F480725

General Info

Members Datasets Scaffolds Average Seq Length
785 214 1570 35

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100475016|Ga0070680_1004750162
Length 41
Sequence MQKGLTMFTSLNSVRQTATVFAGAFVTALLLVSAATSLPIA

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
66 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
169 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.22
Metatranscriptomes 1.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 3.95
Rhizosphere 95.67
Stem 0
Stem Tuber 0
Unclassified 7.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100475016 3300005336 Bacteria 1069
2 JGI24736J21556_1017513 3300001904 Bacteria 1137
3 JGI24736J21556_1080062 3300001904 Bacteria 513
4 JGI24741J21665_1001338 3300001915 Bacteria 7154
5 JGI24741J21665_1006269 3300001915 Bacteria 2404
6 JGI24741J21665_1014101 3300001915 Bacteria 1342
7 JGI24741J21665_1033148 3300001915 Bacteria 769
8 JGI24752J21851_1059759 3300001976 Unclassified 525
9 JGI24746J21847_1007391 3300001977 Bacteria 1683
10 JGI24747J21853_1019285 3300001978 Bacteria 735
11 JGI24740J21852_10000273 3300001979 Bacteria 21837
12 JGI24740J21852_10000977 3300001979 Bacteria 12757
13 JGI24740J21852_10025726 3300001979 Bacteria 1980
14 JGI24740J21852_10041985 3300001979 Bacteria 1374
15 JGI24740J21852_10120977 3300001979 Bacteria 656
16 JGI24739J22299_10000244 3300001989 Bacteria 18398
17 JGI24739J22299_10022095 3300001989 Bacteria 2260
18 JGI24739J22299_10156172 3300001989 Bacteria 674
19 JGI24737J22298_10000021 3300001990 Bacteria 45543
20 JGI24737J22298_10003751 3300001990 Bacteria 5347
21 JGI24737J22298_10014702 3300001990 Bacteria 2539
22 JGI24737J22298_10038630 3300001990 Bacteria 1469
23 JGI24743J22301_10027124 3300001991 Bacteria 1117
24 JGI24735J21928_10015037 3300002067 Bacteria 2418
25 JGI24735J21928_10041633 3300002067 Bacteria 1338
26 JGI24735J21928_10092326 3300002067 Bacteria 868
27 JGI24735J21928_10140458 3300002067 Bacteria 697
28 JGI24745J21846_1003858 3300002073 Bacteria 1583
29 JGI24738J21930_10000082 3300002075 Bacteria 21091
30 JGI24738J21930_10022699 3300002075 Bacteria 1296
31 JGI24744J21845_10003873 3300002077 Bacteria 3091
32 JGI24035J26624_1008610 3300002126 Bacteria 999
33 JGI24034J26672_10014149 3300002239 Bacteria 1215
34 JGI24742J22300_10107513 3300002244 Unclassified 543
35 Ga0070661_100262718 3300005344 Bacteria 1335
36 Ga0070714_101667817 3300005435 Bacteria 623
37 Ga0070681_10555600 3300005458 Bacteria 1062
38 Ga0070679_100221953 3300005530 Bacteria 1851
39 Ga0070672_100004071 3300005543 Bacteria 9541
40 Ga0070672_100004346 3300005543 Bacteria 9275
41 Ga0070672_100019379 3300005543 Bacteria 4938
42 Ga0070672_100031449 3300005543 Bacteria 3995
43 Ga0070672_100037167 3300005543 Bacteria 3713
44 Ga0070672_100374735 3300005543 Bacteria 1217
45 Ga0070672_100417180 3300005543 Bacteria 1152
46 Ga0070665_100000590 3300005548 Bacteria 50563
47 Ga0070665_100008613 3300005548 Bacteria 10323
48 Ga0070665_100123581 3300005548 Bacteria 2590
49 Ga0070665_100223250 3300005548 Bacteria 1885
50 Ga0070665_100787573 3300005548 Bacteria 964
51 Ga0070665_102176415 3300005548 Bacteria 559
52 Ga0068855_100016864 3300005563 Bacteria 8783
53 Ga0068855_100017154 3300005563 Bacteria 8710
54 Ga0068855_100031566 3300005563 Bacteria 6326
55 Ga0068855_100103238 3300005563 Bacteria 3280
56 Ga0068855_100155993 3300005563 Bacteria 2594
57 Ga0068855_100425096 3300005563 Bacteria 1453
58 Ga0068855_100772416 3300005563 Bacteria 1023
59 Ga0068855_100792665 3300005563 Bacteria 1008
60 Ga0068855_100866504 3300005563 Bacteria 956
61 Ga0068855_100939661 3300005563 Bacteria 911
62 Ga0068855_101964023 3300005563 Bacteria 592
63 Ga0070664_100008994 3300005564 Bacteria 8101
64 Ga0070664_100011945 3300005564 Bacteria 7050
65 Ga0070664_100018520 3300005564 Bacteria 5723
66 Ga0070664_100021543 3300005564 Bacteria 5314
67 Ga0070664_100045583 3300005564 Bacteria 3703
68 Ga0070664_100322872 3300005564 Bacteria 1399
69 Ga0070664_100499185 3300005564 Bacteria 1121
70 Ga0068857_100000570 3300005577 Bacteria 26956
71 Ga0068857_100017002 3300005577 Bacteria 6372
72 Ga0068857_100017148 3300005577 Bacteria 6344
73 Ga0068857_100083286 3300005577 Bacteria 2857
74 Ga0068857_100355817 3300005577 Bacteria 1357
75 Ga0068854_100004137 3300005578 Bacteria 9117
76 Ga0068854_100005081 3300005578 Bacteria 8288
77 Ga0068854_100030658 3300005578 Bacteria 3731
78 Ga0068854_100150259 3300005578 Bacteria 1795
79 Ga0068854_100218162 3300005578 Bacteria 1508
80 Ga0068854_100733515 3300005578 Bacteria 856
81 Ga0068854_100804453 3300005578 Bacteria 819
82 Ga0068854_100962702 3300005578 Bacteria 753
83 Ga0068854_101426311 3300005578 Bacteria 627
84 Ga0068854_102125387 3300005578 Unclassified 519
85 Ga0068856_100044598 3300005614 Bacteria 4364
86 Ga0068856_100051735 3300005614 Bacteria 4049
87 Ga0068856_100128240 3300005614 Bacteria 2540
88 Ga0068856_100128542 3300005614 Bacteria 2537
89 Ga0068856_100286009 3300005614 Bacteria 1666
90 Ga0068856_100322975 3300005614 Bacteria 1561
91 Ga0068856_100557860 3300005614 Bacteria 1167
92 Ga0068856_100627003 3300005614 Bacteria 1096
93 Ga0068856_101122038 3300005614 Bacteria 803
94 Ga0068856_101609295 3300005614 Bacteria 663
95 Ga0068856_102328133 3300005614 Bacteria 544
96 Ga0068852_100000333 3300005616 Bacteria 31986
97 Ga0068852_100000446 3300005616 Bacteria 27187
98 Ga0068852_100002244 3300005616 Bacteria 13264
99 Ga0068852_100003747 3300005616 Bacteria 10666
100 Ga0068852_100006639 3300005616 Bacteria 8384
101 Ga0068852_100011645 3300005616 Bacteria 6634
102 Ga0068852_100095984 3300005616 Bacteria 2664
103 Ga0068852_100159650 3300005616 Bacteria 2104
104 Ga0068852_100233338 3300005616 Bacteria 1755
105 Ga0068852_100404898 3300005616 Bacteria 1343
106 Ga0068852_100457407 3300005616 Bacteria 1265
107 Ga0068852_100460676 3300005616 Bacteria 1260
108 Ga0068852_100542154 3300005616 Bacteria 1163
109 Ga0068852_100568238 3300005616 Bacteria 1136
110 Ga0068852_100782719 3300005616 Bacteria 967
111 Ga0068852_102119985 3300005616 Unclassified 584
112 Ga0068859_100000478 3300005617 Bacteria 39430
113 Ga0068859_100012386 3300005617 Bacteria 8580
114 Ga0068864_100000174 3300005618 Bacteria 59338
115 Ga0068864_100002622 3300005618 Bacteria 14849
116 Ga0068864_100003287 3300005618 Bacteria 13355
117 Ga0068864_100037301 3300005618 Bacteria 4148
118 Ga0068864_100059589 3300005618 Bacteria 3303
119 Ga0068864_100477898 3300005618 Bacteria 1196
120 Ga0068864_101817733 3300005618 Bacteria 615
121 Ga0068866_10052902 3300005718 Bacteria 2074
122 Ga0068866_10083938 3300005718 Bacteria 1718
123 Ga0068861_100197370 3300005719 Unclassified 1687
124 Ga0068861_100618205 3300005719 Bacteria 997
125 Ga0068851_10011295 3300005834 Bacteria 4186
126 Ga0068851_10093971 3300005834 Bacteria 1583
127 Ga0068851_10117372 3300005834 Bacteria 1427
128 Ga0068851_10174439 3300005834 Bacteria 1188
129 Ga0068851_10476166 3300005834 Bacteria 746
130 Ga0068870_10007747 3300005840 Bacteria 4803
131 Ga0068870_10723154 3300005840 Bacteria 689
132 Ga0068863_100001778 3300005841 Bacteria 21381
133 Ga0068863_100004660 3300005841 Bacteria 13517
134 Ga0068863_100079146 3300005841 Bacteria 3113
135 Ga0068863_100132319 3300005841 Bacteria 2381
136 Ga0068863_100238217 3300005841 Bacteria 1756
137 Ga0068863_101166208 3300005841 Bacteria 776
138 Ga0068858_100000600 3300005842 Bacteria 37662
139 Ga0068858_100001012 3300005842 Bacteria 28969
140 Ga0068858_100009806 3300005842 Bacteria 9115
141 Ga0068858_100010636 3300005842 Bacteria 8708
142 Ga0068858_100158341 3300005842 Bacteria 2132
143 Ga0068858_100251967 3300005842 Bacteria 1677
144 Ga0068860_100000674 3300005843 Bacteria 39467
145 Ga0068860_100005305 3300005843 Bacteria 13087
146 Ga0068860_100191294 3300005843 Bacteria 1980
147 Ga0068860_100259233 3300005843 Bacteria 1694
148 Ga0068862_100043679 3300005844 Unclassified 3821
149 Ga0068862_100127337 3300005844 Bacteria 2249
150 Ga0068862_101532394 3300005844 Bacteria 672
151 Ga0081539_10010505 3300005985 Bacteria 7508
152 Ga0081539_10050383 3300005985 Bacteria 2356
153 Ga0070716_101067656 3300006173 Bacteria 642
154 Ga0070712_100201702 3300006175 Bacteria 1563
155 Ga0097621_100007643 3300006237 Bacteria 7747
156 Ga0097621_100016747 3300006237 Bacteria 5552
157 Ga0097621_100591399 3300006237 Bacteria 1013
158 Ga0097621_100720328 3300006237 Bacteria 920
159 Ga0097621_100745438 3300006237 Unclassified 904
160 Ga0097621_101189069 3300006237 Bacteria 718
161 Ga0075370_10180798 3300006353 Bacteria 1241
162 Ga0068871_100002657 3300006358 Bacteria 12206
163 Ga0068871_100203024 3300006358 Bacteria 1712
164 Ga0068871_100290388 3300006358 Bacteria 1433
165 Ga0068871_100465456 3300006358 Bacteria 1135
166 Ga0068871_100494382 3300006358 Bacteria 1102
167 Ga0075431_100191051 3300006847 Bacteria 2098
168 Ga0075433_10016296 3300006852 Bacteria 6118
169 Ga0075434_100529686 3300006871 Bacteria 1198
170 Ga0068865_100042284 3300006881 Unclassified 3107
171 Ga0068865_100077802 3300006881 Bacteria 2371
172 Ga0068865_100182728 3300006881 Bacteria 1616
173 Ga0068865_100211998 3300006881 Bacteria 1510
174 Ga0068865_100762409 3300006881 Bacteria 832
175 Ga0075436_101035510 3300006914 Bacteria 617
176 Ga0097620_100000478 3300006931 Bacteria 39430
177 Ga0097620_100012385 3300006931 Bacteria 8580
178 Ga0075435_100456030 3300007076 Bacteria 1103
179 Ga0075435_101094404 3300007076 Bacteria 697
180 Ga0105240_10203371 3300009093 Bacteria 2319
181 Ga0105240_10264615 3300009093 Bacteria 1982
182 Ga0105240_10647771 3300009093 Unclassified 1158
183 Ga0105245_10000300 3300009098 Bacteria 47446
184 Ga0105245_10058168 3300009098 Bacteria 3479
185 Ga0105245_10153115 3300009098 Bacteria 2182
186 Ga0105245_10539389 3300009098 Bacteria 1187
187 Ga0105245_11138340 3300009098 Bacteria 827
188 Ga0105245_11569308 3300009098 Bacteria 710
189 Ga0105247_11042247 3300009101 Bacteria 641
190 Ga0105243_10037062 3300009148 Unclassified 3787
191 Ga0105243_10115885 3300009148 Bacteria 2250
192 Ga0105243_10143925 3300009148 Bacteria 2037
193 Ga0105243_10170622 3300009148 Bacteria 1884
194 Ga0105241_10002793 3300009174 Bacteria 13069
195 Ga0105241_10662458 3300009174 Bacteria 949
196 Ga0105241_10750861 3300009174 Bacteria 895
197 Ga0105241_10948622 3300009174 Bacteria 802
198 Ga0105242_10176973 3300009176 Bacteria 1879
199 Ga0105242_11910920 3300009176 Bacteria 634
200 Ga0105248_10004187 3300009177 Bacteria 15941
201 Ga0105248_10008362 3300009177 Bacteria 11367
202 Ga0105248_10013573 3300009177 Bacteria 8970
203 Ga0105248_10015460 3300009177 Bacteria 8412
204 Ga0105248_10026036 3300009177 Bacteria 6507
205 Ga0105248_10068550 3300009177 Bacteria 3983
206 Ga0105248_10146660 3300009177 Bacteria 2663
207 Ga0105248_10365365 3300009177 Bacteria 1625
208 Ga0105248_10510973 3300009177 Unclassified 1355
209 Ga0105248_11186335 3300009177 Bacteria 863
210 Ga0105237_10330320 3300009545 Bacteria 1529
211 Ga0105237_10668207 3300009545 Bacteria 1046
212 Ga0105237_10977619 3300009545 Bacteria 853
213 Ga0105238_10014171 3300009551 Bacteria 8062
214 Ga0105238_10121035 3300009551 Bacteria 2597
215 Ga0105238_10240291 3300009551 Bacteria 1789
216 Ga0105238_10452580 3300009551 Bacteria 1281
217 Ga0105238_10610678 3300009551 Bacteria 1099
218 Ga0105238_10787574 3300009551 Bacteria 966
219 Ga0105238_12432409 3300009551 Unclassified 559
220 Ga0105249_10000973 3300009553 Bacteria 25384
221 Ga0105249_10092014 3300009553 Bacteria 2839
222 Ga0105239_10020816 3300010375 Bacteria 7238
223 Ga0105239_10106642 3300010375 Unclassified 3104
224 Ga0105239_10929731 3300010375 Bacteria 998
225 Ga0105239_12661256 3300010375 Unclassified 584
226 Ga0105239_12803604 3300010375 Bacteria 569
227 Ga0105246_10010772 3300011119 Bacteria 5668
228 Ga0105246_10070769 3300011119 Bacteria 2454
229 Ga0105246_11700870 3300011119 Bacteria 599
230 Ga0157315_1032040 3300012508 Bacteria 622
231 Ga0157316_1013095 3300012510 Bacteria 806
232 Ga0157373_10008760 3300013100 Bacteria 7497
233 Ga0157373_10089281 3300013100 Bacteria 2171
234 Ga0157373_10100850 3300013100 Bacteria 2031
235 Ga0157373_10186474 3300013100 Bacteria 1461
236 Ga0157373_10254593 3300013100 Bacteria 1242
237 Ga0157373_10323206 3300013100 Bacteria 1098
238 Ga0157373_10448148 3300013100 Bacteria 929
239 Ga0157373_10493231 3300013100 Bacteria 884
240 Ga0157373_10537457 3300013100 Bacteria 847
241 Ga0157373_10553070 3300013100 Bacteria 835
242 Ga0157373_10629505 3300013100 Bacteria 782
243 Ga0157373_10918670 3300013100 Bacteria 650
244 Ga0157373_11132843 3300013100 Bacteria 588
245 Ga0157373_11338098 3300013100 Bacteria 543
246 Ga0157371_10000677 3300013102 Bacteria 40414
247 Ga0157371_10005811 3300013102 Bacteria 10323
248 Ga0157371_10067070 3300013102 Bacteria 2540
249 Ga0157371_10076624 3300013102 Bacteria 2368
250 Ga0157371_10082534 3300013102 Bacteria 2276
251 Ga0157371_10213379 3300013102 Bacteria 1385
252 Ga0157371_10219314 3300013102 Unclassified 1366
253 Ga0157371_10262693 3300013102 Bacteria 1245
254 Ga0157371_10308345 3300013102 Bacteria 1147
255 Ga0157371_10352704 3300013102 Bacteria 1071
256 Ga0157371_10451119 3300013102 Bacteria 945
257 Ga0157371_10459589 3300013102 Bacteria 937
258 Ga0157371_10557833 3300013102 Bacteria 849
259 Ga0157371_10882950 3300013102 Bacteria 677
260 Ga0157371_10933532 3300013102 Bacteria 659
261 Ga0157371_10982356 3300013102 Bacteria 643
262 Ga0157371_11169895 3300013102 Bacteria 592
263 Ga0157371_11442408 3300013102 Unclassified 536
264 Ga0157370_10001230 3300013104 Bacteria 32081
265 Ga0157370_10010994 3300013104 Bacteria 9493
266 Ga0157370_10079594 3300013104 Bacteria 3086
267 Ga0157370_10358829 3300013104 Bacteria 1343
268 Ga0157370_10359640 3300013104 Bacteria 1341
269 Ga0157370_10387280 3300013104 Bacteria 1287
270 Ga0157370_10872591 3300013104 Bacteria 817
271 Ga0157370_11470630 3300013104 Bacteria 613
272 Ga0157369_10038098 3300013105 Bacteria 5259
273 Ga0157369_10113731 3300013105 Bacteria 2875
274 Ga0157369_10146675 3300013105 Bacteria 2495
275 Ga0157369_10203932 3300013105 Bacteria 2075
276 Ga0157369_10454461 3300013105 Bacteria 1326
277 Ga0157369_10970307 3300013105 Bacteria 871
278 Ga0157369_10975502 3300013105 Bacteria 868
279 Ga0157369_11550279 3300013105 Bacteria 674
280 Ga0157369_12673082 3300013105 Bacteria 503
281 Ga0157374_10006636 3300013296 Bacteria 9833
282 Ga0157374_10770244 3300013296 Bacteria 977
283 Ga0157374_11219010 3300013296 Bacteria 774
284 Ga0157374_11919446 3300013296 Bacteria 618
285 Ga0157374_12054721 3300013296 Bacteria 598
286 Ga0157378_10021724 3300013297 Bacteria 5643
287 Ga0157378_10079532 3300013297 Bacteria 2960
288 Ga0157378_10219010 3300013297 Bacteria 1809
289 Ga0157378_10324916 3300013297 Bacteria 1496
290 Ga0157378_11090742 3300013297 Bacteria 835
291 Ga0157378_11920305 3300013297 Unclassified 641
292 Ga0157378_12234292 3300013297 Bacteria 598
293 Ga0163162_10007903 3300013306 Bacteria 10367
294 Ga0163162_10031290 3300013306 Bacteria 5278
295 Ga0163162_10113010 3300013306 Bacteria 2814
296 Ga0163162_10295359 3300013306 Bacteria 1752
297 Ga0163162_10314543 3300013306 Bacteria 1699
298 Ga0163162_10319454 3300013306 Bacteria 1685
299 Ga0163162_11182649 3300013306 Bacteria 867
300 Ga0157372_10031119 3300013307 Bacteria 5843
301 Ga0157372_10285461 3300013307 Bacteria 1919
302 Ga0157372_10479805 3300013307 Bacteria 1450
303 Ga0157372_10879495 3300013307 Bacteria 1040
304 Ga0157372_11519853 3300013307 Bacteria 771
305 Ga0157372_11583732 3300013307 Unclassified 754
306 Ga0157375_10002650 3300013308 Bacteria 15497
307 Ga0157375_10080904 3300013308 Unclassified 3287
308 Ga0157375_10222776 3300013308 Bacteria 2045
309 Ga0157375_10805194 3300013308 Bacteria 1088
310 Ga0157375_12226255 3300013308 Bacteria 653
311 Ga0163163_10004847 3300014325 Bacteria 11562
312 Ga0163163_11726665 3300014325 Bacteria 686
313 Ga0163163_12142093 3300014325 Bacteria 619
314 Ga0157380_10855504 3300014326 Bacteria 932
315 Ga0157377_10157223 3300014745 Bacteria 1410
316 Ga0157377_10272575 3300014745 Bacteria 1106
317 Ga0157377_10381894 3300014745 Bacteria 954
318 Ga0157379_10013476 3300014968 Bacteria 7164
319 Ga0157379_10570550 3300014968 Bacteria 1054
320 Ga0157379_10698459 3300014968 Bacteria 952
321 Ga0157376_10936476 3300014969 Unclassified 886
322 Ga0182007_10358144 3300015262 Unclassified 549
323 Ga0163161_11184131 3300017792 Bacteria 660
324 Ga0206349_1238601 3300020075 Bacteria 1420
325 Ga0206352_10314268 3300020078 Bacteria 671
326 Ga0206354_10526256 3300020081 Bacteria 830
327 Ga0206354_10598179 3300020081 Bacteria 641
328 Ga0206354_11689537 3300020081 Bacteria 829
329 Ga0206353_10199961 3300020082 Bacteria 636
330 Ga0206353_10471967 3300020082 Bacteria 3134
331 Ga0224712_10020040 3300022467 Bacteria 2264
332 Ga0207673_1000364 3300025290 Unclassified 4576
333 Ga0207697_10000026 3300025315 Bacteria 52498
334 Ga0207656_10006218 3300025321 Bacteria 4278
335 Ga0207656_10155930 3300025321 Bacteria 1084
336 Ga0207656_10198561 3300025321 Bacteria 968
337 Ga0207688_10000055 3300025901 Bacteria 41067
338 Ga0207680_10019109 3300025903 Bacteria 3660
339 Ga0207680_10291149 3300025903 Bacteria 1136
340 Ga0207647_10000090 3300025904 Bacteria 69395
341 Ga0207647_10000895 3300025904 Bacteria 23093
342 Ga0207647_10005292 3300025904 Bacteria 9485
343 Ga0207647_10265116 3300025904 Bacteria 983
344 Ga0207647_10291902 3300025904 Bacteria 930
345 Ga0207699_10327865 3300025906 Bacteria 1076
346 Ga0207645_10006293 3300025907 Bacteria 8533
347 Ga0207645_10371683 3300025907 Bacteria 959
348 Ga0207705_10023608 3300025909 Bacteria 4386
349 Ga0207705_10034812 3300025909 Bacteria 3602
350 Ga0207705_10044573 3300025909 Bacteria 3187
351 Ga0207705_10091485 3300025909 Bacteria 2228
352 Ga0207705_10123018 3300025909 Bacteria 1927
353 Ga0207705_10125411 3300025909 Bacteria 1908
354 Ga0207705_10195852 3300025909 Bacteria 1530
355 Ga0207705_10253597 3300025909 Bacteria 1342
356 Ga0207705_10599409 3300025909 Bacteria 857
357 Ga0207705_10957043 3300025909 Bacteria 662
358 Ga0207705_11208072 3300025909 Bacteria 580
359 Ga0207705_11482279 3300025909 Bacteria 514
360 Ga0207707_10083703 3300025912 Bacteria 2786
361 Ga0207707_10299441 3300025912 Bacteria 1391
362 Ga0207707_11398557 3300025912 Unclassified 558
363 Ga0207695_10104925 3300025913 Bacteria 2814
364 Ga0207695_10172802 3300025913 Bacteria 2085
365 Ga0207695_11021191 3300025913 Bacteria 707
366 Ga0207671_10314115 3300025914 Bacteria 1239
367 Ga0207671_10454677 3300025914 Bacteria 1020
368 Ga0207660_10000789 3300025917 Bacteria 20979
369 Ga0207660_10001876 3300025917 Bacteria 14007
370 Ga0207660_10820516 3300025917 Bacteria 759
371 Ga0207660_10840474 3300025917 Bacteria 749
372 Ga0207660_11255492 3300025917 Bacteria 602
373 Ga0207657_10001370 3300025919 Bacteria 26003
374 Ga0207657_10003527 3300025919 Bacteria 16711
375 Ga0207657_10003699 3300025919 Bacteria 16264
376 Ga0207657_10004604 3300025919 Bacteria 14577
377 Ga0207657_10019096 3300025919 Bacteria 6520
378 Ga0207657_10097618 3300025919 Bacteria 2442
379 Ga0207657_10115696 3300025919 Bacteria 2210
380 Ga0207657_10151117 3300025919 Bacteria 1891
381 Ga0207649_10012339 3300025920 Unclassified 4738
382 Ga0207649_10116996 3300025920 Bacteria 1791
383 Ga0207649_10169647 3300025920 Bacteria 1519
384 Ga0207649_10172427 3300025920 Bacteria 1508
385 Ga0207649_10240521 3300025920 Bacteria 1299
386 Ga0207649_10537128 3300025920 Bacteria 893
387 Ga0207649_10595567 3300025920 Bacteria 850
388 Ga0207649_10692367 3300025920 Bacteria 790
389 Ga0207649_10878517 3300025920 Bacteria 702
390 Ga0207652_10292893 3300025921 Bacteria 1469
391 Ga0207652_10768209 3300025921 Bacteria 857
392 Ga0207652_11236132 3300025921 Unclassified 649
393 Ga0207681_10007365 3300025923 Bacteria 6739
394 Ga0207681_10443436 3300025923 Bacteria 1055
395 Ga0207694_10028228 3300025924 Bacteria 4278
396 Ga0207694_10728707 3300025924 Unclassified 837
397 Ga0207694_10811769 3300025924 Bacteria 790
398 Ga0207694_11326674 3300025924 Bacteria 608
399 Ga0207694_11664633 3300025924 Bacteria 537
400 Ga0207650_10017486 3300025925 Bacteria 5022
401 Ga0207650_10104481 3300025925 Bacteria 2185
402 Ga0207659_10020338 3300025926 Unclassified 4387
403 Ga0207659_11186183 3300025926 Bacteria 656
404 Ga0207687_10012804 3300025927 Bacteria 5481
405 Ga0207687_10046010 3300025927 Bacteria 3019
406 Ga0207700_11307083 3300025928 Unclassified 646
407 Ga0207664_10021157 3300025929 Bacteria 4832
408 Ga0207664_10177931 3300025929 Bacteria 1825
409 Ga0207664_10541954 3300025929 Bacteria 1044
410 Ga0207664_11859904 3300025929 Unclassified 525
411 Ga0207644_10010033 3300025931 Bacteria 6233
412 Ga0207644_10051063 3300025931 Bacteria 2966
413 Ga0207644_10054511 3300025931 Unclassified 2880
414 Ga0207644_10118167 3300025931 Bacteria 2014
415 Ga0207644_10625326 3300025931 Bacteria 895
416 Ga0207690_10001646 3300025932 Bacteria 13801
417 Ga0207690_10006935 3300025932 Bacteria 6715
418 Ga0207690_10019008 3300025932 Bacteria 4220
419 Ga0207690_10166379 3300025932 Bacteria 1648
420 Ga0207690_10178539 3300025932 Bacteria 1597
421 Ga0207690_10315787 3300025932 Bacteria 1227
422 Ga0207690_11179783 3300025932 Bacteria 639
423 Ga0207690_11258193 3300025932 Bacteria 618
424 Ga0207706_10000278 3300025933 Bacteria 55758
425 Ga0207706_10004500 3300025933 Bacteria 13088
426 Ga0207706_10023987 3300025933 Bacteria 5473
427 Ga0207706_10245699 3300025933 Bacteria 1564
428 Ga0207706_10688885 3300025933 Bacteria 874
429 Ga0207706_10877629 3300025933 Bacteria 759
430 Ga0207686_10724382 3300025934 Bacteria 792
431 Ga0207709_10052008 3300025935 Bacteria 2513
432 Ga0207709_11258719 3300025935 Unclassified 611
433 Ga0207670_10019904 3300025936 Unclassified 4110
434 Ga0207669_10061212 3300025937 Unclassified 2312
435 Ga0207704_10003727 3300025938 Bacteria 6937
436 Ga0207704_10141299 3300025938 Bacteria 1685
437 Ga0207691_10000045 3300025940 Bacteria 99798
438 Ga0207691_10017860 3300025940 Bacteria 6722
439 Ga0207691_10058760 3300025940 Bacteria 3497
440 Ga0207691_10319718 3300025940 Bacteria 1331
441 Ga0207711_10015916 3300025941 Bacteria 6238
442 Ga0207711_10027642 3300025941 Bacteria 4767
443 Ga0207711_10385301 3300025941 Bacteria 1301
444 Ga0207689_10000182 3300025942 Bacteria 54476
445 Ga0207689_10551334 3300025942 Bacteria 968
446 Ga0207689_10840198 3300025942 Bacteria 775
447 Ga0207661_10132162 3300025944 Bacteria 2139
448 Ga0207661_10226556 3300025944 Bacteria 1654
449 Ga0207661_10515584 3300025944 Bacteria 1093
450 Ga0207661_10928745 3300025944 Bacteria 801
451 Ga0207679_10004207 3300025945 Bacteria 8943
452 Ga0207679_10030097 3300025945 Unclassified 3787
453 Ga0207679_10650292 3300025945 Bacteria 953
454 Ga0207679_10737135 3300025945 Bacteria 896
455 Ga0207679_10754849 3300025945 Bacteria 885
456 Ga0207679_10955214 3300025945 Bacteria 785
457 Ga0207667_10038597 3300025949 Bacteria 5098
458 Ga0207667_10085456 3300025949 Unclassified 3266
459 Ga0207667_10117074 3300025949 Bacteria 2746
460 Ga0207667_10134111 3300025949 Bacteria 2550
461 Ga0207667_10323019 3300025949 Bacteria 1576
462 Ga0207667_10328225 3300025949 Bacteria 1562
463 Ga0207667_10371091 3300025949 Bacteria 1458
464 Ga0207667_10789818 3300025949 Bacteria 947
465 Ga0207667_12114938 3300025949 Bacteria 521
466 Ga0207651_10000633 3300025960 Bacteria 14881
467 Ga0207651_10583000 3300025960 Bacteria 976
468 Ga0207651_11072340 3300025960 Bacteria 721
469 Ga0207651_11906596 3300025960 Bacteria 534
470 Ga0207712_10008682 3300025961 Bacteria 6427
471 Ga0207668_10108656 3300025972 Bacteria 2076
472 Ga0207668_10233148 3300025972 Bacteria 1485
473 Ga0207668_10747668 3300025972 Bacteria 862
474 Ga0207668_11195626 3300025972 Bacteria 683
475 Ga0207640_10002842 3300025981 Bacteria 9286
476 Ga0207640_10965367 3300025981 Bacteria 748
477 Ga0207658_10134908 3300025986 Unclassified 1988
478 Ga0207677_10080133 3300026023 Bacteria 2338
479 Ga0207677_10086024 3300026023 Unclassified 2271
480 Ga0207677_10332361 3300026023 Bacteria 1267
481 Ga0207703_10008602 3300026035 Bacteria 8057
482 Ga0207703_10011937 3300026035 Bacteria 6766
483 Ga0207703_10125323 3300026035 Bacteria 2211
484 Ga0207703_10992765 3300026035 Bacteria 805
485 Ga0207639_10001212 3300026041 Bacteria 17510
486 Ga0207639_10020451 3300026041 Bacteria 4737
487 Ga0207639_10035746 3300026041 Bacteria 3678
488 Ga0207639_10192147 3300026041 Bacteria 1744
489 Ga0207639_10275647 3300026041 Bacteria 1477
490 Ga0207639_10670840 3300026041 Bacteria 960
491 Ga0207678_10005028 3300026067 Bacteria 11865
492 Ga0207678_10036148 3300026067 Bacteria 4300
493 Ga0207678_10150256 3300026067 Unclassified 1988
494 Ga0207678_10245054 3300026067 Unclassified 1535
495 Ga0207678_10541326 3300026067 Bacteria 1018
496 Ga0207678_10552598 3300026067 Bacteria 1007
497 Ga0207702_10152443 3300026078 Bacteria 2104
498 Ga0207702_10300102 3300026078 Bacteria 1524
499 Ga0207702_10355742 3300026078 Bacteria 1402
500 Ga0207702_10486463 3300026078 Bacteria 1202
501 Ga0207702_10505279 3300026078 Bacteria 1179
502 Ga0207702_10929562 3300026078 Bacteria 862
503 Ga0207702_11698319 3300026078 Bacteria 624
504 Ga0207641_10004859 3300026088 Bacteria 11567
505 Ga0207641_10009794 3300026088 Bacteria 7890
506 Ga0207641_10120420 3300026088 Bacteria 2341
507 Ga0207641_10156467 3300026088 Bacteria 2068
508 Ga0207648_10000222 3300026089 Bacteria 61156
509 Ga0207648_10004045 3300026089 Bacteria 15225
510 Ga0207676_10001410 3300026095 Bacteria 17854
511 Ga0207676_10009768 3300026095 Bacteria 6824
512 Ga0207676_10720414 3300026095 Bacteria 968
513 Ga0207674_10000793 3300026116 Bacteria 41212
514 Ga0207674_10001606 3300026116 Bacteria 29092
515 Ga0207674_10003653 3300026116 Bacteria 18761
516 Ga0207674_10007080 3300026116 Bacteria 13106
517 Ga0207674_10093502 3300026116 Bacteria 2995
518 Ga0207674_10356794 3300026116 Bacteria 1413
519 Ga0207675_100377465 3300026118 Bacteria 1393
520 Ga0207698_10006563 3300026142 Bacteria 7270
521 Ga0207698_10008094 3300026142 Bacteria 6625
522 Ga0207698_10009658 3300026142 Bacteria 6162
523 Ga0207698_10011944 3300026142 Bacteria 5658
524 Ga0207698_10012686 3300026142 Bacteria 5526
525 Ga0207698_10074910 3300026142 Bacteria 2702
526 Ga0207698_10234507 3300026142 Bacteria 1668
527 Ga0207698_10250860 3300026142 Bacteria 1619
528 Ga0207698_10290813 3300026142 Bacteria 1516
529 Ga0207698_10485982 3300026142 Bacteria 1199
530 Ga0207698_10587186 3300026142 Bacteria 1097
531 Ga0207698_10610398 3300026142 Bacteria 1076
532 Ga0209974_10459842 3300027876 Bacteria 506
533 Ga0268266_10000200 3300028379 Bacteria 104456
534 Ga0268266_10099951 3300028379 Bacteria 2554
535 Ga0268266_10620752 3300028379 Unclassified 1039
536 Ga0268266_11197664 3300028379 Bacteria 734
537 Ga0268265_10040489 3300028380 Unclassified 3442
538 Ga0268265_10088314 3300028380 Bacteria 2469
539 Ga0268265_10522196 3300028380 Bacteria 1122
540 Ga0268264_10000268 3300028381 Bacteria 91477
541 Ga0268264_10009057 3300028381 Bacteria 8260
542 Ga0268264_10034956 3300028381 Bacteria 4137
543 Ga0307408_101130444 3300031548 Bacteria 728
544 Ga0307410_10013597 3300031852 Bacteria 4756
545 Ga0307410_10521088 3300031852 Bacteria 981
546 Ga0307409_100602448 3300031995 Bacteria 1086
547 Ga0307409_102019463 3300031995 Bacteria 606
548 Ga0307409_102289697 3300031995 Unclassified 570
549 Ga0307416_100620817 3300032002 Bacteria 1163
550 Ga0307414_10628734 3300032004 Bacteria 966
551 Ga0307414_11489930 3300032004 Bacteria 630
552 Ga0307411_10010686 3300032005 Bacteria 4907
553 Ga0307411_12340000 3300032005 Unclassified 502
554 Ga0307415_100047719 3300032126 Bacteria 2884
555 Ga0373959_0216424 3300034820 Bacteria 512
556 Ga0373940_0320937 3300035088 Bacteria 538
557 Ga0373939_0119774 3300035114 Bacteria 927
558 Ga0373956_0465012 3300035119 Bacteria 604
559 Ga0373943_0023727 3300035170 Bacteria 2854
560 Ga0373946_0016281 3300035171 Bacteria 2831
561 Ga0373962_0104024 3300035242 Bacteria 889
562 Ga0373927_0111829 3300035695 Bacteria 1780
563 Ga0373947_0029924 3300035725 Bacteria 3197
564 Ga0373947_1061315 3300035725 Unclassified 552
565 Ga0373925_0016052 3300037068 Bacteria 5421
566 Ga0395899_0032592 3300037312 Bacteria 3914
567 Ga0395899_0036960 3300037312 Bacteria 3661
568 Ga0395899_0045155 3300037312 Bacteria 3282
569 Ga0395899_0207628 3300037312 Bacteria 1362
570 Ga0395899_0228302 3300037312 Bacteria 1286
571 Ga0395899_0233729 3300037312 Bacteria 1268
572 Ga0395899_0369972 3300037312 Bacteria 954
573 Ga0395899_0415793 3300037312 Bacteria 887
574 Ga0395899_0521910 3300037312 Bacteria 767
575 Ga0395899_0560698 3300037312 Bacteria 733
576 Ga0395899_0653021 3300037312 Bacteria 664
577 Ga0395899_0779524 3300037312 Bacteria 592
578 Ga0395900_0002260 3300037418 Bacteria 21395
579 Ga0395900_0012145 3300037418 Bacteria 8801
580 Ga0395900_0015935 3300037418 Bacteria 7658
581 Ga0395900_0024561 3300037418 Bacteria 6170
582 Ga0395900_0060201 3300037418 Bacteria 3908
583 Ga0395900_0200797 3300037418 Bacteria 2017
584 Ga0395900_0230267 3300037418 Bacteria 1864
585 Ga0395900_0296564 3300037418 Bacteria 1604
586 Ga0395900_0309788 3300037418 Bacteria 1562
587 Ga0395900_0369418 3300037418 Bacteria 1404
588 Ga0395900_0449773 3300037418 Bacteria 1244
589 Ga0395900_0460399 3300037418 Bacteria 1227
590 Ga0395900_0474782 3300037418 Bacteria 1204
591 Ga0395900_0502501 3300037418 Bacteria 1163
592 Ga0395900_0606668 3300037418 Bacteria 1034
593 Ga0395900_1218831 3300037418 Bacteria 668
594 Ga0395900_1337942 3300037418 Bacteria 630
595 Ga0395900_1369175 3300037418 Bacteria 621
596 Ga0395900_1395346 3300037418 Bacteria 613
597 Ga0395900_1423800 3300037418 Bacteria 606
598 Ga0395900_1652918 3300037418 Bacteria 552
599 Ga0395898_0124872 3300037466 Bacteria 2465
600 Ga0395898_0174210 3300037466 Bacteria 2056
601 Ga0395898_0192475 3300037466 Bacteria 1949
602 Ga0395898_0240705 3300037466 Bacteria 1726
603 Ga0395898_0254854 3300037466 Bacteria 1673
604 Ga0395898_0273015 3300037466 Bacteria 1612
605 Ga0395898_0362613 3300037466 Bacteria 1382
606 Ga0395898_0371778 3300037466 Bacteria 1363
607 Ga0395898_0829428 3300037466 Bacteria 864
608 Ga0395898_1106365 3300037466 Bacteria 725
609 Ga0395898_1922875 3300037466 Unclassified 511
610 Ga0395905_0000570 3300037471 Bacteria 49997
611 Ga0395905_0002474 3300037471 Bacteria 20465
612 Ga0395905_0005541 3300037471 Bacteria 12881
613 Ga0395905_0011928 3300037471 Bacteria 8381
614 Ga0395905_0013630 3300037471 Bacteria 7788
615 Ga0395905_0045051 3300037471 Bacteria 4138
616 Ga0395905_0062812 3300037471 Bacteria 3474
617 Ga0395905_0085279 3300037471 Bacteria 2960
618 Ga0395905_0218234 3300037471 Bacteria 1785
619 Ga0395905_0237664 3300037471 Bacteria 1703
620 Ga0395905_0269659 3300037471 Bacteria 1588
621 Ga0395905_0406010 3300037471 Bacteria 1257
622 Ga0395905_0462894 3300037471 Bacteria 1166
623 Ga0395905_0586959 3300037471 Bacteria 1016
624 Ga0395905_0617550 3300037471 Bacteria 986
625 Ga0395905_0786372 3300037471 Bacteria 854
626 Ga0395905_0866800 3300037471 Bacteria 806
627 Ga0395905_0900599 3300037471 Bacteria 787
628 Ga0395905_0986276 3300037471 Bacteria 745
629 Ga0395905_1007541 3300037471 Bacteria 736
630 Ga0395905_1031372 3300037471 Bacteria 726
631 Ga0395905_1127563 3300037471 Unclassified 688
632 Ga0395905_1151514 3300037471 Bacteria 679
633 Ga0395905_1223263 3300037471 Bacteria 655
634 Ga0395905_1302080 3300037471 Unclassified 630
635 Ga0395901_0000086 3300038443 Bacteria 125359
636 Ga0395901_0044180 3300038443 Bacteria 4621
637 Ga0395901_0048525 3300038443 Bacteria 4409
638 Ga0395901_0116747 3300038443 Bacteria 2803
639 Ga0395901_0180126 3300038443 Bacteria 2216
640 Ga0395901_0190512 3300038443 Bacteria 2151
641 Ga0395901_0237307 3300038443 Bacteria 1902
642 Ga0395901_0242871 3300038443 Bacteria 1878
643 Ga0395901_0326712 3300038443 Bacteria 1586
644 Ga0395901_0469152 3300038443 Bacteria 1285
645 Ga0395901_0602296 3300038443 Bacteria 1108
646 Ga0395901_0632412 3300038443 Bacteria 1076
647 Ga0395901_0676998 3300038443 Bacteria 1032
648 Ga0395901_1449775 3300038443 Unclassified 644
649 Ga0395901_1468331 3300038443 Bacteria 638
650 Ga0395901_1517623 3300038443 Bacteria 625
651 Ga0395901_1594506 3300038443 Bacteria 606
652 Ga0395901_1836874 3300038443 Bacteria 554
653 Ga0436363_1555067 3300039450 Bacteria 694
654 Ga0451793_0802542 3300041452 Bacteria 675
655 Ga0439448_0055477 3300042005 Bacteria 1303
656 Ga0466972_0029268 3300044658 Bacteria 2712
657 Ga0466972_0037071 3300044658 Bacteria 2383
658 Ga0466972_0066945 3300044658 Bacteria 1717
659 Ga0466965_0322430 3300044683 Bacteria 842
660 Ga0466965_0825212 3300044683 Bacteria 538
661 Ga0466966_0019530 3300044684 Bacteria 4458
662 Ga0466966_0158438 3300044684 Bacteria 1379
663 Ga0466966_1003820 3300044684 Bacteria 504
664 Ga0466961_0252712 3300044693 Bacteria 1082
665 Ga0466961_0253813 3300044693 Bacteria 1080
666 Ga0466961_0293078 3300044693 Bacteria 995
667 Ga0466961_0342361 3300044693 Unclassified 911
668 Ga0466961_0451729 3300044693 Bacteria 778
669 Ga0466961_0771946 3300044693 Bacteria 574
670 Ga0466963_0007516 3300044694 Bacteria 6502
671 Ga0466963_0012436 3300044694 Bacteria 5210
672 Ga0466963_0045369 3300044694 Bacteria 2895
673 Ga0466963_0050204 3300044694 Bacteria 2761
674 Ga0466963_0069299 3300044694 Bacteria 2370
675 Ga0466963_0103381 3300044694 Bacteria 1952
676 Ga0466963_0116022 3300044694 Bacteria 1840
677 Ga0466963_0170492 3300044694 Bacteria 1517
678 Ga0466963_0246022 3300044694 Bacteria 1255
679 Ga0466963_0358267 3300044694 Bacteria 1027
680 Ga0466963_0379179 3300044694 Bacteria 997
681 Ga0466963_0595063 3300044694 Bacteria 781
682 Ga0466963_0814556 3300044694 Bacteria 658
683 Ga0466963_1111288 3300044694 Unclassified 556
684 Ga0466963_1207664 3300044694 Bacteria 531
685 Ga0466964_0010402 3300044706 Bacteria 3509
686 Ga0466964_0108628 3300044706 Bacteria 1234
687 Ga0466964_0280906 3300044706 Bacteria 832
688 Ga0466971_0016567 3300044719 Bacteria 3254
689 Ga0466971_0049019 3300044719 Bacteria 1900
690 Ga0466971_0062852 3300044719 Bacteria 1680
691 Ga0466971_0352002 3300044719 Unclassified 713
692 Ga0466971_0389400 3300044719 Bacteria 678
693 Ga0466970_0084176 3300044765 Bacteria 1722
694 Ga0466957_0001054 3300044842 Bacteria 14216
695 Ga0466957_0027189 3300044842 Bacteria 3398
696 Ga0466957_0040076 3300044842 Bacteria 2828
697 Ga0466957_0073731 3300044842 Bacteria 2116
698 Ga0466957_0221723 3300044842 Unclassified 1249
699 Ga0466957_0249726 3300044842 Bacteria 1179
700 Ga0466957_0276128 3300044842 Bacteria 1123
701 Ga0466957_0292542 3300044842 Bacteria 1093
702 Ga0466960_0068624 3300044901 Bacteria 1759
703 Ga0466960_0432055 3300044901 Bacteria 763
704 Ga0466960_0453107 3300044901 Bacteria 746
705 Ga0466960_0854066 3300044901 Unclassified 553
706 Ga0466959_0051611 3300045049 Bacteria 3015
707 Ga0466959_0077716 3300045049 Bacteria 2395
708 Ga0466959_0347636 3300045049 Bacteria 1011
709 Ga0466959_0881903 3300045049 Bacteria 597
710 Ga0466958_0003488 3300045836 Bacteria 8166
711 Ga0466958_0077884 3300045836 Bacteria 2037
712 Ga0466958_0128172 3300045836 Bacteria 1592
713 Ga0466958_0132228 3300045836 Bacteria 1568
714 Ga0466958_0754240 3300045836 Bacteria 634
715 Ga0466958_0783510 3300045836 Bacteria 622
716 Ga0466967_0000746 3300045976 Bacteria 16725
717 Ga0466967_0009713 3300045976 Bacteria 7163
718 Ga0466967_0030520 3300045976 Bacteria 4525
719 Ga0466967_0111381 3300045976 Bacteria 2515
720 Ga0466967_0123176 3300045976 Bacteria 2398
721 Ga0466967_0145592 3300045976 Bacteria 2210
722 Ga0466967_0151242 3300045976 Bacteria 2169
723 Ga0466967_0176216 3300045976 Bacteria 2014
724 Ga0466967_0211682 3300045976 Bacteria 1839
725 Ga0466967_0445284 3300045976 Bacteria 1265
726 Ga0466967_0501286 3300045976 Bacteria 1191
727 Ga0466967_0639542 3300045976 Bacteria 1051
728 Ga0466967_1079849 3300045976 Bacteria 800
729 Ga0466967_1247322 3300045976 Bacteria 740
730 Ga0466967_1325463 3300045976 Bacteria 717
731 Ga0466967_1948258 3300045976 Bacteria 584
732 Ga0495642_0026471 3300046528 Bacteria 2304
733 Ga0495659_0309958 3300046664 Bacteria 668
734 Ga0495588_0392064 3300046674 Bacteria 729
735 Ga0495669_0015232 3300046684 Bacteria 3292
736 Ga0495669_0027924 3300046684 Bacteria 2469
737 Ga0495683_0128157 3300047323 Bacteria 1199
738 Ga0495677_0195420 3300047445 Bacteria 786
739 Ga0496101_0527725 3300048904 Bacteria 933
740 Ga0496105_1305138 3300048908 Bacteria 530
741 Ga0496106_0016967 3300048909 Bacteria 5389
742 Ga0496107_0099572 3300048910 Bacteria 2130
743 Ga0496107_1190579 3300048910 Unclassified 548
744 Ga0496108_0026600 3300048911 Bacteria 4773
745 Ga0496108_0179821 3300048911 Bacteria 1831
746 Ga0496108_0308009 3300048911 Bacteria 1380
747 Ga0496109_0019000 3300048912 Bacteria 6053
748 Ga0496109_0036814 3300048912 Bacteria 4418
749 Ga0496109_0070634 3300048912 Bacteria 3205
750 Ga0496109_0095970 3300048912 Bacteria 2746
751 Ga0496109_0810970 3300048912 Bacteria 874
752 Ga0496109_1733446 3300048912 Unclassified 558
753 Ga0496110_0030737 3300048913 Bacteria 4631
754 Ga0496110_0211103 3300048913 Bacteria 1765
755 Ga0496110_0474274 3300048913 Bacteria 1140
756 Ga0496110_1244004 3300048913 Bacteria 653
757 Ga0496110_1275862 3300048913 Bacteria 644
758 Ga0496110_1281238 3300048913 Bacteria 642
759 Ga0496110_1288676 3300048913 Bacteria 640
760 Ga0496111_0016562 3300048914 Bacteria 5082
761 Ga0496111_0132337 3300048914 Bacteria 1846
762 Ga0496111_0676239 3300048914 Bacteria 752
763 Ga0496112_0009177 3300048915 Bacteria 8886
764 Ga0496112_0012508 3300048915 Bacteria 7798
765 Ga0496112_0156543 3300048915 Bacteria 2245
766 Ga0496112_1427431 3300048915 Bacteria 607
767 Ga0496113_0069038 3300048916 Bacteria 2683
768 Ga0496113_0502202 3300048916 Bacteria 974
769 Ga0501067_0266803 3300049583 Bacteria 953
770 Ga0501070_0018125 3300049586 Bacteria 5906
771 Ga0501073_0092977 3300049589 Bacteria 2096
772 nmdc:mga07m45_151042_c1 3300050496 Bacteria 1347
773 nmdc:mga06r32_992327_c1 3300050510 Bacteria 793
774 nmdc:mga0n895_1550167_c1 3300050512 Bacteria 628
775 nmdc:mga0rr50_807833_c1 3300050513 Bacteria 800
776 nmdc:mga0a205_3851_c2 3300050515 Bacteria 10890
777 Ga0495655_0331094 3300053083 Bacteria 529
778 Ga0587080_169496 3300059503 Bacteria 517
779 Ga0587090_100474 3300059510 Unclassified 605
780 Ga0587106_064438 3300059605 Bacteria 681
781 Ga0587122_050942 3300059628 Unclassified 537
782 Ga0587078_072467 3300059646 Bacteria 540
783 Ga0587110_046465 3300059654 Unclassified 571
784 Ga0466962_0010709 3300061719 Bacteria 4409
785 Ga0466962_0331210 3300061719 Bacteria 756
786 Ga0070680_100475016
787 JGI24736J21556_1017513
788 JGI24736J21556_1080062
789 JGI24741J21665_1001338
790 JGI24741J21665_1006269
791 JGI24741J21665_1014101
792 JGI24741J21665_1033148
793 JGI24752J21851_1059759
794 JGI24746J21847_1007391
795 JGI24747J21853_1019285
796 JGI24740J21852_10000273
797 JGI24740J21852_10000977
798 JGI24740J21852_10025726
799 JGI24740J21852_10041985
800 JGI24740J21852_10120977
801 JGI24739J22299_10000244
802 JGI24739J22299_10022095
803 JGI24739J22299_10156172
804 JGI24737J22298_10000021
805 JGI24737J22298_10003751
806 JGI24737J22298_10014702
807 JGI24737J22298_10038630
808 JGI24743J22301_10027124
809 JGI24735J21928_10015037
810 JGI24735J21928_10041633
811 JGI24735J21928_10092326
812 JGI24735J21928_10140458
813 JGI24745J21846_1003858
814 JGI24738J21930_10000082
815 JGI24738J21930_10022699
816 JGI24744J21845_10003873
817 JGI24035J26624_1008610
818 JGI24034J26672_10014149
819 JGI24742J22300_10107513
820 Ga0070661_100262718
821 Ga0070714_101667817
822 Ga0070681_10555600
823 Ga0070679_100221953
824 Ga0070672_100004071
825 Ga0070672_100004346
826 Ga0070672_100019379
827 Ga0070672_100031449
828 Ga0070672_100037167
829 Ga0070672_100374735
830 Ga0070672_100417180
831 Ga0070665_100000590
832 Ga0070665_100008613
833 Ga0070665_100123581
834 Ga0070665_100223250
835 Ga0070665_100787573
836 Ga0070665_102176415
837 Ga0068855_100016864
838 Ga0068855_100017154
839 Ga0068855_100031566
840 Ga0068855_100103238
841 Ga0068855_100155993
842 Ga0068855_100425096
843 Ga0068855_100772416
844 Ga0068855_100792665
845 Ga0068855_100866504
846 Ga0068855_100939661
847 Ga0068855_101964023
848 Ga0070664_100008994
849 Ga0070664_100011945
850 Ga0070664_100018520
851 Ga0070664_100021543
852 Ga0070664_100045583
853 Ga0070664_100322872
854 Ga0070664_100499185
855 Ga0068857_100000570
856 Ga0068857_100017002
857 Ga0068857_100017148
858 Ga0068857_100083286
859 Ga0068857_100355817
860 Ga0068854_100004137
861 Ga0068854_100005081
862 Ga0068854_100030658
863 Ga0068854_100150259
864 Ga0068854_100218162
865 Ga0068854_100733515
866 Ga0068854_100804453
867 Ga0068854_100962702
868 Ga0068854_101426311
869 Ga0068854_102125387
870 Ga0068856_100044598
871 Ga0068856_100051735
872 Ga0068856_100128240
873 Ga0068856_100128542
874 Ga0068856_100286009
875 Ga0068856_100322975
876 Ga0068856_100557860
877 Ga0068856_100627003
878 Ga0068856_101122038
879 Ga0068856_101609295
880 Ga0068856_102328133
881 Ga0068852_100000333
882 Ga0068852_100000446
883 Ga0068852_100002244
884 Ga0068852_100003747
885 Ga0068852_100006639
886 Ga0068852_100011645
887 Ga0068852_100095984
888 Ga0068852_100159650
889 Ga0068852_100233338
890 Ga0068852_100404898
891 Ga0068852_100457407
892 Ga0068852_100460676
893 Ga0068852_100542154
894 Ga0068852_100568238
895 Ga0068852_100782719
896 Ga0068852_102119985
897 Ga0068859_100000478
898 Ga0068859_100012386
899 Ga0068864_100000174
900 Ga0068864_100002622
901 Ga0068864_100003287
902 Ga0068864_100037301
903 Ga0068864_100059589
904 Ga0068864_100477898
905 Ga0068864_101817733
906 Ga0068866_10052902
907 Ga0068866_10083938
908 Ga0068861_100197370
909 Ga0068861_100618205
910 Ga0068851_10011295
911 Ga0068851_10093971
912 Ga0068851_10117372
913 Ga0068851_10174439
914 Ga0068851_10476166
915 Ga0068870_10007747
916 Ga0068870_10723154
917 Ga0068863_100001778
918 Ga0068863_100004660
919 Ga0068863_100079146
920 Ga0068863_100132319
921 Ga0068863_100238217
922 Ga0068863_101166208
923 Ga0068858_100000600
924 Ga0068858_100001012
925 Ga0068858_100009806
926 Ga0068858_100010636
927 Ga0068858_100158341
928 Ga0068858_100251967
929 Ga0068860_100000674
930 Ga0068860_100005305
931 Ga0068860_100191294
932 Ga0068860_100259233
933 Ga0068862_100043679
934 Ga0068862_100127337
935 Ga0068862_101532394
936 Ga0081539_10010505
937 Ga0081539_10050383
938 Ga0070716_101067656
939 Ga0070712_100201702
940 Ga0097621_100007643
941 Ga0097621_100016747
942 Ga0097621_100591399
943 Ga0097621_100720328
944 Ga0097621_100745438
945 Ga0097621_101189069
946 Ga0075370_10180798
947 Ga0068871_100002657
948 Ga0068871_100203024
949 Ga0068871_100290388
950 Ga0068871_100465456
951 Ga0068871_100494382
952 Ga0075431_100191051
953 Ga0075433_10016296
954 Ga0075434_100529686
955 Ga0068865_100042284
956 Ga0068865_100077802
957 Ga0068865_100182728
958 Ga0068865_100211998
959 Ga0068865_100762409
960 Ga0075436_101035510
961 Ga0097620_100000478
962 Ga0097620_100012385
963 Ga0075435_100456030
964 Ga0075435_101094404
965 Ga0105240_10203371
966 Ga0105240_10264615
967 Ga0105240_10647771
968 Ga0105245_10000300
969 Ga0105245_10058168
970 Ga0105245_10153115
971 Ga0105245_10539389
972 Ga0105245_11138340
973 Ga0105245_11569308
974 Ga0105247_11042247
975 Ga0105243_10037062
976 Ga0105243_10115885
977 Ga0105243_10143925
978 Ga0105243_10170622
979 Ga0105241_10002793
980 Ga0105241_10662458
981 Ga0105241_10750861
982 Ga0105241_10948622
983 Ga0105242_10176973
984 Ga0105242_11910920
985 Ga0105248_10004187
986 Ga0105248_10008362
987 Ga0105248_10013573
988 Ga0105248_10015460
989 Ga0105248_10026036
990 Ga0105248_10068550
991 Ga0105248_10146660
992 Ga0105248_10365365
993 Ga0105248_10510973
994 Ga0105248_11186335
995 Ga0105237_10330320
996 Ga0105237_10668207
997 Ga0105237_10977619
998 Ga0105238_10014171
999 Ga0105238_10121035
1000 Ga0105238_10240291
1001 Ga0105238_10452580
1002 Ga0105238_10610678
1003 Ga0105238_10787574
1004 Ga0105238_12432409
1005 Ga0105249_10000973
1006 Ga0105249_10092014
1007 Ga0105239_10020816
1008 Ga0105239_10106642
1009 Ga0105239_10929731
1010 Ga0105239_12661256
1011 Ga0105239_12803604
1012 Ga0105246_10010772
1013 Ga0105246_10070769
1014 Ga0105246_11700870
1015 Ga0157315_1032040
1016 Ga0157316_1013095
1017 Ga0157373_10008760
1018 Ga0157373_10089281
1019 Ga0157373_10100850
1020 Ga0157373_10186474
1021 Ga0157373_10254593
1022 Ga0157373_10323206
1023 Ga0157373_10448148
1024 Ga0157373_10493231
1025 Ga0157373_10537457
1026 Ga0157373_10553070
1027 Ga0157373_10629505
1028 Ga0157373_10918670
1029 Ga0157373_11132843
1030 Ga0157373_11338098
1031 Ga0157371_10000677
1032 Ga0157371_10005811
1033 Ga0157371_10067070
1034 Ga0157371_10076624
1035 Ga0157371_10082534
1036 Ga0157371_10213379
1037 Ga0157371_10219314
1038 Ga0157371_10262693
1039 Ga0157371_10308345
1040 Ga0157371_10352704
1041 Ga0157371_10451119
1042 Ga0157371_10459589
1043 Ga0157371_10557833
1044 Ga0157371_10882950
1045 Ga0157371_10933532
1046 Ga0157371_10982356
1047 Ga0157371_11169895
1048 Ga0157371_11442408
1049 Ga0157370_10001230
1050 Ga0157370_10010994
1051 Ga0157370_10079594
1052 Ga0157370_10358829
1053 Ga0157370_10359640
1054 Ga0157370_10387280
1055 Ga0157370_10872591
1056 Ga0157370_11470630
1057 Ga0157369_10038098
1058 Ga0157369_10113731
1059 Ga0157369_10146675
1060 Ga0157369_10203932
1061 Ga0157369_10454461
1062 Ga0157369_10970307
1063 Ga0157369_10975502
1064 Ga0157369_11550279
1065 Ga0157369_12673082
1066 Ga0157374_10006636
1067 Ga0157374_10770244
1068 Ga0157374_11219010
1069 Ga0157374_11919446
1070 Ga0157374_12054721
1071 Ga0157378_10021724
1072 Ga0157378_10079532
1073 Ga0157378_10219010
1074 Ga0157378_10324916
1075 Ga0157378_11090742
1076 Ga0157378_11920305
1077 Ga0157378_12234292
1078 Ga0163162_10007903
1079 Ga0163162_10031290
1080 Ga0163162_10113010
1081 Ga0163162_10295359
1082 Ga0163162_10314543
1083 Ga0163162_10319454
1084 Ga0163162_11182649
1085 Ga0157372_10031119
1086 Ga0157372_10285461
1087 Ga0157372_10479805
1088 Ga0157372_10879495
1089 Ga0157372_11519853
1090 Ga0157372_11583732
1091 Ga0157375_10002650
1092 Ga0157375_10080904
1093 Ga0157375_10222776
1094 Ga0157375_10805194
1095 Ga0157375_12226255
1096 Ga0163163_10004847
1097 Ga0163163_11726665
1098 Ga0163163_12142093
1099 Ga0157380_10855504
1100 Ga0157377_10157223
1101 Ga0157377_10272575
1102 Ga0157377_10381894
1103 Ga0157379_10013476
1104 Ga0157379_10570550
1105 Ga0157379_10698459
1106 Ga0157376_10936476
1107 Ga0182007_10358144
1108 Ga0163161_11184131
1109 Ga0206349_1238601
1110 Ga0206352_10314268
1111 Ga0206354_10526256
1112 Ga0206354_10598179
1113 Ga0206354_11689537
1114 Ga0206353_10199961
1115 Ga0206353_10471967
1116 Ga0224712_10020040
1117 Ga0207673_1000364
1118 Ga0207697_10000026
1119 Ga0207656_10006218
1120 Ga0207656_10155930
1121 Ga0207656_10198561
1122 Ga0207688_10000055
1123 Ga0207680_10019109
1124 Ga0207680_10291149
1125 Ga0207647_10000090
1126 Ga0207647_10000895
1127 Ga0207647_10005292
1128 Ga0207647_10265116
1129 Ga0207647_10291902
1130 Ga0207699_10327865
1131 Ga0207645_10006293
1132 Ga0207645_10371683
1133 Ga0207705_10023608
1134 Ga0207705_10034812
1135 Ga0207705_10044573
1136 Ga0207705_10091485
1137 Ga0207705_10123018
1138 Ga0207705_10125411
1139 Ga0207705_10195852
1140 Ga0207705_10253597
1141 Ga0207705_10599409
1142 Ga0207705_10957043
1143 Ga0207705_11208072
1144 Ga0207705_11482279
1145 Ga0207707_10083703
1146 Ga0207707_10299441
1147 Ga0207707_11398557
1148 Ga0207695_10104925
1149 Ga0207695_10172802
1150 Ga0207695_11021191
1151 Ga0207671_10314115
1152 Ga0207671_10454677
1153 Ga0207660_10000789
1154 Ga0207660_10001876
1155 Ga0207660_10820516
1156 Ga0207660_10840474
1157 Ga0207660_11255492
1158 Ga0207657_10001370
1159 Ga0207657_10003527
1160 Ga0207657_10003699
1161 Ga0207657_10004604
1162 Ga0207657_10019096
1163 Ga0207657_10097618
1164 Ga0207657_10115696
1165 Ga0207657_10151117
1166 Ga0207649_10012339
1167 Ga0207649_10116996
1168 Ga0207649_10169647
1169 Ga0207649_10172427
1170 Ga0207649_10240521
1171 Ga0207649_10537128
1172 Ga0207649_10595567
1173 Ga0207649_10692367
1174 Ga0207649_10878517
1175 Ga0207652_10292893
1176 Ga0207652_10768209
1177 Ga0207652_11236132
1178 Ga0207681_10007365
1179 Ga0207681_10443436
1180 Ga0207694_10028228
1181 Ga0207694_10728707
1182 Ga0207694_10811769
1183 Ga0207694_11326674
1184 Ga0207694_11664633
1185 Ga0207650_10017486
1186 Ga0207650_10104481
1187 Ga0207659_10020338
1188 Ga0207659_11186183
1189 Ga0207687_10012804
1190 Ga0207687_10046010
1191 Ga0207700_11307083
1192 Ga0207664_10021157
1193 Ga0207664_10177931
1194 Ga0207664_10541954
1195 Ga0207664_11859904
1196 Ga0207644_10010033
1197 Ga0207644_10051063
1198 Ga0207644_10054511
1199 Ga0207644_10118167
1200 Ga0207644_10625326
1201 Ga0207690_10001646
1202 Ga0207690_10006935
1203 Ga0207690_10019008
1204 Ga0207690_10166379
1205 Ga0207690_10178539
1206 Ga0207690_10315787
1207 Ga0207690_11179783
1208 Ga0207690_11258193
1209 Ga0207706_10000278
1210 Ga0207706_10004500
1211 Ga0207706_10023987
1212 Ga0207706_10245699
1213 Ga0207706_10688885
1214 Ga0207706_10877629
1215 Ga0207686_10724382
1216 Ga0207709_10052008
1217 Ga0207709_11258719
1218 Ga0207670_10019904
1219 Ga0207669_10061212
1220 Ga0207704_10003727
1221 Ga0207704_10141299
1222 Ga0207691_10000045
1223 Ga0207691_10017860
1224 Ga0207691_10058760
1225 Ga0207691_10319718
1226 Ga0207711_10015916
1227 Ga0207711_10027642
1228 Ga0207711_10385301
1229 Ga0207689_10000182
1230 Ga0207689_10551334
1231 Ga0207689_10840198
1232 Ga0207661_10132162
1233 Ga0207661_10226556
1234 Ga0207661_10515584
1235 Ga0207661_10928745
1236 Ga0207679_10004207
1237 Ga0207679_10030097
1238 Ga0207679_10650292
1239 Ga0207679_10737135
1240 Ga0207679_10754849
1241 Ga0207679_10955214
1242 Ga0207667_10038597
1243 Ga0207667_10085456
1244 Ga0207667_10117074
1245 Ga0207667_10134111
1246 Ga0207667_10323019
1247 Ga0207667_10328225
1248 Ga0207667_10371091
1249 Ga0207667_10789818
1250 Ga0207667_12114938
1251 Ga0207651_10000633
1252 Ga0207651_10583000
1253 Ga0207651_11072340
1254 Ga0207651_11906596
1255 Ga0207712_10008682
1256 Ga0207668_10108656
1257 Ga0207668_10233148
1258 Ga0207668_10747668
1259 Ga0207668_11195626
1260 Ga0207640_10002842
1261 Ga0207640_10965367
1262 Ga0207658_10134908
1263 Ga0207677_10080133
1264 Ga0207677_10086024
1265 Ga0207677_10332361
1266 Ga0207703_10008602
1267 Ga0207703_10011937
1268 Ga0207703_10125323
1269 Ga0207703_10992765
1270 Ga0207639_10001212
1271 Ga0207639_10020451
1272 Ga0207639_10035746
1273 Ga0207639_10192147
1274 Ga0207639_10275647
1275 Ga0207639_10670840
1276 Ga0207678_10005028
1277 Ga0207678_10036148
1278 Ga0207678_10150256
1279 Ga0207678_10245054
1280 Ga0207678_10541326
1281 Ga0207678_10552598
1282 Ga0207702_10152443
1283 Ga0207702_10300102
1284 Ga0207702_10355742
1285 Ga0207702_10486463
1286 Ga0207702_10505279
1287 Ga0207702_10929562
1288 Ga0207702_11698319
1289 Ga0207641_10004859
1290 Ga0207641_10009794
1291 Ga0207641_10120420
1292 Ga0207641_10156467
1293 Ga0207648_10000222
1294 Ga0207648_10004045
1295 Ga0207676_10001410
1296 Ga0207676_10009768
1297 Ga0207676_10720414
1298 Ga0207674_10000793
1299 Ga0207674_10001606
1300 Ga0207674_10003653
1301 Ga0207674_10007080
1302 Ga0207674_10093502
1303 Ga0207674_10356794
1304 Ga0207675_100377465
1305 Ga0207698_10006563
1306 Ga0207698_10008094
1307 Ga0207698_10009658
1308 Ga0207698_10011944
1309 Ga0207698_10012686
1310 Ga0207698_10074910
1311 Ga0207698_10234507
1312 Ga0207698_10250860
1313 Ga0207698_10290813
1314 Ga0207698_10485982
1315 Ga0207698_10587186
1316 Ga0207698_10610398
1317 Ga0209974_10459842
1318 Ga0268266_10000200
1319 Ga0268266_10099951
1320 Ga0268266_10620752
1321 Ga0268266_11197664
1322 Ga0268265_10040489
1323 Ga0268265_10088314
1324 Ga0268265_10522196
1325 Ga0268264_10000268
1326 Ga0268264_10009057
1327 Ga0268264_10034956
1328 Ga0307408_101130444
1329 Ga0307410_10013597
1330 Ga0307410_10521088
1331 Ga0307409_100602448
1332 Ga0307409_102019463
1333 Ga0307409_102289697
1334 Ga0307416_100620817
1335 Ga0307414_10628734
1336 Ga0307414_11489930
1337 Ga0307411_10010686
1338 Ga0307411_12340000
1339 Ga0307415_100047719
1340 Ga0373959_0216424
1341 Ga0373940_0320937
1342 Ga0373939_0119774
1343 Ga0373956_0465012
1344 Ga0373943_0023727
1345 Ga0373946_0016281
1346 Ga0373962_0104024
1347 Ga0373927_0111829
1348 Ga0373947_0029924
1349 Ga0373947_1061315
1350 Ga0373925_0016052
1351 Ga0395899_0032592
1352 Ga0395899_0036960
1353 Ga0395899_0045155
1354 Ga0395899_0207628
1355 Ga0395899_0228302
1356 Ga0395899_0233729
1357 Ga0395899_0369972
1358 Ga0395899_0415793
1359 Ga0395899_0521910
1360 Ga0395899_0560698
1361 Ga0395899_0653021
1362 Ga0395899_0779524
1363 Ga0395900_0002260
1364 Ga0395900_0012145
1365 Ga0395900_0015935
1366 Ga0395900_0024561
1367 Ga0395900_0060201
1368 Ga0395900_0200797
1369 Ga0395900_0230267
1370 Ga0395900_0296564
1371 Ga0395900_0309788
1372 Ga0395900_0369418
1373 Ga0395900_0449773
1374 Ga0395900_0460399
1375 Ga0395900_0474782
1376 Ga0395900_0502501
1377 Ga0395900_0606668
1378 Ga0395900_1218831
1379 Ga0395900_1337942
1380 Ga0395900_1369175
1381 Ga0395900_1395346
1382 Ga0395900_1423800
1383 Ga0395900_1652918
1384 Ga0395898_0124872
1385 Ga0395898_0174210
1386 Ga0395898_0192475
1387 Ga0395898_0240705
1388 Ga0395898_0254854
1389 Ga0395898_0273015
1390 Ga0395898_0362613
1391 Ga0395898_0371778
1392 Ga0395898_0829428
1393 Ga0395898_1106365
1394 Ga0395898_1922875
1395 Ga0395905_0000570
1396 Ga0395905_0002474
1397 Ga0395905_0005541
1398 Ga0395905_0011928
1399 Ga0395905_0013630
1400 Ga0395905_0045051
1401 Ga0395905_0062812
1402 Ga0395905_0085279
1403 Ga0395905_0218234
1404 Ga0395905_0237664
1405 Ga0395905_0269659
1406 Ga0395905_0406010
1407 Ga0395905_0462894
1408 Ga0395905_0586959
1409 Ga0395905_0617550
1410 Ga0395905_0786372
1411 Ga0395905_0866800
1412 Ga0395905_0900599
1413 Ga0395905_0986276
1414 Ga0395905_1007541
1415 Ga0395905_1031372
1416 Ga0395905_1127563
1417 Ga0395905_1151514
1418 Ga0395905_1223263
1419 Ga0395905_1302080
1420 Ga0395901_0000086
1421 Ga0395901_0044180
1422 Ga0395901_0048525
1423 Ga0395901_0116747
1424 Ga0395901_0180126
1425 Ga0395901_0190512
1426 Ga0395901_0237307
1427 Ga0395901_0242871
1428 Ga0395901_0326712
1429 Ga0395901_0469152
1430 Ga0395901_0602296
1431 Ga0395901_0632412
1432 Ga0395901_0676998
1433 Ga0395901_1449775
1434 Ga0395901_1468331
1435 Ga0395901_1517623
1436 Ga0395901_1594506
1437 Ga0395901_1836874
1438 Ga0436363_1555067
1439 Ga0451793_0802542
1440 Ga0439448_0055477
1441 Ga0466972_0029268
1442 Ga0466972_0037071
1443 Ga0466972_0066945
1444 Ga0466965_0322430
1445 Ga0466965_0825212
1446 Ga0466966_0019530
1447 Ga0466966_0158438
1448 Ga0466966_1003820
1449 Ga0466961_0252712
1450 Ga0466961_0253813
1451 Ga0466961_0293078
1452 Ga0466961_0342361
1453 Ga0466961_0451729
1454 Ga0466961_0771946
1455 Ga0466963_0007516
1456 Ga0466963_0012436
1457 Ga0466963_0045369
1458 Ga0466963_0050204
1459 Ga0466963_0069299
1460 Ga0466963_0103381
1461 Ga0466963_0116022
1462 Ga0466963_0170492
1463 Ga0466963_0246022
1464 Ga0466963_0358267
1465 Ga0466963_0379179
1466 Ga0466963_0595063
1467 Ga0466963_0814556
1468 Ga0466963_1111288
1469 Ga0466963_1207664
1470 Ga0466964_0010402
1471 Ga0466964_0108628
1472 Ga0466964_0280906
1473 Ga0466971_0016567
1474 Ga0466971_0049019
1475 Ga0466971_0062852
1476 Ga0466971_0352002
1477 Ga0466971_0389400
1478 Ga0466970_0084176
1479 Ga0466957_0001054
1480 Ga0466957_0027189
1481 Ga0466957_0040076
1482 Ga0466957_0073731
1483 Ga0466957_0221723
1484 Ga0466957_0249726
1485 Ga0466957_0276128
1486 Ga0466957_0292542
1487 Ga0466960_0068624
1488 Ga0466960_0432055
1489 Ga0466960_0453107
1490 Ga0466960_0854066
1491 Ga0466959_0051611
1492 Ga0466959_0077716
1493 Ga0466959_0347636
1494 Ga0466959_0881903
1495 Ga0466958_0003488
1496 Ga0466958_0077884
1497 Ga0466958_0128172
1498 Ga0466958_0132228
1499 Ga0466958_0754240
1500 Ga0466958_0783510
1501 Ga0466967_0000746
1502 Ga0466967_0009713
1503 Ga0466967_0030520
1504 Ga0466967_0111381
1505 Ga0466967_0123176
1506 Ga0466967_0145592
1507 Ga0466967_0151242
1508 Ga0466967_0176216
1509 Ga0466967_0211682
1510 Ga0466967_0445284
1511 Ga0466967_0501286
1512 Ga0466967_0639542
1513 Ga0466967_1079849
1514 Ga0466967_1247322
1515 Ga0466967_1325463
1516 Ga0466967_1948258
1517 Ga0495642_0026471
1518 Ga0495659_0309958
1519 Ga0495588_0392064
1520 Ga0495669_0015232
1521 Ga0495669_0027924
1522 Ga0495683_0128157
1523 Ga0495677_0195420
1524 Ga0496101_0527725
1525 Ga0496105_1305138
1526 Ga0496106_0016967
1527 Ga0496107_0099572
1528 Ga0496107_1190579
1529 Ga0496108_0026600
1530 Ga0496108_0179821
1531 Ga0496108_0308009
1532 Ga0496109_0019000
1533 Ga0496109_0036814
1534 Ga0496109_0070634
1535 Ga0496109_0095970
1536 Ga0496109_0810970
1537 Ga0496109_1733446
1538 Ga0496110_0030737
1539 Ga0496110_0211103
1540 Ga0496110_0474274
1541 Ga0496110_1244004
1542 Ga0496110_1275862
1543 Ga0496110_1281238
1544 Ga0496110_1288676
1545 Ga0496111_0016562
1546 Ga0496111_0132337
1547 Ga0496111_0676239
1548 Ga0496112_0009177
1549 Ga0496112_0012508
1550 Ga0496112_0156543
1551 Ga0496112_1427431
1552 Ga0496113_0069038
1553 Ga0496113_0502202
1554 Ga0501067_0266803
1555 Ga0501070_0018125
1556 Ga0501073_0092977
1557 nmdc:mga07m45_151042_c1
1558 nmdc:mga06r32_992327_c1
1559 nmdc:mga0n895_1550167_c1
1560 nmdc:mga0rr50_807833_c1
1561 nmdc:mga0a205_3851_c2
1562 Ga0495655_0331094
1563 Ga0587080_169496
1564 Ga0587090_100474
1565 Ga0587106_064438
1566 Ga0587122_050942
1567 Ga0587078_072467
1568 Ga0587110_046465
1569 Ga0466962_0010709
1570 Ga0466962_0331210

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map