F480632

General Info

Members Datasets Scaffolds Average Seq Length
782 311 722 267

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0093026|Ga0495670_0093026_267_1142
Length 291
Sequence LFEVACTIGTHLRPSRIFRLLRLPMRNADHAALFRSLHAQGLLQLANAWDAGSARLIESLGAPAIATTSAGVAWSRGYADGDELPIDHLLTAAAEIARVIRVPLSVDVEGGYSDDPDVVAGNVLQLAELGVVGINLEDGAGAPGALCAKIARIKQTLAARGLDVYINARTDVYLRGLAPAERRVEAVLERAAQYRDAGADGLFVPGLVETGAIRDIAAGAGLPLNVMLRPSLPALAELEALGVRRLSAGSDLAEAVFAHVGQLAGSFLQDGRAAAAPRMAYGEINALFGAR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231016 Pseudomonas sp. GM50 Isolate Nodule
9 2511231017 Pseudomonas sp. GM55 Isolate Nodule
10 2511231018 Pseudomonas sp. GM60 Isolate Nodule
11 2511231019 Pseudomonas sp. GM67 Isolate Nodule
12 2511231021 Pseudomonas sp. GM78 Isolate Nodule
13 2511231022 Pseudomonas sp. GM79 Isolate Nodule
14 2511231023 Pseudomonas sp. GM80 Isolate Nodule
15 2511231031 Pseudomonas sp. GM16 Isolate Nodule
16 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
17 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
18 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
19 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
20 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
21 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
22 2643221559 Lysobacter sp. Root559 Isolate Unclassified
23 2643221586 Lysobacter sp. Root667 Isolate Unclassified
24 2643221612 Lysobacter sp. Root76 Isolate Unclassified
25 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
26 2643221695 Lysobacter sp. Root494 Isolate Unclassified
27 2643221727 Lysobacter sp. Root96 Isolate Unclassified
28 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
29 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
30 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
31 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
32 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
33 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
34 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
35 2773857670 Pseudomonas sp. 478 Isolate Unclassified
36 2773857673 Pseudomonas sp. 443 Isolate Unclassified
37 2784132072 Pseudomonas sp. 460 Isolate Unclassified
38 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
39 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
40 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
41 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
42 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
43 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
44 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
45 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
46 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
47 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
48 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
49 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
50 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
51 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
52 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
53 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
54 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
55 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
56 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
57 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
58 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
59 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
60 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
61 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
64 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
65 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
66 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
68 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
69 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
70 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
71 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
72 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
73 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
176 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
177 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
178 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
184 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
185 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
186 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
187 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
188 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
189 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
190 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
191 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
192 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
193 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
194 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
195 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
196 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
197 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
200 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
205 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
209 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
230 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
231 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
234 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
235 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
251 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
272 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
273 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
274 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
275 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
276 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
277 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
283 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
294 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
295 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
296 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
297 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
303 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
304 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
308 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
309 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
310 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
311 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.33
Metatranscriptomes 0
Isolates 7.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.14
Nodule 1.92
Rhizoplane 1.92
Rhizosphere 83.38
Stem 0
Stem Tuber 0
Unclassified 6.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_56 2124908027 Bacteria 59451
2 SwRhRL2b_contig_3133948 2162886007 Bacteria 8023
3 Ga0055525_1000011 3300003759 Bacteria 503124
4 Ga0055524_1005261 3300003775 Bacteria 5816
5 Ga0055524_1035868 3300003775 Bacteria 1345
6 Ga0055524_1037096 3300003775 Bacteria 1298
7 Ga0055536_1003892 3300003781 Bacteria 7835
8 Ga0055536_1010660 3300003781 Bacteria 3616
9 Ga0055530_10000989 3300003791 Bacteria 22772
10 Ga0055531_10001774 3300003794 Bacteria 15341
11 Ga0055531_10005334 3300003794 Bacteria 7543
12 Ga0055531_10005746 3300003794 Bacteria 7186
13 Ga0055531_10006112 3300003794 Bacteria 6895
14 Ga0055531_10012823 3300003794 Bacteria 3909
15 Ga0065714_10000392 3300005288 Bacteria 5047
16 Ga0065714_10018431 3300005288 Bacteria 1993
17 Ga0065714_10068325 3300005288 Bacteria 4801
18 Ga0065714_10082798 3300005288 Bacteria 2287
19 Ga0065714_10123256 3300005288 Bacteria 1323
20 Ga0065704_10072534 3300005289 Bacteria 8358
21 Ga0065712_10003635 3300005290 Bacteria 7641
22 Ga0065715_10112752 3300005293 Bacteria 2518
23 Ga0070677_10027986 3300005333 Bacteria 2126
24 Ga0068869_100009073 3300005334 Bacteria 6445
25 Ga0068869_100036341 3300005334 Bacteria 3497
26 Ga0070689_100235665 3300005340 Bacteria 1506
27 Ga0070687_100252267 3300005343 Bacteria 1097
28 Ga0070692_10023323 3300005345 Bacteria 3031
29 Ga0070668_100152708 3300005347 Bacteria 1869
30 Ga0070669_100018896 3300005353 Bacteria 4926
31 Ga0070669_100058797 3300005353 Bacteria 2822
32 Ga0070674_100214025 3300005356 Bacteria 1495
33 Ga0070688_100211651 3300005365 Bacteria 1361
34 Ga0070667_100036766 3300005367 Bacteria 4106
35 Ga0070694_100041404 3300005444 Bacteria 3073
36 Ga0070663_100022875 3300005455 Bacteria 4183
37 Ga0070663_100164695 3300005455 Bacteria 1709
38 Ga0070678_100018247 3300005456 Bacteria 4546
39 Ga0070678_100063939 3300005456 Bacteria 2725
40 Ga0068867_100003939 3300005459 Bacteria 10446
41 Ga0068853_100316418 3300005539 Bacteria 1446
42 Ga0070672_100032145 3300005543 Bacteria 3958
43 Ga0070672_100041658 3300005543 Unclassified 3532
44 Ga0070686_100615399 3300005544 Bacteria 857
45 Ga0070695_100014547 3300005545 Bacteria 4745
46 Ga0070693_100210727 3300005547 Bacteria 1268
47 Ga0070665_100011801 3300005548 Bacteria 8824
48 Ga0070665_100106733 3300005548 Bacteria 2803
49 Ga0068854_100325855 3300005578 Bacteria 1250
50 Ga0068859_100047623 3300005617 Bacteria 4308
51 Ga0068861_100525568 3300005719 Bacteria 1074
52 Ga0068870_10063303 3300005840 Bacteria 1995
53 Ga0068863_100353126 3300005841 Bacteria 1432
54 Ga0068858_100734881 3300005842 Bacteria 961
55 Ga0068860_100029960 3300005843 Bacteria 5234
56 Ga0068860_100336538 3300005843 Bacteria 1483
57 Ga0068862_100068324 3300005844 Bacteria 3065
58 Ga0075432_10002606 3300006058 Bacteria 6021
59 Ga0075432_10008779 3300006058 Bacteria 3448
60 Ga0075431_100025057 3300006847 Bacteria 6117
61 Ga0068865_100004132 3300006881 Bacteria 8727
62 Ga0097620_100047623 3300006931 Bacteria 4308
63 Ga0079104_1000901 3300006946 Bacteria 24122
64 Ga0105251_10002336 3300009011 Bacteria 15006
65 Ga0105251_10006905 3300009011 Bacteria 7122
66 Ga0105251_10029374 3300009011 Bacteria 2769
67 Ga0105251_10052025 3300009011 Bacteria 1951
68 Ga0105244_10037171 3300009036 Bacteria 2547
69 Ga0105244_10056666 3300009036 Bacteria 1983
70 Ga0105244_10100791 3300009036 Bacteria 1413
71 Ga0105244_10103690 3300009036 Bacteria 1389
72 Ga0105250_10000705 3300009092 Bacteria 20587
73 Ga0105250_10008470 3300009092 Bacteria 4366
74 Ga0111539_10100551 3300009094 Bacteria 3395
75 Ga0105247_10000025 3300009101 Bacteria 208459
76 Ga0105243_10000252 3300009148 Bacteria 61589
77 Ga0105249_10055557 3300009553 Bacteria 3622
78 Ga0105029_100755 3300009984 Bacteria 1831
79 Ga0105246_10000121 3300011119 Bacteria 35746
80 Ga0105246_10272648 3300011119 Bacteria 1353
81 Ga0157345_1000052 3300012498 Bacteria 25093
82 Ga0157373_10000588 3300013100 Bacteria 28326
83 Ga0157373_10028432 3300013100 Bacteria 4033
84 Ga0157373_10175300 3300013100 Bacteria 1509
85 Ga0157371_10001414 3300013102 Bacteria 24972
86 Ga0157370_10062506 3300013104 Bacteria 3531
87 Ga0157370_10388656 3300013104 Bacteria 1285
88 Ga0157370_10443609 3300013104 Bacteria 1193
89 Ga0157369_10000310 3300013105 Bacteria 65383
90 Ga0163162_10011262 3300013306 Bacteria 8720
91 Ga0163162_10014155 3300013306 Bacteria 7795
92 Ga0163162_10172335 3300013306 Bacteria 2289
93 Ga0163162_10224332 3300013306 Bacteria 2009
94 Ga0157375_10020345 3300013308 Bacteria 6060
95 Ga0163163_10028846 3300014325 Bacteria 5334
96 Ga0157380_10119917 3300014326 Bacteria 2226
97 Ga0157380_10177597 3300014326 Bacteria 1868
98 Ga0157380_10372347 3300014326 Bacteria 1345
99 Ga0182008_10031705 3300014497 Bacteria 2658
100 Ga0157379_10018572 3300014968 Bacteria 6133
101 Ga0182006_1000717 3300015261 Bacteria 22942
102 Ga0182006_1032721 3300015261 Bacteria 2088
103 Ga0182007_10000511 3300015262 Bacteria 22909
104 Ga0182005_1001583 3300015265 Bacteria 8963
105 Ga0182005_1017421 3300015265 Bacteria 1989
106 Ga0182005_1048350 3300015265 Bacteria 1156
107 Ga0163161_10000001 3300017792 Bacteria 2041488
108 Ga0163161_10000183 3300017792 Bacteria 57397
109 Ga0163161_10002214 3300017792 Bacteria 14000
110 Ga0163161_10008321 3300017792 Bacteria 7183
111 Ga0163161_10047923 3300017792 Bacteria 3085
112 Ga0163161_10134128 3300017792 Bacteria 1870
113 Ga0163161_10290143 3300017792 Bacteria 1286
114 Ga0213872_10048194 3300021361 Bacteria 1936
115 Ga0209563_100005 3300025230 Bacteria 1774893
116 Ga0209563_100920 3300025230 Bacteria 8665
117 Ga0207425_1025497 3300025245 Bacteria 1220
118 Ga0209673_1003514 3300025273 Bacteria 9186
119 Ga0209673_1024962 3300025273 Bacteria 1997
120 Ga0209130_1005337 3300025284 Bacteria 4499
121 Ga0209675_1001721 3300025291 Bacteria 12055
122 Ga0209675_1002868 3300025291 Bacteria 8555
123 Ga0209675_1021578 3300025291 Bacteria 1714
124 Ga0209676_1000400 3300025292 Bacteria 79157
125 Ga0209676_1001340 3300025292 Bacteria 24705
126 Ga0209676_1001897 3300025292 Bacteria 17053
127 Ga0209676_1002413 3300025292 Bacteria 13343
128 Ga0209676_1006874 3300025292 Bacteria 5505
129 Ga0209676_1007996 3300025292 Bacteria 4819
130 Ga0209676_1020237 3300025292 Bacteria 2266
131 Ga0209676_1031724 3300025292 Bacteria 1598
132 Ga0209676_1040927 3300025292 Bacteria 1300
133 Ga0209025_1003328 3300025294 Bacteria 15447
134 Ga0209025_1041961 3300025294 Bacteria 1951
135 Ga0209025_1051145 3300025294 Bacteria 1644
136 Ga0209564_1005102 3300025295 Bacteria 7642
137 Ga0209758_1010771 3300025297 Bacteria 5414
138 Ga0209758_1029801 3300025297 Bacteria 2273
139 Ga0209050_1000528 3300025298 Bacteria 63464
140 Ga0209050_1015172 3300025298 Bacteria 3258
141 Ga0209256_1001764 3300025299 Bacteria 20583
142 Ga0209256_1002020 3300025299 Bacteria 18091
143 Ga0209256_1005256 3300025299 Bacteria 7560
144 Ga0209051_1005323 3300025303 Bacteria 7574
145 Ga0209257_1000080 3300025304 Bacteria 312038
146 Ga0209257_1000727 3300025304 Bacteria 50163
147 Ga0209257_1001998 3300025304 Bacteria 21872
148 Ga0209257_1008260 3300025304 Bacteria 5984
149 Ga0209257_1010641 3300025304 Bacteria 4609
150 Ga0207697_10012555 3300025315 Bacteria 3550
151 Ga0207696_1000001 3300025711 Bacteria 2579611
152 Ga0207696_1000051 3300025711 Bacteria 276833
153 Ga0207696_1001731 3300025711 Bacteria 11333
154 Ga0207696_1004943 3300025711 Bacteria 5633
155 Ga0207696_1027071 3300025711 Bacteria 1770
156 Ga0207655_1002984 3300025728 Bacteria 12977
157 Ga0207655_1007085 3300025728 Bacteria 7327
158 Ga0207655_1019490 3300025728 Bacteria 3541
159 Ga0207655_1066020 3300025728 Bacteria 1370
160 Ga0207655_1070051 3300025728 Bacteria 1308
161 Ga0207713_1000024 3300025735 Bacteria 339156
162 Ga0207713_1002745 3300025735 Bacteria 12506
163 Ga0207713_1003122 3300025735 Bacteria 11491
164 Ga0207713_1004239 3300025735 Bacteria 9370
165 Ga0207713_1006435 3300025735 Bacteria 7153
166 Ga0207713_1033207 3300025735 Bacteria 2257
167 Ga0207682_10008871 3300025893 Bacteria 3977
168 Ga0207710_10000140 3300025900 Bacteria 83223
169 Ga0207645_10015138 3300025907 Bacteria 5137
170 Ga0207645_10413671 3300025907 Bacteria 908
171 Ga0207643_10021748 3300025908 Bacteria 3529
172 Ga0207662_10070937 3300025918 Bacteria 2108
173 Ga0207681_10013906 3300025923 Bacteria 4987
174 Ga0207659_10065659 3300025926 Bacteria 2630
175 Ga0207706_10053376 3300025933 Bacteria 3568
176 Ga0207709_10000011 3300025935 Bacteria 552881
177 Ga0207669_10300570 3300025937 Bacteria 1219
178 Ga0207704_10475435 3300025938 Bacteria 1002
179 Ga0207691_10001549 3300025940 Bacteria 22817
180 Ga0207691_10064024 3300025940 Bacteria 3333
181 Ga0207689_10006928 3300025942 Bacteria 9969
182 Ga0207689_10064866 3300025942 Bacteria 3004
183 Ga0207689_10185418 3300025942 Bacteria 1716
184 Ga0207712_10027504 3300025961 Bacteria 3798
185 Ga0207703_10508367 3300026035 Bacteria 1132
186 Ga0207678_10043692 3300026067 Bacteria 3877
187 Ga0207678_10186354 3300026067 Bacteria 1772
188 Ga0207641_10118235 3300026088 Bacteria 2361
189 Ga0207648_10005136 3300026089 Bacteria 13253
190 Ga0207648_10055766 3300026089 Bacteria 3449
191 Ga0207675_100023576 3300026118 Bacteria 5726
192 Ga0207683_10111005 3300026121 Bacteria 2455
193 Ga0207683_10224353 3300026121 Bacteria 1713
194 Ga0209281_1000063 3300027111 Bacteria 288465
195 Ga0207428_10012077 3300027907 Bacteria 7601
196 Ga0207428_10045837 3300027907 Bacteria 3518
197 Ga0207428_10152202 3300027907 Bacteria 1760
198 Ga0268266_10125808 3300028379 Bacteria 2287
199 Ga0268266_10206869 3300028379 Bacteria 1798
200 Ga0268266_10388094 3300028379 Bacteria 1318
201 Ga0268264_10111434 3300028381 Bacteria 2397
202 Ga0307509_10085534 3300031507 Bacteria 3245
203 Ga0307412_10011330 3300031911 Bacteria 5161
204 Ga0307412_10062413 3300031911 Bacteria 2509
205 Ga0307414_10014553 3300032004 Bacteria 4722
206 Ga0307411_10106882 3300032005 Bacteria 1993
207 Ga0307510_10001323 3300033180 Bacteria 27015
208 Ga0373941_0014226 3300035115 Bacteria 2120
209 Ga0395905_0155536 3300037471 Bacteria 2151
210 Ga0237819_02002 3300038705 Bacteria 4542
211 Ga0436361_0580218 3300039447 Bacteria 3317
212 Ga0436361_0669402 3300039447 Bacteria 1440
213 Ga0436361_0770940 3300039447 Bacteria 7519
214 Ga0439436_0017230 3300041404 Bacteria 2162
215 Ga0439438_008064 3300041405 Bacteria 3535
216 Ga0439438_011739 3300041405 Bacteria 2716
217 Ga0439447_000844 3300041407 Bacteria 11246
218 Ga0439447_009389 3300041407 Bacteria 2970
219 Ga0439466_0005274 3300041411 Bacteria 4945
220 Ga0439466_0012167 3300041411 Bacteria 3175
221 Ga0439466_0031155 3300041411 Bacteria 1825
222 Ga0439466_0044669 3300041411 Bacteria 1467
223 Ga0439465_0000085 3300041413 Bacteria 20674
224 Ga0439445_0006836 3300042004 Bacteria 2632
225 Ga0439432_006809 3300042006 Bacteria 4069
226 Ga0439432_007611 3300042006 Bacteria 3829
227 Ga0439449_0000042 3300042007 Bacteria 38864
228 Ga0439449_0038389 3300042007 Bacteria 1780
229 Ga0439451_013374 3300042009 Bacteria 1658
230 Ga0439452_002179 3300042010 Bacteria 7404
231 Ga0439452_003644 3300042010 Bacteria 5346
232 Ga0439452_030998 3300042010 Bacteria 1315
233 Ga0439456_001377 3300042013 Bacteria 4868
234 Ga0450919_000828 3300042121 Bacteria 3988
235 Ga0450919_003633 3300042121 Bacteria 1914
236 Ga0450920_004629 3300042122 Bacteria 2424
237 Ga0450922_000653 3300042124 Bacteria 3624
238 Ga0450922_002610 3300042124 Bacteria 1685
239 Ga0450890_003991 3300042127 Bacteria 1941
240 Ga0450902_015013 3300042137 Bacteria 1254
241 Ga0450903_000525 3300042138 Bacteria 8016
242 Ga0450903_001400 3300042138 Bacteria 4498
243 Ga0450905_005349 3300042142 Bacteria 1723
244 Ga0450906_007693 3300042145 Bacteria 2118
245 Ga0450907_000046 3300042146 Bacteria 52226
246 Ga0450907_002605 3300042146 Bacteria 3377
247 Ga0450907_005464 3300042146 Bacteria 2142
248 Ga0450908_003042 3300042184 Bacteria 3271
249 Ga0450909_001216 3300042185 Bacteria 3572
250 Ga0450909_002620 3300042185 Bacteria 2553
251 Ga0439434_0000072 3300042435 Bacteria 24922
252 Ga0439434_0009625 3300042435 Bacteria 2844
253 Ga0439460_0033348 3300042461 Bacteria 1478
254 Ga0439460_0043132 3300042461 Bacteria 1331
255 Ga0439460_0046387 3300042461 Bacteria 1291
256 Ga0450893_0008750 3300042532 Bacteria 1650
257 Ga0450893_0021031 3300042532 Bacteria 1125
258 Ga0439440_0000209 3300042993 Bacteria 9110
259 Ga0439440_0031223 3300042993 Bacteria 1258
260 Ga0466972_0000313 3300044658 Bacteria 27954
261 Ga0466965_0062018 3300044683 Bacteria 1870
262 Ga0453684_0586180 3300044712 Bacteria 1224
263 Ga0495617_000745 3300046452 Bacteria 16015
264 Ga0495617_000762 3300046452 Bacteria 15768
265 Ga0495617_002981 3300046452 Bacteria 6472
266 Ga0495617_004376 3300046452 Bacteria 5147
267 Ga0495617_007588 3300046452 Bacteria 3757
268 Ga0495617_009097 3300046452 Bacteria 3416
269 Ga0495617_016648 3300046452 Bacteria 2486
270 Ga0495617_019164 3300046452 Bacteria 2313
271 Ga0495617_030252 3300046452 Bacteria 1820
272 Ga0495617_030746 3300046452 Bacteria 1804
273 Ga0495617_057064 3300046452 Bacteria 1294
274 Ga0495627_000018 3300046453 Bacteria 315125
275 Ga0495627_000488 3300046453 Bacteria 33292
276 Ga0495627_000695 3300046453 Bacteria 25747
277 Ga0495627_003025 3300046453 Bacteria 7679
278 Ga0495592_0054436 3300046454 Bacteria 2964
279 Ga0495603_0040351 3300046455 Bacteria 2794
280 Ga0495590_0000526 3300046457 Bacteria 18435
281 Ga0495590_0000590 3300046457 Bacteria 17170
282 Ga0495590_0002065 3300046457 Bacteria 8421
283 Ga0495590_0014688 3300046457 Bacteria 2855
284 Ga0495590_0079667 3300046457 Bacteria 1153
285 Ga0495591_000662 3300046458 Bacteria 25480
286 Ga0495591_001053 3300046458 Bacteria 18531
287 Ga0495591_001801 3300046458 Bacteria 12697
288 Ga0495591_006042 3300046458 Bacteria 5453
289 Ga0495591_007275 3300046458 Bacteria 4737
290 Ga0495591_009595 3300046458 Bacteria 3829
291 Ga0495591_012653 3300046458 Bacteria 3128
292 Ga0495591_014787 3300046458 Bacteria 2787
293 Ga0495591_015807 3300046458 Bacteria 2653
294 Ga0495629_0109292 3300046459 Bacteria 1928
295 Ga0495638_0002131 3300046460 Bacteria 16640
296 Ga0495638_0025467 3300046460 Bacteria 3845
297 Ga0495638_0039599 3300046460 Bacteria 2991
298 Ga0495638_0040998 3300046460 Bacteria 2931
299 Ga0495638_0047180 3300046460 Bacteria 2702
300 Ga0495638_0101369 3300046460 Bacteria 1721
301 Ga0495638_0127633 3300046460 Bacteria 1497
302 Ga0495653_0002927 3300046463 Bacteria 13659
303 Ga0495653_0032117 3300046463 Bacteria 4171
304 Ga0495653_0134771 3300046463 Bacteria 1743
305 Ga0495650_0001708 3300046471 Bacteria 20183
306 Ga0495650_0002550 3300046471 Bacteria 14477
307 Ga0495650_0005686 3300046471 Bacteria 7994
308 Ga0495650_0012711 3300046471 Bacteria 4509
309 Ga0495650_0022720 3300046471 Bacteria 3003
310 Ga0495650_0035240 3300046471 Bacteria 2204
311 Ga0495650_0047085 3300046471 Bacteria 1805
312 Ga0495650_0094991 3300046471 Bacteria 1127
313 Ga0495582_0009290 3300046473 Bacteria 5423
314 Ga0495605_0000193 3300046474 Bacteria 76229
315 Ga0495605_0001045 3300046474 Bacteria 18527
316 Ga0495605_0001305 3300046474 Bacteria 16514
317 Ga0495605_0004260 3300046474 Bacteria 8427
318 Ga0495605_0005110 3300046474 Bacteria 7650
319 Ga0495605_0009011 3300046474 Bacteria 5616
320 Ga0495605_0010497 3300046474 Bacteria 5180
321 Ga0495605_0014946 3300046474 Bacteria 4233
322 Ga0495605_0051810 3300046474 Bacteria 1997
323 Ga0495639_0006694 3300046475 Bacteria 4958
324 Ga0495639_0103135 3300046475 Bacteria 1348
325 Ga0495664_0151700 3300046477 Bacteria 1406
326 Ga0495584_0000376 3300046491 Bacteria 30692
327 Ga0495584_0000442 3300046491 Bacteria 28587
328 Ga0495584_0001269 3300046491 Bacteria 15364
329 Ga0495584_0006321 3300046491 Bacteria 6208
330 Ga0495584_0017355 3300046491 Bacteria 3665
331 Ga0495584_0022233 3300046491 Bacteria 3219
332 Ga0495584_0024271 3300046491 Bacteria 3075
333 Ga0495584_0030316 3300046491 Bacteria 2740
334 Ga0495584_0054354 3300046491 Bacteria 2015
335 Ga0495584_0110081 3300046491 Bacteria 1393
336 Ga0495584_0144455 3300046491 Bacteria 1208
337 Ga0495585_0001045 3300046492 Bacteria 22938
338 Ga0495585_0003021 3300046492 Bacteria 11595
339 Ga0495585_0013590 3300046492 Bacteria 4758
340 Ga0495585_0017713 3300046492 Bacteria 4113
341 Ga0495585_0058308 3300046492 Bacteria 2130
342 Ga0495585_0064105 3300046492 Bacteria 2015
343 Ga0495585_0075489 3300046492 Bacteria 1832
344 Ga0495585_0125111 3300046492 Bacteria 1357
345 Ga0495594_0021296 3300046499 Bacteria 3460
346 Ga0495594_0025048 3300046499 Bacteria 3206
347 Ga0495596_0019395 3300046500 Bacteria 2794
348 Ga0495607_0000963 3300046501 Bacteria 26619
349 Ga0495607_0003226 3300046501 Bacteria 12573
350 Ga0495607_0005264 3300046501 Bacteria 9310
351 Ga0495607_0010078 3300046501 Bacteria 6363
352 Ga0495607_0017684 3300046501 Bacteria 4567
353 Ga0495607_0028476 3300046501 Bacteria 3447
354 Ga0495607_0041793 3300046501 Bacteria 2721
355 Ga0495607_0047282 3300046501 Bacteria 2521
356 Ga0495607_0049085 3300046501 Bacteria 2463
357 Ga0495607_0059576 3300046501 Bacteria 2177
358 Ga0495607_0061071 3300046501 Bacteria 2142
359 Ga0495607_0079948 3300046501 Bacteria 1799
360 Ga0495607_0137238 3300046501 Bacteria 1265
361 Ga0495607_0160996 3300046501 Bacteria 1140
362 Ga0495583_0001715 3300046506 Bacteria 21058
363 Ga0495583_0002503 3300046506 Bacteria 15572
364 Ga0495583_0025867 3300046506 Bacteria 2923
365 Ga0495583_0071094 3300046506 Bacteria 1529
366 Ga0495606_0000176 3300046507 Bacteria 113311
367 Ga0495606_0001321 3300046507 Bacteria 33870
368 Ga0495606_0001801 3300046507 Bacteria 27281
369 Ga0495606_0005034 3300046507 Bacteria 12864
370 Ga0495606_0006941 3300046507 Bacteria 10298
371 Ga0495606_0012768 3300046507 Bacteria 6696
372 Ga0495606_0017298 3300046507 Bacteria 5458
373 Ga0495606_0041104 3300046507 Bacteria 3102
374 Ga0495606_0202990 3300046507 Bacteria 1128
375 Ga0495610_0005237 3300046512 Bacteria 9277
376 Ga0495610_0007098 3300046512 Bacteria 7558
377 Ga0495610_0008151 3300046512 Bacteria 6841
378 Ga0495610_0013966 3300046512 Bacteria 4745
379 Ga0495610_0014192 3300046512 Bacteria 4693
380 Ga0495616_0000704 3300046513 Bacteria 24772
381 Ga0495616_0001304 3300046513 Bacteria 17440
382 Ga0495616_0001608 3300046513 Bacteria 15484
383 Ga0495616_0002728 3300046513 Bacteria 11556
384 Ga0495616_0005421 3300046513 Bacteria 7859
385 Ga0495616_0050833 3300046513 Bacteria 2070
386 Ga0495616_0084021 3300046513 Bacteria 1518
387 Ga0495616_0087582 3300046513 Bacteria 1479
388 Ga0495616_0143474 3300046513 Bacteria 1085
389 Ga0495620_0000532 3300046515 Bacteria 24382
390 Ga0495620_0004291 3300046515 Bacteria 8063
391 Ga0495620_0004727 3300046515 Bacteria 7654
392 Ga0495620_0005775 3300046515 Bacteria 6874
393 Ga0495620_0048981 3300046515 Bacteria 1810
394 Ga0495620_0052259 3300046515 Bacteria 1736
395 Ga0495630_0034327 3300046517 Bacteria 3788
396 Ga0495630_0150168 3300046517 Bacteria 1772
397 Ga0495630_0218368 3300046517 Bacteria 1455
398 Ga0495631_0000401 3300046518 Bacteria 29978
399 Ga0495631_0000547 3300046518 Bacteria 25286
400 Ga0495631_0007445 3300046518 Bacteria 5565
401 Ga0495631_0016102 3300046518 Bacteria 3573
402 Ga0495631_0048159 3300046518 Bacteria 1869
403 Ga0495631_0049336 3300046518 Bacteria 1843
404 Ga0495631_0083511 3300046518 Bacteria 1376
405 Ga0495632_0001346 3300046519 Bacteria 20643
406 Ga0495632_0001697 3300046519 Bacteria 17978
407 Ga0495632_0002048 3300046519 Bacteria 15845
408 Ga0495632_0002133 3300046519 Bacteria 15386
409 Ga0495632_0007869 3300046519 Bacteria 6627
410 Ga0495632_0008734 3300046519 Bacteria 6177
411 Ga0495632_0012801 3300046519 Bacteria 4815
412 Ga0495632_0039797 3300046519 Bacteria 2370
413 Ga0495632_0062120 3300046519 Bacteria 1811
414 Ga0495632_0122178 3300046519 Bacteria 1216
415 Ga0495632_0137220 3300046519 Bacteria 1136
416 Ga0495637_0000721 3300046520 Bacteria 22609
417 Ga0495637_0000839 3300046520 Bacteria 20292
418 Ga0495637_0002282 3300046520 Bacteria 10628
419 Ga0495637_0002350 3300046520 Bacteria 10481
420 Ga0495637_0007192 3300046520 Bacteria 5541
421 Ga0495637_0046467 3300046520 Bacteria 1836
422 Ga0495637_0125047 3300046520 Bacteria 986
423 Ga0495643_0006509 3300046522 Bacteria 7685
424 Ga0495643_0010258 3300046522 Bacteria 5768
425 Ga0495643_0025412 3300046522 Bacteria 3351
426 Ga0495643_0028657 3300046522 Bacteria 3119
427 Ga0495643_0035773 3300046522 Bacteria 2732
428 Ga0495644_0004777 3300046523 Bacteria 5322
429 Ga0495644_0017157 3300046523 Bacteria 2769
430 Ga0495644_0061504 3300046523 Bacteria 1411
431 Ga0495644_0065915 3300046523 Bacteria 1360
432 Ga0495648_0005373 3300046524 Bacteria 10660
433 Ga0495648_0007967 3300046524 Bacteria 8402
434 Ga0495648_0009398 3300046524 Bacteria 7586
435 Ga0495648_0011346 3300046524 Bacteria 6716
436 Ga0495648_0025298 3300046524 Bacteria 4021
437 Ga0495648_0030638 3300046524 Bacteria 3553
438 Ga0495648_0031368 3300046524 Bacteria 3500
439 Ga0495648_0032693 3300046524 Bacteria 3409
440 Ga0495648_0034742 3300046524 Bacteria 3277
441 Ga0495648_0040164 3300046524 Bacteria 2969
442 Ga0495648_0054761 3300046524 Bacteria 2408
443 Ga0495648_0141069 3300046524 Bacteria 1268
444 Ga0495666_0018179 3300046526 Bacteria 3501
445 Ga0495666_0082870 3300046526 Bacteria 1516
446 Ga0495642_0000250 3300046528 Bacteria 30239
447 Ga0495642_0000798 3300046528 Bacteria 15293
448 Ga0495642_0001543 3300046528 Bacteria 10199
449 Ga0495654_0000444 3300046530 Bacteria 35120
450 Ga0495654_0000803 3300046530 Bacteria 24100
451 Ga0495654_0001816 3300046530 Bacteria 14212
452 Ga0495654_0004000 3300046530 Bacteria 8870
453 Ga0495654_0032058 3300046530 Bacteria 2664
454 Ga0495654_0041200 3300046530 Bacteria 2297
455 Ga0495654_0044006 3300046530 Bacteria 2210
456 Ga0495654_0058990 3300046530 Bacteria 1849
457 Ga0495654_0073010 3300046530 Bacteria 1623
458 Ga0495586_0014731 3300046535 Bacteria 4155
459 Ga0495587_0040357 3300046536 Bacteria 2790
460 Ga0495609_0001178 3300046538 Bacteria 18050
461 Ga0495609_0005130 3300046538 Bacteria 6975
462 Ga0495609_0007374 3300046538 Bacteria 5498
463 Ga0495609_0008247 3300046538 Bacteria 5114
464 Ga0495609_0017110 3300046538 Bacteria 3370
465 Ga0495609_0023262 3300046538 Bacteria 2849
466 Ga0495609_0034163 3300046538 Bacteria 2306
467 Ga0495609_0037671 3300046538 Bacteria 2181
468 Ga0495609_0055921 3300046538 Bacteria 1749
469 Ga0495597_0004423 3300046542 Bacteria 7722
470 Ga0495597_0006345 3300046542 Bacteria 6124
471 Ga0495597_0007496 3300046542 Bacteria 5533
472 Ga0495597_0011586 3300046542 Bacteria 4271
473 Ga0495597_0069246 3300046542 Bacteria 1523
474 Ga0495622_0004354 3300046557 Bacteria 6590
475 Ga0495622_0007198 3300046557 Bacteria 5168
476 Ga0495622_0048933 3300046557 Bacteria 1963
477 Ga0495622_0052325 3300046557 Bacteria 1894
478 Ga0495622_0072204 3300046557 Bacteria 1592
479 Ga0495622_0078867 3300046557 Bacteria 1516
480 Ga0495633_0000867 3300046558 Bacteria 26255
481 Ga0495633_0006119 3300046558 Bacteria 7205
482 Ga0495633_0033814 3300046558 Bacteria 2463
483 Ga0495633_0111543 3300046558 Bacteria 1268
484 Ga0495656_0004627 3300046615 Bacteria 4725
485 Ga0495656_0015124 3300046615 Bacteria 2907
486 Ga0495656_0023484 3300046615 Bacteria 2427
487 Ga0495656_0047346 3300046615 Bacteria 1823
488 Ga0495656_0158112 3300046615 Bacteria 1099
489 Ga0495668_0002037 3300046616 Bacteria 17610
490 Ga0495668_0011417 3300046616 Bacteria 5317
491 Ga0495668_0048617 3300046616 Bacteria 2353
492 Ga0495668_0089068 3300046616 Bacteria 1691
493 Ga0495668_0089153 3300046616 Bacteria 1690
494 Ga0495634_0001891 3300046642 Bacteria 17961
495 Ga0495611_0000468 3300046648 Bacteria 24110
496 Ga0495611_0003233 3300046648 Bacteria 7210
497 Ga0495625_0002907 3300046660 Bacteria 17906
498 Ga0495625_0004936 3300046660 Bacteria 12404
499 Ga0495625_0017184 3300046660 Bacteria 5665
500 Ga0495625_0067664 3300046660 Bacteria 2513
501 Ga0495625_0108893 3300046660 Bacteria 1895
502 Ga0495625_0141689 3300046660 Bacteria 1621
503 Ga0495625_0204660 3300046660 Bacteria 1300
504 Ga0495625_0261928 3300046660 Bacteria 1118
505 Ga0495635_0001260 3300046663 Bacteria 16939
506 Ga0495659_0020306 3300046664 Bacteria 2229
507 Ga0495659_0086512 3300046664 Bacteria 1197
508 Ga0495659_0089552 3300046664 Bacteria 1179
509 Ga0495661_0011651 3300046665 Bacteria 5959
510 Ga0495661_0038255 3300046665 Bacteria 2990
511 Ga0495661_0040580 3300046665 Bacteria 2885
512 Ga0495661_0070295 3300046665 Bacteria 2049
513 Ga0495661_0138156 3300046665 Bacteria 1328
514 Ga0495588_0020068 3300046674 Bacteria 3279
515 Ga0495588_0049632 3300046674 Bacteria 2158
516 Ga0495588_0071455 3300046674 Bacteria 1805
517 Ga0495588_0108228 3300046674 Bacteria 1463
518 Ga0495588_0144299 3300046674 Bacteria 1258
519 Ga0495623_0001367 3300046679 Bacteria 16547
520 Ga0495646_0001267 3300046680 Bacteria 14846
521 Ga0495646_0019328 3300046680 Bacteria 4314
522 Ga0495646_0071714 3300046680 Bacteria 2037
523 Ga0495669_0005602 3300046684 Bacteria 5239
524 Ga0495613_0016685 3300046689 Bacteria 5467
525 Ga0495613_0027894 3300046689 Bacteria 4203
526 Ga0495613_0033897 3300046689 Bacteria 3792
527 Ga0495624_0001286 3300046690 Bacteria 19787
528 Ga0495624_0127975 3300046690 Bacteria 1558
529 Ga0495670_0003476 3300046691 Bacteria 7737
530 Ga0495670_0010629 3300046691 Bacteria 4523
531 Ga0495670_0021869 3300046691 Bacteria 3156
532 Ga0495670_0034972 3300046691 Bacteria 2503
533 Ga0495670_0093026 3300046691 Bacteria 1545
534 Ga0495670_0123616 3300046691 Bacteria 1345
535 Ga0495670_0125762 3300046691 Bacteria 1334
536 Ga0495671_0000094 3300046692 Bacteria 83635
537 Ga0495671_0003431 3300046692 Bacteria 9734
538 Ga0495671_0004200 3300046692 Bacteria 8674
539 Ga0495671_0005088 3300046692 Bacteria 7737
540 Ga0495671_0007897 3300046692 Bacteria 6018
541 Ga0495671_0028726 3300046692 Bacteria 2861
542 Ga0495671_0035073 3300046692 Bacteria 2549
543 Ga0495671_0040241 3300046692 Bacteria 2357
544 Ga0495671_0140952 3300046692 Bacteria 1174
545 Ga0495649_0001875 3300046694 Bacteria 15372
546 Ga0495649_0008206 3300046694 Bacteria 6293
547 Ga0495649_0012389 3300046694 Bacteria 4963
548 Ga0495649_0018514 3300046694 Bacteria 3917
549 Ga0495649_0018714 3300046694 Bacteria 3892
550 Ga0495649_0033805 3300046694 Bacteria 2814
551 Ga0495649_0038544 3300046694 Bacteria 2621
552 Ga0495589_0000580 3300046794 Bacteria 25222
553 Ga0495589_0001331 3300046794 Bacteria 14516
554 Ga0495589_0005527 3300046794 Bacteria 6666
555 Ga0495589_0006916 3300046794 Bacteria 5957
556 Ga0495589_0030423 3300046794 Bacteria 2718
557 Ga0495589_0042791 3300046794 Bacteria 2256
558 Ga0495589_0044815 3300046794 Bacteria 2198
559 Ga0495600_0002832 3300046809 Bacteria 10089
560 Ga0495600_0052523 3300046809 Bacteria 2661
561 Ga0495660_0001478 3300046810 Bacteria 15991
562 Ga0495660_0010035 3300046810 Bacteria 5508
563 Ga0495660_0012868 3300046810 Bacteria 4852
564 Ga0495660_0013641 3300046810 Bacteria 4710
565 Ga0495660_0019355 3300046810 Bacteria 3908
566 Ga0495660_0031273 3300046810 Bacteria 2993
567 Ga0495660_0056295 3300046810 Bacteria 2125
568 Ga0495660_0081307 3300046810 Bacteria 1698
569 Ga0495581_0001153 3300047315 Bacteria 14465
570 Ga0495581_0210044 3300047315 Bacteria 1138
571 Ga0495604_0087936 3300047317 Bacteria 2312
572 Ga0495636_0000187 3300047318 Bacteria 24622
573 Ga0495636_0002043 3300047318 Bacteria 7741
574 Ga0495636_0002708 3300047318 Bacteria 6836
575 Ga0495636_0033839 3300047318 Bacteria 2102
576 Ga0495636_0115825 3300047318 Bacteria 1182
577 Ga0495674_0066255 3300047319 Bacteria 3134
578 Ga0495672_0002470 3300047320 Bacteria 16990
579 Ga0495672_0002731 3300047320 Bacteria 15820
580 Ga0495672_0003013 3300047320 Bacteria 14812
581 Ga0495672_0003388 3300047320 Bacteria 13709
582 Ga0495672_0006068 3300047320 Bacteria 9439
583 Ga0495672_0007951 3300047320 Bacteria 7905
584 Ga0495672_0011726 3300047320 Bacteria 6163
585 Ga0495672_0013597 3300047320 Bacteria 5606
586 Ga0495672_0016439 3300047320 Bacteria 4986
587 Ga0495672_0035749 3300047320 Bacteria 3057
588 Ga0495676_0001430 3300047321 Bacteria 20579
589 Ga0495676_0037111 3300047321 Bacteria 4060
590 Ga0495680_0004433 3300047322 Bacteria 13408
591 Ga0495680_0004958 3300047322 Bacteria 12594
592 Ga0495680_0005052 3300047322 Bacteria 12458
593 Ga0495680_0052832 3300047322 Bacteria 3165
594 Ga0495680_0329369 3300047322 Bacteria 1067
595 Ga0495683_0000479 3300047323 Bacteria 31100
596 Ga0495683_0006160 3300047323 Bacteria 6575
597 Ga0495683_0010817 3300047323 Bacteria 4812
598 Ga0495683_0027561 3300047323 Bacteria 2904
599 Ga0495683_0060891 3300047323 Bacteria 1870
600 Ga0495683_0082249 3300047323 Bacteria 1569
601 Ga0495687_002016 3300047443 Bacteria 17193
602 Ga0495687_002564 3300047443 Bacteria 14339
603 Ga0495687_002722 3300047443 Bacteria 13710
604 Ga0495675_0029964 3300047444 Bacteria 3471
605 Ga0495675_0116302 3300047444 Bacteria 1667
606 Ga0495677_0004924 3300047445 Bacteria 5091
607 Ga0495679_001806 3300047446 Bacteria 11651
608 Ga0495679_003804 3300047446 Bacteria 7146
609 Ga0495679_013769 3300047446 Bacteria 3021
610 Ga0495679_017758 3300047446 Bacteria 2540
611 Ga0495679_018923 3300047446 Bacteria 2432
612 Ga0495679_023089 3300047446 Bacteria 2116
613 Ga0495679_048514 3300047446 Bacteria 1283
614 Ga0495673_0000279 3300047469 Bacteria 69195
615 Ga0495673_0000753 3300047469 Bacteria 30736
616 Ga0495673_0001887 3300047469 Bacteria 15731
617 Ga0495673_0006271 3300047469 Bacteria 7013
618 Ga0495673_0008945 3300047469 Bacteria 5577
619 Ga0495673_0011098 3300047469 Bacteria 4866
620 Ga0495673_0012896 3300047469 Bacteria 4408
621 Ga0495673_0017271 3300047469 Bacteria 3670
622 Ga0495673_0020414 3300047469 Bacteria 3298
623 Ga0495673_0023802 3300047469 Bacteria 2971
624 Ga0495673_0039379 3300047469 Bacteria 2144
625 Ga0495673_0040848 3300047469 Bacteria 2091
626 Ga0495673_0041083 3300047469 Bacteria 2084
627 Ga0495673_0062326 3300047469 Bacteria 1593
628 Ga0495673_0066556 3300047469 Bacteria 1527
629 Ga0495681_0000659 3300047470 Bacteria 26265
630 Ga0495681_0000859 3300047470 Bacteria 23363
631 Ga0495681_0001461 3300047470 Bacteria 17673
632 Ga0495681_0001998 3300047470 Bacteria 14903
633 Ga0495681_0002273 3300047470 Bacteria 13809
634 Ga0495681_0004668 3300047470 Bacteria 9287
635 Ga0495681_0007561 3300047470 Bacteria 6916
636 Ga0495684_0158036 3300047471 Bacteria 1692
637 Ga0495686_0002014 3300047472 Bacteria 20088
638 Ga0495686_0076714 3300047472 Bacteria 2048
639 Ga0495686_0109494 3300047472 Bacteria 1658
640 Ga0495593_0018284 3300047673 Bacteria 3940
641 Ga0495593_0026174 3300047673 Bacteria 3224
642 Ga0495593_0055303 3300047673 Bacteria 2089
643 Ga0495602_0005007 3300048088 Bacteria 13890
644 Ga0495602_0074719 3300048088 Bacteria 2880
645 Ga0495602_0109424 3300048088 Bacteria 2248
646 Ga0495614_0015172 3300048089 Bacteria 3361
647 Ga0495626_0000536 3300048091 Bacteria 37711
648 Ga0495626_0001094 3300048091 Bacteria 22950
649 Ga0495626_0001115 3300048091 Bacteria 22667
650 Ga0495626_0001219 3300048091 Bacteria 21187
651 Ga0495626_0001943 3300048091 Bacteria 15346
652 Ga0495626_0005883 3300048091 Bacteria 7064
653 Ga0495626_0013416 3300048091 Bacteria 4257
654 Ga0495626_0017675 3300048091 Bacteria 3595
655 Ga0495626_0020665 3300048091 Bacteria 3277
656 Ga0495626_0036834 3300048091 Bacteria 2328
657 Ga0495626_0057257 3300048091 Bacteria 1783
658 Ga0495626_0078900 3300048091 Bacteria 1465
659 Ga0495626_0138956 3300048091 Bacteria 1031
660 Ga0496102_0002255 3300048905 Bacteria 16515
661 Ga0496103_0007656 3300048906 Bacteria 6425
662 Ga0496103_0094731 3300048906 Bacteria 1886
663 Ga0496103_0230359 3300048906 Bacteria 1192
664 Ga0496104_0289558 3300048907 Bacteria 1550
665 Ga0496106_0020543 3300048909 Bacteria 4903
666 Ga0496106_0094314 3300048909 Bacteria 2314
667 Ga0496109_0199675 3300048912 Bacteria 1880
668 Ga0496110_0065550 3300048913 Bacteria 3211
669 Ga0496111_0005004 3300048914 Bacteria 8432
670 Ga0496114_0152930 3300048917 Bacteria 2002
671 Ga0496115_0052777 3300048918 Bacteria 3262
672 Ga0496116_0000023 3300048919 Bacteria 475792
673 Ga0496116_0000850 3300048919 Bacteria 38248
674 Ga0496116_0077853 3300048919 Bacteria 2070
675 Ga0496117_0000463 3300048920 Bacteria 67832
676 Ga0496117_0026838 3300048920 Bacteria 4498
677 Ga0496117_0085021 3300048920 Bacteria 2061
678 Ga0496117_0096079 3300048920 Bacteria 1891
679 Ga0496118_0003815 3300048921 Bacteria 18566
680 Ga0496118_0012630 3300048921 Bacteria 8081
681 Ga0496118_0059719 3300048921 Bacteria 2836
682 Ga0496118_0090110 3300048921 Bacteria 2114
683 Ga0496118_0151410 3300048921 Bacteria 1451
684 Ga0496119_0001891 3300048922 Bacteria 24077
685 Ga0496119_0006363 3300048922 Bacteria 10978
686 Ga0496120_0000137 3300048923 Bacteria 123518
687 Ga0496120_0002332 3300048923 Bacteria 19530
688 Ga0496120_0044361 3300048923 Bacteria 2584
689 Ga0496121_0079416 3300048924 Bacteria 2605
690 Ga0496121_0187726 3300048924 Bacteria 1485
691 Ga0496124_0000017 3300048927 Bacteria 444389
692 Ga0496124_0001066 3300048927 Bacteria 43350
693 Ga0496124_0001309 3300048927 Bacteria 37591
694 Ga0496124_0070046 3300048927 Bacteria 2910
695 Ga0496124_0132131 3300048927 Bacteria 1982
696 Ga0496124_0154054 3300048927 Bacteria 1799
697 Ga0496125_0000245 3300048928 Bacteria 111310
698 Ga0496125_0034882 3300048928 Bacteria 4426
699 Ga0496125_0056994 3300048928 Bacteria 3168
700 Ga0496126_0505290 3300048929 Bacteria 965
701 Ga0495678_000954 3300049459 Bacteria 25047
702 Ga0495678_001864 3300049459 Bacteria 15356
703 Ga0495678_002901 3300049459 Bacteria 11041
704 Ga0495678_003162 3300049459 Bacteria 10391
705 Ga0495678_005291 3300049459 Bacteria 7168
706 Ga0495678_006284 3300049459 Bacteria 6339
707 Ga0495678_006384 3300049459 Bacteria 6285
708 Ga0495678_018244 3300049459 Bacteria 3160
709 Ga0495678_091248 3300049459 Bacteria 1073
710 Ga0495682_0000556 3300049460 Bacteria 25639
711 Ga0495682_0001075 3300049460 Bacteria 16065
712 Ga0495682_0002272 3300049460 Bacteria 9213
713 Ga0495682_0008040 3300049460 Bacteria 4171
714 Ga0495682_0017194 3300049460 Bacteria 2733
715 Ga0495682_0025693 3300049460 Bacteria 2191
716 Ga0495682_0046600 3300049460 Bacteria 1582
717 Ga0495682_0060696 3300049460 Bacteria 1365
718 Ga0495682_0064721 3300049460 Bacteria 1318
719 Ga0501034_0000563 3300049571 Bacteria 58800
720 Ga0501043_0003494 3300049579 Bacteria 12916
721 nmdc:mga06r32_3118_c1 3300050510 Bacteria 14835
722 Ga0500621_081523 3300053126 Bacteria 1296

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_100025057 Ga0075431_1000250576 230
2 3300050510 nmdc:mga06r32_3118_c1 nmdc:mga06r32_3118_c1_13628_14539 230
3 3300005719 Ga0068861_100525568 Ga0068861_1005255682 234
4 3300025711 Ga0207696_1000051 Ga0207696_100005158 242
5 3300025728 Ga0207655_1007085 Ga0207655_10070852 242
6 3300046810 Ga0495660_0081307 Ga0495660_0081307_12_761 249
7 3300046794 Ga0495589_0000580 Ga0495589_0000580_11010_11762 250
8 3300047446 Ga0495679_001806 Ga0495679_001806_3367_4119 250
9 3300048920 Ga0496117_0085021 Ga0496117_0085021_266_1063 251
10 3300048921 Ga0496118_0090110 Ga0496118_0090110_622_1419 251
11 3300005288 Ga0065714_10068325 Ga0065714_100683255 253
12 3300017792 Ga0163161_10002214 Ga0163161_1000221415 253
13 3300046455 Ga0495603_0040351 Ga0495603_0040351_622_1425 253
14 3300047322 Ga0495680_0329369 Ga0495680_0329369_29_790 253
15 3300047444 Ga0495675_0029964 Ga0495675_0029964_19_783 254
16 3300006058 Ga0075432_10002606 Ga0075432_100026065 255
17 3300046460 Ga0495638_0039599 Ga0495638_0039599_2192_2959 255
18 3300046512 Ga0495610_0008151 Ga0495610_0008151_1611_2414 255
19 3300047470 Ga0495681_0004668 Ga0495681_0004668_4689_5492 255
20 3300046517 Ga0495630_0150168 Ga0495630_0150168_508_1311 258
21 3300046642 Ga0495634_0001891 Ga0495634_0001891_2319_3122 258
22 3300046663 Ga0495635_0001260 Ga0495635_0001260_14907_15710 258
23 3300047319 Ga0495674_0066255 Ga0495674_0066255_1927_2730 258
24 3300048088 Ga0495602_0109424 Ga0495602_0109424_894_1697 258
25 3300048917 Ga0496114_0152930 Ga0496114_0152930_678_1481 258
26 3300048918 Ga0496115_0052777 Ga0496115_0052777_409_1212 258
27 3300048924 Ga0496121_0187726 Ga0496121_0187726_34_837 258
28 3300048927 Ga0496124_0001309 Ga0496124_0001309_6303_7118 258
29 3300005347 Ga0070668_100152708 Ga0070668_1001527082 259
30 3300005365 Ga0070688_100211651 Ga0070688_1002116512 259
31 3300005455 Ga0070663_100164695 Ga0070663_1001646952 259
32 3300005456 Ga0070678_100018247 Ga0070678_1000182474 259
33 3300005544 Ga0070686_100615399 Ga0070686_1006153991 259
34 3300026067 Ga0207678_10186354 Ga0207678_101863542 259
35 3300026121 Ga0207683_10111005 Ga0207683_101110052 259
36 3300028379 Ga0268266_10388094 Ga0268266_103880942 259
37 3300003759 Ga0055525_1000011 Ga0055525_100001183 260
38 3300014326 Ga0157380_10177597 Ga0157380_101775972 260
39 3300025230 Ga0209563_100005 Ga0209563_100005408 260
40 3300046460 Ga0495638_0002131 Ga0495638_0002131_8519_9316 260
41 3300046615 Ga0495656_0004627 Ga0495656_0004627_2354_3148 260
42 3300035115 Ga0373941_0014226 Ga0373941_0014226_299_1090 261
43 3300039447 Ga0436361_0770940 Ga0436361_0770940_6123_6923 261
44 3300042006 Ga0439432_006809 Ga0439432_006809_3055_3855 261
45 3300042007 Ga0439449_0038389 Ga0439449_0038389_354_1154 261
46 iso_pu_bacteria 2511231010 2511291322 261
47 iso_pu_bacteria 2511231011 2511296510 261
48 iso_pu_bacteria 2511231023 2511372706 261
49 iso_pu_bacteria 2511231031 2511414315 261
50 iso_pu_bacteria 2600255318 2601796086 261
51 iso_pu_bacteria 2603880185 2606075061 261
52 iso_pu_bacteria 2603880199 2606127924 261
53 iso_pu_bacteria 2623620443 2624480135 261
54 iso_pu_bacteria 2643221695 2644528164 261
55 iso_pu_bacteria 2713897149 2715758470 261
56 iso_pu_bacteria 2738543025 2739315947 261
57 iso_pu_bacteria 2773857673 2774137953 261
58 iso_pu_bacteria 2852657418 2852659583 261
59 iso_pu_bacteria 2878029506 2878032046 261
60 iso_pu_bacteria 2880230671 2880232985 261
61 iso_pu_bacteria 2904518522 2904520299 261
62 iso_pu_bacteria 2919063839 2919068515 261
63 iso_pu_bacteria 2969304461 2969308032 261
64 iso_pu_bacteria 3007614139 3007616328 261
65 iso_pu_bacteria 8056569372 8056574206 261
66 2162886007 SwRhRL2b_contig_3133948 SwRhRL2b_0295.00005470 262
67 3300003775 Ga0055524_1005261 Ga0055524_10052612 262
68 3300003775 Ga0055524_1035868 Ga0055524_10358682 262
69 3300003775 Ga0055524_1037096 Ga0055524_10370962 262
70 3300003781 Ga0055536_1003892 Ga0055536_10038924 262
71 3300003781 Ga0055536_1010660 Ga0055536_10106603 262
72 3300003791 Ga0055530_10000989 Ga0055530_100009891 262
73 3300003794 Ga0055531_10001774 Ga0055531_100017743 262
74 3300003794 Ga0055531_10005746 Ga0055531_100057466 262
75 3300003794 Ga0055531_10006112 Ga0055531_100061125 262
76 3300003794 Ga0055531_10012823 Ga0055531_100128232 262
77 3300005289 Ga0065704_10072534 Ga0065704_100725346 262
78 3300005353 Ga0070669_100018896 Ga0070669_1000188965 262
79 3300005548 Ga0070665_100106733 Ga0070665_1001067333 262
80 3300009011 Ga0105251_10006905 Ga0105251_100069054 262
81 3300009011 Ga0105251_10029374 Ga0105251_100293742 262
82 3300009011 Ga0105251_10052025 Ga0105251_100520252 262
83 3300009036 Ga0105244_10056666 Ga0105244_100566661 262
84 3300009036 Ga0105244_10103690 Ga0105244_101036902 262
85 3300009092 Ga0105250_10008470 Ga0105250_100084703 262
86 3300009148 Ga0105243_10000252 Ga0105243_1000025235 262
87 3300011119 Ga0105246_10000121 Ga0105246_1000012129 262
88 3300012498 Ga0157345_1000052 Ga0157345_100005226 262
89 3300013100 Ga0157373_10000588 Ga0157373_1000058824 262
90 3300013104 Ga0157370_10062506 Ga0157370_100625063 262
91 3300013104 Ga0157370_10388656 Ga0157370_103886562 262
92 3300013105 Ga0157369_10000310 Ga0157369_1000031022 262
93 3300013306 Ga0163162_10014155 Ga0163162_100141553 262
94 3300013306 Ga0163162_10172335 Ga0163162_101723352 262
95 3300013306 Ga0163162_10224332 Ga0163162_102243322 262
96 3300017792 Ga0163161_10000183 Ga0163161_1000018325 262
97 3300017792 Ga0163161_10134128 Ga0163161_101341282 262
98 3300017792 Ga0163161_10290143 Ga0163161_102901432 262
99 3300025230 Ga0209563_100920 Ga0209563_1009203 262
100 3300025245 Ga0207425_1025497 Ga0207425_10254971 262
101 3300025273 Ga0209673_1003514 Ga0209673_10035146 262
102 3300025273 Ga0209673_1024962 Ga0209673_10249622 262
103 3300025284 Ga0209130_1005337 Ga0209130_10053372 262
104 3300025291 Ga0209675_1001721 Ga0209675_10017214 262
105 3300025291 Ga0209675_1002868 Ga0209675_10028684 262
106 3300025291 Ga0209675_1021578 Ga0209675_10215782 262
107 3300025292 Ga0209676_1000400 Ga0209676_100040022 262
108 3300025292 Ga0209676_1001340 Ga0209676_10013405 262
109 3300025292 Ga0209676_1002413 Ga0209676_10024134 262
110 3300025292 Ga0209676_1006874 Ga0209676_10068742 262
111 3300025292 Ga0209676_1020237 Ga0209676_10202373 262
112 3300025292 Ga0209676_1031724 Ga0209676_10317242 262
113 3300025292 Ga0209676_1040927 Ga0209676_10409271 262
114 3300025294 Ga0209025_1041961 Ga0209025_10419612 262
115 3300025294 Ga0209025_1051145 Ga0209025_10511452 262
116 3300025295 Ga0209564_1005102 Ga0209564_10051025 262
117 3300025297 Ga0209758_1029801 Ga0209758_10298012 262
118 3300025298 Ga0209050_1000528 Ga0209050_100052818 262
119 3300025298 Ga0209050_1015172 Ga0209050_10151723 262
120 3300025299 Ga0209256_1001764 Ga0209256_100176422 262
121 3300025299 Ga0209256_1002020 Ga0209256_100202011 262
122 3300025299 Ga0209256_1005256 Ga0209256_10052566 262
123 3300025303 Ga0209051_1005323 Ga0209051_10053234 262
124 3300025304 Ga0209257_1000080 Ga0209257_1000080264 262
125 3300025304 Ga0209257_1000727 Ga0209257_100072737 262
126 3300025304 Ga0209257_1008260 Ga0209257_10082605 262
127 3300025304 Ga0209257_1010641 Ga0209257_10106414 262
128 3300025711 Ga0207696_1001731 Ga0207696_10017316 262
129 3300025711 Ga0207696_1004943 Ga0207696_10049433 262
130 3300025728 Ga0207655_1002984 Ga0207655_10029845 262
131 3300025728 Ga0207655_1019490 Ga0207655_10194902 262
132 3300025728 Ga0207655_1066020 Ga0207655_10660202 262
133 3300025735 Ga0207713_1002745 Ga0207713_100274510 262
134 3300025735 Ga0207713_1003122 Ga0207713_10031226 262
135 3300025735 Ga0207713_1006435 Ga0207713_10064352 262
136 3300025735 Ga0207713_1033207 Ga0207713_10332072 262
137 3300025923 Ga0207681_10013906 Ga0207681_100139064 262
138 3300025935 Ga0207709_10000011 Ga0207709_10000011130 262
139 3300028379 Ga0268266_10206869 Ga0268266_102068692 262
140 3300031911 Ga0307412_10011330 Ga0307412_100113302 262
141 3300031911 Ga0307412_10062413 Ga0307412_100624133 262
142 3300032005 Ga0307411_10106882 Ga0307411_101068822 262
143 3300033180 Ga0307510_10001323 Ga0307510_100013237 262
144 3300038705 Ga0237819_02002 Ga0237819_02002_661_1458 262
145 3300041404 Ga0439436_0017230 Ga0439436_0017230_1275_2081 262
146 3300041413 Ga0439465_0000085 Ga0439465_0000085_8868_9674 262
147 3300042007 Ga0439449_0000042 Ga0439449_0000042_32394_33200 262
148 3300042532 Ga0450893_0021031 Ga0450893_0021031_135_932 262
149 3300046452 Ga0495617_002981 Ga0495617_002981_3772_4569 262
150 3300046452 Ga0495617_004376 Ga0495617_004376_3736_4533 262
151 3300046452 Ga0495617_009097 Ga0495617_009097_2269_3066 262
152 3300046452 Ga0495617_016648 Ga0495617_016648_411_1208 262
153 3300046452 Ga0495617_057064 Ga0495617_057064_194_991 262
154 3300046453 Ga0495627_000488 Ga0495627_000488_19604_20401 262
155 3300046453 Ga0495627_000695 Ga0495627_000695_2310_3107 262
156 3300046453 Ga0495627_003025 Ga0495627_003025_4551_5348 262
157 3300046454 Ga0495592_0054436 Ga0495592_0054436_1432_2229 262
158 3300046457 Ga0495590_0000526 Ga0495590_0000526_6806_7603 262
159 3300046457 Ga0495590_0014688 Ga0495590_0014688_369_1166 262
160 3300046457 Ga0495590_0079667 Ga0495590_0079667_104_901 262
161 3300046458 Ga0495591_000662 Ga0495591_000662_2610_3407 262
162 3300046458 Ga0495591_001053 Ga0495591_001053_15544_16341 262
163 3300046458 Ga0495591_001801 Ga0495591_001801_4989_5786 262
164 3300046458 Ga0495591_009595 Ga0495591_009595_2380_3177 262
165 3300046460 Ga0495638_0025467 Ga0495638_0025467_2260_3057 262
166 3300046460 Ga0495638_0047180 Ga0495638_0047180_1129_1926 262
167 3300046463 Ga0495653_0002927 Ga0495653_0002927_2142_2939 262
168 3300046463 Ga0495653_0032117 Ga0495653_0032117_1597_2394 262
169 3300046471 Ga0495650_0001708 Ga0495650_0001708_18630_19427 262
170 3300046471 Ga0495650_0012711 Ga0495650_0012711_2247_3044 262
171 3300046471 Ga0495650_0022720 Ga0495650_0022720_750_1547 262
172 3300046471 Ga0495650_0047085 Ga0495650_0047085_49_846 262
173 3300046471 Ga0495650_0094991 Ga0495650_0094991_316_1113 262
174 3300046474 Ga0495605_0004260 Ga0495605_0004260_6180_6992 262
175 3300046474 Ga0495605_0005110 Ga0495605_0005110_4539_5336 262
176 3300046474 Ga0495605_0051810 Ga0495605_0051810_349_1146 262
177 3300046475 Ga0495639_0103135 Ga0495639_0103135_321_1133 262
178 3300046491 Ga0495584_0006321 Ga0495584_0006321_3850_4647 262
179 3300046491 Ga0495584_0022233 Ga0495584_0022233_823_1620 262
180 3300046491 Ga0495584_0024271 Ga0495584_0024271_1790_2587 262
181 3300046492 Ga0495585_0001045 Ga0495585_0001045_2532_3329 262
182 3300046492 Ga0495585_0017713 Ga0495585_0017713_2205_3002 262
183 3300046492 Ga0495585_0075489 Ga0495585_0075489_551_1348 262
184 3300046492 Ga0495585_0125111 Ga0495585_0125111_327_1124 262
185 3300046499 Ga0495594_0025048 Ga0495594_0025048_406_1218 262
186 3300046500 Ga0495596_0019395 Ga0495596_0019395_584_1381 262
187 3300046501 Ga0495607_0000963 Ga0495607_0000963_7104_7901 262
188 3300046501 Ga0495607_0003226 Ga0495607_0003226_2375_3172 262
189 3300046501 Ga0495607_0010078 Ga0495607_0010078_3750_4547 262
190 3300046501 Ga0495607_0028476 Ga0495607_0028476_2220_3017 262
191 3300046501 Ga0495607_0041793 Ga0495607_0041793_680_1492 262
192 3300046501 Ga0495607_0049085 Ga0495607_0049085_132_944 262
193 3300046501 Ga0495607_0059576 Ga0495607_0059576_440_1237 262
194 3300046501 Ga0495607_0061071 Ga0495607_0061071_571_1368 262
195 3300046501 Ga0495607_0079948 Ga0495607_0079948_325_1122 262
196 3300046506 Ga0495583_0025867 Ga0495583_0025867_589_1386 262
197 3300046507 Ga0495606_0001321 Ga0495606_0001321_2645_3442 262
198 3300046507 Ga0495606_0001801 Ga0495606_0001801_23897_24694 262
199 3300046507 Ga0495606_0005034 Ga0495606_0005034_5162_5974 262
200 3300046507 Ga0495606_0012768 Ga0495606_0012768_3476_4273 262
201 3300046507 Ga0495606_0017298 Ga0495606_0017298_376_1173 262
202 3300046512 Ga0495610_0005237 Ga0495610_0005237_5622_6419 262
203 3300046512 Ga0495610_0013966 Ga0495610_0013966_1249_2046 262
204 3300046513 Ga0495616_0000704 Ga0495616_0000704_21426_22223 262
205 3300046513 Ga0495616_0001304 Ga0495616_0001304_1881_2678 262
206 3300046513 Ga0495616_0002728 Ga0495616_0002728_3920_4717 262
207 3300046513 Ga0495616_0005421 Ga0495616_0005421_2533_3330 262
208 3300046513 Ga0495616_0087582 Ga0495616_0087582_668_1465 262
209 3300046515 Ga0495620_0000532 Ga0495620_0000532_22531_23328 262
210 3300046515 Ga0495620_0004727 Ga0495620_0004727_2236_3033 262
211 3300046515 Ga0495620_0048981 Ga0495620_0048981_724_1521 262
212 3300046515 Ga0495620_0052259 Ga0495620_0052259_192_989 262
213 3300046518 Ga0495631_0000547 Ga0495631_0000547_792_1589 262
214 3300046518 Ga0495631_0007445 Ga0495631_0007445_2520_3317 262
215 3300046518 Ga0495631_0083511 Ga0495631_0083511_131_928 262
216 3300046519 Ga0495632_0002048 Ga0495632_0002048_12953_13750 262
217 3300046519 Ga0495632_0007869 Ga0495632_0007869_1438_2235 262
218 3300046519 Ga0495632_0008734 Ga0495632_0008734_3914_4711 262
219 3300046519 Ga0495632_0039797 Ga0495632_0039797_25_822 262
220 3300046519 Ga0495632_0062120 Ga0495632_0062120_204_1001 262
221 3300046520 Ga0495637_0000839 Ga0495637_0000839_17264_18061 262
222 3300046520 Ga0495637_0002282 Ga0495637_0002282_9400_10197 262
223 3300046520 Ga0495637_0046467 Ga0495637_0046467_713_1510 262
224 3300046520 Ga0495637_0125047 Ga0495637_0125047_167_964 262
225 3300046522 Ga0495643_0006509 Ga0495643_0006509_2226_3023 262
226 3300046522 Ga0495643_0028657 Ga0495643_0028657_1447_2244 262
227 3300046523 Ga0495644_0004777 Ga0495644_0004777_1663_2460 262
228 3300046524 Ga0495648_0005373 Ga0495648_0005373_2063_2860 262
229 3300046524 Ga0495648_0009398 Ga0495648_0009398_4722_5519 262
230 3300046524 Ga0495648_0025298 Ga0495648_0025298_508_1305 262
231 3300046524 Ga0495648_0032693 Ga0495648_0032693_2439_3236 262
232 3300046526 Ga0495666_0018179 Ga0495666_0018179_1388_2185 262
233 3300046530 Ga0495654_0000444 Ga0495654_0000444_12283_13080 262
234 3300046530 Ga0495654_0041200 Ga0495654_0041200_280_1077 262
235 3300046530 Ga0495654_0058990 Ga0495654_0058990_375_1172 262
236 3300046530 Ga0495654_0073010 Ga0495654_0073010_564_1361 262
237 3300046538 Ga0495609_0001178 Ga0495609_0001178_15025_15822 262
238 3300046538 Ga0495609_0007374 Ga0495609_0007374_2613_3410 262
239 3300046538 Ga0495609_0034163 Ga0495609_0034163_791_1588 262
240 3300046542 Ga0495597_0006345 Ga0495597_0006345_810_1607 262
241 3300046557 Ga0495622_0007198 Ga0495622_0007198_1709_2506 262
242 3300046558 Ga0495633_0000867 Ga0495633_0000867_22900_23697 262
243 3300046615 Ga0495656_0015124 Ga0495656_0015124_79_882 262
244 3300046615 Ga0495656_0158112 Ga0495656_0158112_109_912 262
245 3300046616 Ga0495668_0002037 Ga0495668_0002037_2568_3365 262
246 3300046616 Ga0495668_0048617 Ga0495668_0048617_819_1616 262
247 3300046616 Ga0495668_0089153 Ga0495668_0089153_295_1092 262
248 3300046648 Ga0495611_0000468 Ga0495611_0000468_2490_3287 262
249 3300046660 Ga0495625_0002907 Ga0495625_0002907_2448_3245 262
250 3300046660 Ga0495625_0017184 Ga0495625_0017184_2139_2936 262
251 3300046660 Ga0495625_0067664 Ga0495625_0067664_1045_1842 262
252 3300046660 Ga0495625_0108893 Ga0495625_0108893_594_1391 262
253 3300046665 Ga0495661_0038255 Ga0495661_0038255_1730_2527 262
254 3300046665 Ga0495661_0040580 Ga0495661_0040580_601_1398 262
255 3300046665 Ga0495661_0070295 Ga0495661_0070295_986_1783 262
256 3300046665 Ga0495661_0138156 Ga0495661_0138156_186_983 262
257 3300046680 Ga0495646_0019328 Ga0495646_0019328_613_1410 262
258 3300046689 Ga0495613_0016685 Ga0495613_0016685_3744_4541 262
259 3300046690 Ga0495624_0001286 Ga0495624_0001286_2150_2947 262
260 3300046690 Ga0495624_0127975 Ga0495624_0127975_466_1263 262
261 3300046691 Ga0495670_0093026 Ga0495670_0093026_267_1142 262
262 3300046691 Ga0495670_0125762 Ga0495670_0125762_317_1114 262
263 3300046692 Ga0495671_0004200 Ga0495671_0004200_4584_5381 262
264 3300046692 Ga0495671_0007897 Ga0495671_0007897_4341_5138 262
265 3300046692 Ga0495671_0035073 Ga0495671_0035073_485_1282 262
266 3300046692 Ga0495671_0040241 Ga0495671_0040241_627_1424 262
267 3300046694 Ga0495649_0018514 Ga0495649_0018514_996_1793 262
268 3300046694 Ga0495649_0038544 Ga0495649_0038544_1775_2572 262
269 3300046794 Ga0495589_0006916 Ga0495589_0006916_2533_3330 262
270 3300046794 Ga0495589_0042791 Ga0495589_0042791_146_943 262
271 3300046809 Ga0495600_0002832 Ga0495600_0002832_1373_2170 262
272 3300046810 Ga0495660_0001478 Ga0495660_0001478_2952_3749 262
273 3300046810 Ga0495660_0010035 Ga0495660_0010035_3905_4702 262
274 3300046810 Ga0495660_0013641 Ga0495660_0013641_3300_4097 262
275 3300046810 Ga0495660_0056295 Ga0495660_0056295_602_1399 262
276 3300047317 Ga0495604_0087936 Ga0495604_0087936_613_1410 262
277 3300047318 Ga0495636_0000187 Ga0495636_0000187_3827_4630 262
278 3300047318 Ga0495636_0002043 Ga0495636_0002043_1301_2104 262
279 3300047318 Ga0495636_0033839 Ga0495636_0033839_1215_2018 262
280 3300047318 Ga0495636_0115825 Ga0495636_0115825_254_1057 262
281 3300047320 Ga0495672_0003388 Ga0495672_0003388_2151_2948 262
282 3300047320 Ga0495672_0011726 Ga0495672_0011726_4100_4897 262
283 3300047320 Ga0495672_0035749 Ga0495672_0035749_1843_2640 262
284 3300047321 Ga0495676_0001430 Ga0495676_0001430_2413_3210 262
285 3300047321 Ga0495676_0037111 Ga0495676_0037111_1745_2542 262
286 3300047322 Ga0495680_0052832 Ga0495680_0052832_2015_2812 262
287 3300047323 Ga0495683_0006160 Ga0495683_0006160_4607_5404 262
288 3300047323 Ga0495683_0027561 Ga0495683_0027561_1416_2213 262
289 3300047323 Ga0495683_0060891 Ga0495683_0060891_599_1396 262
290 3300047323 Ga0495683_0082249 Ga0495683_0082249_704_1516 262
291 3300047446 Ga0495679_017758 Ga0495679_017758_869_1666 262
292 3300047446 Ga0495679_018923 Ga0495679_018923_761_1558 262
293 3300047446 Ga0495679_023089 Ga0495679_023089_453_1250 262
294 3300047446 Ga0495679_048514 Ga0495679_048514_132_929 262
295 3300047469 Ga0495673_0000279 Ga0495673_0000279_33890_34690 262
296 3300047469 Ga0495673_0000753 Ga0495673_0000753_2622_3419 262
297 3300047469 Ga0495673_0001887 Ga0495673_0001887_21_818 262
298 3300047469 Ga0495673_0008945 Ga0495673_0008945_493_1290 262
299 3300047469 Ga0495673_0012896 Ga0495673_0012896_2815_3612 262
300 3300047469 Ga0495673_0062326 Ga0495673_0062326_776_1573 262
301 3300047470 Ga0495681_0000659 Ga0495681_0000659_18654_19451 262
302 3300047470 Ga0495681_0000859 Ga0495681_0000859_14051_14848 262
303 3300047470 Ga0495681_0001461 Ga0495681_0001461_16723_17520 262
304 3300047470 Ga0495681_0007561 Ga0495681_0007561_3681_4478 262
305 3300047471 Ga0495684_0158036 Ga0495684_0158036_634_1431 262
306 3300047472 Ga0495686_0002014 Ga0495686_0002014_14646_15443 262
307 3300047472 Ga0495686_0076714 Ga0495686_0076714_666_1463 262
308 3300047673 Ga0495593_0018284 Ga0495593_0018284_913_1710 262
309 3300048088 Ga0495602_0005007 Ga0495602_0005007_10808_11605 262
310 3300048091 Ga0495626_0001094 Ga0495626_0001094_19736_20533 262
311 3300048091 Ga0495626_0005883 Ga0495626_0005883_3630_4427 262
312 3300048091 Ga0495626_0013416 Ga0495626_0013416_1387_2184 262
313 3300048091 Ga0495626_0020665 Ga0495626_0020665_2002_2799 262
314 3300048091 Ga0495626_0036834 Ga0495626_0036834_571_1368 262
315 3300048091 Ga0495626_0057257 Ga0495626_0057257_412_1209 262
316 3300048091 Ga0495626_0138956 Ga0495626_0138956_182_979 262
317 3300048919 Ga0496116_0000850 Ga0496116_0000850_18688_19485 262
318 3300048920 Ga0496117_0026838 Ga0496117_0026838_2786_3583 262
319 3300048921 Ga0496118_0059719 Ga0496118_0059719_915_1712 262
320 3300048927 Ga0496124_0154054 Ga0496124_0154054_681_1478 262
321 3300049459 Ga0495678_000954 Ga0495678_000954_865_1662 262
322 3300049459 Ga0495678_002901 Ga0495678_002901_2714_3511 262
323 3300049459 Ga0495678_005291 Ga0495678_005291_3998_4795 262
324 3300049459 Ga0495678_006284 Ga0495678_006284_1815_2612 262
325 3300049459 Ga0495678_006384 Ga0495678_006384_891_1688 262
326 3300049459 Ga0495678_091248 Ga0495678_091248_129_926 262
327 3300049460 Ga0495682_0000556 Ga0495682_0000556_2049_2846 262
328 3300049460 Ga0495682_0002272 Ga0495682_0002272_3664_4461 262
329 3300049460 Ga0495682_0017194 Ga0495682_0017194_1174_1971 262
330 3300049571 Ga0501034_0000563 Ga0501034_0000563_19885_20691 262
331 3300049579 Ga0501043_0003494 Ga0501043_0003494_8119_8928 262
332 3300053126 Ga0500621_081523 Ga0500621_081523_349_1146 262
333 iso_pu_bacteria 2571042365 2572255854 262
334 iso_pu_bacteria 2738541271 2738688027 262
335 iso_pu_bacteria 2738543016 2739263538 262
336 iso_pu_bacteria 2923516293 2923518312 262
337 iso_pu_bacteria 8003014200 8003015957 262
338 3300005340 Ga0070689_100235665 Ga0070689_1002356652 263
339 3300009011 Ga0105251_10002336 Ga0105251_1000233611 263
340 3300009092 Ga0105250_10000705 Ga0105250_1000070518 263
341 3300009101 Ga0105247_10000025 Ga0105247_10000025163 263
342 3300017792 Ga0163161_10000001 Ga0163161_10000001281 263
343 3300025711 Ga0207696_1000001 Ga0207696_1000001363 263
344 3300025735 Ga0207713_1000024 Ga0207713_1000024258 263
345 3300025900 Ga0207710_10000140 Ga0207710_1000014017 263
346 3300026089 Ga0207648_10055766 Ga0207648_100557662 263
347 3300039447 Ga0436361_0669402 Ga0436361_0669402_281_1087 263
348 3300046453 Ga0495627_000018 Ga0495627_000018_262300_263109 263
349 3300046474 Ga0495605_0000193 Ga0495605_0000193_38295_39110 263
350 3300046507 Ga0495606_0000176 Ga0495606_0000176_16931_17740 263
351 3300046513 Ga0495616_0084021 Ga0495616_0084021_607_1407 263
352 3300046519 Ga0495632_0001697 Ga0495632_0001697_7813_8613 263
353 3300046519 Ga0495632_0122178 Ga0495632_0122178_265_1080 263
354 3300046522 Ga0495643_0025412 Ga0495643_0025412_2072_2872 263
355 3300046530 Ga0495654_0032058 Ga0495654_0032058_1525_2340 263
356 3300046538 Ga0495609_0055921 Ga0495609_0055921_571_1386 263
357 3300046692 Ga0495671_0028726 Ga0495671_0028726_1722_2537 263
358 3300047469 Ga0495673_0011098 Ga0495673_0011098_1039_1854 263
359 3300048906 Ga0496103_0094731 Ga0496103_0094731_1065_1874 263
360 3300048919 Ga0496116_0000023 Ga0496116_0000023_248142_248951 263
361 3300048920 Ga0496117_0000463 Ga0496117_0000463_25879_26688 263
362 3300048921 Ga0496118_0003815 Ga0496118_0003815_1342_2151 263
363 3300048921 Ga0496118_0151410 Ga0496118_0151410_417_1217 263
364 3300048922 Ga0496119_0001891 Ga0496119_0001891_8617_9426 263
365 3300048922 Ga0496119_0006363 Ga0496119_0006363_3589_4389 263
366 3300048923 Ga0496120_0000137 Ga0496120_0000137_15761_16570 263
367 3300048923 Ga0496120_0002332 Ga0496120_0002332_8454_9254 263
368 3300048923 Ga0496120_0044361 Ga0496120_0044361_534_1343 263
369 3300048927 Ga0496124_0000017 Ga0496124_0000017_213851_214660 263
370 3300048927 Ga0496124_0001066 Ga0496124_0001066_27692_28492 263
371 3300048928 Ga0496125_0000245 Ga0496125_0000245_82849_83649 263
372 iso_pu_bacteria 2511231008 2511276773 263
373 iso_pu_bacteria 2643221559 2643815154 263
374 iso_pu_bacteria 2643221586 2643938040 263
375 iso_pu_bacteria 2643221612 2644076890 263
376 iso_pu_bacteria 2643221633 2644186806 263
377 iso_pu_bacteria 2643221727 2644695205 263
378 iso_pu_bacteria 2654587920 2656277456 263
379 iso_pu_bacteria 2654587920 2656279093 263
380 iso_pu_bacteria 2687453601 2689444047 263
381 iso_pu_bacteria 2773857670 2774123304 263
382 iso_pu_bacteria 2784132072 2784315828 263
383 iso_pu_bacteria 2808606377 2808932602 263
384 iso_pu_bacteria 2808606381 2808954723 263
385 iso_pu_bacteria 2808606445 2809214509 263
386 iso_pu_bacteria 2860339153 2860342291 263
387 iso_pu_bacteria 2919456309 2919458962 263
388 iso_pu_bacteria 2931396565 2931402374 263
389 3300005547 Ga0070693_100210727 Ga0070693_1002107272 264
390 3300009984 Ga0105029_100755 Ga0105029_1007552 264
391 3300021361 Ga0213872_10048194 Ga0213872_100481942 264
392 3300025918 Ga0207662_10070937 Ga0207662_100709372 264
393 3300025942 Ga0207689_10064866 Ga0207689_100648663 264
394 3300031507 Ga0307509_10085534 Ga0307509_100855342 264
395 3300039447 Ga0436361_0580218 Ga0436361_0580218_958_1764 264
396 3300042004 Ga0439445_0006836 Ga0439445_0006836_1777_2580 264
397 3300044658 Ga0466972_0000313 Ga0466972_0000313_17983_18786 264
398 3300044683 Ga0466965_0062018 Ga0466965_0062018_561_1364 264
399 3300048088 Ga0495602_0074719 Ga0495602_0074719_1752_2558 264
400 3300048912 Ga0496109_0199675 Ga0496109_0199675_820_1635 264
401 3300003794 Ga0055531_10005334 Ga0055531_100053346 265
402 3300005333 Ga0070677_10027986 Ga0070677_100279862 265
403 3300005334 Ga0068869_100036341 Ga0068869_1000363412 265
404 3300005356 Ga0070674_100214025 Ga0070674_1002140251 265
405 3300005367 Ga0070667_100036766 Ga0070667_1000367662 265
406 3300005456 Ga0070678_100063939 Ga0070678_1000639392 265
407 3300005459 Ga0068867_100003939 Ga0068867_1000039395 265
408 3300005543 Ga0070672_100032145 Ga0070672_1000321453 265
409 3300005548 Ga0070665_100011801 Ga0070665_1000118012 265
410 3300005578 Ga0068854_100325855 Ga0068854_1003258552 265
411 3300005617 Ga0068859_100047623 Ga0068859_1000476233 265
412 3300005840 Ga0068870_10063303 Ga0068870_100633032 265
413 3300005843 Ga0068860_100336538 Ga0068860_1003365382 265
414 3300006058 Ga0075432_10008779 Ga0075432_100087793 265
415 3300006881 Ga0068865_100004132 Ga0068865_1000041327 265
416 3300006931 Ga0097620_100047623 Ga0097620_1000476233 265
417 3300009094 Ga0111539_10100551 Ga0111539_101005512 265
418 3300013308 Ga0157375_10020345 Ga0157375_100203454 265
419 3300014325 Ga0163163_10028846 Ga0163163_100288464 265
420 3300014326 Ga0157380_10372347 Ga0157380_103723472 265
421 3300025292 Ga0209676_1001897 Ga0209676_100189713 265
422 3300025294 Ga0209025_1003328 Ga0209025_10033286 265
423 3300025297 Ga0209758_1010771 Ga0209758_10107711 265
424 3300025304 Ga0209257_1001998 Ga0209257_100199820 265
425 3300025315 Ga0207697_10012555 Ga0207697_100125552 265
426 3300025893 Ga0207682_10008871 Ga0207682_100088712 265
427 3300025907 Ga0207645_10015138 Ga0207645_100151383 265
428 3300025908 Ga0207643_10021748 Ga0207643_100217484 265
429 3300025926 Ga0207659_10065659 Ga0207659_100656592 265
430 3300025937 Ga0207669_10300570 Ga0207669_103005702 265
431 3300025938 Ga0207704_10475435 Ga0207704_104754351 265
432 3300025940 Ga0207691_10001549 Ga0207691_100015496 265
433 3300025942 Ga0207689_10185418 Ga0207689_101854182 265
434 3300026089 Ga0207648_10005136 Ga0207648_100051365 265
435 3300026121 Ga0207683_10224353 Ga0207683_102243532 265
436 3300027907 Ga0207428_10152202 Ga0207428_101522022 265
437 3300028379 Ga0268266_10125808 Ga0268266_101258082 265
438 3300032004 Ga0307414_10014553 Ga0307414_100145532 265
439 3300046452 Ga0495617_000762 Ga0495617_000762_4002_4808 265
440 3300046457 Ga0495590_0002065 Ga0495590_0002065_3902_4708 265
441 3300046471 Ga0495650_0005686 Ga0495650_0005686_5633_6439 265
442 3300046491 Ga0495584_0001269 Ga0495584_0001269_3852_4658 265
443 3300046501 Ga0495607_0047282 Ga0495607_0047282_1435_2241 265
444 3300046501 Ga0495607_0137238 Ga0495607_0137238_179_985 265
445 3300046506 Ga0495583_0071094 Ga0495583_0071094_48_854 265
446 3300046513 Ga0495616_0001608 Ga0495616_0001608_3824_4630 265
447 3300046519 Ga0495632_0002133 Ga0495632_0002133_10718_11524 265
448 3300046522 Ga0495643_0010258 Ga0495643_0010258_3896_4702 265
449 3300046524 Ga0495648_0034742 Ga0495648_0034742_2402_3208 265
450 3300046528 Ga0495642_0000798 Ga0495642_0000798_10716_11522 265
451 3300046538 Ga0495609_0008247 Ga0495609_0008247_1104_1910 265
452 3300046542 Ga0495597_0007496 Ga0495597_0007496_4010_4816 265
453 3300046648 Ga0495611_0003233 Ga0495611_0003233_2000_2806 265
454 3300046664 Ga0495659_0089552 Ga0495659_0089552_155_961 265
455 3300046691 Ga0495670_0034972 Ga0495670_0034972_820_1626 265
456 3300046694 Ga0495649_0001875 Ga0495649_0001875_3857_4663 265
457 3300046794 Ga0495589_0001331 Ga0495589_0001331_4043_4849 265
458 3300046810 Ga0495660_0031273 Ga0495660_0031273_1814_2620 265
459 3300047318 Ga0495636_0002708 Ga0495636_0002708_4927_5733 265
460 3300047320 Ga0495672_0003013 Ga0495672_0003013_4011_4817 265
461 3300047443 Ga0495687_002016 Ga0495687_002016_5556_6362 265
462 3300048091 Ga0495626_0001943 Ga0495626_0001943_3823_4629 265
463 3300049459 Ga0495678_001864 Ga0495678_001864_3861_4667 265
464 3300049460 Ga0495682_0060696 Ga0495682_0060696_180_986 265
465 3300037471 Ga0395905_0155536 Ga0395905_0155536_1167_1994 266
466 iso_pu_bacteria 2511231004 2511257766 266
467 iso_pu_bacteria 2511231007 2511271595 266
468 iso_pu_bacteria 2511231016 2511326709 266
469 iso_pu_bacteria 2511231017 2511331436 266
470 iso_pu_bacteria 2511231018 2511338214 266
471 iso_pu_bacteria 2511231019 2511343259 266
472 iso_pu_bacteria 2511231021 2511358826 266
473 iso_pu_bacteria 2511231022 2511360805 266
474 iso_pu_bacteria 2623620446 2624492603 266
475 iso_pu_bacteria 2738543004 2739197644 266
476 iso_pu_bacteria 2808606382 2808958359 266
477 iso_pu_bacteria 2904550169 2904550412 266
478 iso_pu_bacteria 2919697872 2919702713 266
479 iso_pu_bacteria 2939636861 2939638537 266
480 iso_pu_bacteria 3007511990 3007514571 266
481 iso_pu_bacteria 3007619802 3007621431 266
482 iso_pu_bacteria 8019775933 8019781640 266
483 iso_pu_bacteria 8056155041 8056157662 266
484 2124908027 MRS2a_Contig_56 MRS2a_00433850 267
485 3300005288 Ga0065714_10000392 Ga0065714_100003923 267
486 3300005288 Ga0065714_10018431 Ga0065714_100184312 267
487 3300005288 Ga0065714_10082798 Ga0065714_100827982 267
488 3300005288 Ga0065714_10123256 Ga0065714_101232562 267
489 3300005290 Ga0065712_10003635 Ga0065712_100036352 267
490 3300005293 Ga0065715_10112752 Ga0065715_101127522 267
491 3300005334 Ga0068869_100009073 Ga0068869_1000090733 267
492 3300005343 Ga0070687_100252267 Ga0070687_1002522671 267
493 3300005345 Ga0070692_10023323 Ga0070692_100233233 267
494 3300005353 Ga0070669_100058797 Ga0070669_1000587971 267
495 3300005444 Ga0070694_100041404 Ga0070694_1000414042 267
496 3300005455 Ga0070663_100022875 Ga0070663_1000228755 267
497 3300005539 Ga0068853_100316418 Ga0068853_1003164182 267
498 3300005543 Ga0070672_100041658 Ga0070672_1000416584 267
499 3300005545 Ga0070695_100014547 Ga0070695_1000145472 267
500 3300005841 Ga0068863_100353126 Ga0068863_1003531262 267
501 3300005842 Ga0068858_100734881 Ga0068858_1007348811 267
502 3300005843 Ga0068860_100029960 Ga0068860_1000299605 267
503 3300005844 Ga0068862_100068324 Ga0068862_1000683243 267
504 3300006946 Ga0079104_1000901 Ga0079104_100090111 267
505 3300009036 Ga0105244_10037171 Ga0105244_100371713 267
506 3300009036 Ga0105244_10100791 Ga0105244_101007912 267
507 3300009553 Ga0105249_10055557 Ga0105249_100555572 267
508 3300011119 Ga0105246_10272648 Ga0105246_102726482 267
509 3300013100 Ga0157373_10028432 Ga0157373_100284323 267
510 3300013100 Ga0157373_10175300 Ga0157373_101753002 267
511 3300013102 Ga0157371_10001414 Ga0157371_1000141412 267
512 3300013104 Ga0157370_10443609 Ga0157370_104436092 267
513 3300013306 Ga0163162_10011262 Ga0163162_100112624 267
514 3300014326 Ga0157380_10119917 Ga0157380_101199172 267
515 3300014497 Ga0182008_10031705 Ga0182008_100317051 267
516 3300014968 Ga0157379_10018572 Ga0157379_100185723 267
517 3300015261 Ga0182006_1000717 Ga0182006_100071710 267
518 3300015261 Ga0182006_1032721 Ga0182006_10327212 267
519 3300015262 Ga0182007_10000511 Ga0182007_1000051117 267
520 3300015265 Ga0182005_1001583 Ga0182005_10015834 267
521 3300015265 Ga0182005_1017421 Ga0182005_10174212 267
522 3300015265 Ga0182005_1048350 Ga0182005_10483502 267
523 3300017792 Ga0163161_10008321 Ga0163161_100083212 267
524 3300017792 Ga0163161_10047923 Ga0163161_100479232 267
525 3300025292 Ga0209676_1007996 Ga0209676_10079963 267
526 3300025711 Ga0207696_1027071 Ga0207696_10270712 267
527 3300025728 Ga0207655_1070051 Ga0207655_10700511 267
528 3300025735 Ga0207713_1004239 Ga0207713_10042394 267
529 3300025907 Ga0207645_10413671 Ga0207645_104136712 267
530 3300025933 Ga0207706_10053376 Ga0207706_100533762 267
531 3300025940 Ga0207691_10064024 Ga0207691_100640244 267
532 3300025942 Ga0207689_10006928 Ga0207689_100069283 267
533 3300025961 Ga0207712_10027504 Ga0207712_100275042 267
534 3300026035 Ga0207703_10508367 Ga0207703_105083671 267
535 3300026067 Ga0207678_10043692 Ga0207678_100436925 267
536 3300026088 Ga0207641_10118235 Ga0207641_101182352 267
537 3300026118 Ga0207675_100023576 Ga0207675_1000235765 267
538 3300027111 Ga0209281_1000063 Ga0209281_1000063101 267
539 3300027907 Ga0207428_10012077 Ga0207428_100120776 267
540 3300027907 Ga0207428_10045837 Ga0207428_100458374 267
541 3300028381 Ga0268264_10111434 Ga0268264_101114343 267
542 3300041405 Ga0439438_008064 Ga0439438_008064_1481_2293 267
543 3300041405 Ga0439438_011739 Ga0439438_011739_386_1198 267
544 3300041407 Ga0439447_000844 Ga0439447_000844_9800_10612 267
545 3300041407 Ga0439447_009389 Ga0439447_009389_589_1401 267
546 3300041411 Ga0439466_0005274 Ga0439466_0005274_1491_2303 267
547 3300041411 Ga0439466_0012167 Ga0439466_0012167_1166_1978 267
548 3300041411 Ga0439466_0031155 Ga0439466_0031155_704_1516 267
549 3300041411 Ga0439466_0044669 Ga0439466_0044669_502_1305 267
550 3300042006 Ga0439432_007611 Ga0439432_007611_2314_3126 267
551 3300042009 Ga0439451_013374 Ga0439451_013374_784_1596 267
552 3300042010 Ga0439452_002179 Ga0439452_002179_3840_4652 267
553 3300042010 Ga0439452_003644 Ga0439452_003644_708_1520 267
554 3300042010 Ga0439452_030998 Ga0439452_030998_406_1218 267
555 3300042013 Ga0439456_001377 Ga0439456_001377_254_1066 267
556 3300042121 Ga0450919_000828 Ga0450919_000828_2736_3548 267
557 3300042121 Ga0450919_003633 Ga0450919_003633_506_1318 267
558 3300042122 Ga0450920_004629 Ga0450920_004629_1056_1868 267
559 3300042124 Ga0450922_000653 Ga0450922_000653_831_1643 267
560 3300042124 Ga0450922_002610 Ga0450922_002610_799_1611 267
561 3300042127 Ga0450890_003991 Ga0450890_003991_778_1590 267
562 3300042137 Ga0450902_015013 Ga0450902_015013_238_1050 267
563 3300042138 Ga0450903_000525 Ga0450903_000525_14_826 267
564 3300042138 Ga0450903_001400 Ga0450903_001400_913_1725 267
565 3300042142 Ga0450905_005349 Ga0450905_005349_28_831 267
566 3300042145 Ga0450906_007693 Ga0450906_007693_876_1688 267
567 3300042146 Ga0450907_000046 Ga0450907_000046_44962_45765 267
568 3300042146 Ga0450907_002605 Ga0450907_002605_1402_2214 267
569 3300042146 Ga0450907_005464 Ga0450907_005464_1210_2022 267
570 3300042184 Ga0450908_003042 Ga0450908_003042_1971_2783 267
571 3300042185 Ga0450909_001216 Ga0450909_001216_1059_1871 267
572 3300042185 Ga0450909_002620 Ga0450909_002620_835_1638 267
573 3300042435 Ga0439434_0000072 Ga0439434_0000072_19604_20407 267
574 3300042435 Ga0439434_0009625 Ga0439434_0009625_818_1630 267
575 3300042461 Ga0439460_0033348 Ga0439460_0033348_461_1273 267
576 3300042461 Ga0439460_0043132 Ga0439460_0043132_279_1082 267
577 3300042461 Ga0439460_0046387 Ga0439460_0046387_243_1055 267
578 3300042532 Ga0450893_0008750 Ga0450893_0008750_43_855 267
579 3300042993 Ga0439440_0000209 Ga0439440_0000209_31_834 267
580 3300042993 Ga0439440_0031223 Ga0439440_0031223_141_953 267
581 3300044712 Ga0453684_0586180 Ga0453684_0586180_160_984 267
582 3300046452 Ga0495617_000745 Ga0495617_000745_14051_14863 267
583 3300046452 Ga0495617_007588 Ga0495617_007588_2239_3051 267
584 3300046452 Ga0495617_019164 Ga0495617_019164_1166_1969 267
585 3300046452 Ga0495617_030252 Ga0495617_030252_655_1467 267
586 3300046452 Ga0495617_030746 Ga0495617_030746_966_1769 267
587 3300046457 Ga0495590_0000590 Ga0495590_0000590_2429_3241 267
588 3300046458 Ga0495591_006042 Ga0495591_006042_671_1483 267
589 3300046458 Ga0495591_007275 Ga0495591_007275_2930_3733 267
590 3300046458 Ga0495591_012653 Ga0495591_012653_1228_2040 267
591 3300046458 Ga0495591_014787 Ga0495591_014787_1284_2087 267
592 3300046458 Ga0495591_015807 Ga0495591_015807_1531_2334 267
593 3300046459 Ga0495629_0109292 Ga0495629_0109292_1114_1917 267
594 3300046460 Ga0495638_0040998 Ga0495638_0040998_925_1737 267
595 3300046460 Ga0495638_0101369 Ga0495638_0101369_52_864 267
596 3300046460 Ga0495638_0127633 Ga0495638_0127633_212_1015 267
597 3300046463 Ga0495653_0134771 Ga0495653_0134771_631_1434 267
598 3300046471 Ga0495650_0002550 Ga0495650_0002550_12989_13792 267
599 3300046471 Ga0495650_0035240 Ga0495650_0035240_974_1777 267
600 3300046473 Ga0495582_0009290 Ga0495582_0009290_3978_4781 267
601 3300046474 Ga0495605_0001045 Ga0495605_0001045_15332_16144 267
602 3300046474 Ga0495605_0001305 Ga0495605_0001305_14393_15196 267
603 3300046474 Ga0495605_0009011 Ga0495605_0009011_31_843 267
604 3300046474 Ga0495605_0010497 Ga0495605_0010497_1038_1841 267
605 3300046474 Ga0495605_0014946 Ga0495605_0014946_1288_2100 267
606 3300046475 Ga0495639_0006694 Ga0495639_0006694_4080_4883 267
607 3300046477 Ga0495664_0151700 Ga0495664_0151700_442_1245 267
608 3300046491 Ga0495584_0000376 Ga0495584_0000376_3807_4724 267
609 3300046491 Ga0495584_0000442 Ga0495584_0000442_6083_6895 267
610 3300046491 Ga0495584_0017355 Ga0495584_0017355_42_845 267
611 3300046491 Ga0495584_0030316 Ga0495584_0030316_1530_2342 267
612 3300046491 Ga0495584_0054354 Ga0495584_0054354_494_1297 267
613 3300046491 Ga0495584_0110081 Ga0495584_0110081_42_845 267
614 3300046491 Ga0495584_0144455 Ga0495584_0144455_299_1102 267
615 3300046492 Ga0495585_0003021 Ga0495585_0003021_3600_4403 267
616 3300046492 Ga0495585_0013590 Ga0495585_0013590_1161_1964 267
617 3300046492 Ga0495585_0058308 Ga0495585_0058308_527_1339 267
618 3300046492 Ga0495585_0064105 Ga0495585_0064105_1127_1930 267
619 3300046499 Ga0495594_0021296 Ga0495594_0021296_178_981 267
620 3300046501 Ga0495607_0005264 Ga0495607_0005264_6950_7753 267
621 3300046501 Ga0495607_0017684 Ga0495607_0017684_1246_2058 267
622 3300046501 Ga0495607_0160996 Ga0495607_0160996_19_822 267
623 3300046506 Ga0495583_0001715 Ga0495583_0001715_18267_19079 267
624 3300046506 Ga0495583_0002503 Ga0495583_0002503_9678_10481 267
625 3300046507 Ga0495606_0006941 Ga0495606_0006941_4387_5199 267
626 3300046507 Ga0495606_0041104 Ga0495606_0041104_1719_2522 267
627 3300046507 Ga0495606_0202990 Ga0495606_0202990_128_931 267
628 3300046512 Ga0495610_0007098 Ga0495610_0007098_4368_5180 267
629 3300046512 Ga0495610_0014192 Ga0495610_0014192_3541_4344 267
630 3300046513 Ga0495616_0050833 Ga0495616_0050833_107_910 267
631 3300046513 Ga0495616_0143474 Ga0495616_0143474_176_979 267
632 3300046515 Ga0495620_0004291 Ga0495620_0004291_6930_7733 267
633 3300046515 Ga0495620_0005775 Ga0495620_0005775_5299_6111 267
634 3300046517 Ga0495630_0034327 Ga0495630_0034327_1315_2118 267
635 3300046517 Ga0495630_0218368 Ga0495630_0218368_583_1395 267
636 3300046518 Ga0495631_0000401 Ga0495631_0000401_26778_27581 267
637 3300046518 Ga0495631_0016102 Ga0495631_0016102_277_1089 267
638 3300046518 Ga0495631_0048159 Ga0495631_0048159_52_855 267
639 3300046518 Ga0495631_0049336 Ga0495631_0049336_804_1616 267
640 3300046519 Ga0495632_0001346 Ga0495632_0001346_18524_19327 267
641 3300046519 Ga0495632_0012801 Ga0495632_0012801_656_1468 267
642 3300046519 Ga0495632_0137220 Ga0495632_0137220_38_850 267
643 3300046520 Ga0495637_0000721 Ga0495637_0000721_19429_20232 267
644 3300046520 Ga0495637_0002350 Ga0495637_0002350_2486_3298 267
645 3300046520 Ga0495637_0007192 Ga0495637_0007192_1714_2517 267
646 3300046522 Ga0495643_0035773 Ga0495643_0035773_807_1610 267
647 3300046523 Ga0495644_0017157 Ga0495644_0017157_1225_2037 267
648 3300046523 Ga0495644_0061504 Ga0495644_0061504_506_1309 267
649 3300046523 Ga0495644_0065915 Ga0495644_0065915_25_837 267
650 3300046524 Ga0495648_0007967 Ga0495648_0007967_2242_3054 267
651 3300046524 Ga0495648_0011346 Ga0495648_0011346_3727_4539 267
652 3300046524 Ga0495648_0030638 Ga0495648_0030638_2205_3008 267
653 3300046524 Ga0495648_0031368 Ga0495648_0031368_762_1574 267
654 3300046524 Ga0495648_0040164 Ga0495648_0040164_977_1780 267
655 3300046524 Ga0495648_0054761 Ga0495648_0054761_915_1718 267
656 3300046524 Ga0495648_0141069 Ga0495648_0141069_63_980 267
657 3300046526 Ga0495666_0082870 Ga0495666_0082870_492_1295 267
658 3300046528 Ga0495642_0000250 Ga0495642_0000250_19802_20605 267
659 3300046528 Ga0495642_0001543 Ga0495642_0001543_2338_3150 267
660 3300046530 Ga0495654_0000803 Ga0495654_0000803_17260_18072 267
661 3300046530 Ga0495654_0001816 Ga0495654_0001816_303_1106 267
662 3300046530 Ga0495654_0004000 Ga0495654_0004000_702_1505 267
663 3300046530 Ga0495654_0044006 Ga0495654_0044006_673_1485 267
664 3300046535 Ga0495586_0014731 Ga0495586_0014731_576_1379 267
665 3300046536 Ga0495587_0040357 Ga0495587_0040357_1451_2254 267
666 3300046538 Ga0495609_0005130 Ga0495609_0005130_4583_5386 267
667 3300046538 Ga0495609_0017110 Ga0495609_0017110_431_1243 267
668 3300046538 Ga0495609_0023262 Ga0495609_0023262_945_1748 267
669 3300046538 Ga0495609_0037671 Ga0495609_0037671_583_1395 267
670 3300046542 Ga0495597_0004423 Ga0495597_0004423_2099_2911 267
671 3300046542 Ga0495597_0011586 Ga0495597_0011586_1814_2626 267
672 3300046542 Ga0495597_0069246 Ga0495597_0069246_139_951 267
673 3300046557 Ga0495622_0004354 Ga0495622_0004354_3540_4343 267
674 3300046557 Ga0495622_0048933 Ga0495622_0048933_27_839 267
675 3300046557 Ga0495622_0052325 Ga0495622_0052325_683_1495 267
676 3300046557 Ga0495622_0072204 Ga0495622_0072204_86_898 267
677 3300046557 Ga0495622_0078867 Ga0495622_0078867_128_931 267
678 3300046558 Ga0495633_0006119 Ga0495633_0006119_4137_4940 267
679 3300046558 Ga0495633_0033814 Ga0495633_0033814_715_1527 267
680 3300046558 Ga0495633_0111543 Ga0495633_0111543_201_1013 267
681 3300046615 Ga0495656_0023484 Ga0495656_0023484_654_1457 267
682 3300046615 Ga0495656_0047346 Ga0495656_0047346_527_1339 267
683 3300046616 Ga0495668_0011417 Ga0495668_0011417_3305_4117 267
684 3300046616 Ga0495668_0089068 Ga0495668_0089068_442_1245 267
685 3300046660 Ga0495625_0004936 Ga0495625_0004936_815_1618 267
686 3300046660 Ga0495625_0141689 Ga0495625_0141689_767_1579 267
687 3300046660 Ga0495625_0204660 Ga0495625_0204660_63_866 267
688 3300046660 Ga0495625_0261928 Ga0495625_0261928_169_972 267
689 3300046664 Ga0495659_0020306 Ga0495659_0020306_1055_1858 267
690 3300046664 Ga0495659_0086512 Ga0495659_0086512_169_981 267
691 3300046665 Ga0495661_0011651 Ga0495661_0011651_709_1521 267
692 3300046674 Ga0495588_0020068 Ga0495588_0020068_590_1402 267
693 3300046674 Ga0495588_0049632 Ga0495588_0049632_1188_2000 267
694 3300046674 Ga0495588_0071455 Ga0495588_0071455_254_1057 267
695 3300046674 Ga0495588_0108228 Ga0495588_0108228_404_1207 267
696 3300046674 Ga0495588_0144299 Ga0495588_0144299_340_1143 267
697 3300046679 Ga0495623_0001367 Ga0495623_0001367_1350_2153 267
698 3300046680 Ga0495646_0001267 Ga0495646_0001267_11219_12022 267
699 3300046680 Ga0495646_0071714 Ga0495646_0071714_389_1192 267
700 3300046684 Ga0495669_0005602 Ga0495669_0005602_1148_1951 267
701 3300046689 Ga0495613_0027894 Ga0495613_0027894_2523_3326 267
702 3300046689 Ga0495613_0033897 Ga0495613_0033897_333_1136 267
703 3300046691 Ga0495670_0003476 Ga0495670_0003476_5724_6527 267
704 3300046691 Ga0495670_0010629 Ga0495670_0010629_1597_2409 267
705 3300046691 Ga0495670_0021869 Ga0495670_0021869_1981_2793 267
706 3300046691 Ga0495670_0123616 Ga0495670_0123616_226_1038 267
707 3300046692 Ga0495671_0000094 Ga0495671_0000094_61170_61973 267
708 3300046692 Ga0495671_0003431 Ga0495671_0003431_6291_7103 267
709 3300046692 Ga0495671_0005088 Ga0495671_0005088_6224_7036 267
710 3300046692 Ga0495671_0140952 Ga0495671_0140952_226_1038 267
711 3300046694 Ga0495649_0008206 Ga0495649_0008206_797_1609 267
712 3300046694 Ga0495649_0012389 Ga0495649_0012389_2319_3131 267
713 3300046694 Ga0495649_0018714 Ga0495649_0018714_1190_1993 267
714 3300046694 Ga0495649_0033805 Ga0495649_0033805_784_1587 267
715 3300046794 Ga0495589_0005527 Ga0495589_0005527_4017_4820 267
716 3300046794 Ga0495589_0030423 Ga0495589_0030423_1178_1981 267
717 3300046794 Ga0495589_0044815 Ga0495589_0044815_680_1492 267
718 3300046809 Ga0495600_0052523 Ga0495600_0052523_310_1113 267
719 3300046810 Ga0495660_0012868 Ga0495660_0012868_2602_3414 267
720 3300046810 Ga0495660_0019355 Ga0495660_0019355_1900_2703 267
721 3300047315 Ga0495581_0001153 Ga0495581_0001153_10626_11438 267
722 3300047315 Ga0495581_0210044 Ga0495581_0210044_89_892 267
723 3300047320 Ga0495672_0002470 Ga0495672_0002470_13914_14726 267
724 3300047320 Ga0495672_0002731 Ga0495672_0002731_13731_14543 267
725 3300047320 Ga0495672_0006068 Ga0495672_0006068_7924_8736 267
726 3300047320 Ga0495672_0007951 Ga0495672_0007951_1047_1859 267
727 3300047320 Ga0495672_0013597 Ga0495672_0013597_2453_3265 267
728 3300047320 Ga0495672_0016439 Ga0495672_0016439_2437_3240 267
729 3300047322 Ga0495680_0004433 Ga0495680_0004433_10154_10966 267
730 3300047322 Ga0495680_0004958 Ga0495680_0004958_533_1336 267
731 3300047322 Ga0495680_0005052 Ga0495680_0005052_10375_11178 267
732 3300047323 Ga0495683_0000479 Ga0495683_0000479_2253_3056 267
733 3300047323 Ga0495683_0010817 Ga0495683_0010817_2476_3288 267
734 3300047443 Ga0495687_002564 Ga0495687_002564_10985_11797 267
735 3300047443 Ga0495687_002722 Ga0495687_002722_2082_2894 267
736 3300047444 Ga0495675_0116302 Ga0495675_0116302_478_1281 267
737 3300047445 Ga0495677_0004924 Ga0495677_0004924_2266_3069 267
738 3300047446 Ga0495679_003804 Ga0495679_003804_5172_5984 267
739 3300047446 Ga0495679_013769 Ga0495679_013769_501_1304 267
740 3300047469 Ga0495673_0006271 Ga0495673_0006271_2306_3109 267
741 3300047469 Ga0495673_0017271 Ga0495673_0017271_424_1236 267
742 3300047469 Ga0495673_0020414 Ga0495673_0020414_1999_2811 267
743 3300047469 Ga0495673_0023802 Ga0495673_0023802_909_1721 267
744 3300047469 Ga0495673_0039379 Ga0495673_0039379_790_1593 267
745 3300047469 Ga0495673_0040848 Ga0495673_0040848_1126_1929 267
746 3300047469 Ga0495673_0041083 Ga0495673_0041083_764_1576 267
747 3300047469 Ga0495673_0066556 Ga0495673_0066556_407_1219 267
748 3300047470 Ga0495681_0001998 Ga0495681_0001998_178_981 267
749 3300047470 Ga0495681_0002273 Ga0495681_0002273_2217_3029 267
750 3300047472 Ga0495686_0109494 Ga0495686_0109494_774_1577 267
751 3300047673 Ga0495593_0026174 Ga0495593_0026174_1696_2508 267
752 3300047673 Ga0495593_0055303 Ga0495593_0055303_800_1603 267
753 3300048089 Ga0495614_0015172 Ga0495614_0015172_721_1524 267
754 3300048091 Ga0495626_0000536 Ga0495626_0000536_32513_33325 267
755 3300048091 Ga0495626_0001115 Ga0495626_0001115_15948_16760 267
756 3300048091 Ga0495626_0001219 Ga0495626_0001219_2257_3069 267
757 3300048091 Ga0495626_0017675 Ga0495626_0017675_2508_3320 267
758 3300048091 Ga0495626_0078900 Ga0495626_0078900_211_1014 267
759 3300048905 Ga0496102_0002255 Ga0496102_0002255_2321_3124 267
760 3300048906 Ga0496103_0007656 Ga0496103_0007656_2228_3031 267
761 3300048906 Ga0496103_0230359 Ga0496103_0230359_321_1124 267
762 3300048907 Ga0496104_0289558 Ga0496104_0289558_269_1072 267
763 3300048909 Ga0496106_0020543 Ga0496106_0020543_2114_2938 267
764 3300048909 Ga0496106_0094314 Ga0496106_0094314_986_1789 267
765 3300048913 Ga0496110_0065550 Ga0496110_0065550_1445_2248 267
766 3300048914 Ga0496111_0005004 Ga0496111_0005004_6558_7361 267
767 3300048919 Ga0496116_0077853 Ga0496116_0077853_254_1057 267
768 3300048920 Ga0496117_0096079 Ga0496117_0096079_1029_1832 267
769 3300048921 Ga0496118_0012630 Ga0496118_0012630_6035_6838 267
770 3300048924 Ga0496121_0079416 Ga0496121_0079416_740_1543 267
771 3300048927 Ga0496124_0070046 Ga0496124_0070046_1383_2186 267
772 3300048927 Ga0496124_0132131 Ga0496124_0132131_921_1724 267
773 3300048928 Ga0496125_0034882 Ga0496125_0034882_1742_2545 267
774 3300048928 Ga0496125_0056994 Ga0496125_0056994_241_1044 267
775 3300048929 Ga0496126_0505290 Ga0496126_0505290_85_888 267
776 3300049459 Ga0495678_003162 Ga0495678_003162_2496_3308 267
777 3300049459 Ga0495678_018244 Ga0495678_018244_1634_2446 267
778 3300049460 Ga0495682_0001075 Ga0495682_0001075_14021_14833 267
779 3300049460 Ga0495682_0008040 Ga0495682_0008040_2602_3414 267
780 3300049460 Ga0495682_0025693 Ga0495682_0025693_369_1172 267
781 3300049460 Ga0495682_0046600 Ga0495682_0046600_577_1389 267
782 3300049460 Ga0495682_0064721 Ga0495682_0064721_286_1098 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

34

268

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mg4-assembly4.cif.gz_D crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9377 2 234
4mg4-assembly2.cif.gz_F crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9307 2 235
4mg4-assembly1.cif.gz_H crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9098 2 235
4mg4-assembly1.cif.gz_A crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.8962 2 240
2qiw-assembly1.cif.gz_B crystal structure of a putative phosphoenolpyruvate phosphonomutase (ncgl1015, cgl1060) from corynebacterium glutamicum atcc 13032 at 1.80 a resolution 0.8898 2 238
ID Description Score Start End Superfamily
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9431 2 218 3.20.20.60
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9089 2 218 3.20.20.60
4mg4B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8976 2 240 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8805 2 218 3.20.20.60
2qiwB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8801 2 218 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A1H1MMA1-F1-model_v4 2-Methylisocitrate lyase, PEP mutase family 0.9975 2 261 GO:0016829
AF-A0A3L8CC07-F1-model_v4 PEP phosphonomutase 0.9974 2 261 GO:0003824
AF-A0A5E6RYB2-F1-model_v4 PEP phosphonomutase 0.9957 2 259 GO:0003824
AF-A0A7V8RGX8-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9956 2 260 GO:0016829
AF-A0A7U9GSB7-F1-model_v4 PEP phosphonomutase 0.9954 2 259 GO:0003824

Feature Viewer

pLDDT pTM Quality
95.76 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map