F480680
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 783 | 337 | 758 | 92 |
Family's Representative Sequence
| Representative Sequence | 3300050491|nmdc:mga00v17_848936_c1|nmdc:mga00v17_848936_c1_26_358 |
| Length | 110 |
| Sequence | MGSHHKRAIRAAAAGDIRMSTMLLWSITAAQILLCVSMACAIFRILWGPRAQDRIVGFDCLYVNAMLLLLAFGIRSGSTLYFEAALMVSLLGFVSTVALAKFLLRGEVIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 3 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 4 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 5 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 6 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 7 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 8 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 9 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 10 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 11 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 12 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 13 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 14 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 15 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 16 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 17 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 18 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 19 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 20 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 21 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 22 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 23 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 99 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 100 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 101 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 210 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 214 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 223 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 232 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 233 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 234 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 235 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 236 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 237 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 238 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 239 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 240 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 241 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 242 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 245 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 270 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 271 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 272 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 273 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 274 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 275 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 276 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 277 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 278 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 279 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 310 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 317 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 318 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 319 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 321 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 328 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 329 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 330 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 331 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 332 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 333 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 336 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 337 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.68 |
| Metatranscriptomes | 0.13 |
| Isolates | 3.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.13 |
| Bulb | 0 |
| Endosphere | 6.9 |
| Nodule | 0.51 |
| Rhizoplane | 7.02 |
| Rhizosphere | 78.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10338223 | 3300003322 | Bacteria | 1700 |
| 2 | rootH1_10265339 | 3300003323 | Bacteria | 1967 |
| 3 | rootH1_10398603 | 3300003323 | Bacteria | 1204 |
| 4 | Ga0006562J51391_1006409 | 3300003578 | Bacteria | 5212 |
| 5 | Ga0070658_10003488 | 3300005327 | Bacteria | 12921 |
| 6 | Ga0070658_10165025 | 3300005327 | Bacteria | 1859 |
| 7 | Ga0070658_11344707 | 3300005327 | Bacteria | 620 |
| 8 | Ga0070676_10676252 | 3300005328 | Bacteria | 752 |
| 9 | Ga0070676_11116586 | 3300005328 | Bacteria | 596 |
| 10 | Ga0070676_11125842 | 3300005328 | Bacteria | 594 |
| 11 | Ga0070683_100164491 | 3300005329 | Bacteria | 2105 |
| 12 | Ga0070683_100352283 | 3300005329 | Unclassified | 1402 |
| 13 | Ga0070683_100778266 | 3300005329 | Bacteria | 917 |
| 14 | Ga0070683_101269707 | 3300005329 | Bacteria | 708 |
| 15 | Ga0070670_100159351 | 3300005331 | Bacteria | 1956 |
| 16 | Ga0070670_101666295 | 3300005331 | Bacteria | 587 |
| 17 | Ga0070677_10568362 | 3300005333 | Bacteria | 624 |
| 18 | Ga0068869_100014018 | 3300005334 | Bacteria | 5348 |
| 19 | Ga0068869_100092905 | 3300005334 | Bacteria | 2272 |
| 20 | Ga0068869_100398628 | 3300005334 | Bacteria | 1131 |
| 21 | Ga0068869_100469553 | 3300005334 | Bacteria | 1046 |
| 22 | Ga0070680_100014420 | 3300005336 | Bacteria | 6177 |
| 23 | Ga0070680_100020613 | 3300005336 | Bacteria | 5235 |
| 24 | Ga0070680_100135813 | 3300005336 | Bacteria | 2060 |
| 25 | Ga0070680_100491888 | 3300005336 | Bacteria | 1049 |
| 26 | Ga0070682_100072965 | 3300005337 | Bacteria | 2201 |
| 27 | Ga0068868_101181358 | 3300005338 | Bacteria | 707 |
| 28 | Ga0068868_101457717 | 3300005338 | Bacteria | 640 |
| 29 | Ga0070660_100392741 | 3300005339 | Bacteria | 1146 |
| 30 | Ga0070660_100943870 | 3300005339 | Unclassified | 728 |
| 31 | Ga0070660_100951606 | 3300005339 | Bacteria | 725 |
| 32 | Ga0070689_100830760 | 3300005340 | Bacteria | 814 |
| 33 | Ga0070689_100919737 | 3300005340 | Unclassified | 775 |
| 34 | Ga0070689_101184725 | 3300005340 | Bacteria | 685 |
| 35 | Ga0070691_10289947 | 3300005341 | Bacteria | 890 |
| 36 | Ga0070691_10307286 | 3300005341 | Bacteria | 868 |
| 37 | Ga0070687_100100854 | 3300005343 | Bacteria | 1616 |
| 38 | Ga0070687_100422112 | 3300005343 | Bacteria | 880 |
| 39 | Ga0070661_100010269 | 3300005344 | Bacteria | 6506 |
| 40 | Ga0070692_10022193 | 3300005345 | Bacteria | 3098 |
| 41 | Ga0070692_10371920 | 3300005345 | Bacteria | 894 |
| 42 | Ga0070668_100076893 | 3300005347 | Bacteria | 2608 |
| 43 | Ga0070668_100256201 | 3300005347 | Bacteria | 1454 |
| 44 | Ga0070668_101099378 | 3300005347 | Bacteria | 717 |
| 45 | Ga0070668_101347115 | 3300005347 | Bacteria | 650 |
| 46 | Ga0070668_102052173 | 3300005347 | Bacteria | 528 |
| 47 | Ga0070669_100089827 | 3300005353 | Bacteria | 2302 |
| 48 | Ga0070669_101686263 | 3300005353 | Bacteria | 552 |
| 49 | Ga0070675_100641029 | 3300005354 | Unclassified | 965 |
| 50 | Ga0070671_100359625 | 3300005355 | Bacteria | 1243 |
| 51 | Ga0070671_100942040 | 3300005355 | Bacteria | 755 |
| 52 | Ga0070674_100490005 | 3300005356 | Bacteria | 1022 |
| 53 | Ga0070674_100581297 | 3300005356 | Bacteria | 944 |
| 54 | Ga0070674_100994053 | 3300005356 | Unclassified | 736 |
| 55 | Ga0070673_101641297 | 3300005364 | Bacteria | 608 |
| 56 | Ga0070659_100127702 | 3300005366 | Bacteria | 2063 |
| 57 | Ga0070667_100101024 | 3300005367 | Bacteria | 2491 |
| 58 | Ga0070667_101721521 | 3300005367 | Bacteria | 590 |
| 59 | Ga0070703_10019779 | 3300005406 | Bacteria | 1954 |
| 60 | Ga0070701_10674312 | 3300005438 | Bacteria | 693 |
| 61 | Ga0070705_100000901 | 3300005440 | Bacteria | 16586 |
| 62 | Ga0070705_100124782 | 3300005440 | Bacteria | 1669 |
| 63 | Ga0070700_100001924 | 3300005441 | Bacteria | 10504 |
| 64 | Ga0070700_100417194 | 3300005441 | Bacteria | 1013 |
| 65 | Ga0070700_100500283 | 3300005441 | Bacteria | 935 |
| 66 | Ga0070700_101890338 | 3300005441 | Bacteria | 516 |
| 67 | Ga0070694_100001405 | 3300005444 | Bacteria | 14089 |
| 68 | Ga0070694_100173731 | 3300005444 | Bacteria | 1589 |
| 69 | Ga0070708_100016481 | 3300005445 | Bacteria | 6134 |
| 70 | Ga0070663_100038744 | 3300005455 | Bacteria | 3326 |
| 71 | Ga0070663_100065164 | 3300005455 | Bacteria | 2636 |
| 72 | Ga0070663_100198443 | 3300005455 | Bacteria | 1565 |
| 73 | Ga0070663_100260723 | 3300005455 | Bacteria | 1375 |
| 74 | Ga0070663_100274613 | 3300005455 | Unclassified | 1341 |
| 75 | Ga0070663_100716772 | 3300005455 | Unclassified | 851 |
| 76 | Ga0070663_101582407 | 3300005455 | Bacteria | 584 |
| 77 | Ga0070663_101624389 | 3300005455 | Unclassified | 577 |
| 78 | Ga0070678_100054493 | 3300005456 | Bacteria | 2914 |
| 79 | Ga0070678_100078226 | 3300005456 | Bacteria | 2498 |
| 80 | Ga0070678_100574215 | 3300005456 | Bacteria | 1004 |
| 81 | Ga0070678_100738069 | 3300005456 | Bacteria | 890 |
| 82 | Ga0070678_101125785 | 3300005456 | Bacteria | 726 |
| 83 | Ga0070662_100300943 | 3300005457 | Bacteria | 1303 |
| 84 | Ga0070662_101456942 | 3300005457 | Bacteria | 590 |
| 85 | Ga0070681_10006828 | 3300005458 | Bacteria | 11113 |
| 86 | Ga0070681_10013475 | 3300005458 | Bacteria | 8124 |
| 87 | Ga0070681_10106659 | 3300005458 | Bacteria | 2743 |
| 88 | Ga0070681_10174999 | 3300005458 | Bacteria | 2068 |
| 89 | Ga0070681_10477645 | 3300005458 | Bacteria | 1159 |
| 90 | Ga0070681_10583248 | 3300005458 | Unclassified | 1032 |
| 91 | Ga0070681_10587353 | 3300005458 | Bacteria | 1028 |
| 92 | Ga0068867_100072516 | 3300005459 | Bacteria | 2578 |
| 93 | Ga0068867_101643178 | 3300005459 | Bacteria | 601 |
| 94 | Ga0070685_10416578 | 3300005466 | Unclassified | 934 |
| 95 | Ga0070685_11444812 | 3300005466 | Bacteria | 529 |
| 96 | Ga0070706_100029463 | 3300005467 | Bacteria | 5057 |
| 97 | Ga0070707_100525423 | 3300005468 | Bacteria | 1145 |
| 98 | Ga0070698_100017908 | 3300005471 | Bacteria | 7463 |
| 99 | Ga0070699_100015194 | 3300005518 | Bacteria | 6615 |
| 100 | Ga0070679_100028734 | 3300005530 | Bacteria | 5485 |
| 101 | Ga0070679_100338546 | 3300005530 | Bacteria | 1452 |
| 102 | Ga0070679_100680238 | 3300005530 | Unclassified | 972 |
| 103 | Ga0070679_100918268 | 3300005530 | Unclassified | 819 |
| 104 | Ga0070679_101653465 | 3300005530 | Bacteria | 588 |
| 105 | Ga0070679_101717838 | 3300005530 | Bacteria | 576 |
| 106 | Ga0070684_100189099 | 3300005535 | Bacteria | 1873 |
| 107 | Ga0070684_101079299 | 3300005535 | Bacteria | 754 |
| 108 | Ga0070697_100009532 | 3300005536 | Bacteria | 7588 |
| 109 | Ga0068853_100242692 | 3300005539 | Bacteria | 1652 |
| 110 | Ga0070672_100098034 | 3300005543 | Bacteria | 2374 |
| 111 | Ga0070672_100152234 | 3300005543 | Bacteria | 1914 |
| 112 | Ga0070672_101619603 | 3300005543 | Bacteria | 581 |
| 113 | Ga0070672_101910417 | 3300005543 | Bacteria | 534 |
| 114 | Ga0070686_101345841 | 3300005544 | Bacteria | 598 |
| 115 | Ga0070695_100000158 | 3300005545 | Bacteria | 32227 |
| 116 | Ga0070696_100233450 | 3300005546 | Bacteria | 1385 |
| 117 | Ga0070693_100356129 | 3300005547 | Bacteria | 1003 |
| 118 | Ga0070693_100486276 | 3300005547 | Unclassified | 873 |
| 119 | Ga0070693_100815878 | 3300005547 | Bacteria | 693 |
| 120 | Ga0070693_101005415 | 3300005547 | Bacteria | 631 |
| 121 | Ga0070665_100010765 | 3300005548 | Bacteria | 9253 |
| 122 | Ga0070665_100081964 | 3300005548 | Bacteria | 3231 |
| 123 | Ga0070665_100388894 | 3300005548 | Bacteria | 1402 |
| 124 | Ga0070704_100008256 | 3300005549 | Bacteria | 6233 |
| 125 | Ga0070704_100086648 | 3300005549 | Bacteria | 2322 |
| 126 | Ga0068855_100067522 | 3300005563 | Bacteria | 4165 |
| 127 | Ga0068855_100139229 | 3300005563 | Bacteria | 2768 |
| 128 | Ga0068855_100408200 | 3300005563 | Bacteria | 1487 |
| 129 | Ga0068855_100597169 | 3300005563 | Bacteria | 1191 |
| 130 | Ga0068855_101111531 | 3300005563 | Unclassified | 826 |
| 131 | Ga0068855_101135554 | 3300005563 | Bacteria | 815 |
| 132 | Ga0068855_101216124 | 3300005563 | Bacteria | 783 |
| 133 | Ga0068855_102125797 | 3300005563 | Bacteria | 565 |
| 134 | Ga0070664_100118502 | 3300005564 | Bacteria | 2316 |
| 135 | Ga0070664_100571187 | 3300005564 | Bacteria | 1047 |
| 136 | Ga0070664_101117158 | 3300005564 | Unclassified | 743 |
| 137 | Ga0070664_101540017 | 3300005564 | Unclassified | 629 |
| 138 | Ga0068857_100009560 | 3300005577 | Bacteria | 8420 |
| 139 | Ga0068857_100548081 | 3300005577 | Unclassified | 1089 |
| 140 | Ga0068854_100509208 | 3300005578 | Bacteria | 1015 |
| 141 | Ga0068856_101363028 | 3300005614 | Bacteria | 724 |
| 142 | Ga0070702_100016066 | 3300005615 | Bacteria | 3834 |
| 143 | Ga0070702_101697119 | 3300005615 | Bacteria | 525 |
| 144 | Ga0068852_100392752 | 3300005616 | Bacteria | 1363 |
| 145 | Ga0068852_100681505 | 3300005616 | Bacteria | 1037 |
| 146 | Ga0068852_101875297 | 3300005616 | Bacteria | 622 |
| 147 | Ga0068859_100003502 | 3300005617 | Bacteria | 15988 |
| 148 | Ga0068859_100194379 | 3300005617 | Bacteria | 2113 |
| 149 | Ga0068859_102532578 | 3300005617 | Bacteria | 565 |
| 150 | Ga0068864_100025178 | 3300005618 | Bacteria | 5009 |
| 151 | Ga0068864_100540208 | 3300005618 | Bacteria | 1125 |
| 152 | Ga0068866_10721483 | 3300005718 | Bacteria | 686 |
| 153 | Ga0068866_10845806 | 3300005718 | Bacteria | 639 |
| 154 | Ga0068861_100023390 | 3300005719 | Bacteria | 4456 |
| 155 | Ga0068861_100042905 | 3300005719 | Bacteria | 3392 |
| 156 | Ga0068861_100221668 | 3300005719 | Bacteria | 1599 |
| 157 | Ga0068870_10120828 | 3300005840 | Bacteria | 1509 |
| 158 | Ga0068870_10159334 | 3300005840 | Bacteria | 1337 |
| 159 | Ga0068870_10591421 | 3300005840 | Unclassified | 753 |
| 160 | Ga0068863_100107338 | 3300005841 | Bacteria | 2657 |
| 161 | Ga0068863_100250601 | 3300005841 | Bacteria | 1710 |
| 162 | Ga0068863_100329608 | 3300005841 | Bacteria | 1484 |
| 163 | Ga0068858_100488445 | 3300005842 | Unclassified | 1189 |
| 164 | Ga0068858_102056274 | 3300005842 | Bacteria | 565 |
| 165 | Ga0068860_100001841 | 3300005843 | Bacteria | 22590 |
| 166 | Ga0068860_100080379 | 3300005843 | Bacteria | 3100 |
| 167 | Ga0068862_100002731 | 3300005844 | Bacteria | 15492 |
| 168 | Ga0068862_100017501 | 3300005844 | Bacteria | 5970 |
| 169 | Ga0068862_100296142 | 3300005844 | Bacteria | 1487 |
| 170 | Ga0068862_101976356 | 3300005844 | Unclassified | 594 |
| 171 | Ga0075365_10045106 | 3300006038 | Bacteria | 2891 |
| 172 | Ga0075365_10076577 | 3300006038 | Bacteria | 2259 |
| 173 | Ga0075365_10176951 | 3300006038 | Bacteria | 1491 |
| 174 | Ga0075365_10448618 | 3300006038 | Bacteria | 911 |
| 175 | Ga0075365_10627213 | 3300006038 | Bacteria | 760 |
| 176 | Ga0075363_100114453 | 3300006048 | Bacteria | 1502 |
| 177 | Ga0075363_100474799 | 3300006048 | Bacteria | 741 |
| 178 | Ga0075364_10016127 | 3300006051 | Bacteria | 4644 |
| 179 | Ga0075364_10030113 | 3300006051 | Unclassified | 3483 |
| 180 | Ga0075432_10059355 | 3300006058 | Bacteria | 1360 |
| 181 | Ga0070715_10267802 | 3300006163 | Bacteria | 900 |
| 182 | Ga0075362_10045679 | 3300006177 | Unclassified | 1946 |
| 183 | Ga0075362_10652552 | 3300006177 | Unclassified | 547 |
| 184 | Ga0075367_10030475 | 3300006178 | Bacteria | 3093 |
| 185 | Ga0075367_10098355 | 3300006178 | Unclassified | 1786 |
| 186 | Ga0075367_10933851 | 3300006178 | Unclassified | 553 |
| 187 | Ga0075369_10304711 | 3300006186 | Bacteria | 744 |
| 188 | Ga0075366_10021454 | 3300006195 | Bacteria | 3753 |
| 189 | Ga0075366_11010888 | 3300006195 | Bacteria | 519 |
| 190 | Ga0097621_100330182 | 3300006237 | Unclassified | 1352 |
| 191 | Ga0097621_101146284 | 3300006237 | Bacteria | 731 |
| 192 | Ga0097621_101272882 | 3300006237 | Bacteria | 694 |
| 193 | Ga0075370_10060801 | 3300006353 | Bacteria | 2152 |
| 194 | Ga0075370_10335264 | 3300006353 | Bacteria | 902 |
| 195 | Ga0075370_10476437 | 3300006353 | Bacteria | 752 |
| 196 | Ga0068871_100358514 | 3300006358 | Bacteria | 1291 |
| 197 | Ga0068871_100614064 | 3300006358 | Bacteria | 990 |
| 198 | Ga0068871_100806206 | 3300006358 | Unclassified | 866 |
| 199 | Ga0068871_101692096 | 3300006358 | Bacteria | 600 |
| 200 | Ga0075428_100251939 | 3300006844 | Bacteria | 1903 |
| 201 | Ga0075428_101471530 | 3300006844 | Bacteria | 714 |
| 202 | Ga0075430_100009987 | 3300006846 | Bacteria | 8031 |
| 203 | Ga0075430_100484328 | 3300006846 | Bacteria | 1021 |
| 204 | Ga0075430_101409045 | 3300006846 | Bacteria | 573 |
| 205 | Ga0075431_100856752 | 3300006847 | Bacteria | 880 |
| 206 | Ga0075433_10018253 | 3300006852 | Bacteria | 5826 |
| 207 | Ga0075434_100004344 | 3300006871 | Bacteria | 12753 |
| 208 | Ga0075429_100744713 | 3300006880 | Unclassified | 858 |
| 209 | Ga0068865_100296126 | 3300006881 | Bacteria | 1293 |
| 210 | Ga0068865_100340032 | 3300006881 | Unclassified | 1213 |
| 211 | Ga0097620_100003500 | 3300006931 | Bacteria | 15988 |
| 212 | Ga0097620_100194396 | 3300006931 | Bacteria | 2113 |
| 213 | Ga0097620_102532335 | 3300006931 | Bacteria | 565 |
| 214 | Ga0075435_100198189 | 3300007076 | Unclassified | 1701 |
| 215 | Ga0105244_10260307 | 3300009036 | Unclassified | 807 |
| 216 | Ga0105244_10340994 | 3300009036 | Bacteria | 691 |
| 217 | Ga0105240_10080457 | 3300009093 | Bacteria | 4007 |
| 218 | Ga0105240_11077991 | 3300009093 | Unclassified | 856 |
| 219 | Ga0105240_11867774 | 3300009093 | Bacteria | 625 |
| 220 | Ga0105240_11927442 | 3300009093 | Unclassified | 615 |
| 221 | Ga0111539_10158996 | 3300009094 | Bacteria | 2643 |
| 222 | Ga0111539_11939178 | 3300009094 | Bacteria | 683 |
| 223 | Ga0105245_10067879 | 3300009098 | Bacteria | 3230 |
| 224 | Ga0105245_10703437 | 3300009098 | Bacteria | 1044 |
| 225 | Ga0105245_11771471 | 3300009098 | Bacteria | 670 |
| 226 | Ga0105245_13110375 | 3300009098 | Bacteria | 514 |
| 227 | Ga0105247_10129646 | 3300009101 | Bacteria | 1642 |
| 228 | Ga0105247_10515956 | 3300009101 | Bacteria | 873 |
| 229 | Ga0105243_10056569 | 3300009148 | Bacteria | 3120 |
| 230 | Ga0105243_10204910 | 3300009148 | Bacteria | 1733 |
| 231 | Ga0105243_11520150 | 3300009148 | Bacteria | 694 |
| 232 | Ga0105241_10023704 | 3300009174 | Bacteria | 4553 |
| 233 | Ga0105241_10990175 | 3300009174 | Bacteria | 786 |
| 234 | Ga0105241_11441256 | 3300009174 | Bacteria | 661 |
| 235 | Ga0105242_10205554 | 3300009176 | Bacteria | 1751 |
| 236 | Ga0105242_12505360 | 3300009176 | Unclassified | 564 |
| 237 | Ga0105248_10555022 | 3300009177 | Bacteria | 1296 |
| 238 | Ga0105248_11451535 | 3300009177 | Bacteria | 776 |
| 239 | Ga0105237_10130058 | 3300009545 | Bacteria | 2512 |
| 240 | Ga0105237_11127746 | 3300009545 | Bacteria | 791 |
| 241 | Ga0105237_12454848 | 3300009545 | Bacteria | 532 |
| 242 | Ga0105238_10075653 | 3300009551 | Bacteria | 3358 |
| 243 | Ga0105238_10317910 | 3300009551 | Bacteria | 1542 |
| 244 | Ga0105238_10589408 | 3300009551 | Unclassified | 1119 |
| 245 | Ga0105238_12751765 | 3300009551 | Bacteria | 528 |
| 246 | Ga0105249_10046892 | 3300009553 | Bacteria | 3935 |
| 247 | Ga0105249_10710686 | 3300009553 | Bacteria | 1065 |
| 248 | Ga0105249_11170778 | 3300009553 | Unclassified | 840 |
| 249 | Ga0105035_105373 | 3300009988 | Unclassified | 1038 |
| 250 | Ga0105239_10053150 | 3300010375 | Bacteria | 4444 |
| 251 | Ga0105239_10346368 | 3300010375 | Bacteria | 1677 |
| 252 | Ga0105239_11216887 | 3300010375 | Bacteria | 868 |
| 253 | Ga0105239_12198351 | 3300010375 | Bacteria | 641 |
| 254 | Ga0105239_12536316 | 3300010375 | Unclassified | 598 |
| 255 | Ga0105246_10012864 | 3300011119 | Bacteria | 5234 |
| 256 | Ga0105246_10040416 | 3300011119 | Bacteria | 3147 |
| 257 | Ga0105246_10162168 | 3300011119 | Bacteria | 1704 |
| 258 | Ga0157371_10027723 | 3300013102 | Bacteria | 4106 |
| 259 | Ga0157370_10025664 | 3300013104 | Bacteria | 5830 |
| 260 | Ga0157370_10205779 | 3300013104 | Bacteria | 1825 |
| 261 | Ga0157369_10069466 | 3300013105 | Bacteria | 3784 |
| 262 | Ga0157369_10148213 | 3300013105 | Bacteria | 2481 |
| 263 | Ga0157369_12121682 | 3300013105 | Bacteria | 570 |
| 264 | Ga0157374_12211206 | 3300013296 | Bacteria | 577 |
| 265 | Ga0157378_10099522 | 3300013297 | Bacteria | 2653 |
| 266 | Ga0157378_12670550 | 3300013297 | Bacteria | 552 |
| 267 | Ga0163162_10214861 | 3300013306 | Bacteria | 2053 |
| 268 | Ga0163162_10354739 | 3300013306 | Bacteria | 1599 |
| 269 | Ga0163162_10528127 | 3300013306 | Bacteria | 1309 |
| 270 | Ga0157372_10051543 | 3300013307 | Bacteria | 4581 |
| 271 | Ga0157372_10729895 | 3300013307 | Bacteria | 1152 |
| 272 | Ga0157375_10306008 | 3300013308 | Unclassified | 1753 |
| 273 | Ga0157375_10565070 | 3300013308 | Bacteria | 1298 |
| 274 | Ga0157375_11999221 | 3300013308 | Bacteria | 689 |
| 275 | Ga0157375_12313859 | 3300013308 | Bacteria | 641 |
| 276 | Ga0157375_13330215 | 3300013308 | Bacteria | 535 |
| 277 | Ga0163163_10051486 | 3300014325 | Bacteria | 4060 |
| 278 | Ga0163163_12341025 | 3300014325 | Unclassified | 593 |
| 279 | Ga0157380_10059377 | 3300014326 | Bacteria | 3052 |
| 280 | Ga0157380_10144692 | 3300014326 | Bacteria | 2047 |
| 281 | Ga0157380_10238703 | 3300014326 | Bacteria | 1637 |
| 282 | Ga0157380_10888827 | 3300014326 | Bacteria | 916 |
| 283 | Ga0157380_11899401 | 3300014326 | Bacteria | 656 |
| 284 | Ga0182008_10278474 | 3300014497 | Bacteria | 870 |
| 285 | Ga0157377_10640670 | 3300014745 | Bacteria | 763 |
| 286 | Ga0157376_10222379 | 3300014969 | Bacteria | 1749 |
| 287 | Ga0157376_11054875 | 3300014969 | Bacteria | 837 |
| 288 | Ga0157376_12607770 | 3300014969 | Unclassified | 545 |
| 289 | Ga0163161_10170332 | 3300017792 | Bacteria | 1665 |
| 290 | Ga0207653_10102885 | 3300025885 | Bacteria | 1012 |
| 291 | Ga0207682_10264184 | 3300025893 | Bacteria | 803 |
| 292 | Ga0207642_11064305 | 3300025899 | Unclassified | 522 |
| 293 | Ga0207710_10679884 | 3300025900 | Bacteria | 540 |
| 294 | Ga0207688_10030603 | 3300025901 | Bacteria | 2969 |
| 295 | Ga0207688_10270634 | 3300025901 | Bacteria | 1033 |
| 296 | Ga0207647_10567915 | 3300025904 | Bacteria | 628 |
| 297 | Ga0207643_10015598 | 3300025908 | Bacteria | 4136 |
| 298 | Ga0207643_10094685 | 3300025908 | Bacteria | 1745 |
| 299 | Ga0207643_10383986 | 3300025908 | Bacteria | 886 |
| 300 | Ga0207705_10033509 | 3300025909 | Bacteria | 3670 |
| 301 | Ga0207654_10048191 | 3300025911 | Bacteria | 2437 |
| 302 | Ga0207654_11433403 | 3300025911 | Bacteria | 504 |
| 303 | Ga0207707_10000582 | 3300025912 | Bacteria | 37091 |
| 304 | Ga0207707_10030337 | 3300025912 | Bacteria | 4730 |
| 305 | Ga0207707_10104342 | 3300025912 | Bacteria | 2477 |
| 306 | Ga0207707_10141199 | 3300025912 | Bacteria | 2106 |
| 307 | Ga0207707_10191415 | 3300025912 | Bacteria | 1785 |
| 308 | Ga0207707_10323175 | 3300025912 | Bacteria | 1332 |
| 309 | Ga0207707_10371165 | 3300025912 | Unclassified | 1231 |
| 310 | Ga0207707_10990929 | 3300025912 | Bacteria | 690 |
| 311 | Ga0207707_11009592 | 3300025912 | Unclassified | 682 |
| 312 | Ga0207660_10012873 | 3300025917 | Bacteria | 5477 |
| 313 | Ga0207660_10015931 | 3300025917 | Bacteria | 4970 |
| 314 | Ga0207660_10064435 | 3300025917 | Bacteria | 2645 |
| 315 | Ga0207660_10510124 | 3300025917 | Bacteria | 976 |
| 316 | Ga0207660_11316053 | 3300025917 | Bacteria | 587 |
| 317 | Ga0207662_10116595 | 3300025918 | Bacteria | 1670 |
| 318 | Ga0207657_10021633 | 3300025919 | Bacteria | 6046 |
| 319 | Ga0207657_10135285 | 3300025919 | Bacteria | 2017 |
| 320 | Ga0207657_10644674 | 3300025919 | Unclassified | 825 |
| 321 | Ga0207657_10682167 | 3300025919 | Bacteria | 799 |
| 322 | Ga0207652_10004959 | 3300025921 | Bacteria | 10782 |
| 323 | Ga0207652_10837897 | 3300025921 | Unclassified | 815 |
| 324 | Ga0207681_10055802 | 3300025923 | Bacteria | 2693 |
| 325 | Ga0207681_10958824 | 3300025923 | Bacteria | 717 |
| 326 | Ga0207681_11697489 | 3300025923 | Bacteria | 528 |
| 327 | Ga0207694_10063948 | 3300025924 | Bacteria | 2867 |
| 328 | Ga0207694_10343267 | 3300025924 | Unclassified | 1235 |
| 329 | Ga0207694_10507525 | 3300025924 | Bacteria | 1010 |
| 330 | Ga0207694_11700437 | 3300025924 | Bacteria | 531 |
| 331 | Ga0207650_10934547 | 3300025925 | Bacteria | 737 |
| 332 | Ga0207659_10412969 | 3300025926 | Bacteria | 1131 |
| 333 | Ga0207659_11004091 | 3300025926 | Bacteria | 718 |
| 334 | Ga0207687_10096947 | 3300025927 | Bacteria | 2162 |
| 335 | Ga0207687_11691348 | 3300025927 | Bacteria | 542 |
| 336 | Ga0207644_10535143 | 3300025931 | Bacteria | 969 |
| 337 | Ga0207690_10615816 | 3300025932 | Bacteria | 887 |
| 338 | Ga0207690_10631317 | 3300025932 | Bacteria | 876 |
| 339 | Ga0207706_10036082 | 3300025933 | Bacteria | 4393 |
| 340 | Ga0207706_10150165 | 3300025933 | Bacteria | 2049 |
| 341 | Ga0207686_10213002 | 3300025934 | Bacteria | 1390 |
| 342 | Ga0207686_11530481 | 3300025934 | Bacteria | 550 |
| 343 | Ga0207709_10097817 | 3300025935 | Bacteria | 1934 |
| 344 | Ga0207709_10122331 | 3300025935 | Bacteria | 1759 |
| 345 | Ga0207709_10204763 | 3300025935 | Bacteria | 1412 |
| 346 | Ga0207709_11009493 | 3300025935 | Bacteria | 680 |
| 347 | Ga0207709_11344699 | 3300025935 | Bacteria | 591 |
| 348 | Ga0207670_11151847 | 3300025936 | Unclassified | 656 |
| 349 | Ga0207670_11295079 | 3300025936 | Bacteria | 618 |
| 350 | Ga0207669_10028127 | 3300025937 | Bacteria | 3089 |
| 351 | Ga0207669_10141941 | 3300025937 | Bacteria | 1669 |
| 352 | Ga0207669_10383372 | 3300025937 | Bacteria | 1096 |
| 353 | Ga0207669_10414842 | 3300025937 | Bacteria | 1058 |
| 354 | Ga0207669_11428380 | 3300025937 | Bacteria | 589 |
| 355 | Ga0207669_11652370 | 3300025937 | Bacteria | 547 |
| 356 | Ga0207704_10191751 | 3300025938 | Bacteria | 1487 |
| 357 | Ga0207691_10068902 | 3300025940 | Bacteria | 3196 |
| 358 | Ga0207691_10125677 | 3300025940 | Bacteria | 2270 |
| 359 | Ga0207711_10557441 | 3300025941 | Bacteria | 1069 |
| 360 | Ga0207711_11712006 | 3300025941 | Bacteria | 572 |
| 361 | Ga0207689_10089709 | 3300025942 | Bacteria | 2525 |
| 362 | Ga0207689_10239819 | 3300025942 | Bacteria | 1499 |
| 363 | Ga0207689_10613256 | 3300025942 | Bacteria | 916 |
| 364 | Ga0207689_10854579 | 3300025942 | Bacteria | 768 |
| 365 | Ga0207661_10168132 | 3300025944 | Bacteria | 1907 |
| 366 | Ga0207661_11070446 | 3300025944 | Bacteria | 743 |
| 367 | Ga0207661_11837484 | 3300025944 | Unclassified | 551 |
| 368 | Ga0207679_10167946 | 3300025945 | Bacteria | 1803 |
| 369 | Ga0207679_10218784 | 3300025945 | Bacteria | 1601 |
| 370 | Ga0207679_10445218 | 3300025945 | Bacteria | 1148 |
| 371 | Ga0207679_11371176 | 3300025945 | Unclassified | 649 |
| 372 | Ga0207667_10901174 | 3300025949 | Unclassified | 876 |
| 373 | Ga0207667_10913870 | 3300025949 | Bacteria | 869 |
| 374 | Ga0207667_11076569 | 3300025949 | Bacteria | 788 |
| 375 | Ga0207651_10338271 | 3300025960 | Bacteria | 1264 |
| 376 | Ga0207712_10023018 | 3300025961 | Bacteria | 4108 |
| 377 | Ga0207712_10961598 | 3300025961 | Unclassified | 757 |
| 378 | Ga0207668_10024309 | 3300025972 | Bacteria | 3908 |
| 379 | Ga0207668_10063083 | 3300025972 | Bacteria | 2613 |
| 380 | Ga0207668_10100363 | 3300025972 | Bacteria | 2149 |
| 381 | Ga0207668_10609292 | 3300025972 | Bacteria | 952 |
| 382 | Ga0207640_11282329 | 3300025981 | Bacteria | 653 |
| 383 | Ga0207640_11409018 | 3300025981 | Bacteria | 624 |
| 384 | Ga0207658_10484723 | 3300025986 | Bacteria | 1099 |
| 385 | Ga0207677_10127328 | 3300026023 | Bacteria | 1927 |
| 386 | Ga0207677_10145170 | 3300026023 | Bacteria | 1822 |
| 387 | Ga0207677_11012158 | 3300026023 | Bacteria | 754 |
| 388 | Ga0207703_10949219 | 3300026035 | Bacteria | 824 |
| 389 | Ga0207639_10024518 | 3300026041 | Bacteria | 4366 |
| 390 | Ga0207639_10348575 | 3300026041 | Bacteria | 1322 |
| 391 | Ga0207639_10432801 | 3300026041 | Bacteria | 1191 |
| 392 | Ga0207639_10748999 | 3300026041 | Bacteria | 908 |
| 393 | Ga0207678_10044918 | 3300026067 | Bacteria | 3821 |
| 394 | Ga0207678_10183237 | 3300026067 | Bacteria | 1788 |
| 395 | Ga0207678_10234417 | 3300026067 | Bacteria | 1572 |
| 396 | Ga0207678_10574323 | 3300026067 | Bacteria | 987 |
| 397 | Ga0207678_10763050 | 3300026067 | Bacteria | 853 |
| 398 | Ga0207678_10910281 | 3300026067 | Unclassified | 778 |
| 399 | Ga0207678_11372633 | 3300026067 | Bacteria | 625 |
| 400 | Ga0207708_10001399 | 3300026075 | Bacteria | 18108 |
| 401 | Ga0207708_10087186 | 3300026075 | Bacteria | 2403 |
| 402 | Ga0207708_10103918 | 3300026075 | Bacteria | 2201 |
| 403 | Ga0207708_10251993 | 3300026075 | Bacteria | 1423 |
| 404 | Ga0207708_10608897 | 3300026075 | Bacteria | 926 |
| 405 | Ga0207708_11203057 | 3300026075 | Bacteria | 662 |
| 406 | Ga0207702_10052860 | 3300026078 | Bacteria | 3439 |
| 407 | Ga0207702_10299496 | 3300026078 | Bacteria | 1526 |
| 408 | Ga0207641_10131630 | 3300026088 | Bacteria | 2247 |
| 409 | Ga0207641_10164075 | 3300026088 | Bacteria | 2022 |
| 410 | Ga0207641_11717776 | 3300026088 | Bacteria | 630 |
| 411 | Ga0207648_10635847 | 3300026089 | Bacteria | 985 |
| 412 | Ga0207676_10003912 | 3300026095 | Bacteria | 10515 |
| 413 | Ga0207676_10080910 | 3300026095 | Bacteria | 2638 |
| 414 | Ga0207674_10001143 | 3300026116 | Bacteria | 34428 |
| 415 | Ga0207675_100041267 | 3300026118 | Bacteria | 4309 |
| 416 | Ga0207675_100048221 | 3300026118 | Bacteria | 3977 |
| 417 | Ga0207675_100135123 | 3300026118 | Unclassified | 2339 |
| 418 | Ga0207675_101488178 | 3300026118 | Unclassified | 698 |
| 419 | Ga0207683_10053612 | 3300026121 | Bacteria | 3537 |
| 420 | Ga0207683_10168119 | 3300026121 | Bacteria | 1985 |
| 421 | Ga0207683_10362701 | 3300026121 | Bacteria | 1331 |
| 422 | Ga0207683_10880818 | 3300026121 | Bacteria | 831 |
| 423 | Ga0207698_10319495 | 3300026142 | Bacteria | 1453 |
| 424 | Ga0207698_11032649 | 3300026142 | Bacteria | 833 |
| 425 | Ga0209371_1088252 | 3300027312 | Bacteria | 526 |
| 426 | Ga0209813_10013463 | 3300027866 | Unclassified | 2184 |
| 427 | Ga0209813_10228284 | 3300027866 | Bacteria | 699 |
| 428 | Ga0268266_10008617 | 3300028379 | Bacteria | 9057 |
| 429 | Ga0268266_10119099 | 3300028379 | Bacteria | 2348 |
| 430 | Ga0268266_10494045 | 3300028379 | Bacteria | 1168 |
| 431 | Ga0268265_10000626 | 3300028380 | Bacteria | 35203 |
| 432 | Ga0268265_10036784 | 3300028380 | Bacteria | 3588 |
| 433 | Ga0268265_11065293 | 3300028380 | Bacteria | 801 |
| 434 | Ga0268265_11425059 | 3300028380 | Bacteria | 695 |
| 435 | Ga0268264_10003320 | 3300028381 | Bacteria | 13903 |
| 436 | Ga0268264_11778713 | 3300028381 | Bacteria | 626 |
| 437 | Ga0268256_1097476 | 3300030500 | Bacteria | 526 |
| 438 | Ga0307408_101340466 | 3300031548 | Bacteria | 672 |
| 439 | Ga0307405_10723144 | 3300031731 | Bacteria | 827 |
| 440 | Ga0307413_10325848 | 3300031824 | Bacteria | 1175 |
| 441 | Ga0307413_11901714 | 3300031824 | Bacteria | 534 |
| 442 | Ga0307410_10055976 | 3300031852 | Bacteria | 2680 |
| 443 | Ga0307410_10531599 | 3300031852 | Bacteria | 972 |
| 444 | Ga0307410_11210545 | 3300031852 | Bacteria | 658 |
| 445 | Ga0307406_10007814 | 3300031901 | Bacteria | 5949 |
| 446 | Ga0307406_10118690 | 3300031901 | Bacteria | 1835 |
| 447 | Ga0307407_10265865 | 3300031903 | Bacteria | 1182 |
| 448 | Ga0307407_10567894 | 3300031903 | Bacteria | 841 |
| 449 | Ga0307412_11399774 | 3300031911 | Bacteria | 633 |
| 450 | Ga0307409_100003248 | 3300031995 | Bacteria | 8767 |
| 451 | Ga0307409_100027346 | 3300031995 | Bacteria | 4040 |
| 452 | Ga0307409_101467771 | 3300031995 | Bacteria | 709 |
| 453 | Ga0307416_102331309 | 3300032002 | Bacteria | 635 |
| 454 | Ga0307414_10412783 | 3300032004 | Bacteria | 1175 |
| 455 | Ga0307411_11457571 | 3300032005 | Bacteria | 628 |
| 456 | Ga0307411_11945905 | 3300032005 | Bacteria | 548 |
| 457 | Ga0307415_100012409 | 3300032126 | Bacteria | 4926 |
| 458 | Ga0307415_100071786 | 3300032126 | Bacteria | 2436 |
| 459 | Ga0307415_100209505 | 3300032126 | Bacteria | 1554 |
| 460 | Ga0373936_0360103 | 3300035113 | Bacteria | 663 |
| 461 | Ga0373939_0455072 | 3300035114 | Unclassified | 539 |
| 462 | Ga0373941_0168862 | 3300035115 | Unclassified | 814 |
| 463 | Ga0373961_0012192 | 3300035241 | Bacteria | 2147 |
| 464 | Ga0373961_0294112 | 3300035241 | Bacteria | 599 |
| 465 | Ga0373931_0000324 | 3300035691 | Bacteria | 20133 |
| 466 | Ga0373925_0135394 | 3300037068 | Bacteria | 1925 |
| 467 | Ga0395899_0060742 | 3300037312 | Bacteria | 2784 |
| 468 | Ga0395900_0020727 | 3300037418 | Bacteria | 6718 |
| 469 | Ga0395900_0346047 | 3300037418 | Bacteria | 1461 |
| 470 | Ga0395898_0003674 | 3300037466 | Bacteria | 17038 |
| 471 | Ga0395905_0133717 | 3300037471 | Bacteria | 2333 |
| 472 | Ga0395905_0465636 | 3300037471 | Bacteria | 1163 |
| 473 | Ga0395905_1165290 | 3300037471 | Bacteria | 674 |
| 474 | Ga0395901_0270420 | 3300038443 | Bacteria | 1768 |
| 475 | Ga0395901_0339236 | 3300038443 | Bacteria | 1553 |
| 476 | Ga0395901_0854541 | 3300038443 | Bacteria | 895 |
| 477 | Ga0395901_1483482 | 3300038443 | Bacteria | 634 |
| 478 | Ga0451787_007409 | 3300041441 | Bacteria | 567 |
| 479 | Ga0451789_0738026 | 3300041443 | Bacteria | 627 |
| 480 | Ga0451789_0923876 | 3300041443 | Bacteria | 599 |
| 481 | Ga0451793_1234692 | 3300041452 | Bacteria | 1329 |
| 482 | Ga0451797_1299792 | 3300041453 | Bacteria | 501 |
| 483 | Ga0451795_0299550 | 3300041456 | Bacteria | 559 |
| 484 | Ga0451798_1123436 | 3300041458 | Unclassified | 517 |
| 485 | Ga0451802_2128099 | 3300041460 | Bacteria | 708 |
| 486 | Ga0451807_0571173 | 3300041486 | Bacteria | 635 |
| 487 | Ga0451807_1294539 | 3300041486 | Bacteria | 589 |
| 488 | Ga0451807_1494924 | 3300041486 | Bacteria | 607 |
| 489 | Ga0451807_2155322 | 3300041486 | Bacteria | 503 |
| 490 | Ga0451807_2693519 | 3300041486 | Unclassified | 814 |
| 491 | Ga0451833_0416748 | 3300041491 | Bacteria | 557 |
| 492 | Ga0451837_0650742 | 3300041494 | Bacteria | 622 |
| 493 | Ga0451841_1348048 | 3300041498 | Unclassified | 648 |
| 494 | Ga0451845_0436157 | 3300041501 | Bacteria | 651 |
| 495 | Ga0451843_1116658 | 3300041509 | Bacteria | 713 |
| 496 | Ga0451853_2901402 | 3300041512 | Bacteria | 1043 |
| 497 | Ga0439448_0303566 | 3300042005 | Bacteria | 567 |
| 498 | Ga0439432_243951 | 3300042006 | Bacteria | 516 |
| 499 | Ga0450894_015381 | 3300042131 | Bacteria | 1013 |
| 500 | Ga0439446_0024012 | 3300042156 | Bacteria | 1737 |
| 501 | Ga0439434_0360652 | 3300042435 | Bacteria | 508 |
| 502 | Ga0453683_0379638 | 3300044673 | Bacteria | 910 |
| 503 | Ga0466965_0058514 | 3300044683 | Bacteria | 1922 |
| 504 | Ga0466957_0117044 | 3300044842 | Bacteria | 1696 |
| 505 | Ga0466960_0217108 | 3300044901 | Bacteria | 1051 |
| 506 | Ga0466967_0036885 | 3300045976 | Bacteria | 4178 |
| 507 | Ga0495629_0217343 | 3300046459 | Bacteria | 1319 |
| 508 | Ga0495632_0364017 | 3300046519 | Bacteria | 635 |
| 509 | Ga0495587_0568915 | 3300046536 | Bacteria | 625 |
| 510 | Ga0495635_0548676 | 3300046663 | Bacteria | 758 |
| 511 | Ga0495600_0699478 | 3300046809 | Bacteria | 610 |
| 512 | Ga0495581_0363512 | 3300047315 | Bacteria | 845 |
| 513 | Ga0495604_0426369 | 3300047317 | Bacteria | 870 |
| 514 | Ga0496100_0796125 | 3300048903 | Bacteria | 740 |
| 515 | Ga0496100_1376768 | 3300048903 | Bacteria | 557 |
| 516 | Ga0496101_0109131 | 3300048904 | Bacteria | 2081 |
| 517 | Ga0496101_0291161 | 3300048904 | Bacteria | 1278 |
| 518 | Ga0496102_0009559 | 3300048905 | Bacteria | 8340 |
| 519 | Ga0496102_0039333 | 3300048905 | Bacteria | 4273 |
| 520 | Ga0496102_0251716 | 3300048905 | Bacteria | 1666 |
| 521 | Ga0496102_0848433 | 3300048905 | Bacteria | 836 |
| 522 | Ga0496102_1295703 | 3300048905 | Unclassified | 648 |
| 523 | Ga0496102_1756408 | 3300048905 | Bacteria | 538 |
| 524 | Ga0496103_0036330 | 3300048906 | Bacteria | 3017 |
| 525 | Ga0496103_0098712 | 3300048906 | Unclassified | 1847 |
| 526 | Ga0496103_0161053 | 3300048906 | Bacteria | 1439 |
| 527 | Ga0496103_0953668 | 3300048906 | Bacteria | 536 |
| 528 | Ga0496104_0132289 | 3300048907 | Bacteria | 2396 |
| 529 | Ga0496104_0659058 | 3300048907 | Bacteria | 955 |
| 530 | Ga0496104_1091422 | 3300048907 | Bacteria | 702 |
| 531 | Ga0496105_0052219 | 3300048908 | Bacteria | 3376 |
| 532 | Ga0496105_0121824 | 3300048908 | Bacteria | 2151 |
| 533 | Ga0496106_0042073 | 3300048909 | Bacteria | 3425 |
| 534 | Ga0496106_0438092 | 3300048909 | Bacteria | 1050 |
| 535 | Ga0496106_0723222 | 3300048909 | Bacteria | 793 |
| 536 | Ga0496107_0011296 | 3300048910 | Bacteria | 6217 |
| 537 | Ga0496107_0067379 | 3300048910 | Bacteria | 2597 |
| 538 | Ga0496107_1094858 | 3300048910 | Bacteria | 576 |
| 539 | Ga0496108_0040335 | 3300048911 | Bacteria | 3891 |
| 540 | Ga0496108_1311453 | 3300048911 | Unclassified | 608 |
| 541 | Ga0496109_0039540 | 3300048912 | Bacteria | 4269 |
| 542 | Ga0496109_0336834 | 3300048912 | Bacteria | 1425 |
| 543 | Ga0496109_0874317 | 3300048912 | Bacteria | 837 |
| 544 | Ga0496109_1102814 | 3300048912 | Bacteria | 731 |
| 545 | Ga0496109_1790395 | 3300048912 | Bacteria | 547 |
| 546 | Ga0496110_0017647 | 3300048913 | Bacteria | 5967 |
| 547 | Ga0496111_0307412 | 3300048914 | Bacteria | 1175 |
| 548 | Ga0496112_0015803 | 3300048915 | Bacteria | 7052 |
| 549 | Ga0496112_0016184 | 3300048915 | Bacteria | 6978 |
| 550 | Ga0496114_0008572 | 3300048917 | Bacteria | 8102 |
| 551 | Ga0496114_0040997 | 3300048917 | Bacteria | 3836 |
| 552 | Ga0496114_1256416 | 3300048917 | Bacteria | 627 |
| 553 | Ga0496114_1782755 | 3300048917 | Bacteria | 504 |
| 554 | Ga0496115_0345469 | 3300048918 | Bacteria | 1214 |
| 555 | Ga0496115_0549615 | 3300048918 | Bacteria | 923 |
| 556 | Ga0496116_0000100 | 3300048919 | Bacteria | 194740 |
| 557 | Ga0496116_0043510 | 3300048919 | Bacteria | 3058 |
| 558 | Ga0496118_0059604 | 3300048921 | Bacteria | 2840 |
| 559 | Ga0496119_0019768 | 3300048922 | Bacteria | 4940 |
| 560 | Ga0496119_0585542 | 3300048922 | Bacteria | 509 |
| 561 | Ga0496120_0052116 | 3300048923 | Bacteria | 2332 |
| 562 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 563 | Ga0496121_0358017 | 3300048924 | Bacteria | 970 |
| 564 | Ga0496121_0678993 | 3300048924 | Bacteria | 623 |
| 565 | Ga0496122_0003647 | 3300048925 | Bacteria | 20021 |
| 566 | Ga0496122_0008413 | 3300048925 | Bacteria | 11146 |
| 567 | Ga0496122_0158319 | 3300048925 | Bacteria | 1385 |
| 568 | Ga0496122_0164361 | 3300048925 | Bacteria | 1348 |
| 569 | Ga0496122_0314577 | 3300048925 | Bacteria | 836 |
| 570 | Ga0496123_0000517 | 3300048926 | Bacteria | 67322 |
| 571 | Ga0496123_0076793 | 3300048926 | Bacteria | 2054 |
| 572 | Ga0496123_0226076 | 3300048926 | Bacteria | 940 |
| 573 | Ga0496124_0015675 | 3300048927 | Bacteria | 7250 |
| 574 | Ga0496124_0107810 | 3300048927 | Bacteria | 2247 |
| 575 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 576 | Ga0496125_0000713 | 3300048928 | Bacteria | 54953 |
| 577 | Ga0496126_0000094 | 3300048929 | Bacteria | 208184 |
| 578 | Ga0496126_0561186 | 3300048929 | Bacteria | 904 |
| 579 | Ga0496126_0628342 | 3300048929 | Bacteria | 843 |
| 580 | Ga0501300_023806 | 3300049523 | Bacteria | 896 |
| 581 | Ga0501031_0000010 | 3300049568 | Bacteria | 146435 |
| 582 | Ga0501031_0002408 | 3300049568 | Bacteria | 11893 |
| 583 | Ga0501031_0006171 | 3300049568 | Bacteria | 7824 |
| 584 | Ga0501031_0093978 | 3300049568 | Bacteria | 1957 |
| 585 | Ga0501031_0121925 | 3300049568 | Bacteria | 1703 |
| 586 | Ga0501032_0000023 | 3300049569 | Bacteria | 146435 |
| 587 | Ga0501032_0038284 | 3300049569 | Bacteria | 3267 |
| 588 | Ga0501032_0038787 | 3300049569 | Bacteria | 3242 |
| 589 | Ga0501032_0082015 | 3300049569 | Bacteria | 2146 |
| 590 | Ga0501033_0000104 | 3300049570 | Bacteria | 81029 |
| 591 | Ga0501033_0004294 | 3300049570 | Bacteria | 11449 |
| 592 | Ga0501033_0007428 | 3300049570 | Bacteria | 8537 |
| 593 | Ga0501033_0214291 | 3300049570 | Bacteria | 1373 |
| 594 | Ga0501033_0237615 | 3300049570 | Bacteria | 1293 |
| 595 | Ga0501033_0364429 | 3300049570 | Bacteria | 1011 |
| 596 | Ga0501033_0434097 | 3300049570 | Bacteria | 914 |
| 597 | Ga0501034_0000116 | 3300049571 | Bacteria | 146442 |
| 598 | Ga0501034_0073146 | 3300049571 | Bacteria | 3436 |
| 599 | Ga0501034_0076906 | 3300049571 | Bacteria | 3344 |
| 600 | Ga0501034_0139192 | 3300049571 | Bacteria | 2407 |
| 601 | Ga0501034_0194349 | 3300049571 | Bacteria | 1990 |
| 602 | Ga0501034_0204182 | 3300049571 | Bacteria | 1933 |
| 603 | Ga0501034_0208416 | 3300049571 | Bacteria | 1910 |
| 604 | Ga0501034_0407536 | 3300049571 | Bacteria | 1282 |
| 605 | Ga0501036_0000015 | 3300049572 | Bacteria | 146442 |
| 606 | Ga0501036_0039590 | 3300049572 | Bacteria | 3988 |
| 607 | Ga0501036_0043249 | 3300049572 | Bacteria | 3814 |
| 608 | Ga0501036_0206600 | 3300049572 | Bacteria | 1651 |
| 609 | Ga0501036_0522077 | 3300049572 | Bacteria | 987 |
| 610 | Ga0501037_0000023 | 3300049573 | Bacteria | 146542 |
| 611 | Ga0501037_0004454 | 3300049573 | Bacteria | 10172 |
| 612 | Ga0501037_0015413 | 3300049573 | Bacteria | 5624 |
| 613 | Ga0501037_0029303 | 3300049573 | Bacteria | 4067 |
| 614 | Ga0501037_0349858 | 3300049573 | Bacteria | 1020 |
| 615 | Ga0501038_0000025 | 3300049574 | Bacteria | 146542 |
| 616 | Ga0501038_0023114 | 3300049574 | Bacteria | 5562 |
| 617 | Ga0501038_0087169 | 3300049574 | Bacteria | 2621 |
| 618 | Ga0501038_0095352 | 3300049574 | Bacteria | 2485 |
| 619 | Ga0501038_0134187 | 3300049574 | Bacteria | 2030 |
| 620 | Ga0501038_0208276 | 3300049574 | Bacteria | 1566 |
| 621 | Ga0501039_0000037 | 3300049575 | Bacteria | 122286 |
| 622 | Ga0501039_0053240 | 3300049575 | Bacteria | 3131 |
| 623 | Ga0501039_0266770 | 3300049575 | Bacteria | 1346 |
| 624 | Ga0501039_0740038 | 3300049575 | Bacteria | 768 |
| 625 | Ga0501040_0005598 | 3300049576 | Bacteria | 8116 |
| 626 | Ga0501040_0389412 | 3300049576 | Bacteria | 1000 |
| 627 | Ga0501041_0137308 | 3300049577 | Bacteria | 1524 |
| 628 | Ga0501041_0260106 | 3300049577 | Bacteria | 1091 |
| 629 | Ga0501042_0006985 | 3300049578 | Bacteria | 7369 |
| 630 | Ga0501042_0226930 | 3300049578 | Bacteria | 1347 |
| 631 | Ga0501042_0333915 | 3300049578 | Bacteria | 1096 |
| 632 | Ga0501042_1124383 | 3300049578 | Bacteria | 573 |
| 633 | Ga0501043_0000070 | 3300049579 | Bacteria | 89839 |
| 634 | Ga0501043_0017343 | 3300049579 | Bacteria | 5647 |
| 635 | Ga0501043_0083685 | 3300049579 | Bacteria | 2508 |
| 636 | Ga0501043_0398702 | 3300049579 | Bacteria | 1040 |
| 637 | Ga0501043_0414385 | 3300049579 | Bacteria | 1016 |
| 638 | Ga0501043_0498715 | 3300049579 | Bacteria | 910 |
| 639 | Ga0501043_0592366 | 3300049579 | Bacteria | 820 |
| 640 | Ga0501046_0039644 | 3300049580 | Bacteria | 3770 |
| 641 | Ga0501046_0103078 | 3300049580 | Bacteria | 2187 |
| 642 | Ga0501046_0116579 | 3300049580 | Bacteria | 2035 |
| 643 | Ga0501046_0478553 | 3300049580 | Bacteria | 893 |
| 644 | Ga0501047_0001244 | 3300049581 | Bacteria | 25242 |
| 645 | Ga0501047_0025205 | 3300049581 | Bacteria | 5714 |
| 646 | Ga0501047_0122146 | 3300049581 | Bacteria | 2486 |
| 647 | Ga0501047_0284741 | 3300049581 | Bacteria | 1497 |
| 648 | Ga0501047_0452411 | 3300049581 | Bacteria | 1113 |
| 649 | Ga0501047_0512479 | 3300049581 | Bacteria | 1026 |
| 650 | Ga0501048_1044042 | 3300049582 | Bacteria | 588 |
| 651 | Ga0501048_1079766 | 3300049582 | Bacteria | 577 |
| 652 | Ga0501067_0424955 | 3300049583 | Bacteria | 742 |
| 653 | Ga0501068_0023785 | 3300049584 | Bacteria | 3593 |
| 654 | Ga0501068_0528692 | 3300049584 | Bacteria | 766 |
| 655 | Ga0501069_0080090 | 3300049585 | Bacteria | 1839 |
| 656 | Ga0501070_0047983 | 3300049586 | Bacteria | 3548 |
| 657 | Ga0501070_0073374 | 3300049586 | Bacteria | 2831 |
| 658 | Ga0501070_0076324 | 3300049586 | Bacteria | 2774 |
| 659 | Ga0501070_0186288 | 3300049586 | Bacteria | 1707 |
| 660 | Ga0501070_0803663 | 3300049586 | Bacteria | 738 |
| 661 | Ga0501070_1134270 | 3300049586 | Bacteria | 602 |
| 662 | Ga0501071_0031594 | 3300049587 | Bacteria | 3755 |
| 663 | Ga0501071_0083056 | 3300049587 | Bacteria | 2347 |
| 664 | Ga0501071_1196037 | 3300049587 | Bacteria | 587 |
| 665 | Ga0501073_0201448 | 3300049589 | Bacteria | 1376 |
| 666 | Ga0501074_0245860 | 3300049590 | Bacteria | 1272 |
| 667 | Ga0501074_0394119 | 3300049590 | Bacteria | 982 |
| 668 | Ga0501074_0421783 | 3300049590 | Bacteria | 946 |
| 669 | Ga0501074_0482451 | 3300049590 | Bacteria | 879 |
| 670 | Ga0501075_0243164 | 3300049591 | Bacteria | 1372 |
| 671 | Ga0501076_0093445 | 3300049592 | Bacteria | 2420 |
| 672 | Ga0501076_0176205 | 3300049592 | Bacteria | 1743 |
| 673 | Ga0501077_0407783 | 3300049593 | Bacteria | 869 |
| 674 | Ga0501077_0744717 | 3300049593 | Bacteria | 630 |
| 675 | Ga0501077_0918813 | 3300049593 | Bacteria | 563 |
| 676 | Ga0501079_0183477 | 3300049741 | Bacteria | 1633 |
| 677 | Ga0501080_0084392 | 3300049742 | Bacteria | 2951 |
| 678 | Ga0501080_0110362 | 3300049742 | Bacteria | 2549 |
| 679 | Ga0501080_0187004 | 3300049742 | Bacteria | 1904 |
| 680 | Ga0501080_0891638 | 3300049742 | Bacteria | 776 |
| 681 | Ga0501080_0985345 | 3300049742 | Bacteria | 732 |
| 682 | Ga0501080_1000669 | 3300049742 | Bacteria | 725 |
| 683 | Ga0501080_1037235 | 3300049742 | Bacteria | 710 |
| 684 | Ga0501080_1212241 | 3300049742 | Bacteria | 648 |
| 685 | Ga0501081_0089620 | 3300049743 | Bacteria | 2162 |
| 686 | Ga0501081_0252915 | 3300049743 | Bacteria | 1287 |
| 687 | Ga0501083_0347970 | 3300049744 | Bacteria | 964 |
| 688 | Ga0501083_0428470 | 3300049744 | Bacteria | 861 |
| 689 | Ga0501083_0570771 | 3300049744 | Bacteria | 736 |
| 690 | Ga0501083_0847682 | 3300049744 | Bacteria | 595 |
| 691 | Ga0501280_001054 | 3300049776 | Bacteria | 5606 |
| 692 | Ga0501280_112724 | 3300049776 | Bacteria | 533 |
| 693 | Ga0501282_003196 | 3300049778 | Bacteria | 1768 |
| 694 | Ga0501035_0000074 | 3300049822 | Bacteria | 122269 |
| 695 | Ga0501035_0008072 | 3300049822 | Bacteria | 9810 |
| 696 | Ga0501035_0054537 | 3300049822 | Bacteria | 3572 |
| 697 | Ga0501035_0066879 | 3300049822 | Bacteria | 3189 |
| 698 | Ga0501035_0230153 | 3300049822 | Bacteria | 1580 |
| 699 | Ga0501035_0265749 | 3300049822 | Bacteria | 1453 |
| 700 | Ga0501044_0000069 | 3300049823 | Bacteria | 125974 |
| 701 | Ga0501044_0030874 | 3300049823 | Bacteria | 5643 |
| 702 | Ga0501044_0099811 | 3300049823 | Bacteria | 2921 |
| 703 | Ga0501044_0108035 | 3300049823 | Bacteria | 2793 |
| 704 | Ga0501044_0192500 | 3300049823 | Bacteria | 2001 |
| 705 | Ga0501044_0202925 | 3300049823 | Bacteria | 1940 |
| 706 | Ga0501044_0509090 | 3300049823 | Bacteria | 1104 |
| 707 | Ga0501044_0836155 | 3300049823 | Bacteria | 798 |
| 708 | Ga0501044_0931967 | 3300049823 | Bacteria | 742 |
| 709 | Ga0501045_0103639 | 3300049824 | Bacteria | 2107 |
| 710 | Ga0501045_0164076 | 3300049824 | Bacteria | 1654 |
| 711 | Ga0501045_0438656 | 3300049824 | Bacteria | 971 |
| 712 | nmdc:mga03683_30478_c1 | 3300050489 | Unclassified | 2158 |
| 713 | nmdc:mga03n38_157042_c1 | 3300050490 | Bacteria | 1149 |
| 714 | nmdc:mga03n38_24061_c1 | 3300050490 | Unclassified | 2486 |
| 715 | nmdc:mga00v17_5790_c1 | 3300050491 | Bacteria | 6527 |
| 716 | nmdc:mga00v17_848936_c1 | 3300050491 | Unclassified | 580 |
| 717 | nmdc:mga0yw44_138138_c1 | 3300050492 | Bacteria | 1582 |
| 718 | nmdc:mga0yw44_169194_c1 | 3300050492 | Bacteria | 1434 |
| 719 | nmdc:mga0yw44_224437_c1 | 3300050492 | Unclassified | 1246 |
| 720 | nmdc:mga0yw44_4246_c1 | 3300050492 | Bacteria | 4153 |
| 721 | nmdc:mga0yw44_583868_c1 | 3300050492 | Bacteria | 759 |
| 722 | nmdc:mga0yw44_696899_c1 | 3300050492 | Bacteria | 690 |
| 723 | nmdc:mga0yw44_828363_c1 | 3300050492 | Bacteria | 628 |
| 724 | nmdc:mga0k408_148904_c1 | 3300050493 | Bacteria | 1393 |
| 725 | nmdc:mga0k408_220406_c1 | 3300050493 | Bacteria | 1132 |
| 726 | nmdc:mga06z11_110892_c1 | 3300050494 | Bacteria | 1519 |
| 727 | nmdc:mga06z11_341823_c1 | 3300050494 | Bacteria | 895 |
| 728 | nmdc:mga06z11_883595_c1 | 3300050494 | Bacteria | 545 |
| 729 | nmdc:mga06z11_9784_c1 | 3300050494 | Bacteria | 4053 |
| 730 | nmdc:mga04h51_10906_c1 | 3300050495 | Unclassified | 2509 |
| 731 | nmdc:mga04h51_259831_c1 | 3300050495 | Bacteria | 698 |
| 732 | nmdc:mga07m45_27801_c2 | 3300050496 | Bacteria | 1355 |
| 733 | nmdc:mga07m45_37513_c1 | 3300050496 | Unclassified | 2703 |
| 734 | nmdc:mga07m45_590160_c1 | 3300050496 | Bacteria | 642 |
| 735 | nmdc:mga07m45_904608_c1 | 3300050496 | Unclassified | 505 |
| 736 | nmdc:mga0qj67_1199774_c1 | 3300050509 | Bacteria | 590 |
| 737 | nmdc:mga0qj67_26058_c1 | 3300050509 | Bacteria | 4525 |
| 738 | nmdc:mga0qj67_354997_c1 | 3300050509 | Bacteria | 1185 |
| 739 | nmdc:mga06r32_26679_c1 | 3300050510 | Bacteria | 5389 |
| 740 | nmdc:mga06r32_946660_c1 | 3300050510 | Bacteria | 816 |
| 741 | nmdc:mga0n895_39998_c1 | 3300050512 | Bacteria | 4554 |
| 742 | nmdc:mga08x19_1190915_c1 | 3300050514 | Unclassified | 540 |
| 743 | nmdc:mga0a205_18086_c1 | 3300050515 | Bacteria | 6621 |
| 744 | nmdc:mga0sz30_330859_c1 | 3300050516 | Bacteria | 680 |
| 745 | nmdc:mga0sz30_80476_c1 | 3300050516 | Unclassified | 1409 |
| 746 | Ga0500641_0016481 | 3300053096 | Bacteria | 2752 |
| 747 | Ga0500556_0000039 | 3300053104 | Bacteria | 138158 |
| 748 | Ga0500572_020801 | 3300053111 | Bacteria | 1731 |
| 749 | Ga0500603_238306 | 3300053150 | Bacteria | 583 |
| 750 | Ga0500636_0000006 | 3300053177 | Bacteria | 183899 |
| 751 | Ga0500636_0129561 | 3300053177 | Bacteria | 1407 |
| 752 | Ga0501084_1246404 | 3300054114 | Bacteria | 624 |
| 753 | Ga0501082_0000006 | 3300060353 | Bacteria | 127786 |
| 754 | Ga0501082_0080879 | 3300060353 | Bacteria | 2804 |
| 755 | Ga0501082_0385566 | 3300060353 | Bacteria | 1223 |
| 756 | Ga0530510_0062570 | 3300061734 | Bacteria | 2694 |
| 757 | Ga0530510_0849547 | 3300061734 | Bacteria | 697 |
| 758 | Ga0530510_1044026 | 3300061734 | Unclassified | 626 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049776 | Ga0501280_112724 | Ga0501280_112724_89_358 | 83 |
| 2 | 3300049523 | Ga0501300_023806 | Ga0501300_023806_42_302 | 86 |
| 3 | 3300049776 | Ga0501280_001054 | Ga0501280_001054_4763_5023 | 86 |
| 4 | 3300049778 | Ga0501282_003196 | Ga0501282_003196_1328_1588 | 86 |
| 5 | 3300049593 | Ga0501077_0918813 | Ga0501077_0918813_212_478 | 88 |
| 6 | 3300061734 | Ga0530510_0849547 | Ga0530510_0849547_24_290 | 88 |
| 7 | 3300009101 | Ga0105247_10515956 | Ga0105247_105159562 | 89 |
| 8 | 3300013104 | Ga0157370_10025664 | Ga0157370_100256643 | 89 |
| 9 | 3300014326 | Ga0157380_11899401 | Ga0157380_118994011 | 89 |
| 10 | 3300035113 | Ga0373936_0360103 | Ga0373936_0360103_146_415 | 89 |
| 11 | 3300041443 | Ga0451789_0923876 | Ga0451789_0923876_113_382 | 89 |
| 12 | 3300041452 | Ga0451793_1234692 | Ga0451793_1234692_120_389 | 89 |
| 13 | 3300041456 | Ga0451795_0299550 | Ga0451795_0299550_29_298 | 89 |
| 14 | 3300041460 | Ga0451802_2128099 | Ga0451802_2128099_101_370 | 89 |
| 15 | 3300041486 | Ga0451807_1294539 | Ga0451807_1294539_119_388 | 89 |
| 16 | 3300041486 | Ga0451807_1494924 | Ga0451807_1494924_13_282 | 89 |
| 17 | 3300041486 | Ga0451807_2693519 | Ga0451807_2693519_161_430 | 89 |
| 18 | 3300041491 | Ga0451833_0416748 | Ga0451833_0416748_72_341 | 89 |
| 19 | 3300041494 | Ga0451837_0650742 | Ga0451837_0650742_326_595 | 89 |
| 20 | 3300041498 | Ga0451841_1348048 | Ga0451841_1348048_51_320 | 89 |
| 21 | 3300042006 | Ga0439432_243951 | Ga0439432_243951_210_479 | 89 |
| 22 | 3300042131 | Ga0450894_015381 | Ga0450894_015381_411_680 | 89 |
| 23 | 3300042156 | Ga0439446_0024012 | Ga0439446_0024012_362_631 | 89 |
| 24 | 3300042435 | Ga0439434_0360652 | Ga0439434_0360652_156_425 | 89 |
| 25 | 3300046459 | Ga0495629_0217343 | Ga0495629_0217343_563_832 | 89 |
| 26 | 3300046536 | Ga0495587_0568915 | Ga0495587_0568915_322_591 | 89 |
| 27 | 3300046663 | Ga0495635_0548676 | Ga0495635_0548676_55_324 | 89 |
| 28 | 3300046809 | Ga0495600_0699478 | Ga0495600_0699478_254_523 | 89 |
| 29 | 3300047315 | Ga0495581_0363512 | Ga0495581_0363512_375_644 | 89 |
| 30 | 3300047317 | Ga0495604_0426369 | Ga0495604_0426369_482_751 | 89 |
| 31 | 3300048904 | Ga0496101_0291161 | Ga0496101_0291161_653_922 | 89 |
| 32 | 3300048905 | Ga0496102_0848433 | Ga0496102_0848433_405_674 | 89 |
| 33 | 3300048908 | Ga0496105_0121824 | Ga0496105_0121824_419_688 | 89 |
| 34 | 3300048912 | Ga0496109_0336834 | Ga0496109_0336834_540_809 | 89 |
| 35 | 3300048915 | Ga0496112_0015803 | Ga0496112_0015803_319_588 | 89 |
| 36 | 3300048918 | Ga0496115_0549615 | Ga0496115_0549615_502_771 | 89 |
| 37 | 3300048924 | Ga0496121_0358017 | Ga0496121_0358017_285_554 | 89 |
| 38 | 3300050492 | nmdc:mga0yw44_696899_c1 | nmdc:mga0yw44_696899_c1_398_667 | 89 |
| 39 | 3300050493 | nmdc:mga0k408_220406_c1 | nmdc:mga0k408_220406_c1_163_432 | 89 |
| 40 | 3300053096 | Ga0500641_0016481 | Ga0500641_0016481_597_866 | 89 |
| 41 | 3300053150 | Ga0500603_238306 | Ga0500603_238306_44_313 | 89 |
| 42 | iso_pu_bacteria | 2534681786 | 2535486473 | 89 |
| 43 | iso_pu_bacteria | 2597490356 | 2599104605 | 89 |
| 44 | iso_pu_bacteria | 2643221564 | 2643837794 | 89 |
| 45 | iso_pu_bacteria | 2643221568 | 2643855215 | 89 |
| 46 | iso_pu_bacteria | 2643221623 | 2644133095 | 89 |
| 47 | iso_pu_bacteria | 2738543024 | 2739305873 | 89 |
| 48 | iso_pu_bacteria | 2757320392 | 2757569368 | 89 |
| 49 | iso_pu_bacteria | 2842718218 | 2842719657 | 89 |
| 50 | iso_pu_bacteria | 2844002411 | 2844004668 | 89 |
| 51 | iso_pu_bacteria | 2846952575 | 2846955462 | 89 |
| 52 | iso_pu_bacteria | 2848858292 | 2848862659 | 89 |
| 53 | iso_pu_bacteria | 2854911287 | 2854916674 | 89 |
| 54 | iso_pu_bacteria | 2894772417 | 2894777199 | 89 |
| 55 | iso_pu_bacteria | 2915650412 | 2915652453 | 89 |
| 56 | iso_pu_bacteria | 2919166419 | 2919166786 | 89 |
| 57 | iso_pu_bacteria | 2929138655 | 2929138719 | 89 |
| 58 | iso_pu_bacteria | 2974320154 | 2974323725 | 89 |
| 59 | iso_pu_bacteria | 2977957713 | 2977959128 | 89 |
| 60 | iso_pu_bacteria | 2978969890 | 2978973202 | 89 |
| 61 | iso_pu_bacteria | 2984587000 | 2984591450 | 89 |
| 62 | iso_pu_bacteria | 2996310559 | 2996314958 | 89 |
| 63 | iso_pu_bacteria | 8054460903 | 8054461231 | 89 |
| 64 | 3300032005 | Ga0307411_11457571 | Ga0307411_114575712 | 90 |
| 65 | 3300035114 | Ga0373939_0455072 | Ga0373939_0455072_212_484 | 90 |
| 66 | 3300035115 | Ga0373941_0168862 | Ga0373941_0168862_459_731 | 90 |
| 67 | 3300035241 | Ga0373961_0012192 | Ga0373961_0012192_1606_1878 | 90 |
| 68 | 3300035691 | Ga0373931_0000324 | Ga0373931_0000324_15475_15747 | 90 |
| 69 | 3300049569 | Ga0501032_0038284 | Ga0501032_0038284_2659_2931 | 90 |
| 70 | 3300049571 | Ga0501034_0204182 | Ga0501034_0204182_1392_1664 | 90 |
| 71 | 3300049578 | Ga0501042_0006985 | Ga0501042_0006985_3911_4183 | 90 |
| 72 | 3300049593 | Ga0501077_0744717 | Ga0501077_0744717_11_283 | 90 |
| 73 | 3300050512 | nmdc:mga0n895_39998_c1 | nmdc:mga0n895_39998_c1_1877_2149 | 90 |
| 74 | 3300050514 | nmdc:mga08x19_1190915_c1 | nmdc:mga08x19_1190915_c1_87_359 | 90 |
| 75 | 3300050515 | nmdc:mga0a205_18086_c1 | nmdc:mga0a205_18086_c1_5995_6267 | 90 |
| 76 | iso_pu_bacteria | 2508501050 | 2508731125 | 90 |
| 77 | 3300044673 | Ga0453683_0379638 | Ga0453683_0379638_135_410 | 91 |
| 78 | 3300045976 | Ga0466967_0036885 | Ga0466967_0036885_3681_3956 | 91 |
| 79 | 3300049824 | Ga0501045_0438656 | Ga0501045_0438656_513_791 | 91 |
| 80 | 3300003322 | rootL2_10338223 | rootL2_103382233 | 92 |
| 81 | 3300003323 | rootH1_10265339 | rootH1_102653392 | 92 |
| 82 | 3300003323 | rootH1_10398603 | rootH1_103986033 | 92 |
| 83 | 3300003578 | Ga0006562J51391_1006409 | Ga0006562J51391_10064093 | 92 |
| 84 | 3300005327 | Ga0070658_10003488 | Ga0070658_100034886 | 92 |
| 85 | 3300005327 | Ga0070658_10165025 | Ga0070658_101650253 | 92 |
| 86 | 3300005327 | Ga0070658_11344707 | Ga0070658_113447072 | 92 |
| 87 | 3300005328 | Ga0070676_10676252 | Ga0070676_106762522 | 92 |
| 88 | 3300005328 | Ga0070676_11116586 | Ga0070676_111165862 | 92 |
| 89 | 3300005328 | Ga0070676_11125842 | Ga0070676_111258421 | 92 |
| 90 | 3300005329 | Ga0070683_100164491 | Ga0070683_1001644911 | 92 |
| 91 | 3300005329 | Ga0070683_100352283 | Ga0070683_1003522832 | 92 |
| 92 | 3300005329 | Ga0070683_100778266 | Ga0070683_1007782662 | 92 |
| 93 | 3300005329 | Ga0070683_101269707 | Ga0070683_1012697072 | 92 |
| 94 | 3300005331 | Ga0070670_100159351 | Ga0070670_1001593513 | 92 |
| 95 | 3300005331 | Ga0070670_101666295 | Ga0070670_1016662951 | 92 |
| 96 | 3300005333 | Ga0070677_10568362 | Ga0070677_105683622 | 92 |
| 97 | 3300005334 | Ga0068869_100014018 | Ga0068869_1000140183 | 92 |
| 98 | 3300005334 | Ga0068869_100092905 | Ga0068869_1000929053 | 92 |
| 99 | 3300005334 | Ga0068869_100398628 | Ga0068869_1003986282 | 92 |
| 100 | 3300005334 | Ga0068869_100469553 | Ga0068869_1004695532 | 92 |
| 101 | 3300005336 | Ga0070680_100014420 | Ga0070680_1000144204 | 92 |
| 102 | 3300005336 | Ga0070680_100020613 | Ga0070680_1000206135 | 92 |
| 103 | 3300005336 | Ga0070680_100135813 | Ga0070680_1001358134 | 92 |
| 104 | 3300005336 | Ga0070680_100491888 | Ga0070680_1004918883 | 92 |
| 105 | 3300005337 | Ga0070682_100072965 | Ga0070682_1000729654 | 92 |
| 106 | 3300005338 | Ga0068868_101181358 | Ga0068868_1011813581 | 92 |
| 107 | 3300005338 | Ga0068868_101457717 | Ga0068868_1014577171 | 92 |
| 108 | 3300005339 | Ga0070660_100392741 | Ga0070660_1003927413 | 92 |
| 109 | 3300005339 | Ga0070660_100943870 | Ga0070660_1009438702 | 92 |
| 110 | 3300005339 | Ga0070660_100951606 | Ga0070660_1009516062 | 92 |
| 111 | 3300005340 | Ga0070689_100830760 | Ga0070689_1008307601 | 92 |
| 112 | 3300005340 | Ga0070689_100919737 | Ga0070689_1009197372 | 92 |
| 113 | 3300005340 | Ga0070689_101184725 | Ga0070689_1011847252 | 92 |
| 114 | 3300005341 | Ga0070691_10289947 | Ga0070691_102899472 | 92 |
| 115 | 3300005341 | Ga0070691_10307286 | Ga0070691_103072862 | 92 |
| 116 | 3300005343 | Ga0070687_100100854 | Ga0070687_1001008543 | 92 |
| 117 | 3300005343 | Ga0070687_100422112 | Ga0070687_1004221121 | 92 |
| 118 | 3300005344 | Ga0070661_100010269 | Ga0070661_1000102692 | 92 |
| 119 | 3300005345 | Ga0070692_10022193 | Ga0070692_100221934 | 92 |
| 120 | 3300005345 | Ga0070692_10371920 | Ga0070692_103719202 | 92 |
| 121 | 3300005347 | Ga0070668_100076893 | Ga0070668_1000768933 | 92 |
| 122 | 3300005347 | Ga0070668_100256201 | Ga0070668_1002562013 | 92 |
| 123 | 3300005347 | Ga0070668_101099378 | Ga0070668_1010993781 | 92 |
| 124 | 3300005347 | Ga0070668_101347115 | Ga0070668_1013471152 | 92 |
| 125 | 3300005347 | Ga0070668_102052173 | Ga0070668_1020521731 | 92 |
| 126 | 3300005353 | Ga0070669_100089827 | Ga0070669_1000898273 | 92 |
| 127 | 3300005353 | Ga0070669_101686263 | Ga0070669_1016862632 | 92 |
| 128 | 3300005354 | Ga0070675_100641029 | Ga0070675_1006410293 | 92 |
| 129 | 3300005355 | Ga0070671_100359625 | Ga0070671_1003596252 | 92 |
| 130 | 3300005355 | Ga0070671_100942040 | Ga0070671_1009420402 | 92 |
| 131 | 3300005356 | Ga0070674_100490005 | Ga0070674_1004900052 | 92 |
| 132 | 3300005356 | Ga0070674_100581297 | Ga0070674_1005812972 | 92 |
| 133 | 3300005356 | Ga0070674_100994053 | Ga0070674_1009940531 | 92 |
| 134 | 3300005364 | Ga0070673_101641297 | Ga0070673_1016412972 | 92 |
| 135 | 3300005366 | Ga0070659_100127702 | Ga0070659_1001277023 | 92 |
| 136 | 3300005367 | Ga0070667_100101024 | Ga0070667_1001010243 | 92 |
| 137 | 3300005367 | Ga0070667_101721521 | Ga0070667_1017215212 | 92 |
| 138 | 3300005406 | Ga0070703_10019779 | Ga0070703_100197793 | 92 |
| 139 | 3300005438 | Ga0070701_10674312 | Ga0070701_106743122 | 92 |
| 140 | 3300005440 | Ga0070705_100000901 | Ga0070705_1000009015 | 92 |
| 141 | 3300005440 | Ga0070705_100124782 | Ga0070705_1001247821 | 92 |
| 142 | 3300005441 | Ga0070700_100001924 | Ga0070700_1000019243 | 92 |
| 143 | 3300005441 | Ga0070700_100417194 | Ga0070700_1004171942 | 92 |
| 144 | 3300005441 | Ga0070700_100500283 | Ga0070700_1005002833 | 92 |
| 145 | 3300005441 | Ga0070700_101890338 | Ga0070700_1018903381 | 92 |
| 146 | 3300005444 | Ga0070694_100001405 | Ga0070694_1000014055 | 92 |
| 147 | 3300005444 | Ga0070694_100173731 | Ga0070694_1001737312 | 92 |
| 148 | 3300005445 | Ga0070708_100016481 | Ga0070708_1000164816 | 92 |
| 149 | 3300005455 | Ga0070663_100038744 | Ga0070663_1000387443 | 92 |
| 150 | 3300005455 | Ga0070663_100065164 | Ga0070663_1000651643 | 92 |
| 151 | 3300005455 | Ga0070663_100198443 | Ga0070663_1001984433 | 92 |
| 152 | 3300005455 | Ga0070663_100260723 | Ga0070663_1002607232 | 92 |
| 153 | 3300005455 | Ga0070663_100274613 | Ga0070663_1002746133 | 92 |
| 154 | 3300005455 | Ga0070663_100716772 | Ga0070663_1007167721 | 92 |
| 155 | 3300005455 | Ga0070663_101582407 | Ga0070663_1015824072 | 92 |
| 156 | 3300005455 | Ga0070663_101624389 | Ga0070663_1016243892 | 92 |
| 157 | 3300005456 | Ga0070678_100054493 | Ga0070678_1000544933 | 92 |
| 158 | 3300005456 | Ga0070678_100078226 | Ga0070678_1000782263 | 92 |
| 159 | 3300005456 | Ga0070678_100574215 | Ga0070678_1005742153 | 92 |
| 160 | 3300005456 | Ga0070678_100738069 | Ga0070678_1007380692 | 92 |
| 161 | 3300005456 | Ga0070678_101125785 | Ga0070678_1011257851 | 92 |
| 162 | 3300005457 | Ga0070662_100300943 | Ga0070662_1003009431 | 92 |
| 163 | 3300005457 | Ga0070662_101456942 | Ga0070662_1014569422 | 92 |
| 164 | 3300005458 | Ga0070681_10006828 | Ga0070681_1000682810 | 92 |
| 165 | 3300005458 | Ga0070681_10013475 | Ga0070681_1001347510 | 92 |
| 166 | 3300005458 | Ga0070681_10106659 | Ga0070681_101066593 | 92 |
| 167 | 3300005458 | Ga0070681_10174999 | Ga0070681_101749993 | 92 |
| 168 | 3300005458 | Ga0070681_10477645 | Ga0070681_104776453 | 92 |
| 169 | 3300005458 | Ga0070681_10583248 | Ga0070681_105832483 | 92 |
| 170 | 3300005458 | Ga0070681_10587353 | Ga0070681_105873533 | 92 |
| 171 | 3300005459 | Ga0068867_100072516 | Ga0068867_1000725164 | 92 |
| 172 | 3300005459 | Ga0068867_101643178 | Ga0068867_1016431782 | 92 |
| 173 | 3300005466 | Ga0070685_10416578 | Ga0070685_104165782 | 92 |
| 174 | 3300005466 | Ga0070685_11444812 | Ga0070685_114448122 | 92 |
| 175 | 3300005467 | Ga0070706_100029463 | Ga0070706_1000294633 | 92 |
| 176 | 3300005468 | Ga0070707_100525423 | Ga0070707_1005254233 | 92 |
| 177 | 3300005471 | Ga0070698_100017908 | Ga0070698_1000179085 | 92 |
| 178 | 3300005518 | Ga0070699_100015194 | Ga0070699_1000151946 | 92 |
| 179 | 3300005530 | Ga0070679_100028734 | Ga0070679_1000287345 | 92 |
| 180 | 3300005530 | Ga0070679_100338546 | Ga0070679_1003385463 | 92 |
| 181 | 3300005530 | Ga0070679_100680238 | Ga0070679_1006802382 | 92 |
| 182 | 3300005530 | Ga0070679_100918268 | Ga0070679_1009182682 | 92 |
| 183 | 3300005530 | Ga0070679_101653465 | Ga0070679_1016534652 | 92 |
| 184 | 3300005530 | Ga0070679_101717838 | Ga0070679_1017178382 | 92 |
| 185 | 3300005535 | Ga0070684_100189099 | Ga0070684_1001890993 | 92 |
| 186 | 3300005535 | Ga0070684_101079299 | Ga0070684_1010792992 | 92 |
| 187 | 3300005536 | Ga0070697_100009532 | Ga0070697_1000095326 | 92 |
| 188 | 3300005539 | Ga0068853_100242692 | Ga0068853_1002426923 | 92 |
| 189 | 3300005543 | Ga0070672_100098034 | Ga0070672_1000980343 | 92 |
| 190 | 3300005543 | Ga0070672_100152234 | Ga0070672_1001522343 | 92 |
| 191 | 3300005543 | Ga0070672_101619603 | Ga0070672_1016196032 | 92 |
| 192 | 3300005543 | Ga0070672_101910417 | Ga0070672_1019104171 | 92 |
| 193 | 3300005544 | Ga0070686_101345841 | Ga0070686_1013458412 | 92 |
| 194 | 3300005545 | Ga0070695_100000158 | Ga0070695_10000015830 | 92 |
| 195 | 3300005546 | Ga0070696_100233450 | Ga0070696_1002334503 | 92 |
| 196 | 3300005547 | Ga0070693_100356129 | Ga0070693_1003561292 | 92 |
| 197 | 3300005547 | Ga0070693_100486276 | Ga0070693_1004862762 | 92 |
| 198 | 3300005547 | Ga0070693_100815878 | Ga0070693_1008158782 | 92 |
| 199 | 3300005547 | Ga0070693_101005415 | Ga0070693_1010054152 | 92 |
| 200 | 3300005548 | Ga0070665_100010765 | Ga0070665_1000107652 | 92 |
| 201 | 3300005548 | Ga0070665_100081964 | Ga0070665_1000819644 | 92 |
| 202 | 3300005548 | Ga0070665_100388894 | Ga0070665_1003888943 | 92 |
| 203 | 3300005549 | Ga0070704_100008256 | Ga0070704_1000082565 | 92 |
| 204 | 3300005549 | Ga0070704_100086648 | Ga0070704_1000866483 | 92 |
| 205 | 3300005563 | Ga0068855_100067522 | Ga0068855_1000675221 | 92 |
| 206 | 3300005563 | Ga0068855_100139229 | Ga0068855_1001392292 | 92 |
| 207 | 3300005563 | Ga0068855_100408200 | Ga0068855_1004082003 | 92 |
| 208 | 3300005563 | Ga0068855_100597169 | Ga0068855_1005971692 | 92 |
| 209 | 3300005563 | Ga0068855_101111531 | Ga0068855_1011115311 | 92 |
| 210 | 3300005563 | Ga0068855_101135554 | Ga0068855_1011355542 | 92 |
| 211 | 3300005563 | Ga0068855_101216124 | Ga0068855_1012161242 | 92 |
| 212 | 3300005563 | Ga0068855_102125797 | Ga0068855_1021257972 | 92 |
| 213 | 3300005564 | Ga0070664_100118502 | Ga0070664_1001185024 | 92 |
| 214 | 3300005564 | Ga0070664_100571187 | Ga0070664_1005711872 | 92 |
| 215 | 3300005564 | Ga0070664_101117158 | Ga0070664_1011171582 | 92 |
| 216 | 3300005564 | Ga0070664_101540017 | Ga0070664_1015400172 | 92 |
| 217 | 3300005577 | Ga0068857_100009560 | Ga0068857_1000095605 | 92 |
| 218 | 3300005577 | Ga0068857_100548081 | Ga0068857_1005480812 | 92 |
| 219 | 3300005578 | Ga0068854_100509208 | Ga0068854_1005092082 | 92 |
| 220 | 3300005614 | Ga0068856_101363028 | Ga0068856_1013630282 | 92 |
| 221 | 3300005615 | Ga0070702_100016066 | Ga0070702_1000160664 | 92 |
| 222 | 3300005615 | Ga0070702_101697119 | Ga0070702_1016971191 | 92 |
| 223 | 3300005616 | Ga0068852_100392752 | Ga0068852_1003927521 | 92 |
| 224 | 3300005616 | Ga0068852_100681505 | Ga0068852_1006815052 | 92 |
| 225 | 3300005616 | Ga0068852_101875297 | Ga0068852_1018752972 | 92 |
| 226 | 3300005617 | Ga0068859_100003502 | Ga0068859_1000035025 | 92 |
| 227 | 3300005617 | Ga0068859_100194379 | Ga0068859_1001943793 | 92 |
| 228 | 3300005617 | Ga0068859_102532578 | Ga0068859_1025325782 | 92 |
| 229 | 3300005618 | Ga0068864_100025178 | Ga0068864_1000251786 | 92 |
| 230 | 3300005618 | Ga0068864_100540208 | Ga0068864_1005402083 | 92 |
| 231 | 3300005718 | Ga0068866_10721483 | Ga0068866_107214832 | 92 |
| 232 | 3300005718 | Ga0068866_10845806 | Ga0068866_108458062 | 92 |
| 233 | 3300005719 | Ga0068861_100023390 | Ga0068861_1000233901 | 92 |
| 234 | 3300005719 | Ga0068861_100042905 | Ga0068861_1000429055 | 92 |
| 235 | 3300005719 | Ga0068861_100221668 | Ga0068861_1002216683 | 92 |
| 236 | 3300005840 | Ga0068870_10120828 | Ga0068870_101208283 | 92 |
| 237 | 3300005840 | Ga0068870_10159334 | Ga0068870_101593342 | 92 |
| 238 | 3300005840 | Ga0068870_10591421 | Ga0068870_105914213 | 92 |
| 239 | 3300005841 | Ga0068863_100107338 | Ga0068863_1001073383 | 92 |
| 240 | 3300005841 | Ga0068863_100250601 | Ga0068863_1002506013 | 92 |
| 241 | 3300005841 | Ga0068863_100329608 | Ga0068863_1003296082 | 92 |
| 242 | 3300005842 | Ga0068858_100488445 | Ga0068858_1004884452 | 92 |
| 243 | 3300005842 | Ga0068858_102056274 | Ga0068858_1020562742 | 92 |
| 244 | 3300005843 | Ga0068860_100001841 | Ga0068860_1000018417 | 92 |
| 245 | 3300005843 | Ga0068860_100080379 | Ga0068860_1000803793 | 92 |
| 246 | 3300005844 | Ga0068862_100002731 | Ga0068862_1000027315 | 92 |
| 247 | 3300005844 | Ga0068862_100017501 | Ga0068862_1000175015 | 92 |
| 248 | 3300005844 | Ga0068862_100296142 | Ga0068862_1002961423 | 92 |
| 249 | 3300005844 | Ga0068862_101976356 | Ga0068862_1019763561 | 92 |
| 250 | 3300006038 | Ga0075365_10045106 | Ga0075365_100451062 | 92 |
| 251 | 3300006038 | Ga0075365_10076577 | Ga0075365_100765773 | 92 |
| 252 | 3300006038 | Ga0075365_10176951 | Ga0075365_101769512 | 92 |
| 253 | 3300006038 | Ga0075365_10448618 | Ga0075365_104486182 | 92 |
| 254 | 3300006038 | Ga0075365_10627213 | Ga0075365_106272132 | 92 |
| 255 | 3300006048 | Ga0075363_100114453 | Ga0075363_1001144533 | 92 |
| 256 | 3300006048 | Ga0075363_100474799 | Ga0075363_1004747992 | 92 |
| 257 | 3300006051 | Ga0075364_10016127 | Ga0075364_100161272 | 92 |
| 258 | 3300006051 | Ga0075364_10030113 | Ga0075364_100301136 | 92 |
| 259 | 3300006058 | Ga0075432_10059355 | Ga0075432_100593552 | 92 |
| 260 | 3300006163 | Ga0070715_10267802 | Ga0070715_102678022 | 92 |
| 261 | 3300006177 | Ga0075362_10045679 | Ga0075362_100456793 | 92 |
| 262 | 3300006177 | Ga0075362_10652552 | Ga0075362_106525522 | 92 |
| 263 | 3300006178 | Ga0075367_10030475 | Ga0075367_100304752 | 92 |
| 264 | 3300006178 | Ga0075367_10098355 | Ga0075367_100983553 | 92 |
| 265 | 3300006178 | Ga0075367_10933851 | Ga0075367_109338512 | 92 |
| 266 | 3300006186 | Ga0075369_10304711 | Ga0075369_103047111 | 92 |
| 267 | 3300006195 | Ga0075366_10021454 | Ga0075366_100214542 | 92 |
| 268 | 3300006195 | Ga0075366_11010888 | Ga0075366_110108882 | 92 |
| 269 | 3300006237 | Ga0097621_100330182 | Ga0097621_1003301823 | 92 |
| 270 | 3300006237 | Ga0097621_101146284 | Ga0097621_1011462842 | 92 |
| 271 | 3300006237 | Ga0097621_101272882 | Ga0097621_1012728822 | 92 |
| 272 | 3300006353 | Ga0075370_10060801 | Ga0075370_100608012 | 92 |
| 273 | 3300006353 | Ga0075370_10335264 | Ga0075370_103352642 | 92 |
| 274 | 3300006353 | Ga0075370_10476437 | Ga0075370_104764372 | 92 |
| 275 | 3300006358 | Ga0068871_100358514 | Ga0068871_1003585142 | 92 |
| 276 | 3300006358 | Ga0068871_100614064 | Ga0068871_1006140642 | 92 |
| 277 | 3300006358 | Ga0068871_100806206 | Ga0068871_1008062062 | 92 |
| 278 | 3300006358 | Ga0068871_101692096 | Ga0068871_1016920962 | 92 |
| 279 | 3300006844 | Ga0075428_100251939 | Ga0075428_1002519392 | 92 |
| 280 | 3300006844 | Ga0075428_101471530 | Ga0075428_1014715301 | 92 |
| 281 | 3300006846 | Ga0075430_100009987 | Ga0075430_1000099876 | 92 |
| 282 | 3300006846 | Ga0075430_100484328 | Ga0075430_1004843281 | 92 |
| 283 | 3300006846 | Ga0075430_101409045 | Ga0075430_1014090452 | 92 |
| 284 | 3300006847 | Ga0075431_100856752 | Ga0075431_1008567521 | 92 |
| 285 | 3300006852 | Ga0075433_10018253 | Ga0075433_100182535 | 92 |
| 286 | 3300006871 | Ga0075434_100004344 | Ga0075434_10000434411 | 92 |
| 287 | 3300006880 | Ga0075429_100744713 | Ga0075429_1007447132 | 92 |
| 288 | 3300006881 | Ga0068865_100296126 | Ga0068865_1002961262 | 92 |
| 289 | 3300006881 | Ga0068865_100340032 | Ga0068865_1003400322 | 92 |
| 290 | 3300006931 | Ga0097620_100003500 | Ga0097620_1000035005 | 92 |
| 291 | 3300006931 | Ga0097620_100194396 | Ga0097620_1001943962 | 92 |
| 292 | 3300006931 | Ga0097620_102532335 | Ga0097620_1025323352 | 92 |
| 293 | 3300007076 | Ga0075435_100198189 | Ga0075435_1001981893 | 92 |
| 294 | 3300009036 | Ga0105244_10260307 | Ga0105244_102603072 | 92 |
| 295 | 3300009036 | Ga0105244_10340994 | Ga0105244_103409942 | 92 |
| 296 | 3300009093 | Ga0105240_10080457 | Ga0105240_100804574 | 92 |
| 297 | 3300009093 | Ga0105240_11077991 | Ga0105240_110779912 | 92 |
| 298 | 3300009093 | Ga0105240_11867774 | Ga0105240_118677742 | 92 |
| 299 | 3300009093 | Ga0105240_11927442 | Ga0105240_119274422 | 92 |
| 300 | 3300009094 | Ga0111539_10158996 | Ga0111539_101589965 | 92 |
| 301 | 3300009094 | Ga0111539_11939178 | Ga0111539_119391782 | 92 |
| 302 | 3300009098 | Ga0105245_10067879 | Ga0105245_100678793 | 92 |
| 303 | 3300009098 | Ga0105245_10703437 | Ga0105245_107034372 | 92 |
| 304 | 3300009098 | Ga0105245_11771471 | Ga0105245_117714712 | 92 |
| 305 | 3300009098 | Ga0105245_13110375 | Ga0105245_131103751 | 92 |
| 306 | 3300009101 | Ga0105247_10129646 | Ga0105247_101296463 | 92 |
| 307 | 3300009148 | Ga0105243_10056569 | Ga0105243_100565693 | 92 |
| 308 | 3300009148 | Ga0105243_10204910 | Ga0105243_102049103 | 92 |
| 309 | 3300009148 | Ga0105243_11520150 | Ga0105243_115201501 | 92 |
| 310 | 3300009174 | Ga0105241_10023704 | Ga0105241_100237043 | 92 |
| 311 | 3300009174 | Ga0105241_10990175 | Ga0105241_109901752 | 92 |
| 312 | 3300009174 | Ga0105241_11441256 | Ga0105241_114412562 | 92 |
| 313 | 3300009176 | Ga0105242_10205554 | Ga0105242_102055543 | 92 |
| 314 | 3300009176 | Ga0105242_12505360 | Ga0105242_125053602 | 92 |
| 315 | 3300009177 | Ga0105248_10555022 | Ga0105248_105550222 | 92 |
| 316 | 3300009177 | Ga0105248_11451535 | Ga0105248_114515352 | 92 |
| 317 | 3300009545 | Ga0105237_10130058 | Ga0105237_101300583 | 92 |
| 318 | 3300009545 | Ga0105237_11127746 | Ga0105237_111277462 | 92 |
| 319 | 3300009545 | Ga0105237_12454848 | Ga0105237_124548481 | 92 |
| 320 | 3300009551 | Ga0105238_10075653 | Ga0105238_100756536 | 92 |
| 321 | 3300009551 | Ga0105238_10317910 | Ga0105238_103179102 | 92 |
| 322 | 3300009551 | Ga0105238_10589408 | Ga0105238_105894082 | 92 |
| 323 | 3300009551 | Ga0105238_12751765 | Ga0105238_127517652 | 92 |
| 324 | 3300009553 | Ga0105249_10046892 | Ga0105249_100468923 | 92 |
| 325 | 3300009553 | Ga0105249_10710686 | Ga0105249_107106862 | 92 |
| 326 | 3300009553 | Ga0105249_11170778 | Ga0105249_111707783 | 92 |
| 327 | 3300009988 | Ga0105035_105373 | Ga0105035_1053733 | 92 |
| 328 | 3300010375 | Ga0105239_10053150 | Ga0105239_100531505 | 92 |
| 329 | 3300010375 | Ga0105239_10346368 | Ga0105239_103463683 | 92 |
| 330 | 3300010375 | Ga0105239_11216887 | Ga0105239_112168872 | 92 |
| 331 | 3300010375 | Ga0105239_12198351 | Ga0105239_121983512 | 92 |
| 332 | 3300010375 | Ga0105239_12536316 | Ga0105239_125363162 | 92 |
| 333 | 3300011119 | Ga0105246_10012864 | Ga0105246_100128645 | 92 |
| 334 | 3300011119 | Ga0105246_10040416 | Ga0105246_100404163 | 92 |
| 335 | 3300011119 | Ga0105246_10162168 | Ga0105246_101621682 | 92 |
| 336 | 3300013102 | Ga0157371_10027723 | Ga0157371_100277231 | 92 |
| 337 | 3300013104 | Ga0157370_10205779 | Ga0157370_102057794 | 92 |
| 338 | 3300013105 | Ga0157369_10069466 | Ga0157369_100694664 | 92 |
| 339 | 3300013105 | Ga0157369_10148213 | Ga0157369_101482133 | 92 |
| 340 | 3300013105 | Ga0157369_12121682 | Ga0157369_121216822 | 92 |
| 341 | 3300013296 | Ga0157374_12211206 | Ga0157374_122112062 | 92 |
| 342 | 3300013297 | Ga0157378_10099522 | Ga0157378_100995223 | 92 |
| 343 | 3300013297 | Ga0157378_12670550 | Ga0157378_126705501 | 92 |
| 344 | 3300013306 | Ga0163162_10214861 | Ga0163162_102148613 | 92 |
| 345 | 3300013306 | Ga0163162_10354739 | Ga0163162_103547393 | 92 |
| 346 | 3300013306 | Ga0163162_10528127 | Ga0163162_105281273 | 92 |
| 347 | 3300013307 | Ga0157372_10051543 | Ga0157372_100515433 | 92 |
| 348 | 3300013307 | Ga0157372_10729895 | Ga0157372_107298952 | 92 |
| 349 | 3300013308 | Ga0157375_10306008 | Ga0157375_103060083 | 92 |
| 350 | 3300013308 | Ga0157375_10565070 | Ga0157375_105650702 | 92 |
| 351 | 3300013308 | Ga0157375_11999221 | Ga0157375_119992212 | 92 |
| 352 | 3300013308 | Ga0157375_12313859 | Ga0157375_123138591 | 92 |
| 353 | 3300013308 | Ga0157375_13330215 | Ga0157375_133302152 | 92 |
| 354 | 3300014325 | Ga0163163_10051486 | Ga0163163_100514863 | 92 |
| 355 | 3300014325 | Ga0163163_12341025 | Ga0163163_123410252 | 92 |
| 356 | 3300014326 | Ga0157380_10059377 | Ga0157380_100593774 | 92 |
| 357 | 3300014326 | Ga0157380_10144692 | Ga0157380_101446925 | 92 |
| 358 | 3300014326 | Ga0157380_10238703 | Ga0157380_102387033 | 92 |
| 359 | 3300014326 | Ga0157380_10888827 | Ga0157380_108888272 | 92 |
| 360 | 3300014497 | Ga0182008_10278474 | Ga0182008_102784743 | 92 |
| 361 | 3300014745 | Ga0157377_10640670 | Ga0157377_106406702 | 92 |
| 362 | 3300014969 | Ga0157376_10222379 | Ga0157376_102223792 | 92 |
| 363 | 3300014969 | Ga0157376_11054875 | Ga0157376_110548751 | 92 |
| 364 | 3300014969 | Ga0157376_12607770 | Ga0157376_126077702 | 92 |
| 365 | 3300017792 | Ga0163161_10170332 | Ga0163161_101703321 | 92 |
| 366 | 3300025885 | Ga0207653_10102885 | Ga0207653_101028852 | 92 |
| 367 | 3300025893 | Ga0207682_10264184 | Ga0207682_102641842 | 92 |
| 368 | 3300025899 | Ga0207642_11064305 | Ga0207642_110643052 | 92 |
| 369 | 3300025900 | Ga0207710_10679884 | Ga0207710_106798842 | 92 |
| 370 | 3300025901 | Ga0207688_10030603 | Ga0207688_100306033 | 92 |
| 371 | 3300025901 | Ga0207688_10270634 | Ga0207688_102706342 | 92 |
| 372 | 3300025904 | Ga0207647_10567915 | Ga0207647_105679152 | 92 |
| 373 | 3300025908 | Ga0207643_10015598 | Ga0207643_100155983 | 92 |
| 374 | 3300025908 | Ga0207643_10094685 | Ga0207643_100946853 | 92 |
| 375 | 3300025908 | Ga0207643_10383986 | Ga0207643_103839862 | 92 |
| 376 | 3300025909 | Ga0207705_10033509 | Ga0207705_100335095 | 92 |
| 377 | 3300025911 | Ga0207654_10048191 | Ga0207654_100481913 | 92 |
| 378 | 3300025911 | Ga0207654_11433403 | Ga0207654_114334032 | 92 |
| 379 | 3300025912 | Ga0207707_10000582 | Ga0207707_1000058222 | 92 |
| 380 | 3300025912 | Ga0207707_10030337 | Ga0207707_100303375 | 92 |
| 381 | 3300025912 | Ga0207707_10104342 | Ga0207707_101043423 | 92 |
| 382 | 3300025912 | Ga0207707_10141199 | Ga0207707_101411993 | 92 |
| 383 | 3300025912 | Ga0207707_10191415 | Ga0207707_101914153 | 92 |
| 384 | 3300025912 | Ga0207707_10323175 | Ga0207707_103231753 | 92 |
| 385 | 3300025912 | Ga0207707_10371165 | Ga0207707_103711653 | 92 |
| 386 | 3300025912 | Ga0207707_10990929 | Ga0207707_109909292 | 92 |
| 387 | 3300025912 | Ga0207707_11009592 | Ga0207707_110095921 | 92 |
| 388 | 3300025917 | Ga0207660_10012873 | Ga0207660_100128735 | 92 |
| 389 | 3300025917 | Ga0207660_10015931 | Ga0207660_100159314 | 92 |
| 390 | 3300025917 | Ga0207660_10064435 | Ga0207660_100644355 | 92 |
| 391 | 3300025917 | Ga0207660_10510124 | Ga0207660_105101243 | 92 |
| 392 | 3300025917 | Ga0207660_11316053 | Ga0207660_113160531 | 92 |
| 393 | 3300025918 | Ga0207662_10116595 | Ga0207662_101165953 | 92 |
| 394 | 3300025919 | Ga0207657_10021633 | Ga0207657_100216335 | 92 |
| 395 | 3300025919 | Ga0207657_10135285 | Ga0207657_101352853 | 92 |
| 396 | 3300025919 | Ga0207657_10644674 | Ga0207657_106446742 | 92 |
| 397 | 3300025919 | Ga0207657_10682167 | Ga0207657_106821672 | 92 |
| 398 | 3300025921 | Ga0207652_10004959 | Ga0207652_100049598 | 92 |
| 399 | 3300025921 | Ga0207652_10837897 | Ga0207652_108378972 | 92 |
| 400 | 3300025923 | Ga0207681_10055802 | Ga0207681_100558023 | 92 |
| 401 | 3300025923 | Ga0207681_10958824 | Ga0207681_109588242 | 92 |
| 402 | 3300025923 | Ga0207681_11697489 | Ga0207681_116974891 | 92 |
| 403 | 3300025924 | Ga0207694_10063948 | Ga0207694_100639486 | 92 |
| 404 | 3300025924 | Ga0207694_10343267 | Ga0207694_103432672 | 92 |
| 405 | 3300025924 | Ga0207694_10507525 | Ga0207694_105075252 | 92 |
| 406 | 3300025924 | Ga0207694_11700437 | Ga0207694_117004371 | 92 |
| 407 | 3300025925 | Ga0207650_10934547 | Ga0207650_109345472 | 92 |
| 408 | 3300025926 | Ga0207659_10412969 | Ga0207659_104129693 | 92 |
| 409 | 3300025926 | Ga0207659_11004091 | Ga0207659_110040912 | 92 |
| 410 | 3300025927 | Ga0207687_10096947 | Ga0207687_100969473 | 92 |
| 411 | 3300025927 | Ga0207687_11691348 | Ga0207687_116913482 | 92 |
| 412 | 3300025931 | Ga0207644_10535143 | Ga0207644_105351433 | 92 |
| 413 | 3300025932 | Ga0207690_10615816 | Ga0207690_106158162 | 92 |
| 414 | 3300025932 | Ga0207690_10631317 | Ga0207690_106313172 | 92 |
| 415 | 3300025933 | Ga0207706_10036082 | Ga0207706_100360824 | 92 |
| 416 | 3300025933 | Ga0207706_10150165 | Ga0207706_101501653 | 92 |
| 417 | 3300025934 | Ga0207686_10213002 | Ga0207686_102130023 | 92 |
| 418 | 3300025934 | Ga0207686_11530481 | Ga0207686_115304812 | 92 |
| 419 | 3300025935 | Ga0207709_10097817 | Ga0207709_100978173 | 92 |
| 420 | 3300025935 | Ga0207709_10122331 | Ga0207709_101223313 | 92 |
| 421 | 3300025935 | Ga0207709_10204763 | Ga0207709_102047632 | 92 |
| 422 | 3300025935 | Ga0207709_11009493 | Ga0207709_110094931 | 92 |
| 423 | 3300025935 | Ga0207709_11344699 | Ga0207709_113446992 | 92 |
| 424 | 3300025936 | Ga0207670_11151847 | Ga0207670_111518472 | 92 |
| 425 | 3300025936 | Ga0207670_11295079 | Ga0207670_112950792 | 92 |
| 426 | 3300025937 | Ga0207669_10028127 | Ga0207669_100281273 | 92 |
| 427 | 3300025937 | Ga0207669_10141941 | Ga0207669_101419412 | 92 |
| 428 | 3300025937 | Ga0207669_10383372 | Ga0207669_103833722 | 92 |
| 429 | 3300025937 | Ga0207669_10414842 | Ga0207669_104148422 | 92 |
| 430 | 3300025937 | Ga0207669_11428380 | Ga0207669_114283802 | 92 |
| 431 | 3300025937 | Ga0207669_11652370 | Ga0207669_116523702 | 92 |
| 432 | 3300025938 | Ga0207704_10191751 | Ga0207704_101917513 | 92 |
| 433 | 3300025940 | Ga0207691_10068902 | Ga0207691_100689024 | 92 |
| 434 | 3300025940 | Ga0207691_10125677 | Ga0207691_101256773 | 92 |
| 435 | 3300025941 | Ga0207711_10557441 | Ga0207711_105574411 | 92 |
| 436 | 3300025941 | Ga0207711_11712006 | Ga0207711_117120062 | 92 |
| 437 | 3300025942 | Ga0207689_10089709 | Ga0207689_100897093 | 92 |
| 438 | 3300025942 | Ga0207689_10239819 | Ga0207689_102398193 | 92 |
| 439 | 3300025942 | Ga0207689_10613256 | Ga0207689_106132562 | 92 |
| 440 | 3300025942 | Ga0207689_10854579 | Ga0207689_108545792 | 92 |
| 441 | 3300025944 | Ga0207661_10168132 | Ga0207661_101681322 | 92 |
| 442 | 3300025944 | Ga0207661_11070446 | Ga0207661_110704462 | 92 |
| 443 | 3300025944 | Ga0207661_11837484 | Ga0207661_118374842 | 92 |
| 444 | 3300025945 | Ga0207679_10167946 | Ga0207679_101679463 | 92 |
| 445 | 3300025945 | Ga0207679_10218784 | Ga0207679_102187843 | 92 |
| 446 | 3300025945 | Ga0207679_10445218 | Ga0207679_104452182 | 92 |
| 447 | 3300025945 | Ga0207679_11371176 | Ga0207679_113711762 | 92 |
| 448 | 3300025949 | Ga0207667_10901174 | Ga0207667_109011743 | 92 |
| 449 | 3300025949 | Ga0207667_10913870 | Ga0207667_109138702 | 92 |
| 450 | 3300025949 | Ga0207667_11076569 | Ga0207667_110765692 | 92 |
| 451 | 3300025960 | Ga0207651_10338271 | Ga0207651_103382713 | 92 |
| 452 | 3300025961 | Ga0207712_10023018 | Ga0207712_100230183 | 92 |
| 453 | 3300025961 | Ga0207712_10961598 | Ga0207712_109615982 | 92 |
| 454 | 3300025972 | Ga0207668_10024309 | Ga0207668_100243096 | 92 |
| 455 | 3300025972 | Ga0207668_10063083 | Ga0207668_100630833 | 92 |
| 456 | 3300025972 | Ga0207668_10100363 | Ga0207668_101003633 | 92 |
| 457 | 3300025972 | Ga0207668_10609292 | Ga0207668_106092922 | 92 |
| 458 | 3300025981 | Ga0207640_11282329 | Ga0207640_112823292 | 92 |
| 459 | 3300025981 | Ga0207640_11409018 | Ga0207640_114090181 | 92 |
| 460 | 3300025986 | Ga0207658_10484723 | Ga0207658_104847232 | 92 |
| 461 | 3300026023 | Ga0207677_10127328 | Ga0207677_101273283 | 92 |
| 462 | 3300026023 | Ga0207677_10145170 | Ga0207677_101451702 | 92 |
| 463 | 3300026023 | Ga0207677_11012158 | Ga0207677_110121583 | 92 |
| 464 | 3300026035 | Ga0207703_10949219 | Ga0207703_109492192 | 92 |
| 465 | 3300026041 | Ga0207639_10024518 | Ga0207639_100245183 | 92 |
| 466 | 3300026041 | Ga0207639_10348575 | Ga0207639_103485752 | 92 |
| 467 | 3300026041 | Ga0207639_10432801 | Ga0207639_104328012 | 92 |
| 468 | 3300026041 | Ga0207639_10748999 | Ga0207639_107489993 | 92 |
| 469 | 3300026067 | Ga0207678_10044918 | Ga0207678_100449185 | 92 |
| 470 | 3300026067 | Ga0207678_10183237 | Ga0207678_101832371 | 92 |
| 471 | 3300026067 | Ga0207678_10234417 | Ga0207678_102344173 | 92 |
| 472 | 3300026067 | Ga0207678_10574323 | Ga0207678_105743232 | 92 |
| 473 | 3300026067 | Ga0207678_10763050 | Ga0207678_107630502 | 92 |
| 474 | 3300026067 | Ga0207678_10910281 | Ga0207678_109102811 | 92 |
| 475 | 3300026067 | Ga0207678_11372633 | Ga0207678_113726332 | 92 |
| 476 | 3300026075 | Ga0207708_10001399 | Ga0207708_100013995 | 92 |
| 477 | 3300026075 | Ga0207708_10087186 | Ga0207708_100871863 | 92 |
| 478 | 3300026075 | Ga0207708_10103918 | Ga0207708_101039183 | 92 |
| 479 | 3300026075 | Ga0207708_10251993 | Ga0207708_102519932 | 92 |
| 480 | 3300026075 | Ga0207708_10608897 | Ga0207708_106088972 | 92 |
| 481 | 3300026075 | Ga0207708_11203057 | Ga0207708_112030571 | 92 |
| 482 | 3300026078 | Ga0207702_10052860 | Ga0207702_100528603 | 92 |
| 483 | 3300026078 | Ga0207702_10299496 | Ga0207702_102994962 | 92 |
| 484 | 3300026088 | Ga0207641_10131630 | Ga0207641_101316303 | 92 |
| 485 | 3300026088 | Ga0207641_10164075 | Ga0207641_101640752 | 92 |
| 486 | 3300026088 | Ga0207641_11717776 | Ga0207641_117177761 | 92 |
| 487 | 3300026089 | Ga0207648_10635847 | Ga0207648_106358472 | 92 |
| 488 | 3300026095 | Ga0207676_10003912 | Ga0207676_100039123 | 92 |
| 489 | 3300026095 | Ga0207676_10080910 | Ga0207676_100809103 | 92 |
| 490 | 3300026116 | Ga0207674_10001143 | Ga0207674_100011436 | 92 |
| 491 | 3300026118 | Ga0207675_100041267 | Ga0207675_1000412672 | 92 |
| 492 | 3300026118 | Ga0207675_100048221 | Ga0207675_1000482215 | 92 |
| 493 | 3300026118 | Ga0207675_100135123 | Ga0207675_1001351233 | 92 |
| 494 | 3300026118 | Ga0207675_101488178 | Ga0207675_1014881782 | 92 |
| 495 | 3300026121 | Ga0207683_10053612 | Ga0207683_100536123 | 92 |
| 496 | 3300026121 | Ga0207683_10168119 | Ga0207683_101681192 | 92 |
| 497 | 3300026121 | Ga0207683_10362701 | Ga0207683_103627012 | 92 |
| 498 | 3300026121 | Ga0207683_10880818 | Ga0207683_108808182 | 92 |
| 499 | 3300026142 | Ga0207698_10319495 | Ga0207698_103194953 | 92 |
| 500 | 3300026142 | Ga0207698_11032649 | Ga0207698_110326492 | 92 |
| 501 | 3300027312 | Ga0209371_1088252 | Ga0209371_10882522 | 92 |
| 502 | 3300027866 | Ga0209813_10013463 | Ga0209813_100134633 | 92 |
| 503 | 3300027866 | Ga0209813_10228284 | Ga0209813_102282842 | 92 |
| 504 | 3300028379 | Ga0268266_10008617 | Ga0268266_1000861712 | 92 |
| 505 | 3300028379 | Ga0268266_10119099 | Ga0268266_101190993 | 92 |
| 506 | 3300028379 | Ga0268266_10494045 | Ga0268266_104940452 | 92 |
| 507 | 3300028380 | Ga0268265_10000626 | Ga0268265_1000062631 | 92 |
| 508 | 3300028380 | Ga0268265_10036784 | Ga0268265_100367843 | 92 |
| 509 | 3300028380 | Ga0268265_11065293 | Ga0268265_110652932 | 92 |
| 510 | 3300028380 | Ga0268265_11425059 | Ga0268265_114250592 | 92 |
| 511 | 3300028381 | Ga0268264_10003320 | Ga0268264_100033203 | 92 |
| 512 | 3300028381 | Ga0268264_11778713 | Ga0268264_117787132 | 92 |
| 513 | 3300030500 | Ga0268256_1097476 | Ga0268256_10974762 | 92 |
| 514 | 3300031548 | Ga0307408_101340466 | Ga0307408_1013404662 | 92 |
| 515 | 3300031731 | Ga0307405_10723144 | Ga0307405_107231442 | 92 |
| 516 | 3300031824 | Ga0307413_10325848 | Ga0307413_103258482 | 92 |
| 517 | 3300031824 | Ga0307413_11901714 | Ga0307413_119017142 | 92 |
| 518 | 3300031852 | Ga0307410_10055976 | Ga0307410_100559763 | 92 |
| 519 | 3300031852 | Ga0307410_10531599 | Ga0307410_105315992 | 92 |
| 520 | 3300031852 | Ga0307410_11210545 | Ga0307410_112105452 | 92 |
| 521 | 3300031901 | Ga0307406_10007814 | Ga0307406_100078145 | 92 |
| 522 | 3300031901 | Ga0307406_10118690 | Ga0307406_101186902 | 92 |
| 523 | 3300031903 | Ga0307407_10265865 | Ga0307407_102658652 | 92 |
| 524 | 3300031903 | Ga0307407_10567894 | Ga0307407_105678942 | 92 |
| 525 | 3300031911 | Ga0307412_11399774 | Ga0307412_113997742 | 92 |
| 526 | 3300031995 | Ga0307409_100003248 | Ga0307409_1000032487 | 92 |
| 527 | 3300031995 | Ga0307409_100027346 | Ga0307409_1000273464 | 92 |
| 528 | 3300031995 | Ga0307409_101467771 | Ga0307409_1014677712 | 92 |
| 529 | 3300032002 | Ga0307416_102331309 | Ga0307416_1023313092 | 92 |
| 530 | 3300032004 | Ga0307414_10412783 | Ga0307414_104127832 | 92 |
| 531 | 3300032005 | Ga0307411_11945905 | Ga0307411_119459052 | 92 |
| 532 | 3300032126 | Ga0307415_100012409 | Ga0307415_1000124092 | 92 |
| 533 | 3300032126 | Ga0307415_100071786 | Ga0307415_1000717862 | 92 |
| 534 | 3300032126 | Ga0307415_100209505 | Ga0307415_1002095052 | 92 |
| 535 | 3300035241 | Ga0373961_0294112 | Ga0373961_0294112_129_407 | 92 |
| 536 | 3300037068 | Ga0373925_0135394 | Ga0373925_0135394_1026_1304 | 92 |
| 537 | 3300037312 | Ga0395899_0060742 | Ga0395899_0060742_1912_2190 | 92 |
| 538 | 3300037418 | Ga0395900_0020727 | Ga0395900_0020727_165_443 | 92 |
| 539 | 3300037418 | Ga0395900_0346047 | Ga0395900_0346047_344_625 | 92 |
| 540 | 3300037466 | Ga0395898_0003674 | Ga0395898_0003674_15940_16218 | 92 |
| 541 | 3300037471 | Ga0395905_0133717 | Ga0395905_0133717_1680_1961 | 92 |
| 542 | 3300037471 | Ga0395905_0465636 | Ga0395905_0465636_363_644 | 92 |
| 543 | 3300037471 | Ga0395905_1165290 | Ga0395905_1165290_307_588 | 92 |
| 544 | 3300038443 | Ga0395901_0270420 | Ga0395901_0270420_91_369 | 92 |
| 545 | 3300038443 | Ga0395901_0339236 | Ga0395901_0339236_1166_1444 | 92 |
| 546 | 3300038443 | Ga0395901_0854541 | Ga0395901_0854541_131_412 | 92 |
| 547 | 3300038443 | Ga0395901_1483482 | Ga0395901_1483482_22_300 | 92 |
| 548 | 3300041441 | Ga0451787_007409 | Ga0451787_007409_63_344 | 92 |
| 549 | 3300041443 | Ga0451789_0738026 | Ga0451789_0738026_321_599 | 92 |
| 550 | 3300041453 | Ga0451797_1299792 | Ga0451797_1299792_160_441 | 92 |
| 551 | 3300041458 | Ga0451798_1123436 | Ga0451798_1123436_199_477 | 92 |
| 552 | 3300041486 | Ga0451807_0571173 | Ga0451807_0571173_186_464 | 92 |
| 553 | 3300041486 | Ga0451807_2155322 | Ga0451807_2155322_62_343 | 92 |
| 554 | 3300041501 | Ga0451845_0436157 | Ga0451845_0436157_19_300 | 92 |
| 555 | 3300041509 | Ga0451843_1116658 | Ga0451843_1116658_217_498 | 92 |
| 556 | 3300041512 | Ga0451853_2901402 | Ga0451853_2901402_615_893 | 92 |
| 557 | 3300042005 | Ga0439448_0303566 | Ga0439448_0303566_196_474 | 92 |
| 558 | 3300044683 | Ga0466965_0058514 | Ga0466965_0058514_1207_1488 | 92 |
| 559 | 3300044842 | Ga0466957_0117044 | Ga0466957_0117044_351_629 | 92 |
| 560 | 3300044901 | Ga0466960_0217108 | Ga0466960_0217108_332_616 | 92 |
| 561 | 3300046519 | Ga0495632_0364017 | Ga0495632_0364017_77_355 | 92 |
| 562 | 3300048903 | Ga0496100_0796125 | Ga0496100_0796125_120_398 | 92 |
| 563 | 3300048903 | Ga0496100_1376768 | Ga0496100_1376768_146_424 | 92 |
| 564 | 3300048904 | Ga0496101_0109131 | Ga0496101_0109131_1463_1741 | 92 |
| 565 | 3300048905 | Ga0496102_0009559 | Ga0496102_0009559_1675_1953 | 92 |
| 566 | 3300048905 | Ga0496102_0039333 | Ga0496102_0039333_1874_2152 | 92 |
| 567 | 3300048905 | Ga0496102_0251716 | Ga0496102_0251716_593_871 | 92 |
| 568 | 3300048905 | Ga0496102_1295703 | Ga0496102_1295703_192_470 | 92 |
| 569 | 3300048905 | Ga0496102_1756408 | Ga0496102_1756408_235_516 | 92 |
| 570 | 3300048906 | Ga0496103_0036330 | Ga0496103_0036330_1653_1931 | 92 |
| 571 | 3300048906 | Ga0496103_0098712 | Ga0496103_0098712_458_736 | 92 |
| 572 | 3300048906 | Ga0496103_0161053 | Ga0496103_0161053_541_819 | 92 |
| 573 | 3300048906 | Ga0496103_0953668 | Ga0496103_0953668_50_328 | 92 |
| 574 | 3300048907 | Ga0496104_0132289 | Ga0496104_0132289_1894_2172 | 92 |
| 575 | 3300048907 | Ga0496104_0659058 | Ga0496104_0659058_236_514 | 92 |
| 576 | 3300048907 | Ga0496104_1091422 | Ga0496104_1091422_403_681 | 92 |
| 577 | 3300048908 | Ga0496105_0052219 | Ga0496105_0052219_2169_2447 | 92 |
| 578 | 3300048909 | Ga0496106_0042073 | Ga0496106_0042073_2696_2974 | 92 |
| 579 | 3300048909 | Ga0496106_0438092 | Ga0496106_0438092_693_971 | 92 |
| 580 | 3300048909 | Ga0496106_0723222 | Ga0496106_0723222_175_453 | 92 |
| 581 | 3300048910 | Ga0496107_0011296 | Ga0496107_0011296_5362_5640 | 92 |
| 582 | 3300048910 | Ga0496107_0067379 | Ga0496107_0067379_1087_1365 | 92 |
| 583 | 3300048910 | Ga0496107_1094858 | Ga0496107_1094858_25_303 | 92 |
| 584 | 3300048911 | Ga0496108_0040335 | Ga0496108_0040335_2362_2640 | 92 |
| 585 | 3300048911 | Ga0496108_1311453 | Ga0496108_1311453_142_420 | 92 |
| 586 | 3300048912 | Ga0496109_0039540 | Ga0496109_0039540_3253_3531 | 92 |
| 587 | 3300048912 | Ga0496109_0874317 | Ga0496109_0874317_463_741 | 92 |
| 588 | 3300048912 | Ga0496109_1102814 | Ga0496109_1102814_56_334 | 92 |
| 589 | 3300048912 | Ga0496109_1790395 | Ga0496109_1790395_221_499 | 92 |
| 590 | 3300048913 | Ga0496110_0017647 | Ga0496110_0017647_4708_4986 | 92 |
| 591 | 3300048914 | Ga0496111_0307412 | Ga0496111_0307412_801_1079 | 92 |
| 592 | 3300048915 | Ga0496112_0016184 | Ga0496112_0016184_1703_1981 | 92 |
| 593 | 3300048917 | Ga0496114_0008572 | Ga0496114_0008572_5260_5538 | 92 |
| 594 | 3300048917 | Ga0496114_0040997 | Ga0496114_0040997_3324_3602 | 92 |
| 595 | 3300048917 | Ga0496114_1256416 | Ga0496114_1256416_14_292 | 92 |
| 596 | 3300048917 | Ga0496114_1782755 | Ga0496114_1782755_11_289 | 92 |
| 597 | 3300048918 | Ga0496115_0345469 | Ga0496115_0345469_52_330 | 92 |
| 598 | 3300048919 | Ga0496116_0000100 | Ga0496116_0000100_93259_93540 | 92 |
| 599 | 3300048919 | Ga0496116_0043510 | Ga0496116_0043510_378_659 | 92 |
| 600 | 3300048921 | Ga0496118_0059604 | Ga0496118_0059604_2235_2516 | 92 |
| 601 | 3300048922 | Ga0496119_0019768 | Ga0496119_0019768_397_678 | 92 |
| 602 | 3300048922 | Ga0496119_0585542 | Ga0496119_0585542_47_328 | 92 |
| 603 | 3300048923 | Ga0496120_0052116 | Ga0496120_0052116_1668_1949 | 92 |
| 604 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_152997_153278 | 92 |
| 605 | 3300048924 | Ga0496121_0678993 | Ga0496121_0678993_294_575 | 92 |
| 606 | 3300048925 | Ga0496122_0003647 | Ga0496122_0003647_19501_19794 | 92 |
| 607 | 3300048925 | Ga0496122_0008413 | Ga0496122_0008413_1113_1394 | 92 |
| 608 | 3300048925 | Ga0496122_0158319 | Ga0496122_0158319_173_454 | 92 |
| 609 | 3300048925 | Ga0496122_0164361 | Ga0496122_0164361_802_1083 | 92 |
| 610 | 3300048925 | Ga0496122_0314577 | Ga0496122_0314577_257_538 | 92 |
| 611 | 3300048926 | Ga0496123_0000517 | Ga0496123_0000517_66591_66884 | 92 |
| 612 | 3300048926 | Ga0496123_0076793 | Ga0496123_0076793_1204_1485 | 92 |
| 613 | 3300048926 | Ga0496123_0226076 | Ga0496123_0226076_529_810 | 92 |
| 614 | 3300048927 | Ga0496124_0015675 | Ga0496124_0015675_2265_2546 | 92 |
| 615 | 3300048927 | Ga0496124_0107810 | Ga0496124_0107810_1409_1687 | 92 |
| 616 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_266442_266723 | 92 |
| 617 | 3300048928 | Ga0496125_0000713 | Ga0496125_0000713_42999_43277 | 92 |
| 618 | 3300048929 | Ga0496126_0000094 | Ga0496126_0000094_202123_202404 | 92 |
| 619 | 3300048929 | Ga0496126_0561186 | Ga0496126_0561186_45_326 | 92 |
| 620 | 3300048929 | Ga0496126_0628342 | Ga0496126_0628342_410_688 | 92 |
| 621 | 3300049568 | Ga0501031_0000010 | Ga0501031_0000010_87138_87419 | 92 |
| 622 | 3300049568 | Ga0501031_0002408 | Ga0501031_0002408_3614_3895 | 92 |
| 623 | 3300049568 | Ga0501031_0006171 | Ga0501031_0006171_5684_5962 | 92 |
| 624 | 3300049568 | Ga0501031_0093978 | Ga0501031_0093978_74_352 | 92 |
| 625 | 3300049568 | Ga0501031_0121925 | Ga0501031_0121925_1265_1549 | 92 |
| 626 | 3300049569 | Ga0501032_0000023 | Ga0501032_0000023_59017_59298 | 92 |
| 627 | 3300049569 | Ga0501032_0038787 | Ga0501032_0038787_2402_2680 | 92 |
| 628 | 3300049569 | Ga0501032_0082015 | Ga0501032_0082015_989_1267 | 92 |
| 629 | 3300049570 | Ga0501033_0000104 | Ga0501033_0000104_42208_42489 | 92 |
| 630 | 3300049570 | Ga0501033_0004294 | Ga0501033_0004294_6983_7261 | 92 |
| 631 | 3300049570 | Ga0501033_0007428 | Ga0501033_0007428_3042_3320 | 92 |
| 632 | 3300049570 | Ga0501033_0214291 | Ga0501033_0214291_423_704 | 92 |
| 633 | 3300049570 | Ga0501033_0237615 | Ga0501033_0237615_418_702 | 92 |
| 634 | 3300049570 | Ga0501033_0364429 | Ga0501033_0364429_622_906 | 92 |
| 635 | 3300049570 | Ga0501033_0434097 | Ga0501033_0434097_447_725 | 92 |
| 636 | 3300049571 | Ga0501034_0000116 | Ga0501034_0000116_87145_87426 | 92 |
| 637 | 3300049571 | Ga0501034_0073146 | Ga0501034_0073146_1621_1899 | 92 |
| 638 | 3300049571 | Ga0501034_0076906 | Ga0501034_0076906_918_1196 | 92 |
| 639 | 3300049571 | Ga0501034_0139192 | Ga0501034_0139192_783_1061 | 92 |
| 640 | 3300049571 | Ga0501034_0194349 | Ga0501034_0194349_520_804 | 92 |
| 641 | 3300049571 | Ga0501034_0208416 | Ga0501034_0208416_1389_1670 | 92 |
| 642 | 3300049571 | Ga0501034_0407536 | Ga0501034_0407536_351_632 | 92 |
| 643 | 3300049572 | Ga0501036_0000015 | Ga0501036_0000015_87145_87426 | 92 |
| 644 | 3300049572 | Ga0501036_0039590 | Ga0501036_0039590_3177_3455 | 92 |
| 645 | 3300049572 | Ga0501036_0043249 | Ga0501036_0043249_628_912 | 92 |
| 646 | 3300049572 | Ga0501036_0206600 | Ga0501036_0206600_75_356 | 92 |
| 647 | 3300049572 | Ga0501036_0522077 | Ga0501036_0522077_244_522 | 92 |
| 648 | 3300049573 | Ga0501037_0000023 | Ga0501037_0000023_87245_87526 | 92 |
| 649 | 3300049573 | Ga0501037_0004454 | Ga0501037_0004454_2243_2521 | 92 |
| 650 | 3300049573 | Ga0501037_0015413 | Ga0501037_0015413_3390_3668 | 92 |
| 651 | 3300049573 | Ga0501037_0029303 | Ga0501037_0029303_3067_3345 | 92 |
| 652 | 3300049573 | Ga0501037_0349858 | Ga0501037_0349858_274_558 | 92 |
| 653 | 3300049574 | Ga0501038_0000025 | Ga0501038_0000025_87245_87526 | 92 |
| 654 | 3300049574 | Ga0501038_0023114 | Ga0501038_0023114_1404_1682 | 92 |
| 655 | 3300049574 | Ga0501038_0087169 | Ga0501038_0087169_218_496 | 92 |
| 656 | 3300049574 | Ga0501038_0095352 | Ga0501038_0095352_1920_2198 | 92 |
| 657 | 3300049574 | Ga0501038_0134187 | Ga0501038_0134187_913_1194 | 92 |
| 658 | 3300049574 | Ga0501038_0208276 | Ga0501038_0208276_962_1240 | 92 |
| 659 | 3300049575 | Ga0501039_0000037 | Ga0501039_0000037_87145_87426 | 92 |
| 660 | 3300049575 | Ga0501039_0053240 | Ga0501039_0053240_2241_2519 | 92 |
| 661 | 3300049575 | Ga0501039_0266770 | Ga0501039_0266770_235_516 | 92 |
| 662 | 3300049575 | Ga0501039_0740038 | Ga0501039_0740038_97_375 | 92 |
| 663 | 3300049576 | Ga0501040_0005598 | Ga0501040_0005598_7702_7983 | 92 |
| 664 | 3300049576 | Ga0501040_0389412 | Ga0501040_0389412_556_840 | 92 |
| 665 | 3300049577 | Ga0501041_0137308 | Ga0501041_0137308_164_448 | 92 |
| 666 | 3300049577 | Ga0501041_0260106 | Ga0501041_0260106_79_357 | 92 |
| 667 | 3300049578 | Ga0501042_0226930 | Ga0501042_0226930_388_672 | 92 |
| 668 | 3300049578 | Ga0501042_0333915 | Ga0501042_0333915_568_849 | 92 |
| 669 | 3300049578 | Ga0501042_1124383 | Ga0501042_1124383_109_390 | 92 |
| 670 | 3300049579 | Ga0501043_0000070 | Ga0501043_0000070_30581_30862 | 92 |
| 671 | 3300049579 | Ga0501043_0017343 | Ga0501043_0017343_4562_4840 | 92 |
| 672 | 3300049579 | Ga0501043_0083685 | Ga0501043_0083685_989_1267 | 92 |
| 673 | 3300049579 | Ga0501043_0398702 | Ga0501043_0398702_421_699 | 92 |
| 674 | 3300049579 | Ga0501043_0414385 | Ga0501043_0414385_552_833 | 92 |
| 675 | 3300049579 | Ga0501043_0498715 | Ga0501043_0498715_405_686 | 92 |
| 676 | 3300049579 | Ga0501043_0592366 | Ga0501043_0592366_321_602 | 92 |
| 677 | 3300049580 | Ga0501046_0039644 | Ga0501046_0039644_2054_2335 | 92 |
| 678 | 3300049580 | Ga0501046_0103078 | Ga0501046_0103078_705_983 | 92 |
| 679 | 3300049580 | Ga0501046_0116579 | Ga0501046_0116579_1205_1486 | 92 |
| 680 | 3300049580 | Ga0501046_0478553 | Ga0501046_0478553_18_296 | 92 |
| 681 | 3300049581 | Ga0501047_0001244 | Ga0501047_0001244_17500_17781 | 92 |
| 682 | 3300049581 | Ga0501047_0025205 | Ga0501047_0025205_2199_2477 | 92 |
| 683 | 3300049581 | Ga0501047_0122146 | Ga0501047_0122146_1491_1769 | 92 |
| 684 | 3300049581 | Ga0501047_0284741 | Ga0501047_0284741_882_1163 | 92 |
| 685 | 3300049581 | Ga0501047_0452411 | Ga0501047_0452411_384_665 | 92 |
| 686 | 3300049581 | Ga0501047_0512479 | Ga0501047_0512479_446_724 | 92 |
| 687 | 3300049582 | Ga0501048_1044042 | Ga0501048_1044042_10_288 | 92 |
| 688 | 3300049582 | Ga0501048_1079766 | Ga0501048_1079766_162_443 | 92 |
| 689 | 3300049583 | Ga0501067_0424955 | Ga0501067_0424955_402_680 | 92 |
| 690 | 3300049584 | Ga0501068_0023785 | Ga0501068_0023785_468_746 | 92 |
| 691 | 3300049584 | Ga0501068_0528692 | Ga0501068_0528692_439_720 | 92 |
| 692 | 3300049585 | Ga0501069_0080090 | Ga0501069_0080090_50_331 | 92 |
| 693 | 3300049586 | Ga0501070_0047983 | Ga0501070_0047983_275_553 | 92 |
| 694 | 3300049586 | Ga0501070_0073374 | Ga0501070_0073374_407_685 | 92 |
| 695 | 3300049586 | Ga0501070_0076324 | Ga0501070_0076324_533_814 | 92 |
| 696 | 3300049586 | Ga0501070_0186288 | Ga0501070_0186288_1359_1637 | 92 |
| 697 | 3300049586 | Ga0501070_0803663 | Ga0501070_0803663_158_439 | 92 |
| 698 | 3300049586 | Ga0501070_1134270 | Ga0501070_1134270_190_468 | 92 |
| 699 | 3300049587 | Ga0501071_0031594 | Ga0501071_0031594_714_992 | 92 |
| 700 | 3300049587 | Ga0501071_0083056 | Ga0501071_0083056_2028_2312 | 92 |
| 701 | 3300049587 | Ga0501071_1196037 | Ga0501071_1196037_273_551 | 92 |
| 702 | 3300049589 | Ga0501073_0201448 | Ga0501073_0201448_136_414 | 92 |
| 703 | 3300049590 | Ga0501074_0245860 | Ga0501074_0245860_570_848 | 92 |
| 704 | 3300049590 | Ga0501074_0394119 | Ga0501074_0394119_358_639 | 92 |
| 705 | 3300049590 | Ga0501074_0421783 | Ga0501074_0421783_192_473 | 92 |
| 706 | 3300049590 | Ga0501074_0482451 | Ga0501074_0482451_548_829 | 92 |
| 707 | 3300049591 | Ga0501075_0243164 | Ga0501075_0243164_883_1164 | 92 |
| 708 | 3300049592 | Ga0501076_0093445 | Ga0501076_0093445_610_894 | 92 |
| 709 | 3300049592 | Ga0501076_0176205 | Ga0501076_0176205_568_846 | 92 |
| 710 | 3300049593 | Ga0501077_0407783 | Ga0501077_0407783_429_710 | 92 |
| 711 | 3300049741 | Ga0501079_0183477 | Ga0501079_0183477_166_444 | 92 |
| 712 | 3300049742 | Ga0501080_0084392 | Ga0501080_0084392_2375_2653 | 92 |
| 713 | 3300049742 | Ga0501080_0110362 | Ga0501080_0110362_363_644 | 92 |
| 714 | 3300049742 | Ga0501080_0187004 | Ga0501080_0187004_471_749 | 92 |
| 715 | 3300049742 | Ga0501080_0891638 | Ga0501080_0891638_398_682 | 92 |
| 716 | 3300049742 | Ga0501080_0985345 | Ga0501080_0985345_175_456 | 92 |
| 717 | 3300049742 | Ga0501080_1000669 | Ga0501080_1000669_298_576 | 92 |
| 718 | 3300049742 | Ga0501080_1037235 | Ga0501080_1037235_114_395 | 92 |
| 719 | 3300049742 | Ga0501080_1212241 | Ga0501080_1212241_75_356 | 92 |
| 720 | 3300049743 | Ga0501081_0089620 | Ga0501081_0089620_720_998 | 92 |
| 721 | 3300049743 | Ga0501081_0252915 | Ga0501081_0252915_462_746 | 92 |
| 722 | 3300049744 | Ga0501083_0347970 | Ga0501083_0347970_165_443 | 92 |
| 723 | 3300049744 | Ga0501083_0428470 | Ga0501083_0428470_13_291 | 92 |
| 724 | 3300049744 | Ga0501083_0570771 | Ga0501083_0570771_67_345 | 92 |
| 725 | 3300049744 | Ga0501083_0847682 | Ga0501083_0847682_217_495 | 92 |
| 726 | 3300049822 | Ga0501035_0000074 | Ga0501035_0000074_87126_87407 | 92 |
| 727 | 3300049822 | Ga0501035_0008072 | Ga0501035_0008072_6383_6661 | 92 |
| 728 | 3300049822 | Ga0501035_0054537 | Ga0501035_0054537_1875_2159 | 92 |
| 729 | 3300049822 | Ga0501035_0066879 | Ga0501035_0066879_2138_2416 | 92 |
| 730 | 3300049822 | Ga0501035_0230153 | Ga0501035_0230153_955_1236 | 92 |
| 731 | 3300049822 | Ga0501035_0265749 | Ga0501035_0265749_1093_1371 | 92 |
| 732 | 3300049823 | Ga0501044_0000069 | Ga0501044_0000069_38549_38830 | 92 |
| 733 | 3300049823 | Ga0501044_0030874 | Ga0501044_0030874_3238_3516 | 92 |
| 734 | 3300049823 | Ga0501044_0099811 | Ga0501044_0099811_552_833 | 92 |
| 735 | 3300049823 | Ga0501044_0108035 | Ga0501044_0108035_854_1132 | 92 |
| 736 | 3300049823 | Ga0501044_0192500 | Ga0501044_0192500_1447_1725 | 92 |
| 737 | 3300049823 | Ga0501044_0202925 | Ga0501044_0202925_799_1080 | 92 |
| 738 | 3300049823 | Ga0501044_0509090 | Ga0501044_0509090_372_653 | 92 |
| 739 | 3300049823 | Ga0501044_0836155 | Ga0501044_0836155_24_305 | 92 |
| 740 | 3300049823 | Ga0501044_0931967 | Ga0501044_0931967_421_702 | 92 |
| 741 | 3300049824 | Ga0501045_0103639 | Ga0501045_0103639_791_1072 | 92 |
| 742 | 3300049824 | Ga0501045_0164076 | Ga0501045_0164076_926_1210 | 92 |
| 743 | 3300050489 | nmdc:mga03683_30478_c1 | nmdc:mga03683_30478_c1_46_324 | 92 |
| 744 | 3300050490 | nmdc:mga03n38_157042_c1 | nmdc:mga03n38_157042_c1_594_872 | 92 |
| 745 | 3300050490 | nmdc:mga03n38_24061_c1 | nmdc:mga03n38_24061_c1_417_695 | 92 |
| 746 | 3300050491 | nmdc:mga00v17_5790_c1 | nmdc:mga00v17_5790_c1_4545_4826 | 92 |
| 747 | 3300050491 | nmdc:mga00v17_848936_c1 | nmdc:mga00v17_848936_c1_26_358 | 92 |
| 748 | 3300050492 | nmdc:mga0yw44_138138_c1 | nmdc:mga0yw44_138138_c1_1140_1418 | 92 |
| 749 | 3300050492 | nmdc:mga0yw44_169194_c1 | nmdc:mga0yw44_169194_c1_910_1188 | 92 |
| 750 | 3300050492 | nmdc:mga0yw44_224437_c1 | nmdc:mga0yw44_224437_c1_890_1222 | 92 |
| 751 | 3300050492 | nmdc:mga0yw44_4246_c1 | nmdc:mga0yw44_4246_c1_2515_2796 | 92 |
| 752 | 3300050492 | nmdc:mga0yw44_583868_c1 | nmdc:mga0yw44_583868_c1_195_479 | 92 |
| 753 | 3300050492 | nmdc:mga0yw44_828363_c1 | nmdc:mga0yw44_828363_c1_18_296 | 92 |
| 754 | 3300050493 | nmdc:mga0k408_148904_c1 | nmdc:mga0k408_148904_c1_848_1126 | 92 |
| 755 | 3300050494 | nmdc:mga06z11_110892_c1 | nmdc:mga06z11_110892_c1_219_497 | 92 |
| 756 | 3300050494 | nmdc:mga06z11_341823_c1 | nmdc:mga06z11_341823_c1_474_755 | 92 |
| 757 | 3300050494 | nmdc:mga06z11_883595_c1 | nmdc:mga06z11_883595_c1_235_513 | 92 |
| 758 | 3300050494 | nmdc:mga06z11_9784_c1 | nmdc:mga06z11_9784_c1_3281_3559 | 92 |
| 759 | 3300050495 | nmdc:mga04h51_10906_c1 | nmdc:mga04h51_10906_c1_1189_1467 | 92 |
| 760 | 3300050495 | nmdc:mga04h51_259831_c1 | nmdc:mga04h51_259831_c1_207_488 | 92 |
| 761 | 3300050496 | nmdc:mga07m45_27801_c2 | nmdc:mga07m45_27801_c2_339_617 | 92 |
| 762 | 3300050496 | nmdc:mga07m45_37513_c1 | nmdc:mga07m45_37513_c1_1190_1468 | 92 |
| 763 | 3300050496 | nmdc:mga07m45_590160_c1 | nmdc:mga07m45_590160_c1_208_489 | 92 |
| 764 | 3300050496 | nmdc:mga07m45_904608_c1 | nmdc:mga07m45_904608_c1_56_334 | 92 |
| 765 | 3300050509 | nmdc:mga0qj67_1199774_c1 | nmdc:mga0qj67_1199774_c1_171_449 | 92 |
| 766 | 3300050509 | nmdc:mga0qj67_26058_c1 | nmdc:mga0qj67_26058_c1_3990_4274 | 92 |
| 767 | 3300050509 | nmdc:mga0qj67_354997_c1 | nmdc:mga0qj67_354997_c1_160_438 | 92 |
| 768 | 3300050510 | nmdc:mga06r32_26679_c1 | nmdc:mga06r32_26679_c1_1287_1565 | 92 |
| 769 | 3300050510 | nmdc:mga06r32_946660_c1 | nmdc:mga06r32_946660_c1_381_659 | 92 |
| 770 | 3300050516 | nmdc:mga0sz30_330859_c1 | nmdc:mga0sz30_330859_c1_110_403 | 92 |
| 771 | 3300050516 | nmdc:mga0sz30_80476_c1 | nmdc:mga0sz30_80476_c1_559_837 | 92 |
| 772 | 3300053104 | Ga0500556_0000039 | Ga0500556_0000039_71945_72226 | 92 |
| 773 | 3300053111 | Ga0500572_020801 | Ga0500572_020801_1062_1343 | 92 |
| 774 | 3300053177 | Ga0500636_0000006 | Ga0500636_0000006_117228_117509 | 92 |
| 775 | 3300053177 | Ga0500636_0129561 | Ga0500636_0129561_544_825 | 92 |
| 776 | 3300054114 | Ga0501084_1246404 | Ga0501084_1246404_158_436 | 92 |
| 777 | 3300060353 | Ga0501082_0000006 | Ga0501082_0000006_78452_78730 | 92 |
| 778 | 3300060353 | Ga0501082_0080879 | Ga0501082_0080879_832_1110 | 92 |
| 779 | 3300060353 | Ga0501082_0385566 | Ga0501082_0385566_782_1060 | 92 |
| 780 | 3300061734 | Ga0530510_0062570 | Ga0530510_0062570_1947_2231 | 92 |
| 781 | 3300061734 | Ga0530510_1044026 | Ga0530510_1044026_195_476 | 92 |
| 782 | iso_pu_bacteria | 2919450847 | 2919451995 | 92 |
| 783 | iso_pu_bacteria | 8001845381 | 8001849919 | 92 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7zme-assembly1.cif.gz_6 | cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 2) - membrane arm | 0.9605 | 11 | 87 |
| 7d3u-assembly1.cif.gz_A | structure of mrp complex from dietzia sp. dq12-45-1b | 0.9565 | 15 | 82 |
| 6cfw-assembly1.cif.gz_D | cryoem structure of a respiratory membrane-bound hydrogenase | 0.9465 | 9 | 74 |
| 7p63-assembly1.cif.gz_J | complex i from e. coli, ddm/lmng-purified, under turnover at ph 6, closed state | 0.9453 | 10 | 87 |
| 7zdh-assembly1.cif.gz_J | complex i from ovis aries at ph7.4, closed state | 0.9408 | 13 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9XK79_1_97_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9515 | 13 | 84 | 1.10.287.3510 |
| 5xtdk00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9151 | 10 | 80 | 1.10.287.3510 |
| af_P03901_1_98_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9131 | 10 | 89 | 1.10.287.3510 |
| 6g72K00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8907 | 13 | 89 | 1.10.287.3510 |
| 4he8K00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8823 | 12 | 84 | 1.10.287.3510 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350WPA1-F1-model_v4 | Cation:proton antiporter | 0.9872 | 1 | 84 |
GO:0005886
GO:0015385 |
| AF-A0A4U6R5H1-F1-model_v4 | pH regulation protein F | 0.9809 | 7 | 82 |
GO:0005886
GO:0015385 |
| AF-A0A6B1G8P7-F1-model_v4 | Cation transporter | 0.9789 | 1 | 83 |
GO:0005886
GO:0015385 |
| AF-A0A424YWX2-F1-model_v4 | Cation:proton antiporter | 0.9746 | 8 | 84 |
GO:0005886
GO:0015385 |
| AF-A0A7W1SNR3-F1-model_v4 | K+/H+ antiporter subunit F | 0.9736 | 5 | 78 |
GO:0005886
GO:0015385 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar