F480878

General Info

Members Datasets Scaffolds Average Seq Length
788 275 1576 357

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0159589|Ga0496108_0159589_677_1912
Length 411
Sequence MMTSTGIRAACMSFVRARRMQRGRDDDTPRCEGAPLALLPLIGFTVTVMKIIPLRDARHDPPAAPALPHGHIAPSRAGPLADTRGRALHDLRISVTDRCNFRCVYCMPKDVFGRDYPFLPHAALLTFEEIARVARVFVDLGVRKIRLTGGEPLLRRNLERLVEQLARIGDVDLTLTTNGALLARKARALRDAGLRRVTVSLDALDDPTFRAMNDVDFPVARVLEGIEAAAAAGLAPIKINAVIKRGQNEHAIVPLARHFRGSGQVVRFIEYMDVGHTNGWRMDDVVSAREIVQRIDREFALEPVEPGYRGEVAERWRYVDGAGEIGVIASVTQAFCRDCTRARLSTDGKVYTCLFGTHGHDLRALLRGGADDGALAAAIDALWRRRADRYSELRTAATVALPKVEMSYIGG

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
178 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 5.2
Rhizosphere 94.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0159589 3300048911 Bacteria 1948
2 Ga0070658_10013205 3300005327 Bacteria 6626
3 Ga0070658_10021697 3300005327 Bacteria 5147
4 Ga0070676_10002902 3300005328 Bacteria 8855
5 Ga0070676_10003943 3300005328 Bacteria 7788
6 Ga0070676_10061459 3300005328 Bacteria 2233
7 Ga0070683_100008229 3300005329 Bacteria 8861
8 Ga0070683_100042235 3300005329 Bacteria 4198
9 Ga0070683_100107522 3300005329 Bacteria 2630
10 Ga0070683_100188709 3300005329 Bacteria 1957
11 Ga0070683_100376567 3300005329 Bacteria 1352
12 Ga0070690_100014153 3300005330 Bacteria 4728
13 Ga0070690_100031341 3300005330 Bacteria 3311
14 Ga0070690_100164868 3300005330 Bacteria 1521
15 Ga0070670_100002122 3300005331 Bacteria 16266
16 Ga0070677_10006296 3300005333 Bacteria 3937
17 Ga0068869_100000106 3300005334 Bacteria 39499
18 Ga0068869_100013678 3300005334 Bacteria 5405
19 Ga0068869_100083320 3300005334 Bacteria 2391
20 Ga0068869_100129306 3300005334 Bacteria 1940
21 Ga0070666_10007316 3300005335 Bacteria 6801
22 Ga0070680_100008916 3300005336 Bacteria 7692
23 Ga0070680_100043986 3300005336 Bacteria 3628
24 Ga0070680_100061607 3300005336 Bacteria 3072
25 Ga0068868_100032529 3300005338 Bacteria 4013
26 Ga0068868_100033989 3300005338 Bacteria 3933
27 Ga0068868_100044958 3300005338 Bacteria 3454
28 Ga0070660_100010721 3300005339 Bacteria 6486
29 Ga0070660_100011371 3300005339 Bacteria 6320
30 Ga0070660_100042593 3300005339 Bacteria 3466
31 Ga0070660_100116155 3300005339 Bacteria 2134
32 Ga0070689_100017301 3300005340 Bacteria 5292
33 Ga0070689_100018666 3300005340 Bacteria 5114
34 Ga0070689_100074844 3300005340 Bacteria 2650
35 Ga0070661_100008481 3300005344 Bacteria 7108
36 Ga0070661_100009766 3300005344 Bacteria 6655
37 Ga0070661_100011444 3300005344 Bacteria 6180
38 Ga0070661_100032660 3300005344 Bacteria 3767
39 Ga0070661_100035393 3300005344 Bacteria 3626
40 Ga0070661_100258042 3300005344 Bacteria 1347
41 Ga0070692_10211527 3300005345 Bacteria 1141
42 Ga0070668_100002155 3300005347 Bacteria 14418
43 Ga0070668_100010489 3300005347 Bacteria 6888
44 Ga0070668_100010968 3300005347 Bacteria 6744
45 Ga0070668_100022706 3300005347 Bacteria 4743
46 Ga0070668_100106339 3300005347 Bacteria 2229
47 Ga0070668_100151619 3300005347 Bacteria 1875
48 Ga0070669_100002610 3300005353 Bacteria 13031
49 Ga0070669_100006753 3300005353 Bacteria 8261
50 Ga0070669_100036210 3300005353 Bacteria 3575
51 Ga0070675_100010268 3300005354 Bacteria 7307
52 Ga0070675_100025348 3300005354 Bacteria 4754
53 Ga0070675_100242237 3300005354 Bacteria 1576
54 Ga0070671_100031644 3300005355 Bacteria 4372
55 Ga0070671_100056585 3300005355 Bacteria 3263
56 Ga0070671_100065561 3300005355 Bacteria 3025
57 Ga0070671_100112464 3300005355 Bacteria 2287
58 Ga0070674_100000618 3300005356 Bacteria 17900
59 Ga0070674_100026650 3300005356 Bacteria 3779
60 Ga0070674_100058425 3300005356 Bacteria 2681
61 Ga0070674_100297302 3300005356 Bacteria 1286
62 Ga0070673_100002272 3300005364 Bacteria 11653
63 Ga0070673_100015400 3300005364 Bacteria 5370
64 Ga0070673_100017185 3300005364 Bacteria 5136
65 Ga0070673_100018451 3300005364 Bacteria 4984
66 Ga0070673_100035405 3300005364 Bacteria 3785
67 Ga0070688_100006869 3300005365 Bacteria 6108
68 Ga0070688_100045004 3300005365 Bacteria 2725
69 Ga0070659_100002261 3300005366 Bacteria 13722
70 Ga0070659_100012989 3300005366 Bacteria 6192
71 Ga0070659_100034912 3300005366 Bacteria 3914
72 Ga0070659_100140287 3300005366 Bacteria 1968
73 Ga0070659_100193187 3300005366 Bacteria 1673
74 Ga0070667_100004344 3300005367 Bacteria 11954
75 Ga0070667_100008564 3300005367 Bacteria 8478
76 Ga0070667_100016356 3300005367 Bacteria 6137
77 Ga0070667_100027395 3300005367 Bacteria 4740
78 Ga0070667_100074679 3300005367 Bacteria 2893
79 Ga0070667_100080972 3300005367 Bacteria 2778
80 Ga0070667_100186714 3300005367 Bacteria 1835
81 Ga0070667_100264413 3300005367 Bacteria 1541
82 Ga0070709_10003475 3300005434 Bacteria 8460
83 Ga0070709_10015059 3300005434 Bacteria 4392
84 Ga0070709_10032269 3300005434 Bacteria 3156
85 Ga0070709_10090218 3300005434 Bacteria 2020
86 Ga0070714_100007161 3300005435 Bacteria 8653
87 Ga0070714_100048035 3300005435 Bacteria 3628
88 Ga0070714_100207372 3300005435 Bacteria 1795
89 Ga0070713_100000694 3300005436 Bacteria 21627
90 Ga0070713_100004630 3300005436 Bacteria 9275
91 Ga0070713_100005864 3300005436 Bacteria 8442
92 Ga0070713_100168162 3300005436 Bacteria 1962
93 Ga0070710_10005196 3300005437 Bacteria 6170
94 Ga0070710_10022144 3300005437 Bacteria 3321
95 Ga0070701_10031856 3300005438 Bacteria 2620
96 Ga0070701_10038762 3300005438 Bacteria 2414
97 Ga0070711_100012447 3300005439 Bacteria 5316
98 Ga0070705_100004587 3300005440 Bacteria 6724
99 Ga0070705_100044093 3300005440 Bacteria 2561
100 Ga0070705_100189214 3300005440 Bacteria 1401
101 Ga0070700_100014324 3300005441 Bacteria 4475
102 Ga0070700_100041821 3300005441 Bacteria 2811
103 Ga0070708_100000333 3300005445 Bacteria 35591
104 Ga0070708_100035899 3300005445 Bacteria 4321
105 Ga0070663_100005215 3300005455 Bacteria 7696
106 Ga0070663_100036940 3300005455 Bacteria 3397
107 Ga0070663_100120820 3300005455 Bacteria 1979
108 Ga0070678_100000914 3300005456 Bacteria 15160
109 Ga0070678_100006359 3300005456 Bacteria 6930
110 Ga0070678_100034317 3300005456 Bacteria 3531
111 Ga0070678_100036163 3300005456 Bacteria 3454
112 Ga0070678_100107148 3300005456 Bacteria 2179
113 Ga0070662_100000291 3300005457 Bacteria 29613
114 Ga0070662_100079124 3300005457 Bacteria 2444
115 Ga0070662_100344326 3300005457 Bacteria 1220
116 Ga0070681_10015992 3300005458 Bacteria 7481
117 Ga0070681_10019980 3300005458 Bacteria 6711
118 Ga0070681_10069366 3300005458 Bacteria 3491
119 Ga0070681_10120471 3300005458 Bacteria 2559
120 Ga0070681_10152112 3300005458 Bacteria 2240
121 Ga0068867_100000515 3300005459 Bacteria 25796
122 Ga0068867_100020988 3300005459 Bacteria 4658
123 Ga0068867_100028533 3300005459 Bacteria 4019
124 Ga0068867_100036388 3300005459 Bacteria 3573
125 Ga0068867_100055420 3300005459 Bacteria 2931
126 Ga0068867_100189645 3300005459 Bacteria 1640
127 Ga0068867_100226371 3300005459 Bacteria 1509
128 Ga0070706_100000382 3300005467 Bacteria 53150
129 Ga0070707_100006111 3300005468 Bacteria 11226
130 Ga0070707_100242550 3300005468 Bacteria 1754
131 Ga0070698_100000284 3300005471 Bacteria 51733
132 Ga0070698_100052672 3300005471 Bacteria 4139
133 Ga0070679_100024468 3300005530 Bacteria 5916
134 Ga0070679_100069012 3300005530 Bacteria 3526
135 Ga0070679_100149814 3300005530 Bacteria 2310
136 Ga0070679_100155681 3300005530 Bacteria 2260
137 Ga0070679_100252770 3300005530 Bacteria 1718
138 Ga0070679_100325038 3300005530 Bacteria 1487
139 Ga0068853_100010131 3300005539 Bacteria 7617
140 Ga0068853_100013830 3300005539 Bacteria 6597
141 Ga0068853_100024844 3300005539 Bacteria 5026
142 Ga0068853_100025754 3300005539 Bacteria 4937
143 Ga0070672_100000217 3300005543 Bacteria 31780
144 Ga0070672_100001736 3300005543 Bacteria 13642
145 Ga0070672_100004581 3300005543 Bacteria 9050
146 Ga0070672_100004826 3300005543 Bacteria 8859
147 Ga0070672_100005988 3300005543 Bacteria 8115
148 Ga0070672_100035350 3300005543 Bacteria 3798
149 Ga0070672_100054457 3300005543 Bacteria 3131
150 Ga0070695_100039693 3300005545 Bacteria 2977
151 Ga0070696_100045716 3300005546 Bacteria 3034
152 Ga0070696_100056693 3300005546 Bacteria 2733
153 Ga0070696_100123973 3300005546 Bacteria 1873
154 Ga0070665_100002634 3300005548 Bacteria 19551
155 Ga0070665_100003174 3300005548 Bacteria 17688
156 Ga0070665_100009886 3300005548 Bacteria 9646
157 Ga0070665_100030652 3300005548 Bacteria 5411
158 Ga0070665_100036473 3300005548 Bacteria 4946
159 Ga0070665_100037023 3300005548 Bacteria 4907
160 Ga0070665_100043297 3300005548 Bacteria 4524
161 Ga0070665_100079571 3300005548 Bacteria 3283
162 Ga0070665_100081660 3300005548 Bacteria 3238
163 Ga0068855_100004852 3300005563 Bacteria 16415
164 Ga0068855_100009716 3300005563 Bacteria 11611
165 Ga0068855_100064934 3300005563 Bacteria 4256
166 Ga0068855_100072696 3300005563 Bacteria 3997
167 Ga0068855_100288868 3300005563 Bacteria 1818
168 Ga0070664_100004791 3300005564 Bacteria 10841
169 Ga0070664_100021452 3300005564 Bacteria 5323
170 Ga0070664_100046032 3300005564 Bacteria 3685
171 Ga0070664_100086266 3300005564 Bacteria 2712
172 Ga0070664_100159821 3300005564 Bacteria 1993
173 Ga0070664_100265334 3300005564 Bacteria 1545
174 Ga0068857_100002128 3300005577 Bacteria 16096
175 Ga0068857_100011127 3300005577 Bacteria 7825
176 Ga0068857_100014190 3300005577 Bacteria 6938
177 Ga0068857_100021644 3300005577 Bacteria 5658
178 Ga0068857_100091422 3300005577 Bacteria 2724
179 Ga0068857_100100026 3300005577 Bacteria 2601
180 Ga0068857_100191038 3300005577 Bacteria 1865
181 Ga0068854_100004902 3300005578 Bacteria 8444
182 Ga0068854_100026823 3300005578 Bacteria 3963
183 Ga0068856_100001405 3300005614 Bacteria 25249
184 Ga0068856_100036111 3300005614 Bacteria 4846
185 Ga0068856_100041943 3300005614 Bacteria 4499
186 Ga0068856_100080309 3300005614 Bacteria 3235
187 Ga0068856_100212336 3300005614 Bacteria 1951
188 Ga0070702_100021505 3300005615 Bacteria 3395
189 Ga0070702_100022299 3300005615 Bacteria 3344
190 Ga0070702_100164849 3300005615 Bacteria 1436
191 Ga0068852_100007301 3300005616 Bacteria 8058
192 Ga0068852_100008557 3300005616 Bacteria 7547
193 Ga0068852_100039800 3300005616 Bacteria 3960
194 Ga0068852_100109409 3300005616 Bacteria 2509
195 Ga0068852_100124403 3300005616 Bacteria 2365
196 Ga0068852_100135110 3300005616 Bacteria 2276
197 Ga0068859_100000273 3300005617 Bacteria 51339
198 Ga0068859_100030342 3300005617 Bacteria 5425
199 Ga0068859_100050351 3300005617 Bacteria 4185
200 Ga0068859_100090754 3300005617 Bacteria 3106
201 Ga0068864_100002063 3300005618 Bacteria 16600
202 Ga0068864_100010900 3300005618 Bacteria 7514
203 Ga0068864_100023732 3300005618 Bacteria 5153
204 Ga0068864_100080345 3300005618 Bacteria 2857
205 Ga0068864_100217017 3300005618 Bacteria 1763
206 Ga0068866_10037684 3300005718 Bacteria 2376
207 Ga0068866_10158776 3300005718 Bacteria 1317
208 Ga0068861_100000427 3300005719 Bacteria 24490
209 Ga0068851_10002925 3300005834 Bacteria 7542
210 Ga0068851_10007158 3300005834 Bacteria 5113
211 Ga0068851_10010699 3300005834 Bacteria 4287
212 Ga0068851_10016499 3300005834 Bacteria 3535
213 Ga0068851_10020336 3300005834 Bacteria 3214
214 Ga0068851_10068976 3300005834 Bacteria 1826
215 Ga0068870_10006277 3300005840 Bacteria 5235
216 Ga0068870_10020420 3300005840 Bacteria 3226
217 Ga0068870_10033037 3300005840 Bacteria 2637
218 Ga0068870_10073438 3300005840 Bacteria 1871
219 Ga0068870_10097103 3300005840 Bacteria 1658
220 Ga0068863_100000481 3300005841 Bacteria 40838
221 Ga0068863_100014059 3300005841 Bacteria 7712
222 Ga0068863_100018940 3300005841 Bacteria 6588
223 Ga0068863_100026889 3300005841 Bacteria 5487
224 Ga0068863_100327249 3300005841 Bacteria 1489
225 Ga0068858_100005514 3300005842 Bacteria 12386
226 Ga0068858_100011562 3300005842 Bacteria 8328
227 Ga0068858_100032995 3300005842 Bacteria 4808
228 Ga0068858_100079558 3300005842 Bacteria 3046
229 Ga0068860_100004647 3300005843 Bacteria 14017
230 Ga0068860_100013398 3300005843 Bacteria 8040
231 Ga0068860_100129841 3300005843 Bacteria 2417
232 Ga0068862_100008312 3300005844 Bacteria 8589
233 Ga0068862_100078601 3300005844 Bacteria 2859
234 Ga0068862_100206884 3300005844 Bacteria 1772
235 Ga0081455_10040889 3300005937 Bacteria 4085
236 Ga0081539_10070662 3300005985 Bacteria 1873
237 Ga0070712_100021413 3300006175 Bacteria 4246
238 Ga0097621_100008809 3300006237 Bacteria 7292
239 Ga0097621_100011300 3300006237 Bacteria 6573
240 Ga0068871_100015609 3300006358 Bacteria 5691
241 Ga0068871_100025343 3300006358 Bacteria 4613
242 Ga0068871_100044433 3300006358 Bacteria 3573
243 Ga0068871_100077932 3300006358 Bacteria 2739
244 Ga0068871_100181890 3300006358 Bacteria 1807
245 Ga0075434_100021863 3300006871 Bacteria 6225
246 Ga0075434_100077513 3300006871 Bacteria 3319
247 Ga0075434_100091856 3300006871 Bacteria 3037
248 Ga0068865_100030552 3300006881 Bacteria 3584
249 Ga0068865_100043160 3300006881 Bacteria 3079
250 Ga0068865_100127942 3300006881 Bacteria 1899
251 Ga0075436_100001432 3300006914 Bacteria 16218
252 Ga0075436_100060416 3300006914 Bacteria 2618
253 Ga0097620_100000273 3300006931 Bacteria 51339
254 Ga0097620_100030342 3300006931 Bacteria 5425
255 Ga0097620_100050350 3300006931 Bacteria 4185
256 Ga0097620_100090753 3300006931 Bacteria 3106
257 Ga0075435_100007221 3300007076 Bacteria 7904
258 Ga0075435_100106559 3300007076 Bacteria 2328
259 Ga0105240_10004546 3300009093 Bacteria 21059
260 Ga0105240_10035547 3300009093 Bacteria 6419
261 Ga0105240_10044417 3300009093 Bacteria 5646
262 Ga0105240_10099716 3300009093 Bacteria 3535
263 Ga0111539_10019735 3300009094 Bacteria 8313
264 Ga0105245_10048829 3300009098 Bacteria 3787
265 Ga0105245_10105266 3300009098 Bacteria 2617
266 Ga0105245_10162581 3300009098 Bacteria 2120
267 Ga0105247_10026207 3300009101 Bacteria 3519
268 Ga0114129_10308394 3300009147 Bacteria 2107
269 Ga0105243_10050407 3300009148 Bacteria 3288
270 Ga0105243_10294333 3300009148 Bacteria 1468
271 Ga0105242_10121962 3300009176 Bacteria 2238
272 Ga0105242_10129195 3300009176 Bacteria 2178
273 Ga0105248_10005397 3300009177 Bacteria 14051
274 Ga0105248_10006799 3300009177 Bacteria 12538
275 Ga0105248_10006841 3300009177 Bacteria 12497
276 Ga0105248_10046542 3300009177 Bacteria 4862
277 Ga0105248_10068009 3300009177 Bacteria 4000
278 Ga0105248_10133196 3300009177 Bacteria 2804
279 Ga0105248_10194141 3300009177 Bacteria 2287
280 Ga0105237_10052870 3300009545 Bacteria 4076
281 Ga0105237_10116984 3300009545 Bacteria 2659
282 Ga0105237_10210710 3300009545 Bacteria 1943
283 Ga0105237_10211415 3300009545 Bacteria 1940
284 Ga0105238_10007544 3300009551 Bacteria 10892
285 Ga0105238_10105790 3300009551 Bacteria 2795
286 Ga0105238_10145182 3300009551 Bacteria 2349
287 Ga0105249_10052289 3300009553 Bacteria 3730
288 Ga0105030_100559 3300009987 Bacteria 3316
289 Ga0105239_10100430 3300010375 Bacteria 3200
290 Ga0105239_10202217 3300010375 Bacteria 2225
291 Ga0105239_10370024 3300010375 Bacteria 1620
292 Ga0105246_10212283 3300011119 Bacteria 1511
293 Ga0157373_10000462 3300013100 Bacteria 32264
294 Ga0157373_10004340 3300013100 Bacteria 10675
295 Ga0157373_10063992 3300013100 Bacteria 2604
296 Ga0157371_10000601 3300013102 Bacteria 42868
297 Ga0157371_10017408 3300013102 Bacteria 5339
298 Ga0157371_10021068 3300013102 Bacteria 4792
299 Ga0157370_10013807 3300013104 Bacteria 8297
300 Ga0157370_10024184 3300013104 Bacteria 6020
301 Ga0157370_10027416 3300013104 Bacteria 5616
302 Ga0157370_10068827 3300013104 Bacteria 3345
303 Ga0157370_10203879 3300013104 Bacteria 1834
304 Ga0157369_10035577 3300013105 Bacteria 5460
305 Ga0157369_10047301 3300013105 Bacteria 4672
306 Ga0157369_10055597 3300013105 Bacteria 4272
307 Ga0157369_10060370 3300013105 Bacteria 4089
308 Ga0157369_10179376 3300013105 Bacteria 2229
309 Ga0157374_10010633 3300013296 Bacteria 7925
310 Ga0157374_10046265 3300013296 Bacteria 4029
311 Ga0157374_10129378 3300013296 Bacteria 2442
312 Ga0157374_10462511 3300013296 Bacteria 1271
313 Ga0157378_10048682 3300013297 Bacteria 3769
314 Ga0157378_10077612 3300013297 Bacteria 2995
315 Ga0163162_10040472 3300013306 Bacteria 4660
316 Ga0163162_10086419 3300013306 Bacteria 3214
317 Ga0163162_10142661 3300013306 Bacteria 2509
318 Ga0163162_10165896 3300013306 Bacteria 2332
319 Ga0163162_10167204 3300013306 Bacteria 2323
320 Ga0157372_10002136 3300013307 Bacteria 21495
321 Ga0157372_10079927 3300013307 Bacteria 3699
322 Ga0157372_10089068 3300013307 Bacteria 3505
323 Ga0157372_10103092 3300013307 Bacteria 3260
324 Ga0157372_10268287 3300013307 Bacteria 1983
325 Ga0157372_10506223 3300013307 Bacteria 1408
326 Ga0157375_10006744 3300013308 Bacteria 9998
327 Ga0157375_10010070 3300013308 Bacteria 8313
328 Ga0157375_10101692 3300013308 Bacteria 2958
329 Ga0157375_10187521 3300013308 Bacteria 2222
330 Ga0157375_10202727 3300013308 Bacteria 2140
331 Ga0157375_10205864 3300013308 Bacteria 2124
332 Ga0157375_10549431 3300013308 Bacteria 1317
333 Ga0163163_10020260 3300014325 Bacteria 6259
334 Ga0163163_10042354 3300014325 Bacteria 4459
335 Ga0163163_10279944 3300014325 Bacteria 1719
336 Ga0163163_10311320 3300014325 Bacteria 1628
337 Ga0163163_10352932 3300014325 Bacteria 1527
338 Ga0157380_10068866 3300014326 Bacteria 2854
339 Ga0157380_10073190 3300014326 Bacteria 2777
340 Ga0157380_10218040 3300014326 Bacteria 1705
341 Ga0182008_10060639 3300014497 Bacteria 1865
342 Ga0182008_10099115 3300014497 Bacteria 1439
343 Ga0157377_10025870 3300014745 Bacteria 3134
344 Ga0157377_10040770 3300014745 Bacteria 2572
345 Ga0157377_10083005 3300014745 Bacteria 1877
346 Ga0157379_10000447 3300014968 Bacteria 33364
347 Ga0157379_10001351 3300014968 Bacteria 20063
348 Ga0157379_10004820 3300014968 Bacteria 11593
349 Ga0157379_10006715 3300014968 Bacteria 9939
350 Ga0157379_10012870 3300014968 Bacteria 7317
351 Ga0157379_10021368 3300014968 Bacteria 5728
352 Ga0157379_10163330 3300014968 Bacteria 2010
353 Ga0163161_10055093 3300017792 Bacteria 2887
354 Ga0163161_10065476 3300017792 Bacteria 2652
355 Ga0163161_10250476 3300017792 Bacteria 1380
356 Ga0206354_11472576 3300020081 Bacteria 2035
357 Ga0206353_11572432 3300020082 Bacteria 1580
358 Ga0209051_1000140 3300025303 Bacteria 135919
359 Ga0207697_10000560 3300025315 Bacteria 21060
360 Ga0207697_10009350 3300025315 Bacteria 4241
361 Ga0207656_10010675 3300025321 Bacteria 3447
362 Ga0207656_10014221 3300025321 Bacteria 3061
363 Ga0207656_10042620 3300025321 Bacteria 1932
364 Ga0207682_10000544 3300025893 Bacteria 17370
365 Ga0207682_10000678 3300025893 Bacteria 15854
366 Ga0207682_10031087 3300025893 Bacteria 2142
367 Ga0207692_10006654 3300025898 Bacteria 4697
368 Ga0207642_10016167 3300025899 Bacteria 2803
369 Ga0207688_10005397 3300025901 Bacteria 6947
370 Ga0207680_10009431 3300025903 Bacteria 4842
371 Ga0207680_10097368 3300025903 Bacteria 1884
372 Ga0207647_10033372 3300025904 Bacteria 3296
373 Ga0207699_10007188 3300025906 Bacteria 5434
374 Ga0207699_10029066 3300025906 Bacteria 3079
375 Ga0207699_10076699 3300025906 Bacteria 2060
376 Ga0207645_10000286 3300025907 Bacteria 42134
377 Ga0207645_10000794 3300025907 Bacteria 26435
378 Ga0207645_10005694 3300025907 Bacteria 9001
379 Ga0207645_10062023 3300025907 Bacteria 2388
380 Ga0207643_10000186 3300025908 Bacteria 42591
381 Ga0207643_10008719 3300025908 Bacteria 5440
382 Ga0207643_10016268 3300025908 Bacteria 4057
383 Ga0207643_10102587 3300025908 Bacteria 1678
384 Ga0207705_10232909 3300025909 Bacteria 1401
385 Ga0207684_10000009 3300025910 Bacteria 572126
386 Ga0207684_10101148 3300025910 Bacteria 2463
387 Ga0207684_10136628 3300025910 Bacteria 2105
388 Ga0207707_10037571 3300025912 Bacteria 4232
389 Ga0207707_10099072 3300025912 Bacteria 2548
390 Ga0207707_10136306 3300025912 Bacteria 2146
391 Ga0207695_10002552 3300025913 Bacteria 26762
392 Ga0207695_10065981 3300025913 Bacteria 3719
393 Ga0207695_10155939 3300025913 Bacteria 2218
394 Ga0207671_10040236 3300025914 Bacteria 3460
395 Ga0207693_10001837 3300025915 Bacteria 18609
396 Ga0207693_10011935 3300025915 Bacteria 7022
397 Ga0207693_10031694 3300025915 Bacteria 4177
398 Ga0207663_10026287 3300025916 Bacteria 3376
399 Ga0207663_10054687 3300025916 Bacteria 2501
400 Ga0207663_10298390 3300025916 Bacteria 1203
401 Ga0207660_10069871 3300025917 Bacteria 2551
402 Ga0207660_10076580 3300025917 Bacteria 2446
403 Ga0207662_10002274 3300025918 Bacteria 9611
404 Ga0207657_10000936 3300025919 Bacteria 30891
405 Ga0207657_10003829 3300025919 Bacteria 15981
406 Ga0207657_10014639 3300025919 Bacteria 7642
407 Ga0207657_10015486 3300025919 Bacteria 7387
408 Ga0207657_10019055 3300025919 Bacteria 6528
409 Ga0207657_10097148 3300025919 Bacteria 2449
410 Ga0207657_10262309 3300025919 Bacteria 1375
411 Ga0207649_10006074 3300025920 Bacteria 6555
412 Ga0207649_10040106 3300025920 Bacteria 2843
413 Ga0207649_10055983 3300025920 Bacteria 2461
414 Ga0207649_10167068 3300025920 Bacteria 1529
415 Ga0207652_10026048 3300025921 Bacteria 4867
416 Ga0207652_10046075 3300025921 Bacteria 3719
417 Ga0207652_10140914 3300025921 Bacteria 2156
418 Ga0207652_10280929 3300025921 Bacteria 1502
419 Ga0207646_10004099 3300025922 Bacteria 16048
420 Ga0207646_10050360 3300025922 Bacteria 3728
421 Ga0207646_10080476 3300025922 Bacteria 2913
422 Ga0207646_10223885 3300025922 Bacteria 1699
423 Ga0207646_10225684 3300025922 Bacteria 1692
424 Ga0207681_10004416 3300025923 Bacteria 8666
425 Ga0207681_10018280 3300025923 Bacteria 4415
426 Ga0207681_10022856 3300025923 Bacteria 3993
427 Ga0207681_10040897 3300025923 Bacteria 3087
428 Ga0207681_10158327 3300025923 Bacteria 1704
429 Ga0207694_10285665 3300025924 Bacteria 1356
430 Ga0207650_10002607 3300025925 Bacteria 12483
431 Ga0207650_10003642 3300025925 Bacteria 10555
432 Ga0207650_10004745 3300025925 Bacteria 9285
433 Ga0207650_10028735 3300025925 Bacteria 3990
434 Ga0207650_10056220 3300025925 Bacteria 2923
435 Ga0207650_10075461 3300025925 Bacteria 2544
436 Ga0207650_10132960 3300025925 Bacteria 1949
437 Ga0207650_10193704 3300025925 Bacteria 1625
438 Ga0207650_10246683 3300025925 Bacteria 1445
439 Ga0207659_10004050 3300025926 Bacteria 8842
440 Ga0207659_10033102 3300025926 Bacteria 3554
441 Ga0207659_10113983 3300025926 Bacteria 2060
442 Ga0207687_10003168 3300025927 Bacteria 11165
443 Ga0207687_10062584 3300025927 Bacteria 2632
444 Ga0207687_10112532 3300025927 Bacteria 2023
445 Ga0207687_10162516 3300025927 Bacteria 1715
446 Ga0207700_10013234 3300025928 Bacteria 5359
447 Ga0207700_10018838 3300025928 Bacteria 4650
448 Ga0207700_10071258 3300025928 Bacteria 2676
449 Ga0207700_10189627 3300025928 Bacteria 1727
450 Ga0207664_10011946 3300025929 Bacteria 6200
451 Ga0207664_10093614 3300025929 Bacteria 2468
452 Ga0207664_10141350 3300025929 Bacteria 2036
453 Ga0207664_10273581 3300025929 Bacteria 1480
454 Ga0207644_10002621 3300025931 Bacteria 11583
455 Ga0207644_10012994 3300025931 Bacteria 5541
456 Ga0207644_10031893 3300025931 Bacteria 3674
457 Ga0207644_10094354 3300025931 Bacteria 2235
458 Ga0207690_10003614 3300025932 Bacteria 9204
459 Ga0207690_10051504 3300025932 Bacteria 2754
460 Ga0207690_10134495 3300025932 Bacteria 1814
461 Ga0207706_10000631 3300025933 Bacteria 37435
462 Ga0207706_10007040 3300025933 Bacteria 10396
463 Ga0207706_10046880 3300025933 Bacteria 3826
464 Ga0207686_10064226 3300025934 Bacteria 2337
465 Ga0207709_10163942 3300025935 Bacteria 1553
466 Ga0207670_10067447 3300025936 Bacteria 2462
467 Ga0207670_10229678 3300025936 Bacteria 1424
468 Ga0207669_10022992 3300025937 Bacteria 3321
469 Ga0207669_10039033 3300025937 Bacteria 2740
470 Ga0207669_10078638 3300025937 Bacteria 2102
471 Ga0207669_10113379 3300025937 Bacteria 1822
472 Ga0207669_10157770 3300025937 Bacteria 1598
473 Ga0207669_10196667 3300025937 Bacteria 1460
474 Ga0207704_10228545 3300025938 Bacteria 1382
475 Ga0207665_10018156 3300025939 Bacteria 4622
476 Ga0207691_10000073 3300025940 Bacteria 83553
477 Ga0207691_10000380 3300025940 Bacteria 44703
478 Ga0207691_10002521 3300025940 Bacteria 17910
479 Ga0207691_10006481 3300025940 Bacteria 11301
480 Ga0207691_10008487 3300025940 Bacteria 9866
481 Ga0207691_10030235 3300025940 Bacteria 5063
482 Ga0207691_10049767 3300025940 Bacteria 3839
483 Ga0207711_10006577 3300025941 Bacteria 9787
484 Ga0207711_10048704 3300025941 Bacteria 3626
485 Ga0207711_10231580 3300025941 Bacteria 1692
486 Ga0207689_10000118 3300025942 Bacteria 65374
487 Ga0207689_10003012 3300025942 Bacteria 15530
488 Ga0207689_10010608 3300025942 Bacteria 7933
489 Ga0207689_10012444 3300025942 Bacteria 7270
490 Ga0207689_10013619 3300025942 Bacteria 6935
491 Ga0207689_10166844 3300025942 Bacteria 1814
492 Ga0207661_10012147 3300025944 Bacteria 6254
493 Ga0207661_10034675 3300025944 Bacteria 3927
494 Ga0207661_10044048 3300025944 Bacteria 3524
495 Ga0207661_10179315 3300025944 Bacteria 1849
496 Ga0207679_10005896 3300025945 Bacteria 7705
497 Ga0207679_10048280 3300025945 Bacteria 3098
498 Ga0207679_10051861 3300025945 Bacteria 3006
499 Ga0207679_10077525 3300025945 Bacteria 2529
500 Ga0207679_10094290 3300025945 Bacteria 2324
501 Ga0207679_10124286 3300025945 Bacteria 2059
502 Ga0207679_10129759 3300025945 Bacteria 2020
503 Ga0207679_10133494 3300025945 Bacteria 1995
504 Ga0207679_10135651 3300025945 Bacteria 1981
505 Ga0207667_10002636 3300025949 Bacteria 22187
506 Ga0207667_10007850 3300025949 Bacteria 12743
507 Ga0207667_10015971 3300025949 Bacteria 8503
508 Ga0207667_10017566 3300025949 Bacteria 8046
509 Ga0207667_10127621 3300025949 Bacteria 2620
510 Ga0207667_10242038 3300025949 Bacteria 1846
511 Ga0207667_10586838 3300025949 Bacteria 1125
512 Ga0207651_10008094 3300025960 Bacteria 5649
513 Ga0207651_10010838 3300025960 Bacteria 5072
514 Ga0207651_10011529 3300025960 Bacteria 4953
515 Ga0207651_10024403 3300025960 Bacteria 3740
516 Ga0207651_10085700 3300025960 Bacteria 2286
517 Ga0207651_10101567 3300025960 Bacteria 2135
518 Ga0207651_10208125 3300025960 Bacteria 1572
519 Ga0207668_10011802 3300025972 Bacteria 5324
520 Ga0207668_10012729 3300025972 Bacteria 5159
521 Ga0207668_10174394 3300025972 Bacteria 1689
522 Ga0207640_10080744 3300025981 Bacteria 2221
523 Ga0207640_10098637 3300025981 Bacteria 2043
524 Ga0207658_10011897 3300025986 Bacteria 5932
525 Ga0207658_10012573 3300025986 Bacteria 5778
526 Ga0207658_10018470 3300025986 Bacteria 4816
527 Ga0207658_10034095 3300025986 Bacteria 3636
528 Ga0207677_10004117 3300026023 Bacteria 7777
529 Ga0207677_10020114 3300026023 Bacteria 4047
530 Ga0207677_10271631 3300026023 Bacteria 1387
531 Ga0207703_10002366 3300026035 Bacteria 16408
532 Ga0207703_10008735 3300026035 Bacteria 7997
533 Ga0207703_10020249 3300026035 Bacteria 5202
534 Ga0207703_10055818 3300026035 Bacteria 3214
535 Ga0207703_10070949 3300026035 Bacteria 2876
536 Ga0207703_10294865 3300026035 Bacteria 1477
537 Ga0207639_10003780 3300026041 Bacteria 10189
538 Ga0207639_10009986 3300026041 Bacteria 6562
539 Ga0207639_10032842 3300026041 Bacteria 3824
540 Ga0207639_10040704 3300026041 Bacteria 3470
541 Ga0207639_10305126 3300026041 Bacteria 1408
542 Ga0207678_10009246 3300026067 Bacteria 8673
543 Ga0207678_10014822 3300026067 Bacteria 6860
544 Ga0207678_10016712 3300026067 Bacteria 6445
545 Ga0207678_10157040 3300026067 Bacteria 1942
546 Ga0207678_10169926 3300026067 Bacteria 1861
547 Ga0207708_10001234 3300026075 Bacteria 19269
548 Ga0207708_10012941 3300026075 Bacteria 6222
549 Ga0207708_10034553 3300026075 Bacteria 3845
550 Ga0207708_10038695 3300026075 Bacteria 3633
551 Ga0207702_10004317 3300026078 Bacteria 12678
552 Ga0207702_10008682 3300026078 Bacteria 8569
553 Ga0207702_10014512 3300026078 Bacteria 6541
554 Ga0207702_10017049 3300026078 Bacteria 6009
555 Ga0207702_10106993 3300026078 Bacteria 2479
556 Ga0207702_10235466 3300026078 Bacteria 1713
557 Ga0207641_10032265 3300026088 Bacteria 4348
558 Ga0207641_10034377 3300026088 Bacteria 4216
559 Ga0207641_10206971 3300026088 Bacteria 1812
560 Ga0207641_10304144 3300026088 Bacteria 1507
561 Ga0207648_10001767 3300026089 Bacteria 23674
562 Ga0207648_10003266 3300026089 Bacteria 17045
563 Ga0207648_10005165 3300026089 Bacteria 13220
564 Ga0207648_10005815 3300026089 Bacteria 12352
565 Ga0207648_10039535 3300026089 Bacteria 4147
566 Ga0207648_10061885 3300026089 Bacteria 3263
567 Ga0207648_10066299 3300026089 Bacteria 3148
568 Ga0207648_10174105 3300026089 Bacteria 1903
569 Ga0207676_10002432 3300026095 Bacteria 13263
570 Ga0207676_10006595 3300026095 Bacteria 8212
571 Ga0207676_10009095 3300026095 Bacteria 7073
572 Ga0207676_10009570 3300026095 Bacteria 6899
573 Ga0207676_10028685 3300026095 Bacteria 4159
574 Ga0207676_10187693 3300026095 Bacteria 1816
575 Ga0207676_10193256 3300026095 Bacteria 1792
576 Ga0207674_10000489 3300026116 Bacteria 52346
577 Ga0207674_10002369 3300026116 Bacteria 23826
578 Ga0207674_10004126 3300026116 Bacteria 17572
579 Ga0207674_10005149 3300026116 Bacteria 15593
580 Ga0207674_10014375 3300026116 Bacteria 8745
581 Ga0207674_10030512 3300026116 Bacteria 5667
582 Ga0207674_10253140 3300026116 Bacteria 1708
583 Ga0207675_100002411 3300026118 Bacteria 18514
584 Ga0207675_100005350 3300026118 Bacteria 12328
585 Ga0207675_100020860 3300026118 Bacteria 6109
586 Ga0207675_100082346 3300026118 Bacteria 3018
587 Ga0207675_100088121 3300026118 Bacteria 2915
588 Ga0207675_100184047 3300026118 Bacteria 2001
589 Ga0207683_10001375 3300026121 Bacteria 21987
590 Ga0207683_10002416 3300026121 Bacteria 16316
591 Ga0207683_10004401 3300026121 Bacteria 12177
592 Ga0207683_10009191 3300026121 Bacteria 8422
593 Ga0207683_10012219 3300026121 Bacteria 7330
594 Ga0207683_10013555 3300026121 Bacteria 6954
595 Ga0207683_10058625 3300026121 Bacteria 3381
596 Ga0207698_10006331 3300026142 Bacteria 7374
597 Ga0207698_10009283 3300026142 Bacteria 6261
598 Ga0207698_10024947 3300026142 Bacteria 4203
599 Ga0207698_10046384 3300026142 Bacteria 3281
600 Ga0207698_10081536 3300026142 Bacteria 2612
601 Ga0207698_10143908 3300026142 Bacteria 2058
602 Ga0207698_10215291 3300026142 Bacteria 1731
603 Ga0209983_1004981 3300027665 Bacteria 2773
604 Ga0209971_1000586 3300027682 Bacteria 9478
605 Ga0209998_10000977 3300027717 Bacteria 7221
606 Ga0209974_10001162 3300027876 Bacteria 9379
607 Ga0209974_10017417 3300027876 Bacteria 2384
608 Ga0209974_10025505 3300027876 Bacteria 1956
609 Ga0268266_10013021 3300028379 Bacteria 7170
610 Ga0268266_10021621 3300028379 Bacteria 5480
611 Ga0268266_10026660 3300028379 Bacteria 4917
612 Ga0268266_10065246 3300028379 Bacteria 3147
613 Ga0268266_10088153 3300028379 Bacteria 2716
614 Ga0268266_10093656 3300028379 Bacteria 2636
615 Ga0268266_10113009 3300028379 Bacteria 2408
616 Ga0268265_10060248 3300028380 Bacteria 2908
617 Ga0268265_10182961 3300028380 Bacteria 1802
618 Ga0268264_10000740 3300028381 Bacteria 37012
619 Ga0268264_10064955 3300028381 Bacteria 3073
620 Ga0268264_10114854 3300028381 Bacteria 2364
621 Ga0265319_1003448 3300028563 Bacteria 8231
622 Ga0265318_10005159 3300028577 Bacteria 6170
623 Ga0265338_10060242 3300028800 Bacteria 3337
624 Ga0265330_10031102 3300031235 Bacteria 2393
625 Ga0265332_10001374 3300031238 Bacteria 13773
626 Ga0265325_10006239 3300031241 Bacteria 7265
627 Ga0265329_10035716 3300031242 Bacteria 1604
628 Ga0265340_10055486 3300031247 Bacteria 1908
629 Ga0265339_10092777 3300031249 Bacteria 1580
630 Ga0265331_10014969 3300031250 Bacteria 4113
631 Ga0265316_10129777 3300031344 Bacteria 1899
632 Ga0307408_100006637 3300031548 Bacteria 7673
633 Ga0307408_100368553 3300031548 Bacteria 1224
634 Ga0265313_10046742 3300031595 Bacteria 2100
635 Ga0265314_10002410 3300031711 Bacteria 19203
636 Ga0265342_10009030 3300031712 Bacteria 7078
637 Ga0265342_10061517 3300031712 Bacteria 2212
638 Ga0307405_10009531 3300031731 Bacteria 4982
639 Ga0307405_10093640 3300031731 Bacteria 1996
640 Ga0307413_10002326 3300031824 Bacteria 7708
641 Ga0307413_10016826 3300031824 Bacteria 3792
642 Ga0307413_10113787 3300031824 Bacteria 1817
643 Ga0307410_10000541 3300031852 Bacteria 15518
644 Ga0307410_10003228 3300031852 Bacteria 8138
645 Ga0307406_10075542 3300031901 Bacteria 2223
646 Ga0307406_10188053 3300031901 Bacteria 1509
647 Ga0307412_10006583 3300031911 Bacteria 6578
648 Ga0307409_100000779 3300031995 Bacteria 14446
649 Ga0307409_100157742 3300031995 Bacteria 1980
650 Ga0307416_100003203 3300032002 Bacteria 9591
651 Ga0307416_100003235 3300032002 Bacteria 9546
652 Ga0307414_10044365 3300032004 Bacteria 3036
653 Ga0307414_10107410 3300032004 Bacteria 2115
654 Ga0307411_10001712 3300032005 Bacteria 9209
655 Ga0307411_10177265 3300032005 Bacteria 1614
656 Ga0307415_100015495 3300032126 Bacteria 4516
657 Ga0373923_0008915 3300035111 Bacteria 3598
658 Ga0373957_0007411 3300035120 Bacteria 3510
659 Ga0373955_0007679 3300035172 Bacteria 4966
660 Ga0373935_0184294 3300035692 Bacteria 1435
661 Ga0373927_0030393 3300035695 Bacteria 3524
662 Ga0373933_0006166 3300035724 Bacteria 6527
663 Ga0373937_0050339 3300036401 Bacteria 3815
664 Ga0373937_0114373 3300036401 Bacteria 2512
665 Ga0373937_0247917 3300036401 Bacteria 1679
666 Ga0373925_0122569 3300037068 Bacteria 2019
667 Ga0395899_0002789 3300037312 Bacteria 14079
668 Ga0395899_0115840 3300037312 Bacteria 1923
669 Ga0395900_0002952 3300037418 Bacteria 18521
670 Ga0395900_0013051 3300037418 Bacteria 8492
671 Ga0395900_0042065 3300037418 Bacteria 4707
672 Ga0395898_0004911 3300037466 Bacteria 14516
673 Ga0395905_0003391 3300037471 Bacteria 17054
674 Ga0395901_0004024 3300038443 Bacteria 14804
675 Ga0395901_0005956 3300038443 Bacteria 12345
676 Ga0395901_0135391 3300038443 Bacteria 2589
677 Ga0436361_0262038 3300039447 Bacteria 5560
678 Ga0439461_0002875 3300041410 Bacteria 2790
679 Ga0451807_0057414 3300041486 Bacteria 1869
680 Ga0450920_013793 3300042122 Bacteria 1524
681 Ga0451577_0032092 3300042876 Bacteria 4732
682 Ga0451577_0346718 3300042876 Bacteria 1347
683 Ga0466966_0013025 3300044684 Bacteria 5506
684 Ga0466966_0073812 3300044684 Bacteria 2133
685 Ga0466961_0013734 3300044693 Bacteria 5190
686 Ga0466963_0011242 3300044694 Bacteria 5447
687 Ga0466957_0019574 3300044842 Bacteria 3982
688 Ga0466957_0085457 3300044842 Bacteria 1971
689 Ga0466957_0198325 3300044842 Bacteria 1317
690 Ga0466957_0246473 3300044842 Bacteria 1187
691 Ga0466959_0001320 3300045049 Bacteria 15059
692 Ga0451576_0001131 3300045051 Bacteria 48320
693 Ga0451576_0341419 3300045051 Bacteria 1568
694 Ga0466958_0004902 3300045836 Bacteria 7132
695 Ga0466958_0009608 3300045836 Bacteria 5394
696 Ga0466958_0071759 3300045836 Bacteria 2120
697 Ga0466958_0088923 3300045836 Bacteria 1909
698 Ga0466967_0011216 3300045976 Bacteria 6774
699 Ga0466967_0058985 3300045976 Bacteria 3394
700 Ga0466967_0165928 3300045976 Bacteria 2075
701 Ga0495618_0093165 3300046514 Bacteria 1926
702 Ga0495628_0049050 3300046516 Bacteria 3344
703 Ga0495628_0230142 3300046516 Bacteria 1390
704 Ga0495642_0079473 3300046528 Bacteria 1379
705 Ga0495640_0172636 3300046533 Bacteria 1381
706 Ga0495598_0007218 3300046537 Bacteria 2540
707 Ga0495598_0078951 3300046537 Bacteria 1052
708 Ga0495621_0015098 3300046539 Bacteria 2458
709 Ga0495634_0098444 3300046642 Bacteria 1892
710 Ga0495636_0030717 3300047318 Bacteria 2198
711 Ga0496100_0015122 3300048903 Bacteria 4502
712 Ga0496100_0059648 3300048903 Bacteria 2508
713 Ga0496101_0028312 3300048904 Bacteria 3911
714 Ga0496101_0036029 3300048904 Bacteria 3502
715 Ga0496101_0168151 3300048904 Bacteria 1684
716 Ga0496102_0002362 3300048905 Bacteria 16110
717 Ga0496102_0014641 3300048905 Bacteria 6818
718 Ga0496102_0191286 3300048905 Bacteria 1928
719 Ga0496102_0228159 3300048905 Bacteria 1756
720 Ga0496103_0010448 3300048906 Bacteria 5495
721 Ga0496103_0045632 3300048906 Bacteria 2704
722 Ga0496103_0220103 3300048906 Bacteria 1221
723 Ga0496104_0003024 3300048907 Bacteria 14491
724 Ga0496104_0103125 3300048907 Bacteria 2733
725 Ga0496105_0030285 3300048908 Bacteria 4434
726 Ga0496105_0304548 3300048908 Bacteria 1280
727 Ga0496105_0320043 3300048908 Bacteria 1243
728 Ga0496106_0000427 3300048909 Bacteria 29931
729 Ga0496106_0018653 3300048909 Bacteria 5135
730 Ga0496106_0104296 3300048909 Bacteria 2202
731 Ga0496106_0171414 3300048909 Bacteria 1720
732 Ga0496107_0001256 3300048910 Bacteria 15518
733 Ga0496107_0053587 3300048910 Bacteria 2910
734 Ga0496107_0095866 3300048910 Bacteria 2171
735 Ga0496107_0158869 3300048910 Bacteria 1675
736 Ga0496107_0213153 3300048910 Bacteria 1436
737 Ga0496108_0033356 3300048911 Bacteria 4278
738 Ga0496109_0008131 3300048912 Bacteria 8893
739 Ga0496109_0024721 3300048912 Bacteria 5343
740 Ga0496109_0081632 3300048912 Bacteria 2979
741 Ga0496110_0008639 3300048913 Bacteria 8205
742 Ga0496110_0011736 3300048913 Bacteria 7188
743 Ga0496110_0013091 3300048913 Bacteria 6848
744 Ga0496111_0103829 3300048914 Bacteria 2090
745 Ga0496112_0003395 3300048915 Bacteria 13151
746 Ga0496112_0029262 3300048915 Bacteria 5326
747 Ga0496112_0399596 3300048915 Bacteria 1314
748 Ga0496114_0062240 3300048917 Bacteria 3123
749 Ga0496115_0310734 3300048918 Bacteria 1291
750 Ga0501031_0173281 3300049568 Bacteria 1410
751 Ga0501036_0129137 3300049572 Bacteria 2134
752 Ga0501038_0229772 3300049574 Bacteria 1477
753 Ga0501039_0003714 3300049575 Bacteria 11461
754 Ga0501041_0109870 3300049577 Bacteria 1710
755 Ga0501042_0025944 3300049578 Bacteria 4118
756 Ga0501043_0022690 3300049579 Bacteria 4922
757 Ga0501067_0025719 3300049583 Bacteria 3262
758 Ga0501071_0003502 3300049587 Bacteria 9817
759 Ga0501071_0086819 3300049587 Bacteria 2295
760 Ga0501072_0116911 3300049588 Bacteria 2124
761 Ga0501075_0007700 3300049591 Bacteria 7477
762 Ga0501076_0000632 3300049592 Bacteria 22453
763 Ga0501076_0057727 3300049592 Bacteria 3083
764 Ga0501076_0135491 3300049592 Bacteria 1999
765 Ga0501076_0396729 3300049592 Bacteria 1134
766 Ga0501077_0150495 3300049593 Bacteria 1477
767 Ga0501079_0000427 3300049741 Bacteria 27413
768 Ga0501080_0016253 3300049742 Bacteria 6872
769 Ga0501081_0006139 3300049743 Bacteria 7786
770 Ga0501081_0085485 3300049743 Bacteria 2214
771 Ga0501081_0167662 3300049743 Bacteria 1585
772 Ga0501083_0137263 3300049744 Bacteria 1602
773 nmdc:mga08y16_139671_c1 3300050511 Bacteria 2519
774 nmdc:mga08y16_74372_c1 3300050511 Bacteria 3540
775 nmdc:mga0n895_112597_c1 3300050512 Bacteria 2738
776 nmdc:mga0n895_39726_c1 3300050512 Bacteria 4568
777 nmdc:mga0rr50_2910_c1 3300050513 Bacteria 9769
778 nmdc:mga08x19_27799_c1 3300050514 Bacteria 3539
779 nmdc:mga08x19_3689_c1 3300050514 Bacteria 9117
780 nmdc:mga08x19_56513_c1 3300050514 Bacteria 2533
781 nmdc:mga0a205_43386_c2 3300050515 Bacteria 3639
782 nmdc:mga0a205_94558_c1 3300050515 Bacteria 2887
783 Ga0495601_0015599 3300053077 Bacteria 4592
784 Ga0501082_0023230 3300060353 Bacteria 5349
785 Ga0466962_0015585 3300061719 Bacteria 3666
786 Ga0466962_0102636 3300061719 Bacteria 1374
787 Ga0530510_0188024 3300061734 Bacteria 1533
788 Ga0530510_0285307 3300061734 Bacteria 1234
789 Ga0496108_0159589
790 Ga0070658_10013205
791 Ga0070658_10021697
792 Ga0070676_10002902
793 Ga0070676_10003943
794 Ga0070676_10061459
795 Ga0070683_100008229
796 Ga0070683_100042235
797 Ga0070683_100107522
798 Ga0070683_100188709
799 Ga0070683_100376567
800 Ga0070690_100014153
801 Ga0070690_100031341
802 Ga0070690_100164868
803 Ga0070670_100002122
804 Ga0070677_10006296
805 Ga0068869_100000106
806 Ga0068869_100013678
807 Ga0068869_100083320
808 Ga0068869_100129306
809 Ga0070666_10007316
810 Ga0070680_100008916
811 Ga0070680_100043986
812 Ga0070680_100061607
813 Ga0068868_100032529
814 Ga0068868_100033989
815 Ga0068868_100044958
816 Ga0070660_100010721
817 Ga0070660_100011371
818 Ga0070660_100042593
819 Ga0070660_100116155
820 Ga0070689_100017301
821 Ga0070689_100018666
822 Ga0070689_100074844
823 Ga0070661_100008481
824 Ga0070661_100009766
825 Ga0070661_100011444
826 Ga0070661_100032660
827 Ga0070661_100035393
828 Ga0070661_100258042
829 Ga0070692_10211527
830 Ga0070668_100002155
831 Ga0070668_100010489
832 Ga0070668_100010968
833 Ga0070668_100022706
834 Ga0070668_100106339
835 Ga0070668_100151619
836 Ga0070669_100002610
837 Ga0070669_100006753
838 Ga0070669_100036210
839 Ga0070675_100010268
840 Ga0070675_100025348
841 Ga0070675_100242237
842 Ga0070671_100031644
843 Ga0070671_100056585
844 Ga0070671_100065561
845 Ga0070671_100112464
846 Ga0070674_100000618
847 Ga0070674_100026650
848 Ga0070674_100058425
849 Ga0070674_100297302
850 Ga0070673_100002272
851 Ga0070673_100015400
852 Ga0070673_100017185
853 Ga0070673_100018451
854 Ga0070673_100035405
855 Ga0070688_100006869
856 Ga0070688_100045004
857 Ga0070659_100002261
858 Ga0070659_100012989
859 Ga0070659_100034912
860 Ga0070659_100140287
861 Ga0070659_100193187
862 Ga0070667_100004344
863 Ga0070667_100008564
864 Ga0070667_100016356
865 Ga0070667_100027395
866 Ga0070667_100074679
867 Ga0070667_100080972
868 Ga0070667_100186714
869 Ga0070667_100264413
870 Ga0070709_10003475
871 Ga0070709_10015059
872 Ga0070709_10032269
873 Ga0070709_10090218
874 Ga0070714_100007161
875 Ga0070714_100048035
876 Ga0070714_100207372
877 Ga0070713_100000694
878 Ga0070713_100004630
879 Ga0070713_100005864
880 Ga0070713_100168162
881 Ga0070710_10005196
882 Ga0070710_10022144
883 Ga0070701_10031856
884 Ga0070701_10038762
885 Ga0070711_100012447
886 Ga0070705_100004587
887 Ga0070705_100044093
888 Ga0070705_100189214
889 Ga0070700_100014324
890 Ga0070700_100041821
891 Ga0070708_100000333
892 Ga0070708_100035899
893 Ga0070663_100005215
894 Ga0070663_100036940
895 Ga0070663_100120820
896 Ga0070678_100000914
897 Ga0070678_100006359
898 Ga0070678_100034317
899 Ga0070678_100036163
900 Ga0070678_100107148
901 Ga0070662_100000291
902 Ga0070662_100079124
903 Ga0070662_100344326
904 Ga0070681_10015992
905 Ga0070681_10019980
906 Ga0070681_10069366
907 Ga0070681_10120471
908 Ga0070681_10152112
909 Ga0068867_100000515
910 Ga0068867_100020988
911 Ga0068867_100028533
912 Ga0068867_100036388
913 Ga0068867_100055420
914 Ga0068867_100189645
915 Ga0068867_100226371
916 Ga0070706_100000382
917 Ga0070707_100006111
918 Ga0070707_100242550
919 Ga0070698_100000284
920 Ga0070698_100052672
921 Ga0070679_100024468
922 Ga0070679_100069012
923 Ga0070679_100149814
924 Ga0070679_100155681
925 Ga0070679_100252770
926 Ga0070679_100325038
927 Ga0068853_100010131
928 Ga0068853_100013830
929 Ga0068853_100024844
930 Ga0068853_100025754
931 Ga0070672_100000217
932 Ga0070672_100001736
933 Ga0070672_100004581
934 Ga0070672_100004826
935 Ga0070672_100005988
936 Ga0070672_100035350
937 Ga0070672_100054457
938 Ga0070695_100039693
939 Ga0070696_100045716
940 Ga0070696_100056693
941 Ga0070696_100123973
942 Ga0070665_100002634
943 Ga0070665_100003174
944 Ga0070665_100009886
945 Ga0070665_100030652
946 Ga0070665_100036473
947 Ga0070665_100037023
948 Ga0070665_100043297
949 Ga0070665_100079571
950 Ga0070665_100081660
951 Ga0068855_100004852
952 Ga0068855_100009716
953 Ga0068855_100064934
954 Ga0068855_100072696
955 Ga0068855_100288868
956 Ga0070664_100004791
957 Ga0070664_100021452
958 Ga0070664_100046032
959 Ga0070664_100086266
960 Ga0070664_100159821
961 Ga0070664_100265334
962 Ga0068857_100002128
963 Ga0068857_100011127
964 Ga0068857_100014190
965 Ga0068857_100021644
966 Ga0068857_100091422
967 Ga0068857_100100026
968 Ga0068857_100191038
969 Ga0068854_100004902
970 Ga0068854_100026823
971 Ga0068856_100001405
972 Ga0068856_100036111
973 Ga0068856_100041943
974 Ga0068856_100080309
975 Ga0068856_100212336
976 Ga0070702_100021505
977 Ga0070702_100022299
978 Ga0070702_100164849
979 Ga0068852_100007301
980 Ga0068852_100008557
981 Ga0068852_100039800
982 Ga0068852_100109409
983 Ga0068852_100124403
984 Ga0068852_100135110
985 Ga0068859_100000273
986 Ga0068859_100030342
987 Ga0068859_100050351
988 Ga0068859_100090754
989 Ga0068864_100002063
990 Ga0068864_100010900
991 Ga0068864_100023732
992 Ga0068864_100080345
993 Ga0068864_100217017
994 Ga0068866_10037684
995 Ga0068866_10158776
996 Ga0068861_100000427
997 Ga0068851_10002925
998 Ga0068851_10007158
999 Ga0068851_10010699
1000 Ga0068851_10016499
1001 Ga0068851_10020336
1002 Ga0068851_10068976
1003 Ga0068870_10006277
1004 Ga0068870_10020420
1005 Ga0068870_10033037
1006 Ga0068870_10073438
1007 Ga0068870_10097103
1008 Ga0068863_100000481
1009 Ga0068863_100014059
1010 Ga0068863_100018940
1011 Ga0068863_100026889
1012 Ga0068863_100327249
1013 Ga0068858_100005514
1014 Ga0068858_100011562
1015 Ga0068858_100032995
1016 Ga0068858_100079558
1017 Ga0068860_100004647
1018 Ga0068860_100013398
1019 Ga0068860_100129841
1020 Ga0068862_100008312
1021 Ga0068862_100078601
1022 Ga0068862_100206884
1023 Ga0081455_10040889
1024 Ga0081539_10070662
1025 Ga0070712_100021413
1026 Ga0097621_100008809
1027 Ga0097621_100011300
1028 Ga0068871_100015609
1029 Ga0068871_100025343
1030 Ga0068871_100044433
1031 Ga0068871_100077932
1032 Ga0068871_100181890
1033 Ga0075434_100021863
1034 Ga0075434_100077513
1035 Ga0075434_100091856
1036 Ga0068865_100030552
1037 Ga0068865_100043160
1038 Ga0068865_100127942
1039 Ga0075436_100001432
1040 Ga0075436_100060416
1041 Ga0097620_100000273
1042 Ga0097620_100030342
1043 Ga0097620_100050350
1044 Ga0097620_100090753
1045 Ga0075435_100007221
1046 Ga0075435_100106559
1047 Ga0105240_10004546
1048 Ga0105240_10035547
1049 Ga0105240_10044417
1050 Ga0105240_10099716
1051 Ga0111539_10019735
1052 Ga0105245_10048829
1053 Ga0105245_10105266
1054 Ga0105245_10162581
1055 Ga0105247_10026207
1056 Ga0114129_10308394
1057 Ga0105243_10050407
1058 Ga0105243_10294333
1059 Ga0105242_10121962
1060 Ga0105242_10129195
1061 Ga0105248_10005397
1062 Ga0105248_10006799
1063 Ga0105248_10006841
1064 Ga0105248_10046542
1065 Ga0105248_10068009
1066 Ga0105248_10133196
1067 Ga0105248_10194141
1068 Ga0105237_10052870
1069 Ga0105237_10116984
1070 Ga0105237_10210710
1071 Ga0105237_10211415
1072 Ga0105238_10007544
1073 Ga0105238_10105790
1074 Ga0105238_10145182
1075 Ga0105249_10052289
1076 Ga0105030_100559
1077 Ga0105239_10100430
1078 Ga0105239_10202217
1079 Ga0105239_10370024
1080 Ga0105246_10212283
1081 Ga0157373_10000462
1082 Ga0157373_10004340
1083 Ga0157373_10063992
1084 Ga0157371_10000601
1085 Ga0157371_10017408
1086 Ga0157371_10021068
1087 Ga0157370_10013807
1088 Ga0157370_10024184
1089 Ga0157370_10027416
1090 Ga0157370_10068827
1091 Ga0157370_10203879
1092 Ga0157369_10035577
1093 Ga0157369_10047301
1094 Ga0157369_10055597
1095 Ga0157369_10060370
1096 Ga0157369_10179376
1097 Ga0157374_10010633
1098 Ga0157374_10046265
1099 Ga0157374_10129378
1100 Ga0157374_10462511
1101 Ga0157378_10048682
1102 Ga0157378_10077612
1103 Ga0163162_10040472
1104 Ga0163162_10086419
1105 Ga0163162_10142661
1106 Ga0163162_10165896
1107 Ga0163162_10167204
1108 Ga0157372_10002136
1109 Ga0157372_10079927
1110 Ga0157372_10089068
1111 Ga0157372_10103092
1112 Ga0157372_10268287
1113 Ga0157372_10506223
1114 Ga0157375_10006744
1115 Ga0157375_10010070
1116 Ga0157375_10101692
1117 Ga0157375_10187521
1118 Ga0157375_10202727
1119 Ga0157375_10205864
1120 Ga0157375_10549431
1121 Ga0163163_10020260
1122 Ga0163163_10042354
1123 Ga0163163_10279944
1124 Ga0163163_10311320
1125 Ga0163163_10352932
1126 Ga0157380_10068866
1127 Ga0157380_10073190
1128 Ga0157380_10218040
1129 Ga0182008_10060639
1130 Ga0182008_10099115
1131 Ga0157377_10025870
1132 Ga0157377_10040770
1133 Ga0157377_10083005
1134 Ga0157379_10000447
1135 Ga0157379_10001351
1136 Ga0157379_10004820
1137 Ga0157379_10006715
1138 Ga0157379_10012870
1139 Ga0157379_10021368
1140 Ga0157379_10163330
1141 Ga0163161_10055093
1142 Ga0163161_10065476
1143 Ga0163161_10250476
1144 Ga0206354_11472576
1145 Ga0206353_11572432
1146 Ga0209051_1000140
1147 Ga0207697_10000560
1148 Ga0207697_10009350
1149 Ga0207656_10010675
1150 Ga0207656_10014221
1151 Ga0207656_10042620
1152 Ga0207682_10000544
1153 Ga0207682_10000678
1154 Ga0207682_10031087
1155 Ga0207692_10006654
1156 Ga0207642_10016167
1157 Ga0207688_10005397
1158 Ga0207680_10009431
1159 Ga0207680_10097368
1160 Ga0207647_10033372
1161 Ga0207699_10007188
1162 Ga0207699_10029066
1163 Ga0207699_10076699
1164 Ga0207645_10000286
1165 Ga0207645_10000794
1166 Ga0207645_10005694
1167 Ga0207645_10062023
1168 Ga0207643_10000186
1169 Ga0207643_10008719
1170 Ga0207643_10016268
1171 Ga0207643_10102587
1172 Ga0207705_10232909
1173 Ga0207684_10000009
1174 Ga0207684_10101148
1175 Ga0207684_10136628
1176 Ga0207707_10037571
1177 Ga0207707_10099072
1178 Ga0207707_10136306
1179 Ga0207695_10002552
1180 Ga0207695_10065981
1181 Ga0207695_10155939
1182 Ga0207671_10040236
1183 Ga0207693_10001837
1184 Ga0207693_10011935
1185 Ga0207693_10031694
1186 Ga0207663_10026287
1187 Ga0207663_10054687
1188 Ga0207663_10298390
1189 Ga0207660_10069871
1190 Ga0207660_10076580
1191 Ga0207662_10002274
1192 Ga0207657_10000936
1193 Ga0207657_10003829
1194 Ga0207657_10014639
1195 Ga0207657_10015486
1196 Ga0207657_10019055
1197 Ga0207657_10097148
1198 Ga0207657_10262309
1199 Ga0207649_10006074
1200 Ga0207649_10040106
1201 Ga0207649_10055983
1202 Ga0207649_10167068
1203 Ga0207652_10026048
1204 Ga0207652_10046075
1205 Ga0207652_10140914
1206 Ga0207652_10280929
1207 Ga0207646_10004099
1208 Ga0207646_10050360
1209 Ga0207646_10080476
1210 Ga0207646_10223885
1211 Ga0207646_10225684
1212 Ga0207681_10004416
1213 Ga0207681_10018280
1214 Ga0207681_10022856
1215 Ga0207681_10040897
1216 Ga0207681_10158327
1217 Ga0207694_10285665
1218 Ga0207650_10002607
1219 Ga0207650_10003642
1220 Ga0207650_10004745
1221 Ga0207650_10028735
1222 Ga0207650_10056220
1223 Ga0207650_10075461
1224 Ga0207650_10132960
1225 Ga0207650_10193704
1226 Ga0207650_10246683
1227 Ga0207659_10004050
1228 Ga0207659_10033102
1229 Ga0207659_10113983
1230 Ga0207687_10003168
1231 Ga0207687_10062584
1232 Ga0207687_10112532
1233 Ga0207687_10162516
1234 Ga0207700_10013234
1235 Ga0207700_10018838
1236 Ga0207700_10071258
1237 Ga0207700_10189627
1238 Ga0207664_10011946
1239 Ga0207664_10093614
1240 Ga0207664_10141350
1241 Ga0207664_10273581
1242 Ga0207644_10002621
1243 Ga0207644_10012994
1244 Ga0207644_10031893
1245 Ga0207644_10094354
1246 Ga0207690_10003614
1247 Ga0207690_10051504
1248 Ga0207690_10134495
1249 Ga0207706_10000631
1250 Ga0207706_10007040
1251 Ga0207706_10046880
1252 Ga0207686_10064226
1253 Ga0207709_10163942
1254 Ga0207670_10067447
1255 Ga0207670_10229678
1256 Ga0207669_10022992
1257 Ga0207669_10039033
1258 Ga0207669_10078638
1259 Ga0207669_10113379
1260 Ga0207669_10157770
1261 Ga0207669_10196667
1262 Ga0207704_10228545
1263 Ga0207665_10018156
1264 Ga0207691_10000073
1265 Ga0207691_10000380
1266 Ga0207691_10002521
1267 Ga0207691_10006481
1268 Ga0207691_10008487
1269 Ga0207691_10030235
1270 Ga0207691_10049767
1271 Ga0207711_10006577
1272 Ga0207711_10048704
1273 Ga0207711_10231580
1274 Ga0207689_10000118
1275 Ga0207689_10003012
1276 Ga0207689_10010608
1277 Ga0207689_10012444
1278 Ga0207689_10013619
1279 Ga0207689_10166844
1280 Ga0207661_10012147
1281 Ga0207661_10034675
1282 Ga0207661_10044048
1283 Ga0207661_10179315
1284 Ga0207679_10005896
1285 Ga0207679_10048280
1286 Ga0207679_10051861
1287 Ga0207679_10077525
1288 Ga0207679_10094290
1289 Ga0207679_10124286
1290 Ga0207679_10129759
1291 Ga0207679_10133494
1292 Ga0207679_10135651
1293 Ga0207667_10002636
1294 Ga0207667_10007850
1295 Ga0207667_10015971
1296 Ga0207667_10017566
1297 Ga0207667_10127621
1298 Ga0207667_10242038
1299 Ga0207667_10586838
1300 Ga0207651_10008094
1301 Ga0207651_10010838
1302 Ga0207651_10011529
1303 Ga0207651_10024403
1304 Ga0207651_10085700
1305 Ga0207651_10101567
1306 Ga0207651_10208125
1307 Ga0207668_10011802
1308 Ga0207668_10012729
1309 Ga0207668_10174394
1310 Ga0207640_10080744
1311 Ga0207640_10098637
1312 Ga0207658_10011897
1313 Ga0207658_10012573
1314 Ga0207658_10018470
1315 Ga0207658_10034095
1316 Ga0207677_10004117
1317 Ga0207677_10020114
1318 Ga0207677_10271631
1319 Ga0207703_10002366
1320 Ga0207703_10008735
1321 Ga0207703_10020249
1322 Ga0207703_10055818
1323 Ga0207703_10070949
1324 Ga0207703_10294865
1325 Ga0207639_10003780
1326 Ga0207639_10009986
1327 Ga0207639_10032842
1328 Ga0207639_10040704
1329 Ga0207639_10305126
1330 Ga0207678_10009246
1331 Ga0207678_10014822
1332 Ga0207678_10016712
1333 Ga0207678_10157040
1334 Ga0207678_10169926
1335 Ga0207708_10001234
1336 Ga0207708_10012941
1337 Ga0207708_10034553
1338 Ga0207708_10038695
1339 Ga0207702_10004317
1340 Ga0207702_10008682
1341 Ga0207702_10014512
1342 Ga0207702_10017049
1343 Ga0207702_10106993
1344 Ga0207702_10235466
1345 Ga0207641_10032265
1346 Ga0207641_10034377
1347 Ga0207641_10206971
1348 Ga0207641_10304144
1349 Ga0207648_10001767
1350 Ga0207648_10003266
1351 Ga0207648_10005165
1352 Ga0207648_10005815
1353 Ga0207648_10039535
1354 Ga0207648_10061885
1355 Ga0207648_10066299
1356 Ga0207648_10174105
1357 Ga0207676_10002432
1358 Ga0207676_10006595
1359 Ga0207676_10009095
1360 Ga0207676_10009570
1361 Ga0207676_10028685
1362 Ga0207676_10187693
1363 Ga0207676_10193256
1364 Ga0207674_10000489
1365 Ga0207674_10002369
1366 Ga0207674_10004126
1367 Ga0207674_10005149
1368 Ga0207674_10014375
1369 Ga0207674_10030512
1370 Ga0207674_10253140
1371 Ga0207675_100002411
1372 Ga0207675_100005350
1373 Ga0207675_100020860
1374 Ga0207675_100082346
1375 Ga0207675_100088121
1376 Ga0207675_100184047
1377 Ga0207683_10001375
1378 Ga0207683_10002416
1379 Ga0207683_10004401
1380 Ga0207683_10009191
1381 Ga0207683_10012219
1382 Ga0207683_10013555
1383 Ga0207683_10058625
1384 Ga0207698_10006331
1385 Ga0207698_10009283
1386 Ga0207698_10024947
1387 Ga0207698_10046384
1388 Ga0207698_10081536
1389 Ga0207698_10143908
1390 Ga0207698_10215291
1391 Ga0209983_1004981
1392 Ga0209971_1000586
1393 Ga0209998_10000977
1394 Ga0209974_10001162
1395 Ga0209974_10017417
1396 Ga0209974_10025505
1397 Ga0268266_10013021
1398 Ga0268266_10021621
1399 Ga0268266_10026660
1400 Ga0268266_10065246
1401 Ga0268266_10088153
1402 Ga0268266_10093656
1403 Ga0268266_10113009
1404 Ga0268265_10060248
1405 Ga0268265_10182961
1406 Ga0268264_10000740
1407 Ga0268264_10064955
1408 Ga0268264_10114854
1409 Ga0265319_1003448
1410 Ga0265318_10005159
1411 Ga0265338_10060242
1412 Ga0265330_10031102
1413 Ga0265332_10001374
1414 Ga0265325_10006239
1415 Ga0265329_10035716
1416 Ga0265340_10055486
1417 Ga0265339_10092777
1418 Ga0265331_10014969
1419 Ga0265316_10129777
1420 Ga0307408_100006637
1421 Ga0307408_100368553
1422 Ga0265313_10046742
1423 Ga0265314_10002410
1424 Ga0265342_10009030
1425 Ga0265342_10061517
1426 Ga0307405_10009531
1427 Ga0307405_10093640
1428 Ga0307413_10002326
1429 Ga0307413_10016826
1430 Ga0307413_10113787
1431 Ga0307410_10000541
1432 Ga0307410_10003228
1433 Ga0307406_10075542
1434 Ga0307406_10188053
1435 Ga0307412_10006583
1436 Ga0307409_100000779
1437 Ga0307409_100157742
1438 Ga0307416_100003203
1439 Ga0307416_100003235
1440 Ga0307414_10044365
1441 Ga0307414_10107410
1442 Ga0307411_10001712
1443 Ga0307411_10177265
1444 Ga0307415_100015495
1445 Ga0373923_0008915
1446 Ga0373957_0007411
1447 Ga0373955_0007679
1448 Ga0373935_0184294
1449 Ga0373927_0030393
1450 Ga0373933_0006166
1451 Ga0373937_0050339
1452 Ga0373937_0114373
1453 Ga0373937_0247917
1454 Ga0373925_0122569
1455 Ga0395899_0002789
1456 Ga0395899_0115840
1457 Ga0395900_0002952
1458 Ga0395900_0013051
1459 Ga0395900_0042065
1460 Ga0395898_0004911
1461 Ga0395905_0003391
1462 Ga0395901_0004024
1463 Ga0395901_0005956
1464 Ga0395901_0135391
1465 Ga0436361_0262038
1466 Ga0439461_0002875
1467 Ga0451807_0057414
1468 Ga0450920_013793
1469 Ga0451577_0032092
1470 Ga0451577_0346718
1471 Ga0466966_0013025
1472 Ga0466966_0073812
1473 Ga0466961_0013734
1474 Ga0466963_0011242
1475 Ga0466957_0019574
1476 Ga0466957_0085457
1477 Ga0466957_0198325
1478 Ga0466957_0246473
1479 Ga0466959_0001320
1480 Ga0451576_0001131
1481 Ga0451576_0341419
1482 Ga0466958_0004902
1483 Ga0466958_0009608
1484 Ga0466958_0071759
1485 Ga0466958_0088923
1486 Ga0466967_0011216
1487 Ga0466967_0058985
1488 Ga0466967_0165928
1489 Ga0495618_0093165
1490 Ga0495628_0049050
1491 Ga0495628_0230142
1492 Ga0495642_0079473
1493 Ga0495640_0172636
1494 Ga0495598_0007218
1495 Ga0495598_0078951
1496 Ga0495621_0015098
1497 Ga0495634_0098444
1498 Ga0495636_0030717
1499 Ga0496100_0015122
1500 Ga0496100_0059648
1501 Ga0496101_0028312
1502 Ga0496101_0036029
1503 Ga0496101_0168151
1504 Ga0496102_0002362
1505 Ga0496102_0014641
1506 Ga0496102_0191286
1507 Ga0496102_0228159
1508 Ga0496103_0010448
1509 Ga0496103_0045632
1510 Ga0496103_0220103
1511 Ga0496104_0003024
1512 Ga0496104_0103125
1513 Ga0496105_0030285
1514 Ga0496105_0304548
1515 Ga0496105_0320043
1516 Ga0496106_0000427
1517 Ga0496106_0018653
1518 Ga0496106_0104296
1519 Ga0496106_0171414
1520 Ga0496107_0001256
1521 Ga0496107_0053587
1522 Ga0496107_0095866
1523 Ga0496107_0158869
1524 Ga0496107_0213153
1525 Ga0496108_0033356
1526 Ga0496109_0008131
1527 Ga0496109_0024721
1528 Ga0496109_0081632
1529 Ga0496110_0008639
1530 Ga0496110_0011736
1531 Ga0496110_0013091
1532 Ga0496111_0103829
1533 Ga0496112_0003395
1534 Ga0496112_0029262
1535 Ga0496112_0399596
1536 Ga0496114_0062240
1537 Ga0496115_0310734
1538 Ga0501031_0173281
1539 Ga0501036_0129137
1540 Ga0501038_0229772
1541 Ga0501039_0003714
1542 Ga0501041_0109870
1543 Ga0501042_0025944
1544 Ga0501043_0022690
1545 Ga0501067_0025719
1546 Ga0501071_0003502
1547 Ga0501071_0086819
1548 Ga0501072_0116911
1549 Ga0501075_0007700
1550 Ga0501076_0000632
1551 Ga0501076_0057727
1552 Ga0501076_0135491
1553 Ga0501076_0396729
1554 Ga0501077_0150495
1555 Ga0501079_0000427
1556 Ga0501080_0016253
1557 Ga0501081_0006139
1558 Ga0501081_0085485
1559 Ga0501081_0167662
1560 Ga0501083_0137263
1561 nmdc:mga08y16_139671_c1
1562 nmdc:mga08y16_74372_c1
1563 nmdc:mga0n895_112597_c1
1564 nmdc:mga0n895_39726_c1
1565 nmdc:mga0rr50_2910_c1
1566 nmdc:mga08x19_27799_c1
1567 nmdc:mga08x19_3689_c1
1568 nmdc:mga08x19_56513_c1
1569 nmdc:mga0a205_43386_c2
1570 nmdc:mga0a205_94558_c1
1571 Ga0495601_0015599
1572 Ga0501082_0023230
1573 Ga0466962_0015585
1574 Ga0466962_0102636
1575 Ga0530510_0188024
1576 Ga0530510_0285307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

93

259

0.97

PF06463

Mob_synth_C

Molybdenum Cofactor Synthesis C

264

392

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.9428 37 356
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.9385 38 356
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.9204 37 356
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.9162 38 356
6b4c-assembly8.cif.gz_H structure of viperin from trichoderma virens 0.8191 43 255
ID Description Score Start End Superfamily
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.952 39 346 3.20.20.70
af_P9WJS3_16_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9487 37 358 3.20.20.70
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9438 37 339 3.20.20.70
1tv8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9428 37 356 3.20.20.70
1tv8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9204 37 356 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7W1BPM9-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) 0.988 37 321 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A7W1BPM9-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) 0.9811 37 321 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A3B9VX85-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) 0.9772 37 353 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A2E8TU74-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) 0.9772 39 289 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A2E6UGN6-F1-model_v4 deleted 0.9746 37 354

Map