F480680

General Info

Members Datasets Scaffolds Average Seq Length
783 337 758 92

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_848936_c1|nmdc:mga00v17_848936_c1_26_358
Length 110
Sequence MGSHHKRAIRAAAAGDIRMSTMLLWSITAAQILLCVSMACAIFRILWGPRAQDRIVGFDCLYVNAMLLLLAFGIRSGSTLYFEAALMVSLLGFVSTVALAKFLLRGEVIE

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2534681786 Brucella suis 92/29 Isolate Unclassified
3 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
4 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
5 2643221568 Rhizobium sp. Root564 Isolate Unclassified
6 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
7 2738543024 Aminobacter sp. AP02 Isolate Unclassified
8 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
9 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
10 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
11 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
12 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
13 2854911287 Brucella lupini LUP21 Isolate Unclassified
14 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
15 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
16 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
17 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
18 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
19 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
20 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
21 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
22 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
23 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
214 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
224 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
225 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
226 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
227 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
228 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
229 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
230 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
231 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
232 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
233 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
234 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
235 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
236 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
237 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
238 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
239 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
240 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
241 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
242 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
270 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
271 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
272 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
303 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
304 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
305 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
310 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
315 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
321 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
322 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
323 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
328 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
329 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
330 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
331 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
332 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
333 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
335 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
336 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
337 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.68
Metatranscriptomes 0.13
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 6.9
Nodule 0.51
Rhizoplane 7.02
Rhizosphere 78.93
Stem 0
Stem Tuber 0
Unclassified 6.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10338223 3300003322 Bacteria 1700
2 rootH1_10265339 3300003323 Bacteria 1967
3 rootH1_10398603 3300003323 Bacteria 1204
4 Ga0006562J51391_1006409 3300003578 Bacteria 5212
5 Ga0070658_10003488 3300005327 Bacteria 12921
6 Ga0070658_10165025 3300005327 Bacteria 1859
7 Ga0070658_11344707 3300005327 Bacteria 620
8 Ga0070676_10676252 3300005328 Bacteria 752
9 Ga0070676_11116586 3300005328 Bacteria 596
10 Ga0070676_11125842 3300005328 Bacteria 594
11 Ga0070683_100164491 3300005329 Bacteria 2105
12 Ga0070683_100352283 3300005329 Unclassified 1402
13 Ga0070683_100778266 3300005329 Bacteria 917
14 Ga0070683_101269707 3300005329 Bacteria 708
15 Ga0070670_100159351 3300005331 Bacteria 1956
16 Ga0070670_101666295 3300005331 Bacteria 587
17 Ga0070677_10568362 3300005333 Bacteria 624
18 Ga0068869_100014018 3300005334 Bacteria 5348
19 Ga0068869_100092905 3300005334 Bacteria 2272
20 Ga0068869_100398628 3300005334 Bacteria 1131
21 Ga0068869_100469553 3300005334 Bacteria 1046
22 Ga0070680_100014420 3300005336 Bacteria 6177
23 Ga0070680_100020613 3300005336 Bacteria 5235
24 Ga0070680_100135813 3300005336 Bacteria 2060
25 Ga0070680_100491888 3300005336 Bacteria 1049
26 Ga0070682_100072965 3300005337 Bacteria 2201
27 Ga0068868_101181358 3300005338 Bacteria 707
28 Ga0068868_101457717 3300005338 Bacteria 640
29 Ga0070660_100392741 3300005339 Bacteria 1146
30 Ga0070660_100943870 3300005339 Unclassified 728
31 Ga0070660_100951606 3300005339 Bacteria 725
32 Ga0070689_100830760 3300005340 Bacteria 814
33 Ga0070689_100919737 3300005340 Unclassified 775
34 Ga0070689_101184725 3300005340 Bacteria 685
35 Ga0070691_10289947 3300005341 Bacteria 890
36 Ga0070691_10307286 3300005341 Bacteria 868
37 Ga0070687_100100854 3300005343 Bacteria 1616
38 Ga0070687_100422112 3300005343 Bacteria 880
39 Ga0070661_100010269 3300005344 Bacteria 6506
40 Ga0070692_10022193 3300005345 Bacteria 3098
41 Ga0070692_10371920 3300005345 Bacteria 894
42 Ga0070668_100076893 3300005347 Bacteria 2608
43 Ga0070668_100256201 3300005347 Bacteria 1454
44 Ga0070668_101099378 3300005347 Bacteria 717
45 Ga0070668_101347115 3300005347 Bacteria 650
46 Ga0070668_102052173 3300005347 Bacteria 528
47 Ga0070669_100089827 3300005353 Bacteria 2302
48 Ga0070669_101686263 3300005353 Bacteria 552
49 Ga0070675_100641029 3300005354 Unclassified 965
50 Ga0070671_100359625 3300005355 Bacteria 1243
51 Ga0070671_100942040 3300005355 Bacteria 755
52 Ga0070674_100490005 3300005356 Bacteria 1022
53 Ga0070674_100581297 3300005356 Bacteria 944
54 Ga0070674_100994053 3300005356 Unclassified 736
55 Ga0070673_101641297 3300005364 Bacteria 608
56 Ga0070659_100127702 3300005366 Bacteria 2063
57 Ga0070667_100101024 3300005367 Bacteria 2491
58 Ga0070667_101721521 3300005367 Bacteria 590
59 Ga0070703_10019779 3300005406 Bacteria 1954
60 Ga0070701_10674312 3300005438 Bacteria 693
61 Ga0070705_100000901 3300005440 Bacteria 16586
62 Ga0070705_100124782 3300005440 Bacteria 1669
63 Ga0070700_100001924 3300005441 Bacteria 10504
64 Ga0070700_100417194 3300005441 Bacteria 1013
65 Ga0070700_100500283 3300005441 Bacteria 935
66 Ga0070700_101890338 3300005441 Bacteria 516
67 Ga0070694_100001405 3300005444 Bacteria 14089
68 Ga0070694_100173731 3300005444 Bacteria 1589
69 Ga0070708_100016481 3300005445 Bacteria 6134
70 Ga0070663_100038744 3300005455 Bacteria 3326
71 Ga0070663_100065164 3300005455 Bacteria 2636
72 Ga0070663_100198443 3300005455 Bacteria 1565
73 Ga0070663_100260723 3300005455 Bacteria 1375
74 Ga0070663_100274613 3300005455 Unclassified 1341
75 Ga0070663_100716772 3300005455 Unclassified 851
76 Ga0070663_101582407 3300005455 Bacteria 584
77 Ga0070663_101624389 3300005455 Unclassified 577
78 Ga0070678_100054493 3300005456 Bacteria 2914
79 Ga0070678_100078226 3300005456 Bacteria 2498
80 Ga0070678_100574215 3300005456 Bacteria 1004
81 Ga0070678_100738069 3300005456 Bacteria 890
82 Ga0070678_101125785 3300005456 Bacteria 726
83 Ga0070662_100300943 3300005457 Bacteria 1303
84 Ga0070662_101456942 3300005457 Bacteria 590
85 Ga0070681_10006828 3300005458 Bacteria 11113
86 Ga0070681_10013475 3300005458 Bacteria 8124
87 Ga0070681_10106659 3300005458 Bacteria 2743
88 Ga0070681_10174999 3300005458 Bacteria 2068
89 Ga0070681_10477645 3300005458 Bacteria 1159
90 Ga0070681_10583248 3300005458 Unclassified 1032
91 Ga0070681_10587353 3300005458 Bacteria 1028
92 Ga0068867_100072516 3300005459 Bacteria 2578
93 Ga0068867_101643178 3300005459 Bacteria 601
94 Ga0070685_10416578 3300005466 Unclassified 934
95 Ga0070685_11444812 3300005466 Bacteria 529
96 Ga0070706_100029463 3300005467 Bacteria 5057
97 Ga0070707_100525423 3300005468 Bacteria 1145
98 Ga0070698_100017908 3300005471 Bacteria 7463
99 Ga0070699_100015194 3300005518 Bacteria 6615
100 Ga0070679_100028734 3300005530 Bacteria 5485
101 Ga0070679_100338546 3300005530 Bacteria 1452
102 Ga0070679_100680238 3300005530 Unclassified 972
103 Ga0070679_100918268 3300005530 Unclassified 819
104 Ga0070679_101653465 3300005530 Bacteria 588
105 Ga0070679_101717838 3300005530 Bacteria 576
106 Ga0070684_100189099 3300005535 Bacteria 1873
107 Ga0070684_101079299 3300005535 Bacteria 754
108 Ga0070697_100009532 3300005536 Bacteria 7588
109 Ga0068853_100242692 3300005539 Bacteria 1652
110 Ga0070672_100098034 3300005543 Bacteria 2374
111 Ga0070672_100152234 3300005543 Bacteria 1914
112 Ga0070672_101619603 3300005543 Bacteria 581
113 Ga0070672_101910417 3300005543 Bacteria 534
114 Ga0070686_101345841 3300005544 Bacteria 598
115 Ga0070695_100000158 3300005545 Bacteria 32227
116 Ga0070696_100233450 3300005546 Bacteria 1385
117 Ga0070693_100356129 3300005547 Bacteria 1003
118 Ga0070693_100486276 3300005547 Unclassified 873
119 Ga0070693_100815878 3300005547 Bacteria 693
120 Ga0070693_101005415 3300005547 Bacteria 631
121 Ga0070665_100010765 3300005548 Bacteria 9253
122 Ga0070665_100081964 3300005548 Bacteria 3231
123 Ga0070665_100388894 3300005548 Bacteria 1402
124 Ga0070704_100008256 3300005549 Bacteria 6233
125 Ga0070704_100086648 3300005549 Bacteria 2322
126 Ga0068855_100067522 3300005563 Bacteria 4165
127 Ga0068855_100139229 3300005563 Bacteria 2768
128 Ga0068855_100408200 3300005563 Bacteria 1487
129 Ga0068855_100597169 3300005563 Bacteria 1191
130 Ga0068855_101111531 3300005563 Unclassified 826
131 Ga0068855_101135554 3300005563 Bacteria 815
132 Ga0068855_101216124 3300005563 Bacteria 783
133 Ga0068855_102125797 3300005563 Bacteria 565
134 Ga0070664_100118502 3300005564 Bacteria 2316
135 Ga0070664_100571187 3300005564 Bacteria 1047
136 Ga0070664_101117158 3300005564 Unclassified 743
137 Ga0070664_101540017 3300005564 Unclassified 629
138 Ga0068857_100009560 3300005577 Bacteria 8420
139 Ga0068857_100548081 3300005577 Unclassified 1089
140 Ga0068854_100509208 3300005578 Bacteria 1015
141 Ga0068856_101363028 3300005614 Bacteria 724
142 Ga0070702_100016066 3300005615 Bacteria 3834
143 Ga0070702_101697119 3300005615 Bacteria 525
144 Ga0068852_100392752 3300005616 Bacteria 1363
145 Ga0068852_100681505 3300005616 Bacteria 1037
146 Ga0068852_101875297 3300005616 Bacteria 622
147 Ga0068859_100003502 3300005617 Bacteria 15988
148 Ga0068859_100194379 3300005617 Bacteria 2113
149 Ga0068859_102532578 3300005617 Bacteria 565
150 Ga0068864_100025178 3300005618 Bacteria 5009
151 Ga0068864_100540208 3300005618 Bacteria 1125
152 Ga0068866_10721483 3300005718 Bacteria 686
153 Ga0068866_10845806 3300005718 Bacteria 639
154 Ga0068861_100023390 3300005719 Bacteria 4456
155 Ga0068861_100042905 3300005719 Bacteria 3392
156 Ga0068861_100221668 3300005719 Bacteria 1599
157 Ga0068870_10120828 3300005840 Bacteria 1509
158 Ga0068870_10159334 3300005840 Bacteria 1337
159 Ga0068870_10591421 3300005840 Unclassified 753
160 Ga0068863_100107338 3300005841 Bacteria 2657
161 Ga0068863_100250601 3300005841 Bacteria 1710
162 Ga0068863_100329608 3300005841 Bacteria 1484
163 Ga0068858_100488445 3300005842 Unclassified 1189
164 Ga0068858_102056274 3300005842 Bacteria 565
165 Ga0068860_100001841 3300005843 Bacteria 22590
166 Ga0068860_100080379 3300005843 Bacteria 3100
167 Ga0068862_100002731 3300005844 Bacteria 15492
168 Ga0068862_100017501 3300005844 Bacteria 5970
169 Ga0068862_100296142 3300005844 Bacteria 1487
170 Ga0068862_101976356 3300005844 Unclassified 594
171 Ga0075365_10045106 3300006038 Bacteria 2891
172 Ga0075365_10076577 3300006038 Bacteria 2259
173 Ga0075365_10176951 3300006038 Bacteria 1491
174 Ga0075365_10448618 3300006038 Bacteria 911
175 Ga0075365_10627213 3300006038 Bacteria 760
176 Ga0075363_100114453 3300006048 Bacteria 1502
177 Ga0075363_100474799 3300006048 Bacteria 741
178 Ga0075364_10016127 3300006051 Bacteria 4644
179 Ga0075364_10030113 3300006051 Unclassified 3483
180 Ga0075432_10059355 3300006058 Bacteria 1360
181 Ga0070715_10267802 3300006163 Bacteria 900
182 Ga0075362_10045679 3300006177 Unclassified 1946
183 Ga0075362_10652552 3300006177 Unclassified 547
184 Ga0075367_10030475 3300006178 Bacteria 3093
185 Ga0075367_10098355 3300006178 Unclassified 1786
186 Ga0075367_10933851 3300006178 Unclassified 553
187 Ga0075369_10304711 3300006186 Bacteria 744
188 Ga0075366_10021454 3300006195 Bacteria 3753
189 Ga0075366_11010888 3300006195 Bacteria 519
190 Ga0097621_100330182 3300006237 Unclassified 1352
191 Ga0097621_101146284 3300006237 Bacteria 731
192 Ga0097621_101272882 3300006237 Bacteria 694
193 Ga0075370_10060801 3300006353 Bacteria 2152
194 Ga0075370_10335264 3300006353 Bacteria 902
195 Ga0075370_10476437 3300006353 Bacteria 752
196 Ga0068871_100358514 3300006358 Bacteria 1291
197 Ga0068871_100614064 3300006358 Bacteria 990
198 Ga0068871_100806206 3300006358 Unclassified 866
199 Ga0068871_101692096 3300006358 Bacteria 600
200 Ga0075428_100251939 3300006844 Bacteria 1903
201 Ga0075428_101471530 3300006844 Bacteria 714
202 Ga0075430_100009987 3300006846 Bacteria 8031
203 Ga0075430_100484328 3300006846 Bacteria 1021
204 Ga0075430_101409045 3300006846 Bacteria 573
205 Ga0075431_100856752 3300006847 Bacteria 880
206 Ga0075433_10018253 3300006852 Bacteria 5826
207 Ga0075434_100004344 3300006871 Bacteria 12753
208 Ga0075429_100744713 3300006880 Unclassified 858
209 Ga0068865_100296126 3300006881 Bacteria 1293
210 Ga0068865_100340032 3300006881 Unclassified 1213
211 Ga0097620_100003500 3300006931 Bacteria 15988
212 Ga0097620_100194396 3300006931 Bacteria 2113
213 Ga0097620_102532335 3300006931 Bacteria 565
214 Ga0075435_100198189 3300007076 Unclassified 1701
215 Ga0105244_10260307 3300009036 Unclassified 807
216 Ga0105244_10340994 3300009036 Bacteria 691
217 Ga0105240_10080457 3300009093 Bacteria 4007
218 Ga0105240_11077991 3300009093 Unclassified 856
219 Ga0105240_11867774 3300009093 Bacteria 625
220 Ga0105240_11927442 3300009093 Unclassified 615
221 Ga0111539_10158996 3300009094 Bacteria 2643
222 Ga0111539_11939178 3300009094 Bacteria 683
223 Ga0105245_10067879 3300009098 Bacteria 3230
224 Ga0105245_10703437 3300009098 Bacteria 1044
225 Ga0105245_11771471 3300009098 Bacteria 670
226 Ga0105245_13110375 3300009098 Bacteria 514
227 Ga0105247_10129646 3300009101 Bacteria 1642
228 Ga0105247_10515956 3300009101 Bacteria 873
229 Ga0105243_10056569 3300009148 Bacteria 3120
230 Ga0105243_10204910 3300009148 Bacteria 1733
231 Ga0105243_11520150 3300009148 Bacteria 694
232 Ga0105241_10023704 3300009174 Bacteria 4553
233 Ga0105241_10990175 3300009174 Bacteria 786
234 Ga0105241_11441256 3300009174 Bacteria 661
235 Ga0105242_10205554 3300009176 Bacteria 1751
236 Ga0105242_12505360 3300009176 Unclassified 564
237 Ga0105248_10555022 3300009177 Bacteria 1296
238 Ga0105248_11451535 3300009177 Bacteria 776
239 Ga0105237_10130058 3300009545 Bacteria 2512
240 Ga0105237_11127746 3300009545 Bacteria 791
241 Ga0105237_12454848 3300009545 Bacteria 532
242 Ga0105238_10075653 3300009551 Bacteria 3358
243 Ga0105238_10317910 3300009551 Bacteria 1542
244 Ga0105238_10589408 3300009551 Unclassified 1119
245 Ga0105238_12751765 3300009551 Bacteria 528
246 Ga0105249_10046892 3300009553 Bacteria 3935
247 Ga0105249_10710686 3300009553 Bacteria 1065
248 Ga0105249_11170778 3300009553 Unclassified 840
249 Ga0105035_105373 3300009988 Unclassified 1038
250 Ga0105239_10053150 3300010375 Bacteria 4444
251 Ga0105239_10346368 3300010375 Bacteria 1677
252 Ga0105239_11216887 3300010375 Bacteria 868
253 Ga0105239_12198351 3300010375 Bacteria 641
254 Ga0105239_12536316 3300010375 Unclassified 598
255 Ga0105246_10012864 3300011119 Bacteria 5234
256 Ga0105246_10040416 3300011119 Bacteria 3147
257 Ga0105246_10162168 3300011119 Bacteria 1704
258 Ga0157371_10027723 3300013102 Bacteria 4106
259 Ga0157370_10025664 3300013104 Bacteria 5830
260 Ga0157370_10205779 3300013104 Bacteria 1825
261 Ga0157369_10069466 3300013105 Bacteria 3784
262 Ga0157369_10148213 3300013105 Bacteria 2481
263 Ga0157369_12121682 3300013105 Bacteria 570
264 Ga0157374_12211206 3300013296 Bacteria 577
265 Ga0157378_10099522 3300013297 Bacteria 2653
266 Ga0157378_12670550 3300013297 Bacteria 552
267 Ga0163162_10214861 3300013306 Bacteria 2053
268 Ga0163162_10354739 3300013306 Bacteria 1599
269 Ga0163162_10528127 3300013306 Bacteria 1309
270 Ga0157372_10051543 3300013307 Bacteria 4581
271 Ga0157372_10729895 3300013307 Bacteria 1152
272 Ga0157375_10306008 3300013308 Unclassified 1753
273 Ga0157375_10565070 3300013308 Bacteria 1298
274 Ga0157375_11999221 3300013308 Bacteria 689
275 Ga0157375_12313859 3300013308 Bacteria 641
276 Ga0157375_13330215 3300013308 Bacteria 535
277 Ga0163163_10051486 3300014325 Bacteria 4060
278 Ga0163163_12341025 3300014325 Unclassified 593
279 Ga0157380_10059377 3300014326 Bacteria 3052
280 Ga0157380_10144692 3300014326 Bacteria 2047
281 Ga0157380_10238703 3300014326 Bacteria 1637
282 Ga0157380_10888827 3300014326 Bacteria 916
283 Ga0157380_11899401 3300014326 Bacteria 656
284 Ga0182008_10278474 3300014497 Bacteria 870
285 Ga0157377_10640670 3300014745 Bacteria 763
286 Ga0157376_10222379 3300014969 Bacteria 1749
287 Ga0157376_11054875 3300014969 Bacteria 837
288 Ga0157376_12607770 3300014969 Unclassified 545
289 Ga0163161_10170332 3300017792 Bacteria 1665
290 Ga0207653_10102885 3300025885 Bacteria 1012
291 Ga0207682_10264184 3300025893 Bacteria 803
292 Ga0207642_11064305 3300025899 Unclassified 522
293 Ga0207710_10679884 3300025900 Bacteria 540
294 Ga0207688_10030603 3300025901 Bacteria 2969
295 Ga0207688_10270634 3300025901 Bacteria 1033
296 Ga0207647_10567915 3300025904 Bacteria 628
297 Ga0207643_10015598 3300025908 Bacteria 4136
298 Ga0207643_10094685 3300025908 Bacteria 1745
299 Ga0207643_10383986 3300025908 Bacteria 886
300 Ga0207705_10033509 3300025909 Bacteria 3670
301 Ga0207654_10048191 3300025911 Bacteria 2437
302 Ga0207654_11433403 3300025911 Bacteria 504
303 Ga0207707_10000582 3300025912 Bacteria 37091
304 Ga0207707_10030337 3300025912 Bacteria 4730
305 Ga0207707_10104342 3300025912 Bacteria 2477
306 Ga0207707_10141199 3300025912 Bacteria 2106
307 Ga0207707_10191415 3300025912 Bacteria 1785
308 Ga0207707_10323175 3300025912 Bacteria 1332
309 Ga0207707_10371165 3300025912 Unclassified 1231
310 Ga0207707_10990929 3300025912 Bacteria 690
311 Ga0207707_11009592 3300025912 Unclassified 682
312 Ga0207660_10012873 3300025917 Bacteria 5477
313 Ga0207660_10015931 3300025917 Bacteria 4970
314 Ga0207660_10064435 3300025917 Bacteria 2645
315 Ga0207660_10510124 3300025917 Bacteria 976
316 Ga0207660_11316053 3300025917 Bacteria 587
317 Ga0207662_10116595 3300025918 Bacteria 1670
318 Ga0207657_10021633 3300025919 Bacteria 6046
319 Ga0207657_10135285 3300025919 Bacteria 2017
320 Ga0207657_10644674 3300025919 Unclassified 825
321 Ga0207657_10682167 3300025919 Bacteria 799
322 Ga0207652_10004959 3300025921 Bacteria 10782
323 Ga0207652_10837897 3300025921 Unclassified 815
324 Ga0207681_10055802 3300025923 Bacteria 2693
325 Ga0207681_10958824 3300025923 Bacteria 717
326 Ga0207681_11697489 3300025923 Bacteria 528
327 Ga0207694_10063948 3300025924 Bacteria 2867
328 Ga0207694_10343267 3300025924 Unclassified 1235
329 Ga0207694_10507525 3300025924 Bacteria 1010
330 Ga0207694_11700437 3300025924 Bacteria 531
331 Ga0207650_10934547 3300025925 Bacteria 737
332 Ga0207659_10412969 3300025926 Bacteria 1131
333 Ga0207659_11004091 3300025926 Bacteria 718
334 Ga0207687_10096947 3300025927 Bacteria 2162
335 Ga0207687_11691348 3300025927 Bacteria 542
336 Ga0207644_10535143 3300025931 Bacteria 969
337 Ga0207690_10615816 3300025932 Bacteria 887
338 Ga0207690_10631317 3300025932 Bacteria 876
339 Ga0207706_10036082 3300025933 Bacteria 4393
340 Ga0207706_10150165 3300025933 Bacteria 2049
341 Ga0207686_10213002 3300025934 Bacteria 1390
342 Ga0207686_11530481 3300025934 Bacteria 550
343 Ga0207709_10097817 3300025935 Bacteria 1934
344 Ga0207709_10122331 3300025935 Bacteria 1759
345 Ga0207709_10204763 3300025935 Bacteria 1412
346 Ga0207709_11009493 3300025935 Bacteria 680
347 Ga0207709_11344699 3300025935 Bacteria 591
348 Ga0207670_11151847 3300025936 Unclassified 656
349 Ga0207670_11295079 3300025936 Bacteria 618
350 Ga0207669_10028127 3300025937 Bacteria 3089
351 Ga0207669_10141941 3300025937 Bacteria 1669
352 Ga0207669_10383372 3300025937 Bacteria 1096
353 Ga0207669_10414842 3300025937 Bacteria 1058
354 Ga0207669_11428380 3300025937 Bacteria 589
355 Ga0207669_11652370 3300025937 Bacteria 547
356 Ga0207704_10191751 3300025938 Bacteria 1487
357 Ga0207691_10068902 3300025940 Bacteria 3196
358 Ga0207691_10125677 3300025940 Bacteria 2270
359 Ga0207711_10557441 3300025941 Bacteria 1069
360 Ga0207711_11712006 3300025941 Bacteria 572
361 Ga0207689_10089709 3300025942 Bacteria 2525
362 Ga0207689_10239819 3300025942 Bacteria 1499
363 Ga0207689_10613256 3300025942 Bacteria 916
364 Ga0207689_10854579 3300025942 Bacteria 768
365 Ga0207661_10168132 3300025944 Bacteria 1907
366 Ga0207661_11070446 3300025944 Bacteria 743
367 Ga0207661_11837484 3300025944 Unclassified 551
368 Ga0207679_10167946 3300025945 Bacteria 1803
369 Ga0207679_10218784 3300025945 Bacteria 1601
370 Ga0207679_10445218 3300025945 Bacteria 1148
371 Ga0207679_11371176 3300025945 Unclassified 649
372 Ga0207667_10901174 3300025949 Unclassified 876
373 Ga0207667_10913870 3300025949 Bacteria 869
374 Ga0207667_11076569 3300025949 Bacteria 788
375 Ga0207651_10338271 3300025960 Bacteria 1264
376 Ga0207712_10023018 3300025961 Bacteria 4108
377 Ga0207712_10961598 3300025961 Unclassified 757
378 Ga0207668_10024309 3300025972 Bacteria 3908
379 Ga0207668_10063083 3300025972 Bacteria 2613
380 Ga0207668_10100363 3300025972 Bacteria 2149
381 Ga0207668_10609292 3300025972 Bacteria 952
382 Ga0207640_11282329 3300025981 Bacteria 653
383 Ga0207640_11409018 3300025981 Bacteria 624
384 Ga0207658_10484723 3300025986 Bacteria 1099
385 Ga0207677_10127328 3300026023 Bacteria 1927
386 Ga0207677_10145170 3300026023 Bacteria 1822
387 Ga0207677_11012158 3300026023 Bacteria 754
388 Ga0207703_10949219 3300026035 Bacteria 824
389 Ga0207639_10024518 3300026041 Bacteria 4366
390 Ga0207639_10348575 3300026041 Bacteria 1322
391 Ga0207639_10432801 3300026041 Bacteria 1191
392 Ga0207639_10748999 3300026041 Bacteria 908
393 Ga0207678_10044918 3300026067 Bacteria 3821
394 Ga0207678_10183237 3300026067 Bacteria 1788
395 Ga0207678_10234417 3300026067 Bacteria 1572
396 Ga0207678_10574323 3300026067 Bacteria 987
397 Ga0207678_10763050 3300026067 Bacteria 853
398 Ga0207678_10910281 3300026067 Unclassified 778
399 Ga0207678_11372633 3300026067 Bacteria 625
400 Ga0207708_10001399 3300026075 Bacteria 18108
401 Ga0207708_10087186 3300026075 Bacteria 2403
402 Ga0207708_10103918 3300026075 Bacteria 2201
403 Ga0207708_10251993 3300026075 Bacteria 1423
404 Ga0207708_10608897 3300026075 Bacteria 926
405 Ga0207708_11203057 3300026075 Bacteria 662
406 Ga0207702_10052860 3300026078 Bacteria 3439
407 Ga0207702_10299496 3300026078 Bacteria 1526
408 Ga0207641_10131630 3300026088 Bacteria 2247
409 Ga0207641_10164075 3300026088 Bacteria 2022
410 Ga0207641_11717776 3300026088 Bacteria 630
411 Ga0207648_10635847 3300026089 Bacteria 985
412 Ga0207676_10003912 3300026095 Bacteria 10515
413 Ga0207676_10080910 3300026095 Bacteria 2638
414 Ga0207674_10001143 3300026116 Bacteria 34428
415 Ga0207675_100041267 3300026118 Bacteria 4309
416 Ga0207675_100048221 3300026118 Bacteria 3977
417 Ga0207675_100135123 3300026118 Unclassified 2339
418 Ga0207675_101488178 3300026118 Unclassified 698
419 Ga0207683_10053612 3300026121 Bacteria 3537
420 Ga0207683_10168119 3300026121 Bacteria 1985
421 Ga0207683_10362701 3300026121 Bacteria 1331
422 Ga0207683_10880818 3300026121 Bacteria 831
423 Ga0207698_10319495 3300026142 Bacteria 1453
424 Ga0207698_11032649 3300026142 Bacteria 833
425 Ga0209371_1088252 3300027312 Bacteria 526
426 Ga0209813_10013463 3300027866 Unclassified 2184
427 Ga0209813_10228284 3300027866 Bacteria 699
428 Ga0268266_10008617 3300028379 Bacteria 9057
429 Ga0268266_10119099 3300028379 Bacteria 2348
430 Ga0268266_10494045 3300028379 Bacteria 1168
431 Ga0268265_10000626 3300028380 Bacteria 35203
432 Ga0268265_10036784 3300028380 Bacteria 3588
433 Ga0268265_11065293 3300028380 Bacteria 801
434 Ga0268265_11425059 3300028380 Bacteria 695
435 Ga0268264_10003320 3300028381 Bacteria 13903
436 Ga0268264_11778713 3300028381 Bacteria 626
437 Ga0268256_1097476 3300030500 Bacteria 526
438 Ga0307408_101340466 3300031548 Bacteria 672
439 Ga0307405_10723144 3300031731 Bacteria 827
440 Ga0307413_10325848 3300031824 Bacteria 1175
441 Ga0307413_11901714 3300031824 Bacteria 534
442 Ga0307410_10055976 3300031852 Bacteria 2680
443 Ga0307410_10531599 3300031852 Bacteria 972
444 Ga0307410_11210545 3300031852 Bacteria 658
445 Ga0307406_10007814 3300031901 Bacteria 5949
446 Ga0307406_10118690 3300031901 Bacteria 1835
447 Ga0307407_10265865 3300031903 Bacteria 1182
448 Ga0307407_10567894 3300031903 Bacteria 841
449 Ga0307412_11399774 3300031911 Bacteria 633
450 Ga0307409_100003248 3300031995 Bacteria 8767
451 Ga0307409_100027346 3300031995 Bacteria 4040
452 Ga0307409_101467771 3300031995 Bacteria 709
453 Ga0307416_102331309 3300032002 Bacteria 635
454 Ga0307414_10412783 3300032004 Bacteria 1175
455 Ga0307411_11457571 3300032005 Bacteria 628
456 Ga0307411_11945905 3300032005 Bacteria 548
457 Ga0307415_100012409 3300032126 Bacteria 4926
458 Ga0307415_100071786 3300032126 Bacteria 2436
459 Ga0307415_100209505 3300032126 Bacteria 1554
460 Ga0373936_0360103 3300035113 Bacteria 663
461 Ga0373939_0455072 3300035114 Unclassified 539
462 Ga0373941_0168862 3300035115 Unclassified 814
463 Ga0373961_0012192 3300035241 Bacteria 2147
464 Ga0373961_0294112 3300035241 Bacteria 599
465 Ga0373931_0000324 3300035691 Bacteria 20133
466 Ga0373925_0135394 3300037068 Bacteria 1925
467 Ga0395899_0060742 3300037312 Bacteria 2784
468 Ga0395900_0020727 3300037418 Bacteria 6718
469 Ga0395900_0346047 3300037418 Bacteria 1461
470 Ga0395898_0003674 3300037466 Bacteria 17038
471 Ga0395905_0133717 3300037471 Bacteria 2333
472 Ga0395905_0465636 3300037471 Bacteria 1163
473 Ga0395905_1165290 3300037471 Bacteria 674
474 Ga0395901_0270420 3300038443 Bacteria 1768
475 Ga0395901_0339236 3300038443 Bacteria 1553
476 Ga0395901_0854541 3300038443 Bacteria 895
477 Ga0395901_1483482 3300038443 Bacteria 634
478 Ga0451787_007409 3300041441 Bacteria 567
479 Ga0451789_0738026 3300041443 Bacteria 627
480 Ga0451789_0923876 3300041443 Bacteria 599
481 Ga0451793_1234692 3300041452 Bacteria 1329
482 Ga0451797_1299792 3300041453 Bacteria 501
483 Ga0451795_0299550 3300041456 Bacteria 559
484 Ga0451798_1123436 3300041458 Unclassified 517
485 Ga0451802_2128099 3300041460 Bacteria 708
486 Ga0451807_0571173 3300041486 Bacteria 635
487 Ga0451807_1294539 3300041486 Bacteria 589
488 Ga0451807_1494924 3300041486 Bacteria 607
489 Ga0451807_2155322 3300041486 Bacteria 503
490 Ga0451807_2693519 3300041486 Unclassified 814
491 Ga0451833_0416748 3300041491 Bacteria 557
492 Ga0451837_0650742 3300041494 Bacteria 622
493 Ga0451841_1348048 3300041498 Unclassified 648
494 Ga0451845_0436157 3300041501 Bacteria 651
495 Ga0451843_1116658 3300041509 Bacteria 713
496 Ga0451853_2901402 3300041512 Bacteria 1043
497 Ga0439448_0303566 3300042005 Bacteria 567
498 Ga0439432_243951 3300042006 Bacteria 516
499 Ga0450894_015381 3300042131 Bacteria 1013
500 Ga0439446_0024012 3300042156 Bacteria 1737
501 Ga0439434_0360652 3300042435 Bacteria 508
502 Ga0453683_0379638 3300044673 Bacteria 910
503 Ga0466965_0058514 3300044683 Bacteria 1922
504 Ga0466957_0117044 3300044842 Bacteria 1696
505 Ga0466960_0217108 3300044901 Bacteria 1051
506 Ga0466967_0036885 3300045976 Bacteria 4178
507 Ga0495629_0217343 3300046459 Bacteria 1319
508 Ga0495632_0364017 3300046519 Bacteria 635
509 Ga0495587_0568915 3300046536 Bacteria 625
510 Ga0495635_0548676 3300046663 Bacteria 758
511 Ga0495600_0699478 3300046809 Bacteria 610
512 Ga0495581_0363512 3300047315 Bacteria 845
513 Ga0495604_0426369 3300047317 Bacteria 870
514 Ga0496100_0796125 3300048903 Bacteria 740
515 Ga0496100_1376768 3300048903 Bacteria 557
516 Ga0496101_0109131 3300048904 Bacteria 2081
517 Ga0496101_0291161 3300048904 Bacteria 1278
518 Ga0496102_0009559 3300048905 Bacteria 8340
519 Ga0496102_0039333 3300048905 Bacteria 4273
520 Ga0496102_0251716 3300048905 Bacteria 1666
521 Ga0496102_0848433 3300048905 Bacteria 836
522 Ga0496102_1295703 3300048905 Unclassified 648
523 Ga0496102_1756408 3300048905 Bacteria 538
524 Ga0496103_0036330 3300048906 Bacteria 3017
525 Ga0496103_0098712 3300048906 Unclassified 1847
526 Ga0496103_0161053 3300048906 Bacteria 1439
527 Ga0496103_0953668 3300048906 Bacteria 536
528 Ga0496104_0132289 3300048907 Bacteria 2396
529 Ga0496104_0659058 3300048907 Bacteria 955
530 Ga0496104_1091422 3300048907 Bacteria 702
531 Ga0496105_0052219 3300048908 Bacteria 3376
532 Ga0496105_0121824 3300048908 Bacteria 2151
533 Ga0496106_0042073 3300048909 Bacteria 3425
534 Ga0496106_0438092 3300048909 Bacteria 1050
535 Ga0496106_0723222 3300048909 Bacteria 793
536 Ga0496107_0011296 3300048910 Bacteria 6217
537 Ga0496107_0067379 3300048910 Bacteria 2597
538 Ga0496107_1094858 3300048910 Bacteria 576
539 Ga0496108_0040335 3300048911 Bacteria 3891
540 Ga0496108_1311453 3300048911 Unclassified 608
541 Ga0496109_0039540 3300048912 Bacteria 4269
542 Ga0496109_0336834 3300048912 Bacteria 1425
543 Ga0496109_0874317 3300048912 Bacteria 837
544 Ga0496109_1102814 3300048912 Bacteria 731
545 Ga0496109_1790395 3300048912 Bacteria 547
546 Ga0496110_0017647 3300048913 Bacteria 5967
547 Ga0496111_0307412 3300048914 Bacteria 1175
548 Ga0496112_0015803 3300048915 Bacteria 7052
549 Ga0496112_0016184 3300048915 Bacteria 6978
550 Ga0496114_0008572 3300048917 Bacteria 8102
551 Ga0496114_0040997 3300048917 Bacteria 3836
552 Ga0496114_1256416 3300048917 Bacteria 627
553 Ga0496114_1782755 3300048917 Bacteria 504
554 Ga0496115_0345469 3300048918 Bacteria 1214
555 Ga0496115_0549615 3300048918 Bacteria 923
556 Ga0496116_0000100 3300048919 Bacteria 194740
557 Ga0496116_0043510 3300048919 Bacteria 3058
558 Ga0496118_0059604 3300048921 Bacteria 2840
559 Ga0496119_0019768 3300048922 Bacteria 4940
560 Ga0496119_0585542 3300048922 Bacteria 509
561 Ga0496120_0052116 3300048923 Bacteria 2332
562 Ga0496121_0000001 3300048924 Bacteria 1830318
563 Ga0496121_0358017 3300048924 Bacteria 970
564 Ga0496121_0678993 3300048924 Bacteria 623
565 Ga0496122_0003647 3300048925 Bacteria 20021
566 Ga0496122_0008413 3300048925 Bacteria 11146
567 Ga0496122_0158319 3300048925 Bacteria 1385
568 Ga0496122_0164361 3300048925 Bacteria 1348
569 Ga0496122_0314577 3300048925 Bacteria 836
570 Ga0496123_0000517 3300048926 Bacteria 67322
571 Ga0496123_0076793 3300048926 Bacteria 2054
572 Ga0496123_0226076 3300048926 Bacteria 940
573 Ga0496124_0015675 3300048927 Bacteria 7250
574 Ga0496124_0107810 3300048927 Bacteria 2247
575 Ga0496125_0000001 3300048928 Bacteria 1766138
576 Ga0496125_0000713 3300048928 Bacteria 54953
577 Ga0496126_0000094 3300048929 Bacteria 208184
578 Ga0496126_0561186 3300048929 Bacteria 904
579 Ga0496126_0628342 3300048929 Bacteria 843
580 Ga0501300_023806 3300049523 Bacteria 896
581 Ga0501031_0000010 3300049568 Bacteria 146435
582 Ga0501031_0002408 3300049568 Bacteria 11893
583 Ga0501031_0006171 3300049568 Bacteria 7824
584 Ga0501031_0093978 3300049568 Bacteria 1957
585 Ga0501031_0121925 3300049568 Bacteria 1703
586 Ga0501032_0000023 3300049569 Bacteria 146435
587 Ga0501032_0038284 3300049569 Bacteria 3267
588 Ga0501032_0038787 3300049569 Bacteria 3242
589 Ga0501032_0082015 3300049569 Bacteria 2146
590 Ga0501033_0000104 3300049570 Bacteria 81029
591 Ga0501033_0004294 3300049570 Bacteria 11449
592 Ga0501033_0007428 3300049570 Bacteria 8537
593 Ga0501033_0214291 3300049570 Bacteria 1373
594 Ga0501033_0237615 3300049570 Bacteria 1293
595 Ga0501033_0364429 3300049570 Bacteria 1011
596 Ga0501033_0434097 3300049570 Bacteria 914
597 Ga0501034_0000116 3300049571 Bacteria 146442
598 Ga0501034_0073146 3300049571 Bacteria 3436
599 Ga0501034_0076906 3300049571 Bacteria 3344
600 Ga0501034_0139192 3300049571 Bacteria 2407
601 Ga0501034_0194349 3300049571 Bacteria 1990
602 Ga0501034_0204182 3300049571 Bacteria 1933
603 Ga0501034_0208416 3300049571 Bacteria 1910
604 Ga0501034_0407536 3300049571 Bacteria 1282
605 Ga0501036_0000015 3300049572 Bacteria 146442
606 Ga0501036_0039590 3300049572 Bacteria 3988
607 Ga0501036_0043249 3300049572 Bacteria 3814
608 Ga0501036_0206600 3300049572 Bacteria 1651
609 Ga0501036_0522077 3300049572 Bacteria 987
610 Ga0501037_0000023 3300049573 Bacteria 146542
611 Ga0501037_0004454 3300049573 Bacteria 10172
612 Ga0501037_0015413 3300049573 Bacteria 5624
613 Ga0501037_0029303 3300049573 Bacteria 4067
614 Ga0501037_0349858 3300049573 Bacteria 1020
615 Ga0501038_0000025 3300049574 Bacteria 146542
616 Ga0501038_0023114 3300049574 Bacteria 5562
617 Ga0501038_0087169 3300049574 Bacteria 2621
618 Ga0501038_0095352 3300049574 Bacteria 2485
619 Ga0501038_0134187 3300049574 Bacteria 2030
620 Ga0501038_0208276 3300049574 Bacteria 1566
621 Ga0501039_0000037 3300049575 Bacteria 122286
622 Ga0501039_0053240 3300049575 Bacteria 3131
623 Ga0501039_0266770 3300049575 Bacteria 1346
624 Ga0501039_0740038 3300049575 Bacteria 768
625 Ga0501040_0005598 3300049576 Bacteria 8116
626 Ga0501040_0389412 3300049576 Bacteria 1000
627 Ga0501041_0137308 3300049577 Bacteria 1524
628 Ga0501041_0260106 3300049577 Bacteria 1091
629 Ga0501042_0006985 3300049578 Bacteria 7369
630 Ga0501042_0226930 3300049578 Bacteria 1347
631 Ga0501042_0333915 3300049578 Bacteria 1096
632 Ga0501042_1124383 3300049578 Bacteria 573
633 Ga0501043_0000070 3300049579 Bacteria 89839
634 Ga0501043_0017343 3300049579 Bacteria 5647
635 Ga0501043_0083685 3300049579 Bacteria 2508
636 Ga0501043_0398702 3300049579 Bacteria 1040
637 Ga0501043_0414385 3300049579 Bacteria 1016
638 Ga0501043_0498715 3300049579 Bacteria 910
639 Ga0501043_0592366 3300049579 Bacteria 820
640 Ga0501046_0039644 3300049580 Bacteria 3770
641 Ga0501046_0103078 3300049580 Bacteria 2187
642 Ga0501046_0116579 3300049580 Bacteria 2035
643 Ga0501046_0478553 3300049580 Bacteria 893
644 Ga0501047_0001244 3300049581 Bacteria 25242
645 Ga0501047_0025205 3300049581 Bacteria 5714
646 Ga0501047_0122146 3300049581 Bacteria 2486
647 Ga0501047_0284741 3300049581 Bacteria 1497
648 Ga0501047_0452411 3300049581 Bacteria 1113
649 Ga0501047_0512479 3300049581 Bacteria 1026
650 Ga0501048_1044042 3300049582 Bacteria 588
651 Ga0501048_1079766 3300049582 Bacteria 577
652 Ga0501067_0424955 3300049583 Bacteria 742
653 Ga0501068_0023785 3300049584 Bacteria 3593
654 Ga0501068_0528692 3300049584 Bacteria 766
655 Ga0501069_0080090 3300049585 Bacteria 1839
656 Ga0501070_0047983 3300049586 Bacteria 3548
657 Ga0501070_0073374 3300049586 Bacteria 2831
658 Ga0501070_0076324 3300049586 Bacteria 2774
659 Ga0501070_0186288 3300049586 Bacteria 1707
660 Ga0501070_0803663 3300049586 Bacteria 738
661 Ga0501070_1134270 3300049586 Bacteria 602
662 Ga0501071_0031594 3300049587 Bacteria 3755
663 Ga0501071_0083056 3300049587 Bacteria 2347
664 Ga0501071_1196037 3300049587 Bacteria 587
665 Ga0501073_0201448 3300049589 Bacteria 1376
666 Ga0501074_0245860 3300049590 Bacteria 1272
667 Ga0501074_0394119 3300049590 Bacteria 982
668 Ga0501074_0421783 3300049590 Bacteria 946
669 Ga0501074_0482451 3300049590 Bacteria 879
670 Ga0501075_0243164 3300049591 Bacteria 1372
671 Ga0501076_0093445 3300049592 Bacteria 2420
672 Ga0501076_0176205 3300049592 Bacteria 1743
673 Ga0501077_0407783 3300049593 Bacteria 869
674 Ga0501077_0744717 3300049593 Bacteria 630
675 Ga0501077_0918813 3300049593 Bacteria 563
676 Ga0501079_0183477 3300049741 Bacteria 1633
677 Ga0501080_0084392 3300049742 Bacteria 2951
678 Ga0501080_0110362 3300049742 Bacteria 2549
679 Ga0501080_0187004 3300049742 Bacteria 1904
680 Ga0501080_0891638 3300049742 Bacteria 776
681 Ga0501080_0985345 3300049742 Bacteria 732
682 Ga0501080_1000669 3300049742 Bacteria 725
683 Ga0501080_1037235 3300049742 Bacteria 710
684 Ga0501080_1212241 3300049742 Bacteria 648
685 Ga0501081_0089620 3300049743 Bacteria 2162
686 Ga0501081_0252915 3300049743 Bacteria 1287
687 Ga0501083_0347970 3300049744 Bacteria 964
688 Ga0501083_0428470 3300049744 Bacteria 861
689 Ga0501083_0570771 3300049744 Bacteria 736
690 Ga0501083_0847682 3300049744 Bacteria 595
691 Ga0501280_001054 3300049776 Bacteria 5606
692 Ga0501280_112724 3300049776 Bacteria 533
693 Ga0501282_003196 3300049778 Bacteria 1768
694 Ga0501035_0000074 3300049822 Bacteria 122269
695 Ga0501035_0008072 3300049822 Bacteria 9810
696 Ga0501035_0054537 3300049822 Bacteria 3572
697 Ga0501035_0066879 3300049822 Bacteria 3189
698 Ga0501035_0230153 3300049822 Bacteria 1580
699 Ga0501035_0265749 3300049822 Bacteria 1453
700 Ga0501044_0000069 3300049823 Bacteria 125974
701 Ga0501044_0030874 3300049823 Bacteria 5643
702 Ga0501044_0099811 3300049823 Bacteria 2921
703 Ga0501044_0108035 3300049823 Bacteria 2793
704 Ga0501044_0192500 3300049823 Bacteria 2001
705 Ga0501044_0202925 3300049823 Bacteria 1940
706 Ga0501044_0509090 3300049823 Bacteria 1104
707 Ga0501044_0836155 3300049823 Bacteria 798
708 Ga0501044_0931967 3300049823 Bacteria 742
709 Ga0501045_0103639 3300049824 Bacteria 2107
710 Ga0501045_0164076 3300049824 Bacteria 1654
711 Ga0501045_0438656 3300049824 Bacteria 971
712 nmdc:mga03683_30478_c1 3300050489 Unclassified 2158
713 nmdc:mga03n38_157042_c1 3300050490 Bacteria 1149
714 nmdc:mga03n38_24061_c1 3300050490 Unclassified 2486
715 nmdc:mga00v17_5790_c1 3300050491 Bacteria 6527
716 nmdc:mga00v17_848936_c1 3300050491 Unclassified 580
717 nmdc:mga0yw44_138138_c1 3300050492 Bacteria 1582
718 nmdc:mga0yw44_169194_c1 3300050492 Bacteria 1434
719 nmdc:mga0yw44_224437_c1 3300050492 Unclassified 1246
720 nmdc:mga0yw44_4246_c1 3300050492 Bacteria 4153
721 nmdc:mga0yw44_583868_c1 3300050492 Bacteria 759
722 nmdc:mga0yw44_696899_c1 3300050492 Bacteria 690
723 nmdc:mga0yw44_828363_c1 3300050492 Bacteria 628
724 nmdc:mga0k408_148904_c1 3300050493 Bacteria 1393
725 nmdc:mga0k408_220406_c1 3300050493 Bacteria 1132
726 nmdc:mga06z11_110892_c1 3300050494 Bacteria 1519
727 nmdc:mga06z11_341823_c1 3300050494 Bacteria 895
728 nmdc:mga06z11_883595_c1 3300050494 Bacteria 545
729 nmdc:mga06z11_9784_c1 3300050494 Bacteria 4053
730 nmdc:mga04h51_10906_c1 3300050495 Unclassified 2509
731 nmdc:mga04h51_259831_c1 3300050495 Bacteria 698
732 nmdc:mga07m45_27801_c2 3300050496 Bacteria 1355
733 nmdc:mga07m45_37513_c1 3300050496 Unclassified 2703
734 nmdc:mga07m45_590160_c1 3300050496 Bacteria 642
735 nmdc:mga07m45_904608_c1 3300050496 Unclassified 505
736 nmdc:mga0qj67_1199774_c1 3300050509 Bacteria 590
737 nmdc:mga0qj67_26058_c1 3300050509 Bacteria 4525
738 nmdc:mga0qj67_354997_c1 3300050509 Bacteria 1185
739 nmdc:mga06r32_26679_c1 3300050510 Bacteria 5389
740 nmdc:mga06r32_946660_c1 3300050510 Bacteria 816
741 nmdc:mga0n895_39998_c1 3300050512 Bacteria 4554
742 nmdc:mga08x19_1190915_c1 3300050514 Unclassified 540
743 nmdc:mga0a205_18086_c1 3300050515 Bacteria 6621
744 nmdc:mga0sz30_330859_c1 3300050516 Bacteria 680
745 nmdc:mga0sz30_80476_c1 3300050516 Unclassified 1409
746 Ga0500641_0016481 3300053096 Bacteria 2752
747 Ga0500556_0000039 3300053104 Bacteria 138158
748 Ga0500572_020801 3300053111 Bacteria 1731
749 Ga0500603_238306 3300053150 Bacteria 583
750 Ga0500636_0000006 3300053177 Bacteria 183899
751 Ga0500636_0129561 3300053177 Bacteria 1407
752 Ga0501084_1246404 3300054114 Bacteria 624
753 Ga0501082_0000006 3300060353 Bacteria 127786
754 Ga0501082_0080879 3300060353 Bacteria 2804
755 Ga0501082_0385566 3300060353 Bacteria 1223
756 Ga0530510_0062570 3300061734 Bacteria 2694
757 Ga0530510_0849547 3300061734 Bacteria 697
758 Ga0530510_1044026 3300061734 Unclassified 626

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049776 Ga0501280_112724 Ga0501280_112724_89_358 83
2 3300049523 Ga0501300_023806 Ga0501300_023806_42_302 86
3 3300049776 Ga0501280_001054 Ga0501280_001054_4763_5023 86
4 3300049778 Ga0501282_003196 Ga0501282_003196_1328_1588 86
5 3300049593 Ga0501077_0918813 Ga0501077_0918813_212_478 88
6 3300061734 Ga0530510_0849547 Ga0530510_0849547_24_290 88
7 3300009101 Ga0105247_10515956 Ga0105247_105159562 89
8 3300013104 Ga0157370_10025664 Ga0157370_100256643 89
9 3300014326 Ga0157380_11899401 Ga0157380_118994011 89
10 3300035113 Ga0373936_0360103 Ga0373936_0360103_146_415 89
11 3300041443 Ga0451789_0923876 Ga0451789_0923876_113_382 89
12 3300041452 Ga0451793_1234692 Ga0451793_1234692_120_389 89
13 3300041456 Ga0451795_0299550 Ga0451795_0299550_29_298 89
14 3300041460 Ga0451802_2128099 Ga0451802_2128099_101_370 89
15 3300041486 Ga0451807_1294539 Ga0451807_1294539_119_388 89
16 3300041486 Ga0451807_1494924 Ga0451807_1494924_13_282 89
17 3300041486 Ga0451807_2693519 Ga0451807_2693519_161_430 89
18 3300041491 Ga0451833_0416748 Ga0451833_0416748_72_341 89
19 3300041494 Ga0451837_0650742 Ga0451837_0650742_326_595 89
20 3300041498 Ga0451841_1348048 Ga0451841_1348048_51_320 89
21 3300042006 Ga0439432_243951 Ga0439432_243951_210_479 89
22 3300042131 Ga0450894_015381 Ga0450894_015381_411_680 89
23 3300042156 Ga0439446_0024012 Ga0439446_0024012_362_631 89
24 3300042435 Ga0439434_0360652 Ga0439434_0360652_156_425 89
25 3300046459 Ga0495629_0217343 Ga0495629_0217343_563_832 89
26 3300046536 Ga0495587_0568915 Ga0495587_0568915_322_591 89
27 3300046663 Ga0495635_0548676 Ga0495635_0548676_55_324 89
28 3300046809 Ga0495600_0699478 Ga0495600_0699478_254_523 89
29 3300047315 Ga0495581_0363512 Ga0495581_0363512_375_644 89
30 3300047317 Ga0495604_0426369 Ga0495604_0426369_482_751 89
31 3300048904 Ga0496101_0291161 Ga0496101_0291161_653_922 89
32 3300048905 Ga0496102_0848433 Ga0496102_0848433_405_674 89
33 3300048908 Ga0496105_0121824 Ga0496105_0121824_419_688 89
34 3300048912 Ga0496109_0336834 Ga0496109_0336834_540_809 89
35 3300048915 Ga0496112_0015803 Ga0496112_0015803_319_588 89
36 3300048918 Ga0496115_0549615 Ga0496115_0549615_502_771 89
37 3300048924 Ga0496121_0358017 Ga0496121_0358017_285_554 89
38 3300050492 nmdc:mga0yw44_696899_c1 nmdc:mga0yw44_696899_c1_398_667 89
39 3300050493 nmdc:mga0k408_220406_c1 nmdc:mga0k408_220406_c1_163_432 89
40 3300053096 Ga0500641_0016481 Ga0500641_0016481_597_866 89
41 3300053150 Ga0500603_238306 Ga0500603_238306_44_313 89
42 iso_pu_bacteria 2534681786 2535486473 89
43 iso_pu_bacteria 2597490356 2599104605 89
44 iso_pu_bacteria 2643221564 2643837794 89
45 iso_pu_bacteria 2643221568 2643855215 89
46 iso_pu_bacteria 2643221623 2644133095 89
47 iso_pu_bacteria 2738543024 2739305873 89
48 iso_pu_bacteria 2757320392 2757569368 89
49 iso_pu_bacteria 2842718218 2842719657 89
50 iso_pu_bacteria 2844002411 2844004668 89
51 iso_pu_bacteria 2846952575 2846955462 89
52 iso_pu_bacteria 2848858292 2848862659 89
53 iso_pu_bacteria 2854911287 2854916674 89
54 iso_pu_bacteria 2894772417 2894777199 89
55 iso_pu_bacteria 2915650412 2915652453 89
56 iso_pu_bacteria 2919166419 2919166786 89
57 iso_pu_bacteria 2929138655 2929138719 89
58 iso_pu_bacteria 2974320154 2974323725 89
59 iso_pu_bacteria 2977957713 2977959128 89
60 iso_pu_bacteria 2978969890 2978973202 89
61 iso_pu_bacteria 2984587000 2984591450 89
62 iso_pu_bacteria 2996310559 2996314958 89
63 iso_pu_bacteria 8054460903 8054461231 89
64 3300032005 Ga0307411_11457571 Ga0307411_114575712 90
65 3300035114 Ga0373939_0455072 Ga0373939_0455072_212_484 90
66 3300035115 Ga0373941_0168862 Ga0373941_0168862_459_731 90
67 3300035241 Ga0373961_0012192 Ga0373961_0012192_1606_1878 90
68 3300035691 Ga0373931_0000324 Ga0373931_0000324_15475_15747 90
69 3300049569 Ga0501032_0038284 Ga0501032_0038284_2659_2931 90
70 3300049571 Ga0501034_0204182 Ga0501034_0204182_1392_1664 90
71 3300049578 Ga0501042_0006985 Ga0501042_0006985_3911_4183 90
72 3300049593 Ga0501077_0744717 Ga0501077_0744717_11_283 90
73 3300050512 nmdc:mga0n895_39998_c1 nmdc:mga0n895_39998_c1_1877_2149 90
74 3300050514 nmdc:mga08x19_1190915_c1 nmdc:mga08x19_1190915_c1_87_359 90
75 3300050515 nmdc:mga0a205_18086_c1 nmdc:mga0a205_18086_c1_5995_6267 90
76 iso_pu_bacteria 2508501050 2508731125 90
77 3300044673 Ga0453683_0379638 Ga0453683_0379638_135_410 91
78 3300045976 Ga0466967_0036885 Ga0466967_0036885_3681_3956 91
79 3300049824 Ga0501045_0438656 Ga0501045_0438656_513_791 91
80 3300003322 rootL2_10338223 rootL2_103382233 92
81 3300003323 rootH1_10265339 rootH1_102653392 92
82 3300003323 rootH1_10398603 rootH1_103986033 92
83 3300003578 Ga0006562J51391_1006409 Ga0006562J51391_10064093 92
84 3300005327 Ga0070658_10003488 Ga0070658_100034886 92
85 3300005327 Ga0070658_10165025 Ga0070658_101650253 92
86 3300005327 Ga0070658_11344707 Ga0070658_113447072 92
87 3300005328 Ga0070676_10676252 Ga0070676_106762522 92
88 3300005328 Ga0070676_11116586 Ga0070676_111165862 92
89 3300005328 Ga0070676_11125842 Ga0070676_111258421 92
90 3300005329 Ga0070683_100164491 Ga0070683_1001644911 92
91 3300005329 Ga0070683_100352283 Ga0070683_1003522832 92
92 3300005329 Ga0070683_100778266 Ga0070683_1007782662 92
93 3300005329 Ga0070683_101269707 Ga0070683_1012697072 92
94 3300005331 Ga0070670_100159351 Ga0070670_1001593513 92
95 3300005331 Ga0070670_101666295 Ga0070670_1016662951 92
96 3300005333 Ga0070677_10568362 Ga0070677_105683622 92
97 3300005334 Ga0068869_100014018 Ga0068869_1000140183 92
98 3300005334 Ga0068869_100092905 Ga0068869_1000929053 92
99 3300005334 Ga0068869_100398628 Ga0068869_1003986282 92
100 3300005334 Ga0068869_100469553 Ga0068869_1004695532 92
101 3300005336 Ga0070680_100014420 Ga0070680_1000144204 92
102 3300005336 Ga0070680_100020613 Ga0070680_1000206135 92
103 3300005336 Ga0070680_100135813 Ga0070680_1001358134 92
104 3300005336 Ga0070680_100491888 Ga0070680_1004918883 92
105 3300005337 Ga0070682_100072965 Ga0070682_1000729654 92
106 3300005338 Ga0068868_101181358 Ga0068868_1011813581 92
107 3300005338 Ga0068868_101457717 Ga0068868_1014577171 92
108 3300005339 Ga0070660_100392741 Ga0070660_1003927413 92
109 3300005339 Ga0070660_100943870 Ga0070660_1009438702 92
110 3300005339 Ga0070660_100951606 Ga0070660_1009516062 92
111 3300005340 Ga0070689_100830760 Ga0070689_1008307601 92
112 3300005340 Ga0070689_100919737 Ga0070689_1009197372 92
113 3300005340 Ga0070689_101184725 Ga0070689_1011847252 92
114 3300005341 Ga0070691_10289947 Ga0070691_102899472 92
115 3300005341 Ga0070691_10307286 Ga0070691_103072862 92
116 3300005343 Ga0070687_100100854 Ga0070687_1001008543 92
117 3300005343 Ga0070687_100422112 Ga0070687_1004221121 92
118 3300005344 Ga0070661_100010269 Ga0070661_1000102692 92
119 3300005345 Ga0070692_10022193 Ga0070692_100221934 92
120 3300005345 Ga0070692_10371920 Ga0070692_103719202 92
121 3300005347 Ga0070668_100076893 Ga0070668_1000768933 92
122 3300005347 Ga0070668_100256201 Ga0070668_1002562013 92
123 3300005347 Ga0070668_101099378 Ga0070668_1010993781 92
124 3300005347 Ga0070668_101347115 Ga0070668_1013471152 92
125 3300005347 Ga0070668_102052173 Ga0070668_1020521731 92
126 3300005353 Ga0070669_100089827 Ga0070669_1000898273 92
127 3300005353 Ga0070669_101686263 Ga0070669_1016862632 92
128 3300005354 Ga0070675_100641029 Ga0070675_1006410293 92
129 3300005355 Ga0070671_100359625 Ga0070671_1003596252 92
130 3300005355 Ga0070671_100942040 Ga0070671_1009420402 92
131 3300005356 Ga0070674_100490005 Ga0070674_1004900052 92
132 3300005356 Ga0070674_100581297 Ga0070674_1005812972 92
133 3300005356 Ga0070674_100994053 Ga0070674_1009940531 92
134 3300005364 Ga0070673_101641297 Ga0070673_1016412972 92
135 3300005366 Ga0070659_100127702 Ga0070659_1001277023 92
136 3300005367 Ga0070667_100101024 Ga0070667_1001010243 92
137 3300005367 Ga0070667_101721521 Ga0070667_1017215212 92
138 3300005406 Ga0070703_10019779 Ga0070703_100197793 92
139 3300005438 Ga0070701_10674312 Ga0070701_106743122 92
140 3300005440 Ga0070705_100000901 Ga0070705_1000009015 92
141 3300005440 Ga0070705_100124782 Ga0070705_1001247821 92
142 3300005441 Ga0070700_100001924 Ga0070700_1000019243 92
143 3300005441 Ga0070700_100417194 Ga0070700_1004171942 92
144 3300005441 Ga0070700_100500283 Ga0070700_1005002833 92
145 3300005441 Ga0070700_101890338 Ga0070700_1018903381 92
146 3300005444 Ga0070694_100001405 Ga0070694_1000014055 92
147 3300005444 Ga0070694_100173731 Ga0070694_1001737312 92
148 3300005445 Ga0070708_100016481 Ga0070708_1000164816 92
149 3300005455 Ga0070663_100038744 Ga0070663_1000387443 92
150 3300005455 Ga0070663_100065164 Ga0070663_1000651643 92
151 3300005455 Ga0070663_100198443 Ga0070663_1001984433 92
152 3300005455 Ga0070663_100260723 Ga0070663_1002607232 92
153 3300005455 Ga0070663_100274613 Ga0070663_1002746133 92
154 3300005455 Ga0070663_100716772 Ga0070663_1007167721 92
155 3300005455 Ga0070663_101582407 Ga0070663_1015824072 92
156 3300005455 Ga0070663_101624389 Ga0070663_1016243892 92
157 3300005456 Ga0070678_100054493 Ga0070678_1000544933 92
158 3300005456 Ga0070678_100078226 Ga0070678_1000782263 92
159 3300005456 Ga0070678_100574215 Ga0070678_1005742153 92
160 3300005456 Ga0070678_100738069 Ga0070678_1007380692 92
161 3300005456 Ga0070678_101125785 Ga0070678_1011257851 92
162 3300005457 Ga0070662_100300943 Ga0070662_1003009431 92
163 3300005457 Ga0070662_101456942 Ga0070662_1014569422 92
164 3300005458 Ga0070681_10006828 Ga0070681_1000682810 92
165 3300005458 Ga0070681_10013475 Ga0070681_1001347510 92
166 3300005458 Ga0070681_10106659 Ga0070681_101066593 92
167 3300005458 Ga0070681_10174999 Ga0070681_101749993 92
168 3300005458 Ga0070681_10477645 Ga0070681_104776453 92
169 3300005458 Ga0070681_10583248 Ga0070681_105832483 92
170 3300005458 Ga0070681_10587353 Ga0070681_105873533 92
171 3300005459 Ga0068867_100072516 Ga0068867_1000725164 92
172 3300005459 Ga0068867_101643178 Ga0068867_1016431782 92
173 3300005466 Ga0070685_10416578 Ga0070685_104165782 92
174 3300005466 Ga0070685_11444812 Ga0070685_114448122 92
175 3300005467 Ga0070706_100029463 Ga0070706_1000294633 92
176 3300005468 Ga0070707_100525423 Ga0070707_1005254233 92
177 3300005471 Ga0070698_100017908 Ga0070698_1000179085 92
178 3300005518 Ga0070699_100015194 Ga0070699_1000151946 92
179 3300005530 Ga0070679_100028734 Ga0070679_1000287345 92
180 3300005530 Ga0070679_100338546 Ga0070679_1003385463 92
181 3300005530 Ga0070679_100680238 Ga0070679_1006802382 92
182 3300005530 Ga0070679_100918268 Ga0070679_1009182682 92
183 3300005530 Ga0070679_101653465 Ga0070679_1016534652 92
184 3300005530 Ga0070679_101717838 Ga0070679_1017178382 92
185 3300005535 Ga0070684_100189099 Ga0070684_1001890993 92
186 3300005535 Ga0070684_101079299 Ga0070684_1010792992 92
187 3300005536 Ga0070697_100009532 Ga0070697_1000095326 92
188 3300005539 Ga0068853_100242692 Ga0068853_1002426923 92
189 3300005543 Ga0070672_100098034 Ga0070672_1000980343 92
190 3300005543 Ga0070672_100152234 Ga0070672_1001522343 92
191 3300005543 Ga0070672_101619603 Ga0070672_1016196032 92
192 3300005543 Ga0070672_101910417 Ga0070672_1019104171 92
193 3300005544 Ga0070686_101345841 Ga0070686_1013458412 92
194 3300005545 Ga0070695_100000158 Ga0070695_10000015830 92
195 3300005546 Ga0070696_100233450 Ga0070696_1002334503 92
196 3300005547 Ga0070693_100356129 Ga0070693_1003561292 92
197 3300005547 Ga0070693_100486276 Ga0070693_1004862762 92
198 3300005547 Ga0070693_100815878 Ga0070693_1008158782 92
199 3300005547 Ga0070693_101005415 Ga0070693_1010054152 92
200 3300005548 Ga0070665_100010765 Ga0070665_1000107652 92
201 3300005548 Ga0070665_100081964 Ga0070665_1000819644 92
202 3300005548 Ga0070665_100388894 Ga0070665_1003888943 92
203 3300005549 Ga0070704_100008256 Ga0070704_1000082565 92
204 3300005549 Ga0070704_100086648 Ga0070704_1000866483 92
205 3300005563 Ga0068855_100067522 Ga0068855_1000675221 92
206 3300005563 Ga0068855_100139229 Ga0068855_1001392292 92
207 3300005563 Ga0068855_100408200 Ga0068855_1004082003 92
208 3300005563 Ga0068855_100597169 Ga0068855_1005971692 92
209 3300005563 Ga0068855_101111531 Ga0068855_1011115311 92
210 3300005563 Ga0068855_101135554 Ga0068855_1011355542 92
211 3300005563 Ga0068855_101216124 Ga0068855_1012161242 92
212 3300005563 Ga0068855_102125797 Ga0068855_1021257972 92
213 3300005564 Ga0070664_100118502 Ga0070664_1001185024 92
214 3300005564 Ga0070664_100571187 Ga0070664_1005711872 92
215 3300005564 Ga0070664_101117158 Ga0070664_1011171582 92
216 3300005564 Ga0070664_101540017 Ga0070664_1015400172 92
217 3300005577 Ga0068857_100009560 Ga0068857_1000095605 92
218 3300005577 Ga0068857_100548081 Ga0068857_1005480812 92
219 3300005578 Ga0068854_100509208 Ga0068854_1005092082 92
220 3300005614 Ga0068856_101363028 Ga0068856_1013630282 92
221 3300005615 Ga0070702_100016066 Ga0070702_1000160664 92
222 3300005615 Ga0070702_101697119 Ga0070702_1016971191 92
223 3300005616 Ga0068852_100392752 Ga0068852_1003927521 92
224 3300005616 Ga0068852_100681505 Ga0068852_1006815052 92
225 3300005616 Ga0068852_101875297 Ga0068852_1018752972 92
226 3300005617 Ga0068859_100003502 Ga0068859_1000035025 92
227 3300005617 Ga0068859_100194379 Ga0068859_1001943793 92
228 3300005617 Ga0068859_102532578 Ga0068859_1025325782 92
229 3300005618 Ga0068864_100025178 Ga0068864_1000251786 92
230 3300005618 Ga0068864_100540208 Ga0068864_1005402083 92
231 3300005718 Ga0068866_10721483 Ga0068866_107214832 92
232 3300005718 Ga0068866_10845806 Ga0068866_108458062 92
233 3300005719 Ga0068861_100023390 Ga0068861_1000233901 92
234 3300005719 Ga0068861_100042905 Ga0068861_1000429055 92
235 3300005719 Ga0068861_100221668 Ga0068861_1002216683 92
236 3300005840 Ga0068870_10120828 Ga0068870_101208283 92
237 3300005840 Ga0068870_10159334 Ga0068870_101593342 92
238 3300005840 Ga0068870_10591421 Ga0068870_105914213 92
239 3300005841 Ga0068863_100107338 Ga0068863_1001073383 92
240 3300005841 Ga0068863_100250601 Ga0068863_1002506013 92
241 3300005841 Ga0068863_100329608 Ga0068863_1003296082 92
242 3300005842 Ga0068858_100488445 Ga0068858_1004884452 92
243 3300005842 Ga0068858_102056274 Ga0068858_1020562742 92
244 3300005843 Ga0068860_100001841 Ga0068860_1000018417 92
245 3300005843 Ga0068860_100080379 Ga0068860_1000803793 92
246 3300005844 Ga0068862_100002731 Ga0068862_1000027315 92
247 3300005844 Ga0068862_100017501 Ga0068862_1000175015 92
248 3300005844 Ga0068862_100296142 Ga0068862_1002961423 92
249 3300005844 Ga0068862_101976356 Ga0068862_1019763561 92
250 3300006038 Ga0075365_10045106 Ga0075365_100451062 92
251 3300006038 Ga0075365_10076577 Ga0075365_100765773 92
252 3300006038 Ga0075365_10176951 Ga0075365_101769512 92
253 3300006038 Ga0075365_10448618 Ga0075365_104486182 92
254 3300006038 Ga0075365_10627213 Ga0075365_106272132 92
255 3300006048 Ga0075363_100114453 Ga0075363_1001144533 92
256 3300006048 Ga0075363_100474799 Ga0075363_1004747992 92
257 3300006051 Ga0075364_10016127 Ga0075364_100161272 92
258 3300006051 Ga0075364_10030113 Ga0075364_100301136 92
259 3300006058 Ga0075432_10059355 Ga0075432_100593552 92
260 3300006163 Ga0070715_10267802 Ga0070715_102678022 92
261 3300006177 Ga0075362_10045679 Ga0075362_100456793 92
262 3300006177 Ga0075362_10652552 Ga0075362_106525522 92
263 3300006178 Ga0075367_10030475 Ga0075367_100304752 92
264 3300006178 Ga0075367_10098355 Ga0075367_100983553 92
265 3300006178 Ga0075367_10933851 Ga0075367_109338512 92
266 3300006186 Ga0075369_10304711 Ga0075369_103047111 92
267 3300006195 Ga0075366_10021454 Ga0075366_100214542 92
268 3300006195 Ga0075366_11010888 Ga0075366_110108882 92
269 3300006237 Ga0097621_100330182 Ga0097621_1003301823 92
270 3300006237 Ga0097621_101146284 Ga0097621_1011462842 92
271 3300006237 Ga0097621_101272882 Ga0097621_1012728822 92
272 3300006353 Ga0075370_10060801 Ga0075370_100608012 92
273 3300006353 Ga0075370_10335264 Ga0075370_103352642 92
274 3300006353 Ga0075370_10476437 Ga0075370_104764372 92
275 3300006358 Ga0068871_100358514 Ga0068871_1003585142 92
276 3300006358 Ga0068871_100614064 Ga0068871_1006140642 92
277 3300006358 Ga0068871_100806206 Ga0068871_1008062062 92
278 3300006358 Ga0068871_101692096 Ga0068871_1016920962 92
279 3300006844 Ga0075428_100251939 Ga0075428_1002519392 92
280 3300006844 Ga0075428_101471530 Ga0075428_1014715301 92
281 3300006846 Ga0075430_100009987 Ga0075430_1000099876 92
282 3300006846 Ga0075430_100484328 Ga0075430_1004843281 92
283 3300006846 Ga0075430_101409045 Ga0075430_1014090452 92
284 3300006847 Ga0075431_100856752 Ga0075431_1008567521 92
285 3300006852 Ga0075433_10018253 Ga0075433_100182535 92
286 3300006871 Ga0075434_100004344 Ga0075434_10000434411 92
287 3300006880 Ga0075429_100744713 Ga0075429_1007447132 92
288 3300006881 Ga0068865_100296126 Ga0068865_1002961262 92
289 3300006881 Ga0068865_100340032 Ga0068865_1003400322 92
290 3300006931 Ga0097620_100003500 Ga0097620_1000035005 92
291 3300006931 Ga0097620_100194396 Ga0097620_1001943962 92
292 3300006931 Ga0097620_102532335 Ga0097620_1025323352 92
293 3300007076 Ga0075435_100198189 Ga0075435_1001981893 92
294 3300009036 Ga0105244_10260307 Ga0105244_102603072 92
295 3300009036 Ga0105244_10340994 Ga0105244_103409942 92
296 3300009093 Ga0105240_10080457 Ga0105240_100804574 92
297 3300009093 Ga0105240_11077991 Ga0105240_110779912 92
298 3300009093 Ga0105240_11867774 Ga0105240_118677742 92
299 3300009093 Ga0105240_11927442 Ga0105240_119274422 92
300 3300009094 Ga0111539_10158996 Ga0111539_101589965 92
301 3300009094 Ga0111539_11939178 Ga0111539_119391782 92
302 3300009098 Ga0105245_10067879 Ga0105245_100678793 92
303 3300009098 Ga0105245_10703437 Ga0105245_107034372 92
304 3300009098 Ga0105245_11771471 Ga0105245_117714712 92
305 3300009098 Ga0105245_13110375 Ga0105245_131103751 92
306 3300009101 Ga0105247_10129646 Ga0105247_101296463 92
307 3300009148 Ga0105243_10056569 Ga0105243_100565693 92
308 3300009148 Ga0105243_10204910 Ga0105243_102049103 92
309 3300009148 Ga0105243_11520150 Ga0105243_115201501 92
310 3300009174 Ga0105241_10023704 Ga0105241_100237043 92
311 3300009174 Ga0105241_10990175 Ga0105241_109901752 92
312 3300009174 Ga0105241_11441256 Ga0105241_114412562 92
313 3300009176 Ga0105242_10205554 Ga0105242_102055543 92
314 3300009176 Ga0105242_12505360 Ga0105242_125053602 92
315 3300009177 Ga0105248_10555022 Ga0105248_105550222 92
316 3300009177 Ga0105248_11451535 Ga0105248_114515352 92
317 3300009545 Ga0105237_10130058 Ga0105237_101300583 92
318 3300009545 Ga0105237_11127746 Ga0105237_111277462 92
319 3300009545 Ga0105237_12454848 Ga0105237_124548481 92
320 3300009551 Ga0105238_10075653 Ga0105238_100756536 92
321 3300009551 Ga0105238_10317910 Ga0105238_103179102 92
322 3300009551 Ga0105238_10589408 Ga0105238_105894082 92
323 3300009551 Ga0105238_12751765 Ga0105238_127517652 92
324 3300009553 Ga0105249_10046892 Ga0105249_100468923 92
325 3300009553 Ga0105249_10710686 Ga0105249_107106862 92
326 3300009553 Ga0105249_11170778 Ga0105249_111707783 92
327 3300009988 Ga0105035_105373 Ga0105035_1053733 92
328 3300010375 Ga0105239_10053150 Ga0105239_100531505 92
329 3300010375 Ga0105239_10346368 Ga0105239_103463683 92
330 3300010375 Ga0105239_11216887 Ga0105239_112168872 92
331 3300010375 Ga0105239_12198351 Ga0105239_121983512 92
332 3300010375 Ga0105239_12536316 Ga0105239_125363162 92
333 3300011119 Ga0105246_10012864 Ga0105246_100128645 92
334 3300011119 Ga0105246_10040416 Ga0105246_100404163 92
335 3300011119 Ga0105246_10162168 Ga0105246_101621682 92
336 3300013102 Ga0157371_10027723 Ga0157371_100277231 92
337 3300013104 Ga0157370_10205779 Ga0157370_102057794 92
338 3300013105 Ga0157369_10069466 Ga0157369_100694664 92
339 3300013105 Ga0157369_10148213 Ga0157369_101482133 92
340 3300013105 Ga0157369_12121682 Ga0157369_121216822 92
341 3300013296 Ga0157374_12211206 Ga0157374_122112062 92
342 3300013297 Ga0157378_10099522 Ga0157378_100995223 92
343 3300013297 Ga0157378_12670550 Ga0157378_126705501 92
344 3300013306 Ga0163162_10214861 Ga0163162_102148613 92
345 3300013306 Ga0163162_10354739 Ga0163162_103547393 92
346 3300013306 Ga0163162_10528127 Ga0163162_105281273 92
347 3300013307 Ga0157372_10051543 Ga0157372_100515433 92
348 3300013307 Ga0157372_10729895 Ga0157372_107298952 92
349 3300013308 Ga0157375_10306008 Ga0157375_103060083 92
350 3300013308 Ga0157375_10565070 Ga0157375_105650702 92
351 3300013308 Ga0157375_11999221 Ga0157375_119992212 92
352 3300013308 Ga0157375_12313859 Ga0157375_123138591 92
353 3300013308 Ga0157375_13330215 Ga0157375_133302152 92
354 3300014325 Ga0163163_10051486 Ga0163163_100514863 92
355 3300014325 Ga0163163_12341025 Ga0163163_123410252 92
356 3300014326 Ga0157380_10059377 Ga0157380_100593774 92
357 3300014326 Ga0157380_10144692 Ga0157380_101446925 92
358 3300014326 Ga0157380_10238703 Ga0157380_102387033 92
359 3300014326 Ga0157380_10888827 Ga0157380_108888272 92
360 3300014497 Ga0182008_10278474 Ga0182008_102784743 92
361 3300014745 Ga0157377_10640670 Ga0157377_106406702 92
362 3300014969 Ga0157376_10222379 Ga0157376_102223792 92
363 3300014969 Ga0157376_11054875 Ga0157376_110548751 92
364 3300014969 Ga0157376_12607770 Ga0157376_126077702 92
365 3300017792 Ga0163161_10170332 Ga0163161_101703321 92
366 3300025885 Ga0207653_10102885 Ga0207653_101028852 92
367 3300025893 Ga0207682_10264184 Ga0207682_102641842 92
368 3300025899 Ga0207642_11064305 Ga0207642_110643052 92
369 3300025900 Ga0207710_10679884 Ga0207710_106798842 92
370 3300025901 Ga0207688_10030603 Ga0207688_100306033 92
371 3300025901 Ga0207688_10270634 Ga0207688_102706342 92
372 3300025904 Ga0207647_10567915 Ga0207647_105679152 92
373 3300025908 Ga0207643_10015598 Ga0207643_100155983 92
374 3300025908 Ga0207643_10094685 Ga0207643_100946853 92
375 3300025908 Ga0207643_10383986 Ga0207643_103839862 92
376 3300025909 Ga0207705_10033509 Ga0207705_100335095 92
377 3300025911 Ga0207654_10048191 Ga0207654_100481913 92
378 3300025911 Ga0207654_11433403 Ga0207654_114334032 92
379 3300025912 Ga0207707_10000582 Ga0207707_1000058222 92
380 3300025912 Ga0207707_10030337 Ga0207707_100303375 92
381 3300025912 Ga0207707_10104342 Ga0207707_101043423 92
382 3300025912 Ga0207707_10141199 Ga0207707_101411993 92
383 3300025912 Ga0207707_10191415 Ga0207707_101914153 92
384 3300025912 Ga0207707_10323175 Ga0207707_103231753 92
385 3300025912 Ga0207707_10371165 Ga0207707_103711653 92
386 3300025912 Ga0207707_10990929 Ga0207707_109909292 92
387 3300025912 Ga0207707_11009592 Ga0207707_110095921 92
388 3300025917 Ga0207660_10012873 Ga0207660_100128735 92
389 3300025917 Ga0207660_10015931 Ga0207660_100159314 92
390 3300025917 Ga0207660_10064435 Ga0207660_100644355 92
391 3300025917 Ga0207660_10510124 Ga0207660_105101243 92
392 3300025917 Ga0207660_11316053 Ga0207660_113160531 92
393 3300025918 Ga0207662_10116595 Ga0207662_101165953 92
394 3300025919 Ga0207657_10021633 Ga0207657_100216335 92
395 3300025919 Ga0207657_10135285 Ga0207657_101352853 92
396 3300025919 Ga0207657_10644674 Ga0207657_106446742 92
397 3300025919 Ga0207657_10682167 Ga0207657_106821672 92
398 3300025921 Ga0207652_10004959 Ga0207652_100049598 92
399 3300025921 Ga0207652_10837897 Ga0207652_108378972 92
400 3300025923 Ga0207681_10055802 Ga0207681_100558023 92
401 3300025923 Ga0207681_10958824 Ga0207681_109588242 92
402 3300025923 Ga0207681_11697489 Ga0207681_116974891 92
403 3300025924 Ga0207694_10063948 Ga0207694_100639486 92
404 3300025924 Ga0207694_10343267 Ga0207694_103432672 92
405 3300025924 Ga0207694_10507525 Ga0207694_105075252 92
406 3300025924 Ga0207694_11700437 Ga0207694_117004371 92
407 3300025925 Ga0207650_10934547 Ga0207650_109345472 92
408 3300025926 Ga0207659_10412969 Ga0207659_104129693 92
409 3300025926 Ga0207659_11004091 Ga0207659_110040912 92
410 3300025927 Ga0207687_10096947 Ga0207687_100969473 92
411 3300025927 Ga0207687_11691348 Ga0207687_116913482 92
412 3300025931 Ga0207644_10535143 Ga0207644_105351433 92
413 3300025932 Ga0207690_10615816 Ga0207690_106158162 92
414 3300025932 Ga0207690_10631317 Ga0207690_106313172 92
415 3300025933 Ga0207706_10036082 Ga0207706_100360824 92
416 3300025933 Ga0207706_10150165 Ga0207706_101501653 92
417 3300025934 Ga0207686_10213002 Ga0207686_102130023 92
418 3300025934 Ga0207686_11530481 Ga0207686_115304812 92
419 3300025935 Ga0207709_10097817 Ga0207709_100978173 92
420 3300025935 Ga0207709_10122331 Ga0207709_101223313 92
421 3300025935 Ga0207709_10204763 Ga0207709_102047632 92
422 3300025935 Ga0207709_11009493 Ga0207709_110094931 92
423 3300025935 Ga0207709_11344699 Ga0207709_113446992 92
424 3300025936 Ga0207670_11151847 Ga0207670_111518472 92
425 3300025936 Ga0207670_11295079 Ga0207670_112950792 92
426 3300025937 Ga0207669_10028127 Ga0207669_100281273 92
427 3300025937 Ga0207669_10141941 Ga0207669_101419412 92
428 3300025937 Ga0207669_10383372 Ga0207669_103833722 92
429 3300025937 Ga0207669_10414842 Ga0207669_104148422 92
430 3300025937 Ga0207669_11428380 Ga0207669_114283802 92
431 3300025937 Ga0207669_11652370 Ga0207669_116523702 92
432 3300025938 Ga0207704_10191751 Ga0207704_101917513 92
433 3300025940 Ga0207691_10068902 Ga0207691_100689024 92
434 3300025940 Ga0207691_10125677 Ga0207691_101256773 92
435 3300025941 Ga0207711_10557441 Ga0207711_105574411 92
436 3300025941 Ga0207711_11712006 Ga0207711_117120062 92
437 3300025942 Ga0207689_10089709 Ga0207689_100897093 92
438 3300025942 Ga0207689_10239819 Ga0207689_102398193 92
439 3300025942 Ga0207689_10613256 Ga0207689_106132562 92
440 3300025942 Ga0207689_10854579 Ga0207689_108545792 92
441 3300025944 Ga0207661_10168132 Ga0207661_101681322 92
442 3300025944 Ga0207661_11070446 Ga0207661_110704462 92
443 3300025944 Ga0207661_11837484 Ga0207661_118374842 92
444 3300025945 Ga0207679_10167946 Ga0207679_101679463 92
445 3300025945 Ga0207679_10218784 Ga0207679_102187843 92
446 3300025945 Ga0207679_10445218 Ga0207679_104452182 92
447 3300025945 Ga0207679_11371176 Ga0207679_113711762 92
448 3300025949 Ga0207667_10901174 Ga0207667_109011743 92
449 3300025949 Ga0207667_10913870 Ga0207667_109138702 92
450 3300025949 Ga0207667_11076569 Ga0207667_110765692 92
451 3300025960 Ga0207651_10338271 Ga0207651_103382713 92
452 3300025961 Ga0207712_10023018 Ga0207712_100230183 92
453 3300025961 Ga0207712_10961598 Ga0207712_109615982 92
454 3300025972 Ga0207668_10024309 Ga0207668_100243096 92
455 3300025972 Ga0207668_10063083 Ga0207668_100630833 92
456 3300025972 Ga0207668_10100363 Ga0207668_101003633 92
457 3300025972 Ga0207668_10609292 Ga0207668_106092922 92
458 3300025981 Ga0207640_11282329 Ga0207640_112823292 92
459 3300025981 Ga0207640_11409018 Ga0207640_114090181 92
460 3300025986 Ga0207658_10484723 Ga0207658_104847232 92
461 3300026023 Ga0207677_10127328 Ga0207677_101273283 92
462 3300026023 Ga0207677_10145170 Ga0207677_101451702 92
463 3300026023 Ga0207677_11012158 Ga0207677_110121583 92
464 3300026035 Ga0207703_10949219 Ga0207703_109492192 92
465 3300026041 Ga0207639_10024518 Ga0207639_100245183 92
466 3300026041 Ga0207639_10348575 Ga0207639_103485752 92
467 3300026041 Ga0207639_10432801 Ga0207639_104328012 92
468 3300026041 Ga0207639_10748999 Ga0207639_107489993 92
469 3300026067 Ga0207678_10044918 Ga0207678_100449185 92
470 3300026067 Ga0207678_10183237 Ga0207678_101832371 92
471 3300026067 Ga0207678_10234417 Ga0207678_102344173 92
472 3300026067 Ga0207678_10574323 Ga0207678_105743232 92
473 3300026067 Ga0207678_10763050 Ga0207678_107630502 92
474 3300026067 Ga0207678_10910281 Ga0207678_109102811 92
475 3300026067 Ga0207678_11372633 Ga0207678_113726332 92
476 3300026075 Ga0207708_10001399 Ga0207708_100013995 92
477 3300026075 Ga0207708_10087186 Ga0207708_100871863 92
478 3300026075 Ga0207708_10103918 Ga0207708_101039183 92
479 3300026075 Ga0207708_10251993 Ga0207708_102519932 92
480 3300026075 Ga0207708_10608897 Ga0207708_106088972 92
481 3300026075 Ga0207708_11203057 Ga0207708_112030571 92
482 3300026078 Ga0207702_10052860 Ga0207702_100528603 92
483 3300026078 Ga0207702_10299496 Ga0207702_102994962 92
484 3300026088 Ga0207641_10131630 Ga0207641_101316303 92
485 3300026088 Ga0207641_10164075 Ga0207641_101640752 92
486 3300026088 Ga0207641_11717776 Ga0207641_117177761 92
487 3300026089 Ga0207648_10635847 Ga0207648_106358472 92
488 3300026095 Ga0207676_10003912 Ga0207676_100039123 92
489 3300026095 Ga0207676_10080910 Ga0207676_100809103 92
490 3300026116 Ga0207674_10001143 Ga0207674_100011436 92
491 3300026118 Ga0207675_100041267 Ga0207675_1000412672 92
492 3300026118 Ga0207675_100048221 Ga0207675_1000482215 92
493 3300026118 Ga0207675_100135123 Ga0207675_1001351233 92
494 3300026118 Ga0207675_101488178 Ga0207675_1014881782 92
495 3300026121 Ga0207683_10053612 Ga0207683_100536123 92
496 3300026121 Ga0207683_10168119 Ga0207683_101681192 92
497 3300026121 Ga0207683_10362701 Ga0207683_103627012 92
498 3300026121 Ga0207683_10880818 Ga0207683_108808182 92
499 3300026142 Ga0207698_10319495 Ga0207698_103194953 92
500 3300026142 Ga0207698_11032649 Ga0207698_110326492 92
501 3300027312 Ga0209371_1088252 Ga0209371_10882522 92
502 3300027866 Ga0209813_10013463 Ga0209813_100134633 92
503 3300027866 Ga0209813_10228284 Ga0209813_102282842 92
504 3300028379 Ga0268266_10008617 Ga0268266_1000861712 92
505 3300028379 Ga0268266_10119099 Ga0268266_101190993 92
506 3300028379 Ga0268266_10494045 Ga0268266_104940452 92
507 3300028380 Ga0268265_10000626 Ga0268265_1000062631 92
508 3300028380 Ga0268265_10036784 Ga0268265_100367843 92
509 3300028380 Ga0268265_11065293 Ga0268265_110652932 92
510 3300028380 Ga0268265_11425059 Ga0268265_114250592 92
511 3300028381 Ga0268264_10003320 Ga0268264_100033203 92
512 3300028381 Ga0268264_11778713 Ga0268264_117787132 92
513 3300030500 Ga0268256_1097476 Ga0268256_10974762 92
514 3300031548 Ga0307408_101340466 Ga0307408_1013404662 92
515 3300031731 Ga0307405_10723144 Ga0307405_107231442 92
516 3300031824 Ga0307413_10325848 Ga0307413_103258482 92
517 3300031824 Ga0307413_11901714 Ga0307413_119017142 92
518 3300031852 Ga0307410_10055976 Ga0307410_100559763 92
519 3300031852 Ga0307410_10531599 Ga0307410_105315992 92
520 3300031852 Ga0307410_11210545 Ga0307410_112105452 92
521 3300031901 Ga0307406_10007814 Ga0307406_100078145 92
522 3300031901 Ga0307406_10118690 Ga0307406_101186902 92
523 3300031903 Ga0307407_10265865 Ga0307407_102658652 92
524 3300031903 Ga0307407_10567894 Ga0307407_105678942 92
525 3300031911 Ga0307412_11399774 Ga0307412_113997742 92
526 3300031995 Ga0307409_100003248 Ga0307409_1000032487 92
527 3300031995 Ga0307409_100027346 Ga0307409_1000273464 92
528 3300031995 Ga0307409_101467771 Ga0307409_1014677712 92
529 3300032002 Ga0307416_102331309 Ga0307416_1023313092 92
530 3300032004 Ga0307414_10412783 Ga0307414_104127832 92
531 3300032005 Ga0307411_11945905 Ga0307411_119459052 92
532 3300032126 Ga0307415_100012409 Ga0307415_1000124092 92
533 3300032126 Ga0307415_100071786 Ga0307415_1000717862 92
534 3300032126 Ga0307415_100209505 Ga0307415_1002095052 92
535 3300035241 Ga0373961_0294112 Ga0373961_0294112_129_407 92
536 3300037068 Ga0373925_0135394 Ga0373925_0135394_1026_1304 92
537 3300037312 Ga0395899_0060742 Ga0395899_0060742_1912_2190 92
538 3300037418 Ga0395900_0020727 Ga0395900_0020727_165_443 92
539 3300037418 Ga0395900_0346047 Ga0395900_0346047_344_625 92
540 3300037466 Ga0395898_0003674 Ga0395898_0003674_15940_16218 92
541 3300037471 Ga0395905_0133717 Ga0395905_0133717_1680_1961 92
542 3300037471 Ga0395905_0465636 Ga0395905_0465636_363_644 92
543 3300037471 Ga0395905_1165290 Ga0395905_1165290_307_588 92
544 3300038443 Ga0395901_0270420 Ga0395901_0270420_91_369 92
545 3300038443 Ga0395901_0339236 Ga0395901_0339236_1166_1444 92
546 3300038443 Ga0395901_0854541 Ga0395901_0854541_131_412 92
547 3300038443 Ga0395901_1483482 Ga0395901_1483482_22_300 92
548 3300041441 Ga0451787_007409 Ga0451787_007409_63_344 92
549 3300041443 Ga0451789_0738026 Ga0451789_0738026_321_599 92
550 3300041453 Ga0451797_1299792 Ga0451797_1299792_160_441 92
551 3300041458 Ga0451798_1123436 Ga0451798_1123436_199_477 92
552 3300041486 Ga0451807_0571173 Ga0451807_0571173_186_464 92
553 3300041486 Ga0451807_2155322 Ga0451807_2155322_62_343 92
554 3300041501 Ga0451845_0436157 Ga0451845_0436157_19_300 92
555 3300041509 Ga0451843_1116658 Ga0451843_1116658_217_498 92
556 3300041512 Ga0451853_2901402 Ga0451853_2901402_615_893 92
557 3300042005 Ga0439448_0303566 Ga0439448_0303566_196_474 92
558 3300044683 Ga0466965_0058514 Ga0466965_0058514_1207_1488 92
559 3300044842 Ga0466957_0117044 Ga0466957_0117044_351_629 92
560 3300044901 Ga0466960_0217108 Ga0466960_0217108_332_616 92
561 3300046519 Ga0495632_0364017 Ga0495632_0364017_77_355 92
562 3300048903 Ga0496100_0796125 Ga0496100_0796125_120_398 92
563 3300048903 Ga0496100_1376768 Ga0496100_1376768_146_424 92
564 3300048904 Ga0496101_0109131 Ga0496101_0109131_1463_1741 92
565 3300048905 Ga0496102_0009559 Ga0496102_0009559_1675_1953 92
566 3300048905 Ga0496102_0039333 Ga0496102_0039333_1874_2152 92
567 3300048905 Ga0496102_0251716 Ga0496102_0251716_593_871 92
568 3300048905 Ga0496102_1295703 Ga0496102_1295703_192_470 92
569 3300048905 Ga0496102_1756408 Ga0496102_1756408_235_516 92
570 3300048906 Ga0496103_0036330 Ga0496103_0036330_1653_1931 92
571 3300048906 Ga0496103_0098712 Ga0496103_0098712_458_736 92
572 3300048906 Ga0496103_0161053 Ga0496103_0161053_541_819 92
573 3300048906 Ga0496103_0953668 Ga0496103_0953668_50_328 92
574 3300048907 Ga0496104_0132289 Ga0496104_0132289_1894_2172 92
575 3300048907 Ga0496104_0659058 Ga0496104_0659058_236_514 92
576 3300048907 Ga0496104_1091422 Ga0496104_1091422_403_681 92
577 3300048908 Ga0496105_0052219 Ga0496105_0052219_2169_2447 92
578 3300048909 Ga0496106_0042073 Ga0496106_0042073_2696_2974 92
579 3300048909 Ga0496106_0438092 Ga0496106_0438092_693_971 92
580 3300048909 Ga0496106_0723222 Ga0496106_0723222_175_453 92
581 3300048910 Ga0496107_0011296 Ga0496107_0011296_5362_5640 92
582 3300048910 Ga0496107_0067379 Ga0496107_0067379_1087_1365 92
583 3300048910 Ga0496107_1094858 Ga0496107_1094858_25_303 92
584 3300048911 Ga0496108_0040335 Ga0496108_0040335_2362_2640 92
585 3300048911 Ga0496108_1311453 Ga0496108_1311453_142_420 92
586 3300048912 Ga0496109_0039540 Ga0496109_0039540_3253_3531 92
587 3300048912 Ga0496109_0874317 Ga0496109_0874317_463_741 92
588 3300048912 Ga0496109_1102814 Ga0496109_1102814_56_334 92
589 3300048912 Ga0496109_1790395 Ga0496109_1790395_221_499 92
590 3300048913 Ga0496110_0017647 Ga0496110_0017647_4708_4986 92
591 3300048914 Ga0496111_0307412 Ga0496111_0307412_801_1079 92
592 3300048915 Ga0496112_0016184 Ga0496112_0016184_1703_1981 92
593 3300048917 Ga0496114_0008572 Ga0496114_0008572_5260_5538 92
594 3300048917 Ga0496114_0040997 Ga0496114_0040997_3324_3602 92
595 3300048917 Ga0496114_1256416 Ga0496114_1256416_14_292 92
596 3300048917 Ga0496114_1782755 Ga0496114_1782755_11_289 92
597 3300048918 Ga0496115_0345469 Ga0496115_0345469_52_330 92
598 3300048919 Ga0496116_0000100 Ga0496116_0000100_93259_93540 92
599 3300048919 Ga0496116_0043510 Ga0496116_0043510_378_659 92
600 3300048921 Ga0496118_0059604 Ga0496118_0059604_2235_2516 92
601 3300048922 Ga0496119_0019768 Ga0496119_0019768_397_678 92
602 3300048922 Ga0496119_0585542 Ga0496119_0585542_47_328 92
603 3300048923 Ga0496120_0052116 Ga0496120_0052116_1668_1949 92
604 3300048924 Ga0496121_0000001 Ga0496121_0000001_152997_153278 92
605 3300048924 Ga0496121_0678993 Ga0496121_0678993_294_575 92
606 3300048925 Ga0496122_0003647 Ga0496122_0003647_19501_19794 92
607 3300048925 Ga0496122_0008413 Ga0496122_0008413_1113_1394 92
608 3300048925 Ga0496122_0158319 Ga0496122_0158319_173_454 92
609 3300048925 Ga0496122_0164361 Ga0496122_0164361_802_1083 92
610 3300048925 Ga0496122_0314577 Ga0496122_0314577_257_538 92
611 3300048926 Ga0496123_0000517 Ga0496123_0000517_66591_66884 92
612 3300048926 Ga0496123_0076793 Ga0496123_0076793_1204_1485 92
613 3300048926 Ga0496123_0226076 Ga0496123_0226076_529_810 92
614 3300048927 Ga0496124_0015675 Ga0496124_0015675_2265_2546 92
615 3300048927 Ga0496124_0107810 Ga0496124_0107810_1409_1687 92
616 3300048928 Ga0496125_0000001 Ga0496125_0000001_266442_266723 92
617 3300048928 Ga0496125_0000713 Ga0496125_0000713_42999_43277 92
618 3300048929 Ga0496126_0000094 Ga0496126_0000094_202123_202404 92
619 3300048929 Ga0496126_0561186 Ga0496126_0561186_45_326 92
620 3300048929 Ga0496126_0628342 Ga0496126_0628342_410_688 92
621 3300049568 Ga0501031_0000010 Ga0501031_0000010_87138_87419 92
622 3300049568 Ga0501031_0002408 Ga0501031_0002408_3614_3895 92
623 3300049568 Ga0501031_0006171 Ga0501031_0006171_5684_5962 92
624 3300049568 Ga0501031_0093978 Ga0501031_0093978_74_352 92
625 3300049568 Ga0501031_0121925 Ga0501031_0121925_1265_1549 92
626 3300049569 Ga0501032_0000023 Ga0501032_0000023_59017_59298 92
627 3300049569 Ga0501032_0038787 Ga0501032_0038787_2402_2680 92
628 3300049569 Ga0501032_0082015 Ga0501032_0082015_989_1267 92
629 3300049570 Ga0501033_0000104 Ga0501033_0000104_42208_42489 92
630 3300049570 Ga0501033_0004294 Ga0501033_0004294_6983_7261 92
631 3300049570 Ga0501033_0007428 Ga0501033_0007428_3042_3320 92
632 3300049570 Ga0501033_0214291 Ga0501033_0214291_423_704 92
633 3300049570 Ga0501033_0237615 Ga0501033_0237615_418_702 92
634 3300049570 Ga0501033_0364429 Ga0501033_0364429_622_906 92
635 3300049570 Ga0501033_0434097 Ga0501033_0434097_447_725 92
636 3300049571 Ga0501034_0000116 Ga0501034_0000116_87145_87426 92
637 3300049571 Ga0501034_0073146 Ga0501034_0073146_1621_1899 92
638 3300049571 Ga0501034_0076906 Ga0501034_0076906_918_1196 92
639 3300049571 Ga0501034_0139192 Ga0501034_0139192_783_1061 92
640 3300049571 Ga0501034_0194349 Ga0501034_0194349_520_804 92
641 3300049571 Ga0501034_0208416 Ga0501034_0208416_1389_1670 92
642 3300049571 Ga0501034_0407536 Ga0501034_0407536_351_632 92
643 3300049572 Ga0501036_0000015 Ga0501036_0000015_87145_87426 92
644 3300049572 Ga0501036_0039590 Ga0501036_0039590_3177_3455 92
645 3300049572 Ga0501036_0043249 Ga0501036_0043249_628_912 92
646 3300049572 Ga0501036_0206600 Ga0501036_0206600_75_356 92
647 3300049572 Ga0501036_0522077 Ga0501036_0522077_244_522 92
648 3300049573 Ga0501037_0000023 Ga0501037_0000023_87245_87526 92
649 3300049573 Ga0501037_0004454 Ga0501037_0004454_2243_2521 92
650 3300049573 Ga0501037_0015413 Ga0501037_0015413_3390_3668 92
651 3300049573 Ga0501037_0029303 Ga0501037_0029303_3067_3345 92
652 3300049573 Ga0501037_0349858 Ga0501037_0349858_274_558 92
653 3300049574 Ga0501038_0000025 Ga0501038_0000025_87245_87526 92
654 3300049574 Ga0501038_0023114 Ga0501038_0023114_1404_1682 92
655 3300049574 Ga0501038_0087169 Ga0501038_0087169_218_496 92
656 3300049574 Ga0501038_0095352 Ga0501038_0095352_1920_2198 92
657 3300049574 Ga0501038_0134187 Ga0501038_0134187_913_1194 92
658 3300049574 Ga0501038_0208276 Ga0501038_0208276_962_1240 92
659 3300049575 Ga0501039_0000037 Ga0501039_0000037_87145_87426 92
660 3300049575 Ga0501039_0053240 Ga0501039_0053240_2241_2519 92
661 3300049575 Ga0501039_0266770 Ga0501039_0266770_235_516 92
662 3300049575 Ga0501039_0740038 Ga0501039_0740038_97_375 92
663 3300049576 Ga0501040_0005598 Ga0501040_0005598_7702_7983 92
664 3300049576 Ga0501040_0389412 Ga0501040_0389412_556_840 92
665 3300049577 Ga0501041_0137308 Ga0501041_0137308_164_448 92
666 3300049577 Ga0501041_0260106 Ga0501041_0260106_79_357 92
667 3300049578 Ga0501042_0226930 Ga0501042_0226930_388_672 92
668 3300049578 Ga0501042_0333915 Ga0501042_0333915_568_849 92
669 3300049578 Ga0501042_1124383 Ga0501042_1124383_109_390 92
670 3300049579 Ga0501043_0000070 Ga0501043_0000070_30581_30862 92
671 3300049579 Ga0501043_0017343 Ga0501043_0017343_4562_4840 92
672 3300049579 Ga0501043_0083685 Ga0501043_0083685_989_1267 92
673 3300049579 Ga0501043_0398702 Ga0501043_0398702_421_699 92
674 3300049579 Ga0501043_0414385 Ga0501043_0414385_552_833 92
675 3300049579 Ga0501043_0498715 Ga0501043_0498715_405_686 92
676 3300049579 Ga0501043_0592366 Ga0501043_0592366_321_602 92
677 3300049580 Ga0501046_0039644 Ga0501046_0039644_2054_2335 92
678 3300049580 Ga0501046_0103078 Ga0501046_0103078_705_983 92
679 3300049580 Ga0501046_0116579 Ga0501046_0116579_1205_1486 92
680 3300049580 Ga0501046_0478553 Ga0501046_0478553_18_296 92
681 3300049581 Ga0501047_0001244 Ga0501047_0001244_17500_17781 92
682 3300049581 Ga0501047_0025205 Ga0501047_0025205_2199_2477 92
683 3300049581 Ga0501047_0122146 Ga0501047_0122146_1491_1769 92
684 3300049581 Ga0501047_0284741 Ga0501047_0284741_882_1163 92
685 3300049581 Ga0501047_0452411 Ga0501047_0452411_384_665 92
686 3300049581 Ga0501047_0512479 Ga0501047_0512479_446_724 92
687 3300049582 Ga0501048_1044042 Ga0501048_1044042_10_288 92
688 3300049582 Ga0501048_1079766 Ga0501048_1079766_162_443 92
689 3300049583 Ga0501067_0424955 Ga0501067_0424955_402_680 92
690 3300049584 Ga0501068_0023785 Ga0501068_0023785_468_746 92
691 3300049584 Ga0501068_0528692 Ga0501068_0528692_439_720 92
692 3300049585 Ga0501069_0080090 Ga0501069_0080090_50_331 92
693 3300049586 Ga0501070_0047983 Ga0501070_0047983_275_553 92
694 3300049586 Ga0501070_0073374 Ga0501070_0073374_407_685 92
695 3300049586 Ga0501070_0076324 Ga0501070_0076324_533_814 92
696 3300049586 Ga0501070_0186288 Ga0501070_0186288_1359_1637 92
697 3300049586 Ga0501070_0803663 Ga0501070_0803663_158_439 92
698 3300049586 Ga0501070_1134270 Ga0501070_1134270_190_468 92
699 3300049587 Ga0501071_0031594 Ga0501071_0031594_714_992 92
700 3300049587 Ga0501071_0083056 Ga0501071_0083056_2028_2312 92
701 3300049587 Ga0501071_1196037 Ga0501071_1196037_273_551 92
702 3300049589 Ga0501073_0201448 Ga0501073_0201448_136_414 92
703 3300049590 Ga0501074_0245860 Ga0501074_0245860_570_848 92
704 3300049590 Ga0501074_0394119 Ga0501074_0394119_358_639 92
705 3300049590 Ga0501074_0421783 Ga0501074_0421783_192_473 92
706 3300049590 Ga0501074_0482451 Ga0501074_0482451_548_829 92
707 3300049591 Ga0501075_0243164 Ga0501075_0243164_883_1164 92
708 3300049592 Ga0501076_0093445 Ga0501076_0093445_610_894 92
709 3300049592 Ga0501076_0176205 Ga0501076_0176205_568_846 92
710 3300049593 Ga0501077_0407783 Ga0501077_0407783_429_710 92
711 3300049741 Ga0501079_0183477 Ga0501079_0183477_166_444 92
712 3300049742 Ga0501080_0084392 Ga0501080_0084392_2375_2653 92
713 3300049742 Ga0501080_0110362 Ga0501080_0110362_363_644 92
714 3300049742 Ga0501080_0187004 Ga0501080_0187004_471_749 92
715 3300049742 Ga0501080_0891638 Ga0501080_0891638_398_682 92
716 3300049742 Ga0501080_0985345 Ga0501080_0985345_175_456 92
717 3300049742 Ga0501080_1000669 Ga0501080_1000669_298_576 92
718 3300049742 Ga0501080_1037235 Ga0501080_1037235_114_395 92
719 3300049742 Ga0501080_1212241 Ga0501080_1212241_75_356 92
720 3300049743 Ga0501081_0089620 Ga0501081_0089620_720_998 92
721 3300049743 Ga0501081_0252915 Ga0501081_0252915_462_746 92
722 3300049744 Ga0501083_0347970 Ga0501083_0347970_165_443 92
723 3300049744 Ga0501083_0428470 Ga0501083_0428470_13_291 92
724 3300049744 Ga0501083_0570771 Ga0501083_0570771_67_345 92
725 3300049744 Ga0501083_0847682 Ga0501083_0847682_217_495 92
726 3300049822 Ga0501035_0000074 Ga0501035_0000074_87126_87407 92
727 3300049822 Ga0501035_0008072 Ga0501035_0008072_6383_6661 92
728 3300049822 Ga0501035_0054537 Ga0501035_0054537_1875_2159 92
729 3300049822 Ga0501035_0066879 Ga0501035_0066879_2138_2416 92
730 3300049822 Ga0501035_0230153 Ga0501035_0230153_955_1236 92
731 3300049822 Ga0501035_0265749 Ga0501035_0265749_1093_1371 92
732 3300049823 Ga0501044_0000069 Ga0501044_0000069_38549_38830 92
733 3300049823 Ga0501044_0030874 Ga0501044_0030874_3238_3516 92
734 3300049823 Ga0501044_0099811 Ga0501044_0099811_552_833 92
735 3300049823 Ga0501044_0108035 Ga0501044_0108035_854_1132 92
736 3300049823 Ga0501044_0192500 Ga0501044_0192500_1447_1725 92
737 3300049823 Ga0501044_0202925 Ga0501044_0202925_799_1080 92
738 3300049823 Ga0501044_0509090 Ga0501044_0509090_372_653 92
739 3300049823 Ga0501044_0836155 Ga0501044_0836155_24_305 92
740 3300049823 Ga0501044_0931967 Ga0501044_0931967_421_702 92
741 3300049824 Ga0501045_0103639 Ga0501045_0103639_791_1072 92
742 3300049824 Ga0501045_0164076 Ga0501045_0164076_926_1210 92
743 3300050489 nmdc:mga03683_30478_c1 nmdc:mga03683_30478_c1_46_324 92
744 3300050490 nmdc:mga03n38_157042_c1 nmdc:mga03n38_157042_c1_594_872 92
745 3300050490 nmdc:mga03n38_24061_c1 nmdc:mga03n38_24061_c1_417_695 92
746 3300050491 nmdc:mga00v17_5790_c1 nmdc:mga00v17_5790_c1_4545_4826 92
747 3300050491 nmdc:mga00v17_848936_c1 nmdc:mga00v17_848936_c1_26_358 92
748 3300050492 nmdc:mga0yw44_138138_c1 nmdc:mga0yw44_138138_c1_1140_1418 92
749 3300050492 nmdc:mga0yw44_169194_c1 nmdc:mga0yw44_169194_c1_910_1188 92
750 3300050492 nmdc:mga0yw44_224437_c1 nmdc:mga0yw44_224437_c1_890_1222 92
751 3300050492 nmdc:mga0yw44_4246_c1 nmdc:mga0yw44_4246_c1_2515_2796 92
752 3300050492 nmdc:mga0yw44_583868_c1 nmdc:mga0yw44_583868_c1_195_479 92
753 3300050492 nmdc:mga0yw44_828363_c1 nmdc:mga0yw44_828363_c1_18_296 92
754 3300050493 nmdc:mga0k408_148904_c1 nmdc:mga0k408_148904_c1_848_1126 92
755 3300050494 nmdc:mga06z11_110892_c1 nmdc:mga06z11_110892_c1_219_497 92
756 3300050494 nmdc:mga06z11_341823_c1 nmdc:mga06z11_341823_c1_474_755 92
757 3300050494 nmdc:mga06z11_883595_c1 nmdc:mga06z11_883595_c1_235_513 92
758 3300050494 nmdc:mga06z11_9784_c1 nmdc:mga06z11_9784_c1_3281_3559 92
759 3300050495 nmdc:mga04h51_10906_c1 nmdc:mga04h51_10906_c1_1189_1467 92
760 3300050495 nmdc:mga04h51_259831_c1 nmdc:mga04h51_259831_c1_207_488 92
761 3300050496 nmdc:mga07m45_27801_c2 nmdc:mga07m45_27801_c2_339_617 92
762 3300050496 nmdc:mga07m45_37513_c1 nmdc:mga07m45_37513_c1_1190_1468 92
763 3300050496 nmdc:mga07m45_590160_c1 nmdc:mga07m45_590160_c1_208_489 92
764 3300050496 nmdc:mga07m45_904608_c1 nmdc:mga07m45_904608_c1_56_334 92
765 3300050509 nmdc:mga0qj67_1199774_c1 nmdc:mga0qj67_1199774_c1_171_449 92
766 3300050509 nmdc:mga0qj67_26058_c1 nmdc:mga0qj67_26058_c1_3990_4274 92
767 3300050509 nmdc:mga0qj67_354997_c1 nmdc:mga0qj67_354997_c1_160_438 92
768 3300050510 nmdc:mga06r32_26679_c1 nmdc:mga06r32_26679_c1_1287_1565 92
769 3300050510 nmdc:mga06r32_946660_c1 nmdc:mga06r32_946660_c1_381_659 92
770 3300050516 nmdc:mga0sz30_330859_c1 nmdc:mga0sz30_330859_c1_110_403 92
771 3300050516 nmdc:mga0sz30_80476_c1 nmdc:mga0sz30_80476_c1_559_837 92
772 3300053104 Ga0500556_0000039 Ga0500556_0000039_71945_72226 92
773 3300053111 Ga0500572_020801 Ga0500572_020801_1062_1343 92
774 3300053177 Ga0500636_0000006 Ga0500636_0000006_117228_117509 92
775 3300053177 Ga0500636_0129561 Ga0500636_0129561_544_825 92
776 3300054114 Ga0501084_1246404 Ga0501084_1246404_158_436 92
777 3300060353 Ga0501082_0000006 Ga0501082_0000006_78452_78730 92
778 3300060353 Ga0501082_0080879 Ga0501082_0080879_832_1110 92
779 3300060353 Ga0501082_0385566 Ga0501082_0385566_782_1060 92
780 3300061734 Ga0530510_0062570 Ga0530510_0062570_1947_2231 92
781 3300061734 Ga0530510_1044026 Ga0530510_1044026_195_476 92
782 iso_pu_bacteria 2919450847 2919451995 92
783 iso_pu_bacteria 8001845381 8001849919 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04066

MrpF_PhaF

Multiple resistance and pH regulation protein F (MrpF / PhaF)

52

104

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zme-assembly1.cif.gz_6 cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 2) - membrane arm 0.9605 11 87
7d3u-assembly1.cif.gz_A structure of mrp complex from dietzia sp. dq12-45-1b 0.9565 15 82
6cfw-assembly1.cif.gz_D cryoem structure of a respiratory membrane-bound hydrogenase 0.9465 9 74
7p63-assembly1.cif.gz_J complex i from e. coli, ddm/lmng-purified, under turnover at ph 6, closed state 0.9453 10 87
7zdh-assembly1.cif.gz_J complex i from ovis aries at ph7.4, closed state 0.9408 13 84
ID Description Score Start End Superfamily
af_Q9XK79_1_97_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9515 13 84 1.10.287.3510
5xtdk00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9151 10 80 1.10.287.3510
af_P03901_1_98_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9131 10 89 1.10.287.3510
6g72K00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8907 13 89 1.10.287.3510
4he8K00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8823 12 84 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A350WPA1-F1-model_v4 Cation:proton antiporter 0.9872 1 84 GO:0005886
GO:0015385
AF-A0A4U6R5H1-F1-model_v4 pH regulation protein F 0.9809 7 82 GO:0005886
GO:0015385
AF-A0A6B1G8P7-F1-model_v4 Cation transporter 0.9789 1 83 GO:0005886
GO:0015385
AF-A0A424YWX2-F1-model_v4 Cation:proton antiporter 0.9746 8 84 GO:0005886
GO:0015385
AF-A0A7W1SNR3-F1-model_v4 K+/H+ antiporter subunit F 0.9736 5 78 GO:0005886
GO:0015385

Feature Viewer

pLDDT pTM Quality
88.12 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map