3300025945 | Ga0207679_10025975 | Ga0207679_100259754 | 252 |
| 514 | 3300025961 | Ga0207712_10000003 | Ga0207712_10000003470 | 252 |
| 515 | 3300025961 | Ga0207712_10235415 | Ga0207712_102354152 | 252 |
| 516 | 3300025961 | Ga0207712_10331831 | Ga0207712_103318312 | 252 |
| 517 | 3300025972 | Ga0207668_10044746 | Ga0207668_100447463 | 252 |
| 518 | 3300025981 | Ga0207640_10000285 | Ga0207640_100002856 | 252 |
| 519 | 3300025981 | Ga0207640_10002518 | Ga0207640_1000251810 | 252 |
| 520 | 3300025981 | Ga0207640_10168323 | Ga0207640_101683232 | 252 |
| 521 | 3300026023 | Ga0207677_10001435 | Ga0207677_100014357 | 252 |
| 522 | 3300026035 | Ga0207703_10000067 | Ga0207703_1000006716 | 252 |
| 523 | 3300026035 | Ga0207703_10073601 | Ga0207703_100736013 | 252 |
| 524 | 3300026041 | Ga0207639_10001671 | Ga0207639_100016713 | 252 |
| 525 | 3300026067 | Ga0207678_10063204 | Ga0207678_100632043 | 252 |
| 526 | 3300026078 | Ga0207702_10000016 | Ga0207702_10000016104 | 252 |
| 527 | 3300026078 | Ga0207702_10192541 | Ga0207702_101925412 | 252 |
| 528 | 3300026088 | Ga0207641_10008529 | Ga0207641_100085293 | 252 |
| 529 | 3300026121 | Ga0207683_10006404 | Ga0207683_100064043 | 252 |
| 530 | 3300026121 | Ga0207683_10297110 | Ga0207683_102971101 | 252 |
| 531 | 3300026142 | Ga0207698_10000012 | Ga0207698_10000012235 | 252 |
| 532 | 3300028379 | Ga0268266_10000023 | Ga0268266_10000023345 | 252 |
| 533 | 3300028379 | Ga0268266_10000553 | Ga0268266_1000055331 | 252 |
| 534 | 3300028379 | Ga0268266_10002681 | Ga0268266_1000268119 | 252 |
| 535 | 3300028381 | Ga0268264_10007216 | Ga0268264_100072168 | 252 |
| 536 | 3300037853 | Ga0436364_1031907 | Ga0436364_1031907_58036_58806 | 252 |
| 537 | 3300039437 | Ga0436365_0328253 | Ga0436365_0328253_684_1454 | 252 |
| 538 | 3300039453 | Ga0436362_0533856 | Ga0436362_0533856_178_948 | 252 |
| 539 | 3300041451 | Ga0451791_1163314 | Ga0451791_1163314_347_1132 | 252 |
| 540 | 3300041512 | Ga0451853_0384465 | Ga0451853_0384465_1062_1859 | 252 |
| 541 | 3300041512 | Ga0451853_1991254 | Ga0451853_1991254_395_1180 | 252 |
| 542 | 3300044684 | Ga0466966_0208199 | Ga0466966_0208199_127_897 | 252 |
| 543 | 3300044693 | Ga0466961_0338983 | Ga0466961_0338983_80_850 | 252 |
| 544 | 3300044693 | Ga0466961_0350564 | Ga0466961_0350564_101_871 | 252 |
| 545 | 3300044694 | Ga0466963_0000070 | Ga0466963_0000070_28113_28910 | 252 |
| 546 | 3300044694 | Ga0466963_0079187 | Ga0466963_0079187_115_885 | 252 |
| 547 | 3300045049 | Ga0466959_0252775 | Ga0466959_0252775_256_1026 | 252 |
| 548 | 3300045836 | Ga0466958_0112295 | Ga0466958_0112295_80_850 | 252 |
| 549 | 3300046454 | Ga0495592_0000621 | Ga0495592_0000621_3543_4337 | 252 |
| 550 | 3300046454 | Ga0495592_0213460 | Ga0495592_0213460_339_1124 | 252 |
| 551 | 3300046455 | Ga0495603_0003021 | Ga0495603_0003021_8248_9045 | 252 |
| 552 | 3300046455 | Ga0495603_0077607 | Ga0495603_0077607_24_794 | 252 |
| 553 | 3300046459 | Ga0495629_0007647 | Ga0495629_0007647_7088_7873 | 252 |
| 554 | 3300046459 | Ga0495629_0019746 | Ga0495629_0019746_3309_4094 | 252 |
| 555 | 3300046460 | Ga0495638_0009398 | Ga0495638_0009398_1380_2168 | 252 |
| 556 | 3300046461 | Ga0495641_0015104 | Ga0495641_0015104_2451_3245 | 252 |
| 557 | 3300046463 | Ga0495653_0099929 | Ga0495653_0099929_913_1677 | 252 |
| 558 | 3300046473 | Ga0495582_0000005 | Ga0495582_0000005_108844_109638 | 252 |
| 559 | 3300046476 | Ga0495662_0000022 | Ga0495662_0000022_18025_18822 | 252 |
| 560 | 3300046491 | Ga0495584_0163949 | Ga0495584_0163949_40_810 | 252 |
| 561 | 3300046507 | Ga0495606_0000211 | Ga0495606_0000211_60853_61638 | 252 |
| 562 | 3300046511 | Ga0495608_0000031 | Ga0495608_0000031_10117_10902 | 252 |
| 563 | 3300046511 | Ga0495608_0000406 | Ga0495608_0000406_14412_15209 | 252 |
| 564 | 3300046511 | Ga0495608_0107463 | Ga0495608_0107463_281_1075 | 252 |
| 565 | 3300046514 | Ga0495618_0000068 | Ga0495618_0000068_68923_69717 | 252 |
| 566 | 3300046515 | Ga0495620_0000315 | Ga0495620_0000315_29536_30306 | 252 |
| 567 | 3300046516 | Ga0495628_0000323 | Ga0495628_0000323_7238_8023 | 252 |
| 568 | 3300046516 | Ga0495628_0036648 | Ga0495628_0036648_1855_2652 | 252 |
| 569 | 3300046516 | Ga0495628_0069964 | Ga0495628_0069964_951_1715 | 252 |
| 570 | 3300046516 | Ga0495628_0188052 | Ga0495628_0188052_28_792 | 252 |
| 571 | 3300046517 | Ga0495630_0000018 | Ga0495630_0000018_12_797 | 252 |
| 572 | 3300046517 | Ga0495630_0020993 | Ga0495630_0020993_1220_2017 | 252 |
| 573 | 3300046517 | Ga0495630_0064242 | Ga0495630_0064242_1472_2269 | 252 |
| 574 | 3300046529 | Ga0495652_0000003 | Ga0495652_0000003_35360_36145 | 252 |
| 575 | 3300046533 | Ga0495640_0047817 | Ga0495640_0047817_2000_2797 | 252 |
| 576 | 3300046536 | Ga0495587_0001970 | Ga0495587_0001970_5625_6452 | 252 |
| 577 | 3300046536 | Ga0495587_0265446 | Ga0495587_0265446_127_918 | 252 |
| 578 | 3300046543 | Ga0495645_0205758 | Ga0495645_0205758_332_1117 | 252 |
| 579 | 3300046557 | Ga0495622_0000014 | Ga0495622_0000014_125583_126410 | 252 |
| 580 | 3300046559 | Ga0495667_0082143 | Ga0495667_0082143_978_1742 | 252 |
| 581 | 3300046616 | Ga0495668_0031957 | Ga0495668_0031957_301_1095 | 252 |
| 582 | 3300046642 | Ga0495634_0026899 | Ga0495634_0026899_2769_3566 | 252 |
| 583 | 3300046660 | Ga0495625_0000029 | Ga0495625_0000029_4364_5155 | 252 |
| 584 | 3300046663 | Ga0495635_0000009 | Ga0495635_0000009_241116_241913 | 252 |
| 585 | 3300046675 | Ga0495657_0000024 | Ga0495657_0000024_10117_10902 | 252 |
| 586 | 3300046675 | Ga0495657_0004915 | Ga0495657_0004915_4397_5191 | 252 |
| 587 | 3300046675 | Ga0495657_0213593 | Ga0495657_0213593_199_969 | 252 |
| 588 | 3300046678 | Ga0495599_0031412 | Ga0495599_0031412_80_877 | 252 |
| 589 | 3300046681 | Ga0495647_0000037 | Ga0495647_0000037_13393_14193 | 252 |
| 590 | 3300046683 | Ga0495658_0000019 | Ga0495658_0000019_46543_47337 | 252 |
| 591 | 3300046684 | Ga0495669_0000562 | Ga0495669_0000562_773_1567 | 252 |
| 592 | 3300046689 | Ga0495613_0000249 | Ga0495613_0000249_17791_18585 | 252 |
| 593 | 3300046689 | Ga0495613_0000309 | Ga0495613_0000309_7067_7855 | 252 |
| 594 | 3300046690 | Ga0495624_0000028 | Ga0495624_0000028_25129_25926 | 252 |
| 595 | 3300046690 | Ga0495624_0066552 | Ga0495624_0066552_1159_1956 | 252 |
| 596 | 3300046691 | Ga0495670_0017148 | Ga0495670_0017148_1036_1836 | 252 |
| 597 | 3300046694 | Ga0495649_0015920 | Ga0495649_0015920_44_841 | 252 |
| 598 | 3300046809 | Ga0495600_0003314 | Ga0495600_0003314_4877_5665 | 252 |
| 599 | 3300046809 | Ga0495600_0010047 | Ga0495600_0010047_2447_3241 | 252 |
| 600 | 3300046809 | Ga0495600_0041968 | Ga0495600_0041968_890_1687 | 252 |
| 601 | 3300047315 | Ga0495581_0069066 | Ga0495581_0069066_662_1459 | 252 |
| 602 | 3300047317 | Ga0495604_0000056 | Ga0495604_0000056_21199_21996 | 252 |
| 603 | 3300047317 | Ga0495604_0003466 | Ga0495604_0003466_4902_5690 | 252 |
| 604 | 3300047317 | Ga0495604_0006459 | Ga0495604_0006459_4173_4961 | 252 |
| 605 | 3300047319 | Ga0495674_0000042 | Ga0495674_0000042_16175_16960 | 252 |
| 606 | 3300047321 | Ga0495676_0000646 | Ga0495676_0000646_1205_2002 | 252 |
| 607 | 3300047321 | Ga0495676_0005236 | Ga0495676_0005236_1424_2209 | 252 |
| 608 | 3300047321 | Ga0495676_0138941 | Ga0495676_0138941_62_856 | 252 |
| 609 | 3300047322 | Ga0495680_0000023 | Ga0495680_0000023_32462_33259 | 252 |
| 610 | 3300047322 | Ga0495680_0000421 | Ga0495680_0000421_23674_24468 | 252 |
| 611 | 3300047322 | Ga0495680_0061884 | Ga0495680_0061884_1030_1827 | 252 |
| 612 | 3300047444 | Ga0495675_0000209 | Ga0495675_0000209_10120_10905 | 252 |
| 613 | 3300047447 | Ga0495685_019250 | Ga0495685_019250_604_1401 | 252 |
| 614 | 3300047673 | Ga0495593_0053085 | Ga0495593_0053085_70_891 | 252 |
| 615 | 3300048903 | Ga0496100_0000038 | Ga0496100_0000038_83599_84384 | 252 |
| 616 | 3300048903 | Ga0496100_0000116 | Ga0496100_0000116_42074_42862 | 252 |
| 617 | 3300048903 | Ga0496100_0161150 | Ga0496100_0161150_173_943 | 252 |
| 618 | 3300048904 | Ga0496101_0000003 | Ga0496101_0000003_402858_403646 | 252 |
| 619 | 3300048904 | Ga0496101_0000010 | Ga0496101_0000010_14515_15300 | 252 |
| 620 | 3300048904 | Ga0496101_0008544 | Ga0496101_0008544_4361_5119 | 252 |
| 621 | 3300048905 | Ga0496102_0027850 | Ga0496102_0027850_717_1487 | 252 |
| 622 | 3300048905 | Ga0496102_0130941 | Ga0496102_0130941_1527_2297 | 252 |
| 623 | 3300048905 | Ga0496102_0177626 | Ga0496102_0177626_1076_1861 | 252 |
| 624 | 3300048906 | Ga0496103_0036541 | Ga0496103_0036541_327_1085 | 252 |
| 625 | 3300048906 | Ga0496103_0129794 | Ga0496103_0129794_652_1458 | 252 |
| 626 | 3300048906 | Ga0496103_0252865 | Ga0496103_0252865_276_1070 | 252 |
| 627 | 3300048907 | Ga0496104_0000003 | Ga0496104_0000003_177933_178727 | 252 |
| 628 | 3300048907 | Ga0496104_0000576 | Ga0496104_0000576_17579_18364 | 252 |
| 629 | 3300048907 | Ga0496104_0007540 | Ga0496104_0007540_7275_8033 | 252 |
| 630 | 3300048907 | Ga0496104_0017150 | Ga0496104_0017150_4365_5135 | 252 |
| 631 | 3300048907 | Ga0496104_0020399 | Ga0496104_0020399_298_1083 | 252 |
| 632 | 3300048907 | Ga0496104_0310719 | Ga0496104_0310719_684_1454 | 252 |
| 633 | 3300048908 | Ga0496105_0000008 | Ga0496105_0000008_294140_294934 | 252 |
| 634 | 3300048908 | Ga0496105_0001400 | Ga0496105_0001400_5753_6511 | 252 |
| 635 | 3300048908 | Ga0496105_0009052 | Ga0496105_0009052_2594_3379 | 252 |
| 636 | 3300048909 | Ga0496106_0000018 | Ga0496106_0000018_57979_58764 | 252 |
| 637 | 3300048909 | Ga0496106_0000177 | Ga0496106_0000177_2920_3708 | 252 |
| 638 | 3300048909 | Ga0496106_0062443 | Ga0496106_0062443_377_1135 | 252 |
| 639 | 3300048910 | Ga0496107_0000032 | Ga0496107_0000032_84597_85382 | 252 |
| 640 | 3300048910 | Ga0496107_0000081 | Ga0496107_0000081_2920_3708 | 252 |
| 641 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_260550_261341 | 252 |
| 642 | 3300048911 | Ga0496108_0000631 | Ga0496108_0000631_22278_23042 | 252 |
| 643 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_260512_261303 | 252 |
| 644 | 3300048912 | Ga0496109_0000085 | Ga0496109_0000085_94212_94976 | 252 |
| 645 | 3300048912 | Ga0496109_0001613 | Ga0496109_0001613_9644_10402 | 252 |
| 646 | 3300048912 | Ga0496109_0228633 | Ga0496109_0228633_298_1092 | 252 |
| 647 | 3300048913 | Ga0496110_0000033 | Ga0496110_0000033_64084_64881 | 252 |
| 648 | 3300048913 | Ga0496110_0017994 | Ga0496110_0017994_224_1018 | 252 |
| 649 | 3300048913 | Ga0496110_0129358 | Ga0496110_0129358_76_891 | 252 |
| 650 | 3300048914 | Ga0496111_0001844 | Ga0496111_0001844_10005_10802 | 252 |
| 651 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_614192_614989 | 252 |
| 652 | 3300048915 | Ga0496112_0017217 | Ga0496112_0017217_69_872 | 252 |
| 653 | 3300048916 | Ga0496113_0000007 | Ga0496113_0000007_94973_95818 | 252 |
| 654 | 3300048917 | Ga0496114_0009498 | Ga0496114_0009498_476_1234 | 252 |
| 655 | 3300048917 | Ga0496114_0587247 | Ga0496114_0587247_94_879 | 252 |
| 656 | 3300048918 | Ga0496115_0000020 | Ga0496115_0000020_54582_55367 | 252 |
| 657 | 3300048918 | Ga0496115_0005222 | Ga0496115_0005222_1656_2414 | 252 |
| 658 | 3300048918 | Ga0496115_0006918 | Ga0496115_0006918_537_1307 | 252 |
| 659 | 3300048919 | Ga0496116_0000780 | Ga0496116_0000780_7798_8568 | 252 |
| 660 | 3300048920 | Ga0496117_0015033 | Ga0496117_0015033_2077_2847 | 252 |
| 661 | 3300048921 | Ga0496118_0000174 | Ga0496118_0000174_113271_114041 | 252 |
| 662 | 3300048921 | Ga0496118_0088493 | Ga0496118_0088493_661_1431 | 252 |
| 663 | 3300048922 | Ga0496119_0004215 | Ga0496119_0004215_7779_8549 | 252 |
| 664 | 3300048922 | Ga0496119_0021993 | Ga0496119_0021993_2984_3754 | 252 |
| 665 | 3300048924 | Ga0496121_0005891 | Ga0496121_0005891_4404_5198 | 252 |
| 666 | 3300048924 | Ga0496121_0016585 | Ga0496121_0016585_6221_6991 | 252 |
| 667 | 3300048924 | Ga0496121_0082402 | Ga0496121_0082402_1167_1964 | 252 |
| 668 | 3300048924 | Ga0496121_0086517 | Ga0496121_0086517_1477_2313 | 252 |
| 669 | 3300048927 | Ga0496124_0115152 | Ga0496124_0115152_1242_2039 | 252 |
| 670 | 3300048927 | Ga0496124_0116434 | Ga0496124_0116434_578_1384 | 252 |
| 671 | 3300048928 | Ga0496125_0013994 | Ga0496125_0013994_5356_6150 | 252 |
| 672 | 3300048928 | Ga0496125_0289604 | Ga0496125_0289604_219_989 | 252 |
| 673 | 3300049576 | Ga0501040_0058110 | Ga0501040_0058110_1346_2113 | 252 |
| 674 | 3300049579 | Ga0501043_0371369 | Ga0501043_0371369_224_994 | 252 |
| 675 | 3300049581 | Ga0501047_0009620 | Ga0501047_0009620_1895_2701 | 252 |
| 676 | 3300049582 | Ga0501048_0071099 | Ga0501048_0071099_719_1486 | 252 |
| 677 | 3300049584 | Ga0501068_0018498 | Ga0501068_0018498_127_894 | 252 |
| 678 | 3300049585 | Ga0501069_0077986 | Ga0501069_0077986_675_1442 | 252 |
| 679 | 3300049586 | Ga0501070_0009281 | Ga0501070_0009281_349_1164 | 252 |
| 680 | 3300049587 | Ga0501071_0014797 | Ga0501071_0014797_3106_3873 | 252 |
| 681 | 3300049588 | Ga0501072_0152356 | Ga0501072_0152356_266_1033 | 252 |
| 682 | 3300049590 | Ga0501074_0044985 | Ga0501074_0044985_61_858 | 252 |
| 683 | 3300049590 | Ga0501074_0261410 | Ga0501074_0261410_125_892 | 252 |
| 684 | 3300049592 | Ga0501076_0090419 | Ga0501076_0090419_589_1356 | 252 |
| 685 | 3300049741 | Ga0501079_0171082 | Ga0501079_0171082_416_1198 | 252 |
| 686 | 3300049741 | Ga0501079_0255159 | Ga0501079_0255159_265_1029 | 252 |
| 687 | 3300049744 | Ga0501083_0021756 | Ga0501083_0021756_2352_3158 | 252 |
| 688 | 3300049823 | Ga0501044_0065287 | Ga0501044_0065287_2695_3483 | 252 |
| 689 | 3300050511 | nmdc:mga08y16_567673_c1 | nmdc:mga08y16_567673_c1_55_843 | 252 |
| 690 | 3300053077 | Ga0495601_0000097 | Ga0495601_0000097_15837_16625 | 252 |
| 691 | 3300053077 | Ga0495601_0008176 | Ga0495601_0008176_3717_4502 | 252 |
| 692 | 3300053078 | Ga0495612_0005844 | Ga0495612_0005844_1814_2611 | 252 |
| 693 | 3300053084 | Ga0495595_0000014 | Ga0495595_0000014_134354_135139 | 252 |
| 694 | 3300053084 | Ga0495595_0000109 | Ga0495595_0000109_25877_26674 | 252 |
| 695 | 3300053085 | Ga0495619_0000022 | Ga0495619_0000022_127186_127986 | 252 |
| 696 | 3300053085 | Ga0495619_0000319 | Ga0495619_0000319_22777_23562 | 252 |
| 697 | 3300053094 | Ga0500566_0005120 | Ga0500566_0005120_3946_4731 | 252 |
| 698 | 3300053096 | Ga0500641_0002398 | Ga0500641_0002398_4369_5166 | 252 |
| 699 | 3300053119 | Ga0500595_039603 | Ga0500595_039603_232_1044 | 252 |
| 700 | 3300053123 | Ga0500614_004265 | Ga0500614_004265_1345_2139 | 252 |
| 701 | 3300054114 | Ga0501084_0396990 | Ga0501084_0396990_77_844 | 252 |
| 702 | 3300061719 | Ga0466962_0049559 | Ga0466962_0049559_1212_1982 | 252 |
| 703 | 3300005327 | Ga0070658_10040957 | Ga0070658_100409575 | 253 |
| 704 | 3300005336 | Ga0070680_100220226 | Ga0070680_1002202262 | 253 |
| 705 | 3300005339 | Ga0070660_100078256 | Ga0070660_1000782562 | 253 |
| 706 | 3300005436 | Ga0070713_100374734 | Ga0070713_1003747342 | 253 |
| 707 | 3300005444 | Ga0070694_100034592 | Ga0070694_1000345923 | 253 |
| 708 | 3300005458 | Ga0070681_10034745 | Ga0070681_100347455 | 253 |
| 709 | 3300005458 | Ga0070681_10084225 | Ga0070681_100842254 | 253 |
| 710 | 3300005530 | Ga0070679_100126520 | Ga0070679_1001265202 | 253 |
| 711 | 3300005535 | Ga0070684_100424822 | Ga0070684_1004248222 | 253 |
| 712 | 3300005547 | Ga0070693_100146483 | Ga0070693_1001464832 | 253 |
| 713 | 3300005563 | Ga0068855_100060814 | Ga0068855_1000608144 | 253 |
| 714 | 3300005614 | Ga0068856_100074113 | Ga0068856_1000741132 | 253 |
| 715 | 3300006163 | Ga0070715_10228858 | Ga0070715_102288581 | 253 |
| 716 | 3300006175 | Ga0070712_100404597 | Ga0070712_1004045972 | 253 |
| 717 | 3300006852 | Ga0075433_10075025 | Ga0075433_100750254 | 253 |
| 718 | 3300006871 | Ga0075434_100191835 | Ga0075434_1001918353 | 253 |
| 719 | 3300006914 | Ga0075436_100448620 | Ga0075436_1004486202 | 253 |
| 720 | 3300007076 | Ga0075435_100037060 | Ga0075435_1000370603 | 253 |
| 721 | 3300009147 | Ga0114129_10013663 | Ga0114129_1001366310 | 253 |
| 722 | 3300009174 | Ga0105241_10189587 | Ga0105241_101895872 | 253 |
| 723 | 3300009176 | Ga0105242_10051900 | Ga0105242_100519002 | 253 |
| 724 | 3300013105 | Ga0157369_10068684 | Ga0157369_100686843 | 253 |
| 725 | 3300013296 | Ga0157374_10571808 | Ga0157374_105718082 | 253 |
| 726 | 3300013297 | Ga0157378_10461332 | Ga0157378_104613322 | 253 |
| 727 | 3300020070 | Ga0206356_10933897 | Ga0206356_109338972 | 253 |
| 728 | 3300020082 | Ga0206353_11051550 | Ga0206353_110515502 | 253 |
| 729 | 3300025909 | Ga0207705_10094717 | Ga0207705_100947173 | 253 |
| 730 | 3300025912 | Ga0207707_10092802 | Ga0207707_100928023 | 253 |
| 731 | 3300025912 | Ga0207707_10122363 | Ga0207707_101223633 | 253 |
| 732 | 3300025915 | Ga0207693_10093503 | Ga0207693_100935032 | 253 |
| 733 | 3300025915 | Ga0207693_10245339 | Ga0207693_102453392 | 253 |
| 734 | 3300025916 | Ga0207663_10099496 | Ga0207663_100994962 | 253 |
| 735 | 3300025917 | Ga0207660_10311908 | Ga0207660_103119082 | 253 |
| 736 | 3300025919 | Ga0207657_10082913 | Ga0207657_100829134 | 253 |
| 737 | 3300025922 | Ga0207646_10060981 | Ga0207646_100609812 | 253 |
| 738 | 3300025949 | Ga0207667_10611451 | Ga0207667_106114512 | 253 |
| 739 | 3300026078 | Ga0207702_10060671 | Ga0207702_100606714 | 253 |
| 740 | 3300037312 | Ga0395899_0107394 | Ga0395899_0107394_1012_1782 | 253 |
| 741 | 3300037418 | Ga0395900_0186535 | Ga0395900_0186535_639_1409 | 253 |
| 742 | 3300037466 | Ga0395898_0019644 | Ga0395898_0019644_5221_5991 | 253 |
| 743 | 3300037471 | Ga0395905_0025788 | Ga0395905_0025788_2426_3196 | 253 |
| 744 | 3300037471 | Ga0395905_0186330 | Ga0395905_0186330_549_1325 | 253 |
| 745 | 3300038443 | Ga0395901_0024834 | Ga0395901_0024834_5346_6116 | 253 |
| 746 | 3300038443 | Ga0395901_0153898 | Ga0395901_0153898_855_1628 | 253 |
| 747 | 3300046459 | Ga0495629_0088279 | Ga0495629_0088279_542_1315 | 253 |
| 748 | 3300046461 | Ga0495641_0082409 | Ga0495641_0082409_94_867 | 253 |
| 749 | 3300046462 | Ga0495651_0004887 | Ga0495651_0004887_8156_8926 | 253 |
| 750 | 3300046463 | Ga0495653_0010741 | Ga0495653_0010741_2550_3323 | 253 |
| 751 | 3300046511 | Ga0495608_0019149 | Ga0495608_0019149_3732_4505 | 253 |
| 752 | 3300046516 | Ga0495628_0073094 | Ga0495628_0073094_121_891 | 253 |
| 753 | 3300046516 | Ga0495628_0247640 | Ga0495628_0247640_158_928 | 253 |
| 754 | 3300046517 | Ga0495630_0318177 | Ga0495630_0318177_188_961 | 253 |
| 755 | 3300046526 | Ga0495666_0047579 | Ga0495666_0047579_1069_1839 | 253 |
| 756 | 3300046529 | Ga0495652_0168788 | Ga0495652_0168788_372_1142 | 253 |
| 757 | 3300046533 | Ga0495640_0001520 | Ga0495640_0001520_9030_9803 | 253 |
| 758 | 3300046536 | Ga0495587_0208484 | Ga0495587_0208484_223_993 | 253 |
| 759 | 3300046543 | Ga0495645_0061651 | Ga0495645_0061651_1273_2043 | 253 |
| 760 | 3300046559 | Ga0495667_0004189 | Ga0495667_0004189_492_1265 | 253 |
| 761 | 3300046675 | Ga0495657_0079758 | Ga0495657_0079758_930_1703 | 253 |
| 762 | 3300046675 | Ga0495657_0181127 | Ga0495657_0181127_81_851 | 253 |
| 763 | 3300046678 | Ga0495599_0193580 | Ga0495599_0193580_42_815 | 253 |
| 764 | 3300046689 | Ga0495613_0057044 | Ga0495613_0057044_992_1765 | 253 |
| 765 | 3300046691 | Ga0495670_0122393 | Ga0495670_0122393_297_1073 | 253 |
| 766 | 3300047317 | Ga0495604_0049521 | Ga0495604_0049521_92_862 | 253 |
| 767 | 3300047317 | Ga0495604_0087982 | Ga0495604_0087982_1386_2159 | 253 |
| 768 | 3300047319 | Ga0495674_0007533 | Ga0495674_0007533_1191_1964 | 253 |
| 769 | 3300047319 | Ga0495674_0124032 | Ga0495674_0124032_1012_1782 | 253 |
| 770 | 3300047322 | Ga0495680_0003583 | Ga0495680_0003583_6776_7549 | 253 |
| 771 | 3300048088 | Ga0495602_0178666 | Ga0495602_0178666_543_1316 | 253 |
| 772 | 3300048903 | Ga0496100_0010105 | Ga0496100_0010105_3156_3920 | 253 |
| 773 | 3300048904 | Ga0496101_0008537 | Ga0496101_0008537_5599_6363 | 253 |
| 774 | 3300048905 | Ga0496102_0077064 | Ga0496102_0077064_603_1364 | 253 |
| 775 | 3300048906 | Ga0496103_0021878 | Ga0496103_0021878_2145_2906 | 253 |
| 776 | 3300048909 | Ga0496106_0011021 | Ga0496106_0011021_1244_2008 | 253 |
| 777 | 3300048914 | Ga0496111_0125039 | Ga0496111_0125039_511_1290 | 253 |
| 778 | 3300048915 | Ga0496112_0016767 | Ga0496112_0016767_2611_3372 | 253 |
| 779 | 3300048915 | Ga0496112_0026222 | Ga0496112_0026222_1997_2758 | 253 |
| 780 | 3300048915 | Ga0496112_0051598 | Ga0496112_0051598_2368_3129 | 253 |
| 781 | 3300048916 | Ga0496113_0290973 | Ga0496113_0290973_345_1106 | 253 |
| 782 | 3300048918 | Ga0496115_0105769 | Ga0496115_0105769_177_950 | 253 |
| 783 | 3300050510 | nmdc:mga06r32_504525_c1 | nmdc:mga06r32_504525_c1_24_797 | 253 |
| 784 | 3300050512 | nmdc:mga0n895_108290_c1 | nmdc:mga0n895_108290_c1_1387_2148 | 253 |
| 785 | 3300050514 | nmdc:mga08x19_383629_c1 | nmdc:mga08x19_383629_c1_140_901 | 253 |
| 786 | 3300050515 | nmdc:mga0a205_54850_c1 | nmdc:mga0a205_54850_c1_1391_2152 | 253 |
| 787 | 3300053077 | Ga0495601_0139304 | Ga0495601_0139304_385_1155 | 253 |
| 788 | 3300053083 | Ga0495655_0001313 | Ga0495655_0001313_812_1573 | 253 |
| 789 | 3300053085 | Ga0495619_0069309 | Ga0495619_0069309_28_801 | 253 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5njg-assembly1.cif.gz_B | structure of an abc transporter: part of the structure that could be built de novo | 0.6988 | 3 | 253 |
| 6hbu-assembly1.cif.gz_A | cryo-em structure of the abcg2 e211q mutant bound to atp and magnesium | 0.6944 | 4 | 246 |
| 5njg-assembly1.cif.gz_B | structure of an abc transporter: part of the structure that could be built de novo | 0.6924 | 3 | 253 |
| 8p8j-assembly1.cif.gz_B | structure of 5d3-fab and nanobody(nb96)-bound abcg2 | 0.6863 | 4 | 246 |
| 5nj3-assembly1.cif.gz_A | structure of an abc transporter: complete structure | 0.682 | 3 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.7962 | 48 | 244 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.778 | 34 | 246 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.7569 | 31 | 246 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6626 | 34 | 246 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6534 | 31 | 246 | 3.40.1710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538ENL9-F1-model_v4 | ABC-2 type transporter transmembrane domain-containing protein | 0.9911 | 2 | 253 |
GO:0043190
GO:0140359 |
| AF-A0A538CUW8-F1-model_v4 | ABC-2 type transporter transmembrane domain-containing protein | 0.9872 | 2 | 253 |
GO:0016020
GO:0140359 |
| AF-A0A7V9D1C1-F1-model_v4 | ABC transporter permease | 0.9871 | 2 | 253 |
GO:0043190
GO:0140359 |
| AF-A0A538CAD6-F1-model_v4 | ABC transporter permease | 0.9847 | 2 | 253 |
GO:0016020
GO:0140359 |
| AF-A0A7K0RK29-F1-model_v4 | ABC-2 type transporter transmembrane domain-containing protein | 0.9834 | 2 | 252 |
GO:0043190
GO:0140359 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar