F480632
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 782 | 311 | 722 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300046691|Ga0495670_0093026|Ga0495670_0093026_267_1142 |
| Length | 291 |
| Sequence | LFEVACTIGTHLRPSRIFRLLRLPMRNADHAALFRSLHAQGLLQLANAWDAGSARLIESLGAPAIATTSAGVAWSRGYADGDELPIDHLLTAAAEIARVIRVPLSVDVEGGYSDDPDVVAGNVLQLAELGVVGINLEDGAGAPGALCAKIARIKQTLAARGLDVYINARTDVYLRGLAPAERRVEAVLERAAQYRDAGADGLFVPGLVETGAIRDIAAGAGLPLNVMLRPSLPALAELEALGVRRLSAGSDLAEAVFAHVGQLAGSFLQDGRAAAAPRMAYGEINALFGAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 5 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 6 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 7 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 8 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 9 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 10 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 11 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 12 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 13 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 14 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 15 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 16 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 17 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 18 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 19 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 20 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 21 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 22 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 23 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 24 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 25 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 26 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 27 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 28 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 29 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 30 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 31 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 32 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 33 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 34 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 35 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 36 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 37 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 38 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 39 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 40 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 41 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 42 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 43 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 44 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 45 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 46 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 47 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 48 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 49 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 50 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 51 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 52 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 53 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 54 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 55 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 56 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 57 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 58 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 61 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 62 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 66 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 67 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 69 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 81 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 82 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 171 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 173 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 174 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 175 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 176 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 177 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 178 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 179 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 180 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 181 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 182 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 183 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 184 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 185 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 186 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 187 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 188 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 189 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 190 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 191 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 192 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 193 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 194 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 195 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 196 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 197 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 198 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 199 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 200 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 201 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 202 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 203 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 204 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 291 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 294 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 295 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 296 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 297 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 298 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 299 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 300 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 301 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 302 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 308 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 309 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 310 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 311 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.33 |
| Metatranscriptomes | 0 |
| Isolates | 7.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.14 |
| Nodule | 1.92 |
| Rhizoplane | 1.92 |
| Rhizosphere | 83.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_56 | 2124908027 | Bacteria | 59451 |
| 2 | SwRhRL2b_contig_3133948 | 2162886007 | Bacteria | 8023 |
| 3 | Ga0055525_1000011 | 3300003759 | Bacteria | 503124 |
| 4 | Ga0055524_1005261 | 3300003775 | Bacteria | 5816 |
| 5 | Ga0055524_1035868 | 3300003775 | Bacteria | 1345 |
| 6 | Ga0055524_1037096 | 3300003775 | Bacteria | 1298 |
| 7 | Ga0055536_1003892 | 3300003781 | Bacteria | 7835 |
| 8 | Ga0055536_1010660 | 3300003781 | Bacteria | 3616 |
| 9 | Ga0055530_10000989 | 3300003791 | Bacteria | 22772 |
| 10 | Ga0055531_10001774 | 3300003794 | Bacteria | 15341 |
| 11 | Ga0055531_10005334 | 3300003794 | Bacteria | 7543 |
| 12 | Ga0055531_10005746 | 3300003794 | Bacteria | 7186 |
| 13 | Ga0055531_10006112 | 3300003794 | Bacteria | 6895 |
| 14 | Ga0055531_10012823 | 3300003794 | Bacteria | 3909 |
| 15 | Ga0065714_10000392 | 3300005288 | Bacteria | 5047 |
| 16 | Ga0065714_10018431 | 3300005288 | Bacteria | 1993 |
| 17 | Ga0065714_10068325 | 3300005288 | Bacteria | 4801 |
| 18 | Ga0065714_10082798 | 3300005288 | Bacteria | 2287 |
| 19 | Ga0065714_10123256 | 3300005288 | Bacteria | 1323 |
| 20 | Ga0065704_10072534 | 3300005289 | Bacteria | 8358 |
| 21 | Ga0065712_10003635 | 3300005290 | Bacteria | 7641 |
| 22 | Ga0065715_10112752 | 3300005293 | Bacteria | 2518 |
| 23 | Ga0070677_10027986 | 3300005333 | Bacteria | 2126 |
| 24 | Ga0068869_100009073 | 3300005334 | Bacteria | 6445 |
| 25 | Ga0068869_100036341 | 3300005334 | Bacteria | 3497 |
| 26 | Ga0070689_100235665 | 3300005340 | Bacteria | 1506 |
| 27 | Ga0070687_100252267 | 3300005343 | Bacteria | 1097 |
| 28 | Ga0070692_10023323 | 3300005345 | Bacteria | 3031 |
| 29 | Ga0070668_100152708 | 3300005347 | Bacteria | 1869 |
| 30 | Ga0070669_100018896 | 3300005353 | Bacteria | 4926 |
| 31 | Ga0070669_100058797 | 3300005353 | Bacteria | 2822 |
| 32 | Ga0070674_100214025 | 3300005356 | Bacteria | 1495 |
| 33 | Ga0070688_100211651 | 3300005365 | Bacteria | 1361 |
| 34 | Ga0070667_100036766 | 3300005367 | Bacteria | 4106 |
| 35 | Ga0070694_100041404 | 3300005444 | Bacteria | 3073 |
| 36 | Ga0070663_100022875 | 3300005455 | Bacteria | 4183 |
| 37 | Ga0070663_100164695 | 3300005455 | Bacteria | 1709 |
| 38 | Ga0070678_100018247 | 3300005456 | Bacteria | 4546 |
| 39 | Ga0070678_100063939 | 3300005456 | Bacteria | 2725 |
| 40 | Ga0068867_100003939 | 3300005459 | Bacteria | 10446 |
| 41 | Ga0068853_100316418 | 3300005539 | Bacteria | 1446 |
| 42 | Ga0070672_100032145 | 3300005543 | Bacteria | 3958 |
| 43 | Ga0070672_100041658 | 3300005543 | Unclassified | 3532 |
| 44 | Ga0070686_100615399 | 3300005544 | Bacteria | 857 |
| 45 | Ga0070695_100014547 | 3300005545 | Bacteria | 4745 |
| 46 | Ga0070693_100210727 | 3300005547 | Bacteria | 1268 |
| 47 | Ga0070665_100011801 | 3300005548 | Bacteria | 8824 |
| 48 | Ga0070665_100106733 | 3300005548 | Bacteria | 2803 |
| 49 | Ga0068854_100325855 | 3300005578 | Bacteria | 1250 |
| 50 | Ga0068859_100047623 | 3300005617 | Bacteria | 4308 |
| 51 | Ga0068861_100525568 | 3300005719 | Bacteria | 1074 |
| 52 | Ga0068870_10063303 | 3300005840 | Bacteria | 1995 |
| 53 | Ga0068863_100353126 | 3300005841 | Bacteria | 1432 |
| 54 | Ga0068858_100734881 | 3300005842 | Bacteria | 961 |
| 55 | Ga0068860_100029960 | 3300005843 | Bacteria | 5234 |
| 56 | Ga0068860_100336538 | 3300005843 | Bacteria | 1483 |
| 57 | Ga0068862_100068324 | 3300005844 | Bacteria | 3065 |
| 58 | Ga0075432_10002606 | 3300006058 | Bacteria | 6021 |
| 59 | Ga0075432_10008779 | 3300006058 | Bacteria | 3448 |
| 60 | Ga0075431_100025057 | 3300006847 | Bacteria | 6117 |
| 61 | Ga0068865_100004132 | 3300006881 | Bacteria | 8727 |
| 62 | Ga0097620_100047623 | 3300006931 | Bacteria | 4308 |
| 63 | Ga0079104_1000901 | 3300006946 | Bacteria | 24122 |
| 64 | Ga0105251_10002336 | 3300009011 | Bacteria | 15006 |
| 65 | Ga0105251_10006905 | 3300009011 | Bacteria | 7122 |
| 66 | Ga0105251_10029374 | 3300009011 | Bacteria | 2769 |
| 67 | Ga0105251_10052025 | 3300009011 | Bacteria | 1951 |
| 68 | Ga0105244_10037171 | 3300009036 | Bacteria | 2547 |
| 69 | Ga0105244_10056666 | 3300009036 | Bacteria | 1983 |
| 70 | Ga0105244_10100791 | 3300009036 | Bacteria | 1413 |
| 71 | Ga0105244_10103690 | 3300009036 | Bacteria | 1389 |
| 72 | Ga0105250_10000705 | 3300009092 | Bacteria | 20587 |
| 73 | Ga0105250_10008470 | 3300009092 | Bacteria | 4366 |
| 74 | Ga0111539_10100551 | 3300009094 | Bacteria | 3395 |
| 75 | Ga0105247_10000025 | 3300009101 | Bacteria | 208459 |
| 76 | Ga0105243_10000252 | 3300009148 | Bacteria | 61589 |
| 77 | Ga0105249_10055557 | 3300009553 | Bacteria | 3622 |
| 78 | Ga0105029_100755 | 3300009984 | Bacteria | 1831 |
| 79 | Ga0105246_10000121 | 3300011119 | Bacteria | 35746 |
| 80 | Ga0105246_10272648 | 3300011119 | Bacteria | 1353 |
| 81 | Ga0157345_1000052 | 3300012498 | Bacteria | 25093 |
| 82 | Ga0157373_10000588 | 3300013100 | Bacteria | 28326 |
| 83 | Ga0157373_10028432 | 3300013100 | Bacteria | 4033 |
| 84 | Ga0157373_10175300 | 3300013100 | Bacteria | 1509 |
| 85 | Ga0157371_10001414 | 3300013102 | Bacteria | 24972 |
| 86 | Ga0157370_10062506 | 3300013104 | Bacteria | 3531 |
| 87 | Ga0157370_10388656 | 3300013104 | Bacteria | 1285 |
| 88 | Ga0157370_10443609 | 3300013104 | Bacteria | 1193 |
| 89 | Ga0157369_10000310 | 3300013105 | Bacteria | 65383 |
| 90 | Ga0163162_10011262 | 3300013306 | Bacteria | 8720 |
| 91 | Ga0163162_10014155 | 3300013306 | Bacteria | 7795 |
| 92 | Ga0163162_10172335 | 3300013306 | Bacteria | 2289 |
| 93 | Ga0163162_10224332 | 3300013306 | Bacteria | 2009 |
| 94 | Ga0157375_10020345 | 3300013308 | Bacteria | 6060 |
| 95 | Ga0163163_10028846 | 3300014325 | Bacteria | 5334 |
| 96 | Ga0157380_10119917 | 3300014326 | Bacteria | 2226 |
| 97 | Ga0157380_10177597 | 3300014326 | Bacteria | 1868 |
| 98 | Ga0157380_10372347 | 3300014326 | Bacteria | 1345 |
| 99 | Ga0182008_10031705 | 3300014497 | Bacteria | 2658 |
| 100 | Ga0157379_10018572 | 3300014968 | Bacteria | 6133 |
| 101 | Ga0182006_1000717 | 3300015261 | Bacteria | 22942 |
| 102 | Ga0182006_1032721 | 3300015261 | Bacteria | 2088 |
| 103 | Ga0182007_10000511 | 3300015262 | Bacteria | 22909 |
| 104 | Ga0182005_1001583 | 3300015265 | Bacteria | 8963 |
| 105 | Ga0182005_1017421 | 3300015265 | Bacteria | 1989 |
| 106 | Ga0182005_1048350 | 3300015265 | Bacteria | 1156 |
| 107 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 108 | Ga0163161_10000183 | 3300017792 | Bacteria | 57397 |
| 109 | Ga0163161_10002214 | 3300017792 | Bacteria | 14000 |
| 110 | Ga0163161_10008321 | 3300017792 | Bacteria | 7183 |
| 111 | Ga0163161_10047923 | 3300017792 | Bacteria | 3085 |
| 112 | Ga0163161_10134128 | 3300017792 | Bacteria | 1870 |
| 113 | Ga0163161_10290143 | 3300017792 | Bacteria | 1286 |
| 114 | Ga0213872_10048194 | 3300021361 | Bacteria | 1936 |
| 115 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 116 | Ga0209563_100920 | 3300025230 | Bacteria | 8665 |
| 117 | Ga0207425_1025497 | 3300025245 | Bacteria | 1220 |
| 118 | Ga0209673_1003514 | 3300025273 | Bacteria | 9186 |
| 119 | Ga0209673_1024962 | 3300025273 | Bacteria | 1997 |
| 120 | Ga0209130_1005337 | 3300025284 | Bacteria | 4499 |
| 121 | Ga0209675_1001721 | 3300025291 | Bacteria | 12055 |
| 122 | Ga0209675_1002868 | 3300025291 | Bacteria | 8555 |
| 123 | Ga0209675_1021578 | 3300025291 | Bacteria | 1714 |
| 124 | Ga0209676_1000400 | 3300025292 | Bacteria | 79157 |
| 125 | Ga0209676_1001340 | 3300025292 | Bacteria | 24705 |
| 126 | Ga0209676_1001897 | 3300025292 | Bacteria | 17053 |
| 127 | Ga0209676_1002413 | 3300025292 | Bacteria | 13343 |
| 128 | Ga0209676_1006874 | 3300025292 | Bacteria | 5505 |
| 129 | Ga0209676_1007996 | 3300025292 | Bacteria | 4819 |
| 130 | Ga0209676_1020237 | 3300025292 | Bacteria | 2266 |
| 131 | Ga0209676_1031724 | 3300025292 | Bacteria | 1598 |
| 132 | Ga0209676_1040927 | 3300025292 | Bacteria | 1300 |
| 133 | Ga0209025_1003328 | 3300025294 | Bacteria | 15447 |
| 134 | Ga0209025_1041961 | 3300025294 | Bacteria | 1951 |
| 135 | Ga0209025_1051145 | 3300025294 | Bacteria | 1644 |
| 136 | Ga0209564_1005102 | 3300025295 | Bacteria | 7642 |
| 137 | Ga0209758_1010771 | 3300025297 | Bacteria | 5414 |
| 138 | Ga0209758_1029801 | 3300025297 | Bacteria | 2273 |
| 139 | Ga0209050_1000528 | 3300025298 | Bacteria | 63464 |
| 140 | Ga0209050_1015172 | 3300025298 | Bacteria | 3258 |
| 141 | Ga0209256_1001764 | 3300025299 | Bacteria | 20583 |
| 142 | Ga0209256_1002020 | 3300025299 | Bacteria | 18091 |
| 143 | Ga0209256_1005256 | 3300025299 | Bacteria | 7560 |
| 144 | Ga0209051_1005323 | 3300025303 | Bacteria | 7574 |
| 145 | Ga0209257_1000080 | 3300025304 | Bacteria | 312038 |
| 146 | Ga0209257_1000727 | 3300025304 | Bacteria | 50163 |
| 147 | Ga0209257_1001998 | 3300025304 | Bacteria | 21872 |
| 148 | Ga0209257_1008260 | 3300025304 | Bacteria | 5984 |
| 149 | Ga0209257_1010641 | 3300025304 | Bacteria | 4609 |
| 150 | Ga0207697_10012555 | 3300025315 | Bacteria | 3550 |
| 151 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 152 | Ga0207696_1000051 | 3300025711 | Bacteria | 276833 |
| 153 | Ga0207696_1001731 | 3300025711 | Bacteria | 11333 |
| 154 | Ga0207696_1004943 | 3300025711 | Bacteria | 5633 |
| 155 | Ga0207696_1027071 | 3300025711 | Bacteria | 1770 |
| 156 | Ga0207655_1002984 | 3300025728 | Bacteria | 12977 |
| 157 | Ga0207655_1007085 | 3300025728 | Bacteria | 7327 |
| 158 | Ga0207655_1019490 | 3300025728 | Bacteria | 3541 |
| 159 | Ga0207655_1066020 | 3300025728 | Bacteria | 1370 |
| 160 | Ga0207655_1070051 | 3300025728 | Bacteria | 1308 |
| 161 | Ga0207713_1000024 | 3300025735 | Bacteria | 339156 |
| 162 | Ga0207713_1002745 | 3300025735 | Bacteria | 12506 |
| 163 | Ga0207713_1003122 | 3300025735 | Bacteria | 11491 |
| 164 | Ga0207713_1004239 | 3300025735 | Bacteria | 9370 |
| 165 | Ga0207713_1006435 | 3300025735 | Bacteria | 7153 |
| 166 | Ga0207713_1033207 | 3300025735 | Bacteria | 2257 |
| 167 | Ga0207682_10008871 | 3300025893 | Bacteria | 3977 |
| 168 | Ga0207710_10000140 | 3300025900 | Bacteria | 83223 |
| 169 | Ga0207645_10015138 | 3300025907 | Bacteria | 5137 |
| 170 | Ga0207645_10413671 | 3300025907 | Bacteria | 908 |
| 171 | Ga0207643_10021748 | 3300025908 | Bacteria | 3529 |
| 172 | Ga0207662_10070937 | 3300025918 | Bacteria | 2108 |
| 173 | Ga0207681_10013906 | 3300025923 | Bacteria | 4987 |
| 174 | Ga0207659_10065659 | 3300025926 | Bacteria | 2630 |
| 175 | Ga0207706_10053376 | 3300025933 | Bacteria | 3568 |
| 176 | Ga0207709_10000011 | 3300025935 | Bacteria | 552881 |
| 177 | Ga0207669_10300570 | 3300025937 | Bacteria | 1219 |
| 178 | Ga0207704_10475435 | 3300025938 | Bacteria | 1002 |
| 179 | Ga0207691_10001549 | 3300025940 | Bacteria | 22817 |
| 180 | Ga0207691_10064024 | 3300025940 | Bacteria | 3333 |
| 181 | Ga0207689_10006928 | 3300025942 | Bacteria | 9969 |
| 182 | Ga0207689_10064866 | 3300025942 | Bacteria | 3004 |
| 183 | Ga0207689_10185418 | 3300025942 | Bacteria | 1716 |
| 184 | Ga0207712_10027504 | 3300025961 | Bacteria | 3798 |
| 185 | Ga0207703_10508367 | 3300026035 | Bacteria | 1132 |
| 186 | Ga0207678_10043692 | 3300026067 | Bacteria | 3877 |
| 187 | Ga0207678_10186354 | 3300026067 | Bacteria | 1772 |
| 188 | Ga0207641_10118235 | 3300026088 | Bacteria | 2361 |
| 189 | Ga0207648_10005136 | 3300026089 | Bacteria | 13253 |
| 190 | Ga0207648_10055766 | 3300026089 | Bacteria | 3449 |
| 191 | Ga0207675_100023576 | 3300026118 | Bacteria | 5726 |
| 192 | Ga0207683_10111005 | 3300026121 | Bacteria | 2455 |
| 193 | Ga0207683_10224353 | 3300026121 | Bacteria | 1713 |
| 194 | Ga0209281_1000063 | 3300027111 | Bacteria | 288465 |
| 195 | Ga0207428_10012077 | 3300027907 | Bacteria | 7601 |
| 196 | Ga0207428_10045837 | 3300027907 | Bacteria | 3518 |
| 197 | Ga0207428_10152202 | 3300027907 | Bacteria | 1760 |
| 198 | Ga0268266_10125808 | 3300028379 | Bacteria | 2287 |
| 199 | Ga0268266_10206869 | 3300028379 | Bacteria | 1798 |
| 200 | Ga0268266_10388094 | 3300028379 | Bacteria | 1318 |
| 201 | Ga0268264_10111434 | 3300028381 | Bacteria | 2397 |
| 202 | Ga0307509_10085534 | 3300031507 | Bacteria | 3245 |
| 203 | Ga0307412_10011330 | 3300031911 | Bacteria | 5161 |
| 204 | Ga0307412_10062413 | 3300031911 | Bacteria | 2509 |
| 205 | Ga0307414_10014553 | 3300032004 | Bacteria | 4722 |
| 206 | Ga0307411_10106882 | 3300032005 | Bacteria | 1993 |
| 207 | Ga0307510_10001323 | 3300033180 | Bacteria | 27015 |
| 208 | Ga0373941_0014226 | 3300035115 | Bacteria | 2120 |
| 209 | Ga0395905_0155536 | 3300037471 | Bacteria | 2151 |
| 210 | Ga0237819_02002 | 3300038705 | Bacteria | 4542 |
| 211 | Ga0436361_0580218 | 3300039447 | Bacteria | 3317 |
| 212 | Ga0436361_0669402 | 3300039447 | Bacteria | 1440 |
| 213 | Ga0436361_0770940 | 3300039447 | Bacteria | 7519 |
| 214 | Ga0439436_0017230 | 3300041404 | Bacteria | 2162 |
| 215 | Ga0439438_008064 | 3300041405 | Bacteria | 3535 |
| 216 | Ga0439438_011739 | 3300041405 | Bacteria | 2716 |
| 217 | Ga0439447_000844 | 3300041407 | Bacteria | 11246 |
| 218 | Ga0439447_009389 | 3300041407 | Bacteria | 2970 |
| 219 | Ga0439466_0005274 | 3300041411 | Bacteria | 4945 |
| 220 | Ga0439466_0012167 | 3300041411 | Bacteria | 3175 |
| 221 | Ga0439466_0031155 | 3300041411 | Bacteria | 1825 |
| 222 | Ga0439466_0044669 | 3300041411 | Bacteria | 1467 |
| 223 | Ga0439465_0000085 | 3300041413 | Bacteria | 20674 |
| 224 | Ga0439445_0006836 | 3300042004 | Bacteria | 2632 |
| 225 | Ga0439432_006809 | 3300042006 | Bacteria | 4069 |
| 226 | Ga0439432_007611 | 3300042006 | Bacteria | 3829 |
| 227 | Ga0439449_0000042 | 3300042007 | Bacteria | 38864 |
| 228 | Ga0439449_0038389 | 3300042007 | Bacteria | 1780 |
| 229 | Ga0439451_013374 | 3300042009 | Bacteria | 1658 |
| 230 | Ga0439452_002179 | 3300042010 | Bacteria | 7404 |
| 231 | Ga0439452_003644 | 3300042010 | Bacteria | 5346 |
| 232 | Ga0439452_030998 | 3300042010 | Bacteria | 1315 |
| 233 | Ga0439456_001377 | 3300042013 | Bacteria | 4868 |
| 234 | Ga0450919_000828 | 3300042121 | Bacteria | 3988 |
| 235 | Ga0450919_003633 | 3300042121 | Bacteria | 1914 |
| 236 | Ga0450920_004629 | 3300042122 | Bacteria | 2424 |
| 237 | Ga0450922_000653 | 3300042124 | Bacteria | 3624 |
| 238 | Ga0450922_002610 | 3300042124 | Bacteria | 1685 |
| 239 | Ga0450890_003991 | 3300042127 | Bacteria | 1941 |
| 240 | Ga0450902_015013 | 3300042137 | Bacteria | 1254 |
| 241 | Ga0450903_000525 | 3300042138 | Bacteria | 8016 |
| 242 | Ga0450903_001400 | 3300042138 | Bacteria | 4498 |
| 243 | Ga0450905_005349 | 3300042142 | Bacteria | 1723 |
| 244 | Ga0450906_007693 | 3300042145 | Bacteria | 2118 |
| 245 | Ga0450907_000046 | 3300042146 | Bacteria | 52226 |
| 246 | Ga0450907_002605 | 3300042146 | Bacteria | 3377 |
| 247 | Ga0450907_005464 | 3300042146 | Bacteria | 2142 |
| 248 | Ga0450908_003042 | 3300042184 | Bacteria | 3271 |
| 249 | Ga0450909_001216 | 3300042185 | Bacteria | 3572 |
| 250 | Ga0450909_002620 | 3300042185 | Bacteria | 2553 |
| 251 | Ga0439434_0000072 | 3300042435 | Bacteria | 24922 |
| 252 | Ga0439434_0009625 | 3300042435 | Bacteria | 2844 |
| 253 | Ga0439460_0033348 | 3300042461 | Bacteria | 1478 |
| 254 | Ga0439460_0043132 | 3300042461 | Bacteria | 1331 |
| 255 | Ga0439460_0046387 | 3300042461 | Bacteria | 1291 |
| 256 | Ga0450893_0008750 | 3300042532 | Bacteria | 1650 |
| 257 | Ga0450893_0021031 | 3300042532 | Bacteria | 1125 |
| 258 | Ga0439440_0000209 | 3300042993 | Bacteria | 9110 |
| 259 | Ga0439440_0031223 | 3300042993 | Bacteria | 1258 |
| 260 | Ga0466972_0000313 | 3300044658 | Bacteria | 27954 |
| 261 | Ga0466965_0062018 | 3300044683 | Bacteria | 1870 |
| 262 | Ga0453684_0586180 | 3300044712 | Bacteria | 1224 |
| 263 | Ga0495617_000745 | 3300046452 | Bacteria | 16015 |
| 264 | Ga0495617_000762 | 3300046452 | Bacteria | 15768 |
| 265 | Ga0495617_002981 | 3300046452 | Bacteria | 6472 |
| 266 | Ga0495617_004376 | 3300046452 | Bacteria | 5147 |
| 267 | Ga0495617_007588 | 3300046452 | Bacteria | 3757 |
| 268 | Ga0495617_009097 | 3300046452 | Bacteria | 3416 |
| 269 | Ga0495617_016648 | 3300046452 | Bacteria | 2486 |
| 270 | Ga0495617_019164 | 3300046452 | Bacteria | 2313 |
| 271 | Ga0495617_030252 | 3300046452 | Bacteria | 1820 |
| 272 | Ga0495617_030746 | 3300046452 | Bacteria | 1804 |
| 273 | Ga0495617_057064 | 3300046452 | Bacteria | 1294 |
| 274 | Ga0495627_000018 | 3300046453 | Bacteria | 315125 |
| 275 | Ga0495627_000488 | 3300046453 | Bacteria | 33292 |
| 276 | Ga0495627_000695 | 3300046453 | Bacteria | 25747 |
| 277 | Ga0495627_003025 | 3300046453 | Bacteria | 7679 |
| 278 | Ga0495592_0054436 | 3300046454 | Bacteria | 2964 |
| 279 | Ga0495603_0040351 | 3300046455 | Bacteria | 2794 |
| 280 | Ga0495590_0000526 | 3300046457 | Bacteria | 18435 |
| 281 | Ga0495590_0000590 | 3300046457 | Bacteria | 17170 |
| 282 | Ga0495590_0002065 | 3300046457 | Bacteria | 8421 |
| 283 | Ga0495590_0014688 | 3300046457 | Bacteria | 2855 |
| 284 | Ga0495590_0079667 | 3300046457 | Bacteria | 1153 |
| 285 | Ga0495591_000662 | 3300046458 | Bacteria | 25480 |
| 286 | Ga0495591_001053 | 3300046458 | Bacteria | 18531 |
| 287 | Ga0495591_001801 | 3300046458 | Bacteria | 12697 |
| 288 | Ga0495591_006042 | 3300046458 | Bacteria | 5453 |
| 289 | Ga0495591_007275 | 3300046458 | Bacteria | 4737 |
| 290 | Ga0495591_009595 | 3300046458 | Bacteria | 3829 |
| 291 | Ga0495591_012653 | 3300046458 | Bacteria | 3128 |
| 292 | Ga0495591_014787 | 3300046458 | Bacteria | 2787 |
| 293 | Ga0495591_015807 | 3300046458 | Bacteria | 2653 |
| 294 | Ga0495629_0109292 | 3300046459 | Bacteria | 1928 |
| 295 | Ga0495638_0002131 | 3300046460 | Bacteria | 16640 |
| 296 | Ga0495638_0025467 | 3300046460 | Bacteria | 3845 |
| 297 | Ga0495638_0039599 | 3300046460 | Bacteria | 2991 |
| 298 | Ga0495638_0040998 | 3300046460 | Bacteria | 2931 |
| 299 | Ga0495638_0047180 | 3300046460 | Bacteria | 2702 |
| 300 | Ga0495638_0101369 | 3300046460 | Bacteria | 1721 |
| 301 | Ga0495638_0127633 | 3300046460 | Bacteria | 1497 |
| 302 | Ga0495653_0002927 | 3300046463 | Bacteria | 13659 |
| 303 | Ga0495653_0032117 | 3300046463 | Bacteria | 4171 |
| 304 | Ga0495653_0134771 | 3300046463 | Bacteria | 1743 |
| 305 | Ga0495650_0001708 | 3300046471 | Bacteria | 20183 |
| 306 | Ga0495650_0002550 | 3300046471 | Bacteria | 14477 |
| 307 | Ga0495650_0005686 | 3300046471 | Bacteria | 7994 |
| 308 | Ga0495650_0012711 | 3300046471 | Bacteria | 4509 |
| 309 | Ga0495650_0022720 | 3300046471 | Bacteria | 3003 |
| 310 | Ga0495650_0035240 | 3300046471 | Bacteria | 2204 |
| 311 | Ga0495650_0047085 | 3300046471 | Bacteria | 1805 |
| 312 | Ga0495650_0094991 | 3300046471 | Bacteria | 1127 |
| 313 | Ga0495582_0009290 | 3300046473 | Bacteria | 5423 |
| 314 | Ga0495605_0000193 | 3300046474 | Bacteria | 76229 |
| 315 | Ga0495605_0001045 | 3300046474 | Bacteria | 18527 |
| 316 | Ga0495605_0001305 | 3300046474 | Bacteria | 16514 |
| 317 | Ga0495605_0004260 | 3300046474 | Bacteria | 8427 |
| 318 | Ga0495605_0005110 | 3300046474 | Bacteria | 7650 |
| 319 | Ga0495605_0009011 | 3300046474 | Bacteria | 5616 |
| 320 | Ga0495605_0010497 | 3300046474 | Bacteria | 5180 |
| 321 | Ga0495605_0014946 | 3300046474 | Bacteria | 4233 |
| 322 | Ga0495605_0051810 | 3300046474 | Bacteria | 1997 |
| 323 | Ga0495639_0006694 | 3300046475 | Bacteria | 4958 |
| 324 | Ga0495639_0103135 | 3300046475 | Bacteria | 1348 |
| 325 | Ga0495664_0151700 | 3300046477 | Bacteria | 1406 |
| 326 | Ga0495584_0000376 | 3300046491 | Bacteria | 30692 |
| 327 | Ga0495584_0000442 | 3300046491 | Bacteria | 28587 |
| 328 | Ga0495584_0001269 | 3300046491 | Bacteria | 15364 |
| 329 | Ga0495584_0006321 | 3300046491 | Bacteria | 6208 |
| 330 | Ga0495584_0017355 | 3300046491 | Bacteria | 3665 |
| 331 | Ga0495584_0022233 | 3300046491 | Bacteria | 3219 |
| 332 | Ga0495584_0024271 | 3300046491 | Bacteria | 3075 |
| 333 | Ga0495584_0030316 | 3300046491 | Bacteria | 2740 |
| 334 | Ga0495584_0054354 | 3300046491 | Bacteria | 2015 |
| 335 | Ga0495584_0110081 | 3300046491 | Bacteria | 1393 |
| 336 | Ga0495584_0144455 | 3300046491 | Bacteria | 1208 |
| 337 | Ga0495585_0001045 | 3300046492 | Bacteria | 22938 |
| 338 | Ga0495585_0003021 | 3300046492 | Bacteria | 11595 |
| 339 | Ga0495585_0013590 | 3300046492 | Bacteria | 4758 |
| 340 | Ga0495585_0017713 | 3300046492 | Bacteria | 4113 |
| 341 | Ga0495585_0058308 | 3300046492 | Bacteria | 2130 |
| 342 | Ga0495585_0064105 | 3300046492 | Bacteria | 2015 |
| 343 | Ga0495585_0075489 | 3300046492 | Bacteria | 1832 |
| 344 | Ga0495585_0125111 | 3300046492 | Bacteria | 1357 |
| 345 | Ga0495594_0021296 | 3300046499 | Bacteria | 3460 |
| 346 | Ga0495594_0025048 | 3300046499 | Bacteria | 3206 |
| 347 | Ga0495596_0019395 | 3300046500 | Bacteria | 2794 |
| 348 | Ga0495607_0000963 | 3300046501 | Bacteria | 26619 |
| 349 | Ga0495607_0003226 | 3300046501 | Bacteria | 12573 |
| 350 | Ga0495607_0005264 | 3300046501 | Bacteria | 9310 |
| 351 | Ga0495607_0010078 | 3300046501 | Bacteria | 6363 |
| 352 | Ga0495607_0017684 | 3300046501 | Bacteria | 4567 |
| 353 | Ga0495607_0028476 | 3300046501 | Bacteria | 3447 |
| 354 | Ga0495607_0041793 | 3300046501 | Bacteria | 2721 |
| 355 | Ga0495607_0047282 | 3300046501 | Bacteria | 2521 |
| 356 | Ga0495607_0049085 | 3300046501 | Bacteria | 2463 |
| 357 | Ga0495607_0059576 | 3300046501 | Bacteria | 2177 |
| 358 | Ga0495607_0061071 | 3300046501 | Bacteria | 2142 |
| 359 | Ga0495607_0079948 | 3300046501 | Bacteria | 1799 |
| 360 | Ga0495607_0137238 | 3300046501 | Bacteria | 1265 |
| 361 | Ga0495607_0160996 | 3300046501 | Bacteria | 1140 |
| 362 | Ga0495583_0001715 | 3300046506 | Bacteria | 21058 |
| 363 | Ga0495583_0002503 | 3300046506 | Bacteria | 15572 |
| 364 | Ga0495583_0025867 | 3300046506 | Bacteria | 2923 |
| 365 | Ga0495583_0071094 | 3300046506 | Bacteria | 1529 |
| 366 | Ga0495606_0000176 | 3300046507 | Bacteria | 113311 |
| 367 | Ga0495606_0001321 | 3300046507 | Bacteria | 33870 |
| 368 | Ga0495606_0001801 | 3300046507 | Bacteria | 27281 |
| 369 | Ga0495606_0005034 | 3300046507 | Bacteria | 12864 |
| 370 | Ga0495606_0006941 | 3300046507 | Bacteria | 10298 |
| 371 | Ga0495606_0012768 | 3300046507 | Bacteria | 6696 |
| 372 | Ga0495606_0017298 | 3300046507 | Bacteria | 5458 |
| 373 | Ga0495606_0041104 | 3300046507 | Bacteria | 3102 |
| 374 | Ga0495606_0202990 | 3300046507 | Bacteria | 1128 |
| 375 | Ga0495610_0005237 | 3300046512 | Bacteria | 9277 |
| 376 | Ga0495610_0007098 | 3300046512 | Bacteria | 7558 |
| 377 | Ga0495610_0008151 | 3300046512 | Bacteria | 6841 |
| 378 | Ga0495610_0013966 | 3300046512 | Bacteria | 4745 |
| 379 | Ga0495610_0014192 | 3300046512 | Bacteria | 4693 |
| 380 | Ga0495616_0000704 | 3300046513 | Bacteria | 24772 |
| 381 | Ga0495616_0001304 | 3300046513 | Bacteria | 17440 |
| 382 | Ga0495616_0001608 | 3300046513 | Bacteria | 15484 |
| 383 | Ga0495616_0002728 | 3300046513 | Bacteria | 11556 |
| 384 | Ga0495616_0005421 | 3300046513 | Bacteria | 7859 |
| 385 | Ga0495616_0050833 | 3300046513 | Bacteria | 2070 |
| 386 | Ga0495616_0084021 | 3300046513 | Bacteria | 1518 |
| 387 | Ga0495616_0087582 | 3300046513 | Bacteria | 1479 |
| 388 | Ga0495616_0143474 | 3300046513 | Bacteria | 1085 |
| 389 | Ga0495620_0000532 | 3300046515 | Bacteria | 24382 |
| 390 | Ga0495620_0004291 | 3300046515 | Bacteria | 8063 |
| 391 | Ga0495620_0004727 | 3300046515 | Bacteria | 7654 |
| 392 | Ga0495620_0005775 | 3300046515 | Bacteria | 6874 |
| 393 | Ga0495620_0048981 | 3300046515 | Bacteria | 1810 |
| 394 | Ga0495620_0052259 | 3300046515 | Bacteria | 1736 |
| 395 | Ga0495630_0034327 | 3300046517 | Bacteria | 3788 |
| 396 | Ga0495630_0150168 | 3300046517 | Bacteria | 1772 |
| 397 | Ga0495630_0218368 | 3300046517 | Bacteria | 1455 |
| 398 | Ga0495631_0000401 | 3300046518 | Bacteria | 29978 |
| 399 | Ga0495631_0000547 | 3300046518 | Bacteria | 25286 |
| 400 | Ga0495631_0007445 | 3300046518 | Bacteria | 5565 |
| 401 | Ga0495631_0016102 | 3300046518 | Bacteria | 3573 |
| 402 | Ga0495631_0048159 | 3300046518 | Bacteria | 1869 |
| 403 | Ga0495631_0049336 | 3300046518 | Bacteria | 1843 |
| 404 | Ga0495631_0083511 | 3300046518 | Bacteria | 1376 |
| 405 | Ga0495632_0001346 | 3300046519 | Bacteria | 20643 |
| 406 | Ga0495632_0001697 | 3300046519 | Bacteria | 17978 |
| 407 | Ga0495632_0002048 | 3300046519 | Bacteria | 15845 |
| 408 | Ga0495632_0002133 | 3300046519 | Bacteria | 15386 |
| 409 | Ga0495632_0007869 | 3300046519 | Bacteria | 6627 |
| 410 | Ga0495632_0008734 | 3300046519 | Bacteria | 6177 |
| 411 | Ga0495632_0012801 | 3300046519 | Bacteria | 4815 |
| 412 | Ga0495632_0039797 | 3300046519 | Bacteria | 2370 |
| 413 | Ga0495632_0062120 | 3300046519 | Bacteria | 1811 |
| 414 | Ga0495632_0122178 | 3300046519 | Bacteria | 1216 |
| 415 | Ga0495632_0137220 | 3300046519 | Bacteria | 1136 |
| 416 | Ga0495637_0000721 | 3300046520 | Bacteria | 22609 |
| 417 | Ga0495637_0000839 | 3300046520 | Bacteria | 20292 |
| 418 | Ga0495637_0002282 | 3300046520 | Bacteria | 10628 |
| 419 | Ga0495637_0002350 | 3300046520 | Bacteria | 10481 |
| 420 | Ga0495637_0007192 | 3300046520 | Bacteria | 5541 |
| 421 | Ga0495637_0046467 | 3300046520 | Bacteria | 1836 |
| 422 | Ga0495637_0125047 | 3300046520 | Bacteria | 986 |
| 423 | Ga0495643_0006509 | 3300046522 | Bacteria | 7685 |
| 424 | Ga0495643_0010258 | 3300046522 | Bacteria | 5768 |
| 425 | Ga0495643_0025412 | 3300046522 | Bacteria | 3351 |
| 426 | Ga0495643_0028657 | 3300046522 | Bacteria | 3119 |
| 427 | Ga0495643_0035773 | 3300046522 | Bacteria | 2732 |
| 428 | Ga0495644_0004777 | 3300046523 | Bacteria | 5322 |
| 429 | Ga0495644_0017157 | 3300046523 | Bacteria | 2769 |
| 430 | Ga0495644_0061504 | 3300046523 | Bacteria | 1411 |
| 431 | Ga0495644_0065915 | 3300046523 | Bacteria | 1360 |
| 432 | Ga0495648_0005373 | 3300046524 | Bacteria | 10660 |
| 433 | Ga0495648_0007967 | 3300046524 | Bacteria | 8402 |
| 434 | Ga0495648_0009398 | 3300046524 | Bacteria | 7586 |
| 435 | Ga0495648_0011346 | 3300046524 | Bacteria | 6716 |
| 436 | Ga0495648_0025298 | 3300046524 | Bacteria | 4021 |
| 437 | Ga0495648_0030638 | 3300046524 | Bacteria | 3553 |
| 438 | Ga0495648_0031368 | 3300046524 | Bacteria | 3500 |
| 439 | Ga0495648_0032693 | 3300046524 | Bacteria | 3409 |
| 440 | Ga0495648_0034742 | 3300046524 | Bacteria | 3277 |
| 441 | Ga0495648_0040164 | 3300046524 | Bacteria | 2969 |
| 442 | Ga0495648_0054761 | 3300046524 | Bacteria | 2408 |
| 443 | Ga0495648_0141069 | 3300046524 | Bacteria | 1268 |
| 444 | Ga0495666_0018179 | 3300046526 | Bacteria | 3501 |
| 445 | Ga0495666_0082870 | 3300046526 | Bacteria | 1516 |
| 446 | Ga0495642_0000250 | 3300046528 | Bacteria | 30239 |
| 447 | Ga0495642_0000798 | 3300046528 | Bacteria | 15293 |
| 448 | Ga0495642_0001543 | 3300046528 | Bacteria | 10199 |
| 449 | Ga0495654_0000444 | 3300046530 | Bacteria | 35120 |
| 450 | Ga0495654_0000803 | 3300046530 | Bacteria | 24100 |
| 451 | Ga0495654_0001816 | 3300046530 | Bacteria | 14212 |
| 452 | Ga0495654_0004000 | 3300046530 | Bacteria | 8870 |
| 453 | Ga0495654_0032058 | 3300046530 | Bacteria | 2664 |
| 454 | Ga0495654_0041200 | 3300046530 | Bacteria | 2297 |
| 455 | Ga0495654_0044006 | 3300046530 | Bacteria | 2210 |
| 456 | Ga0495654_0058990 | 3300046530 | Bacteria | 1849 |
| 457 | Ga0495654_0073010 | 3300046530 | Bacteria | 1623 |
| 458 | Ga0495586_0014731 | 3300046535 | Bacteria | 4155 |
| 459 | Ga0495587_0040357 | 3300046536 | Bacteria | 2790 |
| 460 | Ga0495609_0001178 | 3300046538 | Bacteria | 18050 |
| 461 | Ga0495609_0005130 | 3300046538 | Bacteria | 6975 |
| 462 | Ga0495609_0007374 | 3300046538 | Bacteria | 5498 |
| 463 | Ga0495609_0008247 | 3300046538 | Bacteria | 5114 |
| 464 | Ga0495609_0017110 | 3300046538 | Bacteria | 3370 |
| 465 | Ga0495609_0023262 | 3300046538 | Bacteria | 2849 |
| 466 | Ga0495609_0034163 | 3300046538 | Bacteria | 2306 |
| 467 | Ga0495609_0037671 | 3300046538 | Bacteria | 2181 |
| 468 | Ga0495609_0055921 | 3300046538 | Bacteria | 1749 |
| 469 | Ga0495597_0004423 | 3300046542 | Bacteria | 7722 |
| 470 | Ga0495597_0006345 | 3300046542 | Bacteria | 6124 |
| 471 | Ga0495597_0007496 | 3300046542 | Bacteria | 5533 |
| 472 | Ga0495597_0011586 | 3300046542 | Bacteria | 4271 |
| 473 | Ga0495597_0069246 | 3300046542 | Bacteria | 1523 |
| 474 | Ga0495622_0004354 | 3300046557 | Bacteria | 6590 |
| 475 | Ga0495622_0007198 | 3300046557 | Bacteria | 5168 |
| 476 | Ga0495622_0048933 | 3300046557 | Bacteria | 1963 |
| 477 | Ga0495622_0052325 | 3300046557 | Bacteria | 1894 |
| 478 | Ga0495622_0072204 | 3300046557 | Bacteria | 1592 |
| 479 | Ga0495622_0078867 | 3300046557 | Bacteria | 1516 |
| 480 | Ga0495633_0000867 | 3300046558 | Bacteria | 26255 |
| 481 | Ga0495633_0006119 | 3300046558 | Bacteria | 7205 |
| 482 | Ga0495633_0033814 | 3300046558 | Bacteria | 2463 |
| 483 | Ga0495633_0111543 | 3300046558 | Bacteria | 1268 |
| 484 | Ga0495656_0004627 | 3300046615 | Bacteria | 4725 |
| 485 | Ga0495656_0015124 | 3300046615 | Bacteria | 2907 |
| 486 | Ga0495656_0023484 | 3300046615 | Bacteria | 2427 |
| 487 | Ga0495656_0047346 | 3300046615 | Bacteria | 1823 |
| 488 | Ga0495656_0158112 | 3300046615 | Bacteria | 1099 |
| 489 | Ga0495668_0002037 | 3300046616 | Bacteria | 17610 |
| 490 | Ga0495668_0011417 | 3300046616 | Bacteria | 5317 |
| 491 | Ga0495668_0048617 | 3300046616 | Bacteria | 2353 |
| 492 | Ga0495668_0089068 | 3300046616 | Bacteria | 1691 |
| 493 | Ga0495668_0089153 | 3300046616 | Bacteria | 1690 |
| 494 | Ga0495634_0001891 | 3300046642 | Bacteria | 17961 |
| 495 | Ga0495611_0000468 | 3300046648 | Bacteria | 24110 |
| 496 | Ga0495611_0003233 | 3300046648 | Bacteria | 7210 |
| 497 | Ga0495625_0002907 | 3300046660 | Bacteria | 17906 |
| 498 | Ga0495625_0004936 | 3300046660 | Bacteria | 12404 |
| 499 | Ga0495625_0017184 | 3300046660 | Bacteria | 5665 |
| 500 | Ga0495625_0067664 | 3300046660 | Bacteria | 2513 |
| 501 | Ga0495625_0108893 | 3300046660 | Bacteria | 1895 |
| 502 | Ga0495625_0141689 | 3300046660 | Bacteria | 1621 |
| 503 | Ga0495625_0204660 | 3300046660 | Bacteria | 1300 |
| 504 | Ga0495625_0261928 | 3300046660 | Bacteria | 1118 |
| 505 | Ga0495635_0001260 | 3300046663 | Bacteria | 16939 |
| 506 | Ga0495659_0020306 | 3300046664 | Bacteria | 2229 |
| 507 | Ga0495659_0086512 | 3300046664 | Bacteria | 1197 |
| 508 | Ga0495659_0089552 | 3300046664 | Bacteria | 1179 |
| 509 | Ga0495661_0011651 | 3300046665 | Bacteria | 5959 |
| 510 | Ga0495661_0038255 | 3300046665 | Bacteria | 2990 |
| 511 | Ga0495661_0040580 | 3300046665 | Bacteria | 2885 |
| 512 | Ga0495661_0070295 | 3300046665 | Bacteria | 2049 |
| 513 | Ga0495661_0138156 | 3300046665 | Bacteria | 1328 |
| 514 | Ga0495588_0020068 | 3300046674 | Bacteria | 3279 |
| 515 | Ga0495588_0049632 | 3300046674 | Bacteria | 2158 |
| 516 | Ga0495588_0071455 | 3300046674 | Bacteria | 1805 |
| 517 | Ga0495588_0108228 | 3300046674 | Bacteria | 1463 |
| 518 | Ga0495588_0144299 | 3300046674 | Bacteria | 1258 |
| 519 | Ga0495623_0001367 | 3300046679 | Bacteria | 16547 |
| 520 | Ga0495646_0001267 | 3300046680 | Bacteria | 14846 |
| 521 | Ga0495646_0019328 | 3300046680 | Bacteria | 4314 |
| 522 | Ga0495646_0071714 | 3300046680 | Bacteria | 2037 |
| 523 | Ga0495669_0005602 | 3300046684 | Bacteria | 5239 |
| 524 | Ga0495613_0016685 | 3300046689 | Bacteria | 5467 |
| 525 | Ga0495613_0027894 | 3300046689 | Bacteria | 4203 |
| 526 | Ga0495613_0033897 | 3300046689 | Bacteria | 3792 |
| 527 | Ga0495624_0001286 | 3300046690 | Bacteria | 19787 |
| 528 | Ga0495624_0127975 | 3300046690 | Bacteria | 1558 |
| 529 | Ga0495670_0003476 | 3300046691 | Bacteria | 7737 |
| 530 | Ga0495670_0010629 | 3300046691 | Bacteria | 4523 |
| 531 | Ga0495670_0021869 | 3300046691 | Bacteria | 3156 |
| 532 | Ga0495670_0034972 | 3300046691 | Bacteria | 2503 |
| 533 | Ga0495670_0093026 | 3300046691 | Bacteria | 1545 |
| 534 | Ga0495670_0123616 | 3300046691 | Bacteria | 1345 |
| 535 | Ga0495670_0125762 | 3300046691 | Bacteria | 1334 |
| 536 | Ga0495671_0000094 | 3300046692 | Bacteria | 83635 |
| 537 | Ga0495671_0003431 | 3300046692 | Bacteria | 9734 |
| 538 | Ga0495671_0004200 | 3300046692 | Bacteria | 8674 |
| 539 | Ga0495671_0005088 | 3300046692 | Bacteria | 7737 |
| 540 | Ga0495671_0007897 | 3300046692 | Bacteria | 6018 |
| 541 | Ga0495671_0028726 | 3300046692 | Bacteria | 2861 |
| 542 | Ga0495671_0035073 | 3300046692 | Bacteria | 2549 |
| 543 | Ga0495671_0040241 | 3300046692 | Bacteria | 2357 |
| 544 | Ga0495671_0140952 | 3300046692 | Bacteria | 1174 |
| 545 | Ga0495649_0001875 | 3300046694 | Bacteria | 15372 |
| 546 | Ga0495649_0008206 | 3300046694 | Bacteria | 6293 |
| 547 | Ga0495649_0012389 | 3300046694 | Bacteria | 4963 |
| 548 | Ga0495649_0018514 | 3300046694 | Bacteria | 3917 |
| 549 | Ga0495649_0018714 | 3300046694 | Bacteria | 3892 |
| 550 | Ga0495649_0033805 | 3300046694 | Bacteria | 2814 |
| 551 | Ga0495649_0038544 | 3300046694 | Bacteria | 2621 |
| 552 | Ga0495589_0000580 | 3300046794 | Bacteria | 25222 |
| 553 | Ga0495589_0001331 | 3300046794 | Bacteria | 14516 |
| 554 | Ga0495589_0005527 | 3300046794 | Bacteria | 6666 |
| 555 | Ga0495589_0006916 | 3300046794 | Bacteria | 5957 |
| 556 | Ga0495589_0030423 | 3300046794 | Bacteria | 2718 |
| 557 | Ga0495589_0042791 | 3300046794 | Bacteria | 2256 |
| 558 | Ga0495589_0044815 | 3300046794 | Bacteria | 2198 |
| 559 | Ga0495600_0002832 | 3300046809 | Bacteria | 10089 |
| 560 | Ga0495600_0052523 | 3300046809 | Bacteria | 2661 |
| 561 | Ga0495660_0001478 | 3300046810 | Bacteria | 15991 |
| 562 | Ga0495660_0010035 | 3300046810 | Bacteria | 5508 |
| 563 | Ga0495660_0012868 | 3300046810 | Bacteria | 4852 |
| 564 | Ga0495660_0013641 | 3300046810 | Bacteria | 4710 |
| 565 | Ga0495660_0019355 | 3300046810 | Bacteria | 3908 |
| 566 | Ga0495660_0031273 | 3300046810 | Bacteria | 2993 |
| 567 | Ga0495660_0056295 | 3300046810 | Bacteria | 2125 |
| 568 | Ga0495660_0081307 | 3300046810 | Bacteria | 1698 |
| 569 | Ga0495581_0001153 | 3300047315 | Bacteria | 14465 |
| 570 | Ga0495581_0210044 | 3300047315 | Bacteria | 1138 |
| 571 | Ga0495604_0087936 | 3300047317 | Bacteria | 2312 |
| 572 | Ga0495636_0000187 | 3300047318 | Bacteria | 24622 |
| 573 | Ga0495636_0002043 | 3300047318 | Bacteria | 7741 |
| 574 | Ga0495636_0002708 | 3300047318 | Bacteria | 6836 |
| 575 | Ga0495636_0033839 | 3300047318 | Bacteria | 2102 |
| 576 | Ga0495636_0115825 | 3300047318 | Bacteria | 1182 |
| 577 | Ga0495674_0066255 | 3300047319 | Bacteria | 3134 |
| 578 | Ga0495672_0002470 | 3300047320 | Bacteria | 16990 |
| 579 | Ga0495672_0002731 | 3300047320 | Bacteria | 15820 |
| 580 | Ga0495672_0003013 | 3300047320 | Bacteria | 14812 |
| 581 | Ga0495672_0003388 | 3300047320 | Bacteria | 13709 |
| 582 | Ga0495672_0006068 | 3300047320 | Bacteria | 9439 |
| 583 | Ga0495672_0007951 | 3300047320 | Bacteria | 7905 |
| 584 | Ga0495672_0011726 | 3300047320 | Bacteria | 6163 |
| 585 | Ga0495672_0013597 | 3300047320 | Bacteria | 5606 |
| 586 | Ga0495672_0016439 | 3300047320 | Bacteria | 4986 |
| 587 | Ga0495672_0035749 | 3300047320 | Bacteria | 3057 |
| 588 | Ga0495676_0001430 | 3300047321 | Bacteria | 20579 |
| 589 | Ga0495676_0037111 | 3300047321 | Bacteria | 4060 |
| 590 | Ga0495680_0004433 | 3300047322 | Bacteria | 13408 |
| 591 | Ga0495680_0004958 | 3300047322 | Bacteria | 12594 |
| 592 | Ga0495680_0005052 | 3300047322 | Bacteria | 12458 |
| 593 | Ga0495680_0052832 | 3300047322 | Bacteria | 3165 |
| 594 | Ga0495680_0329369 | 3300047322 | Bacteria | 1067 |
| 595 | Ga0495683_0000479 | 3300047323 | Bacteria | 31100 |
| 596 | Ga0495683_0006160 | 3300047323 | Bacteria | 6575 |
| 597 | Ga0495683_0010817 | 3300047323 | Bacteria | 4812 |
| 598 | Ga0495683_0027561 | 3300047323 | Bacteria | 2904 |
| 599 | Ga0495683_0060891 | 3300047323 | Bacteria | 1870 |
| 600 | Ga0495683_0082249 | 3300047323 | Bacteria | 1569 |
| 601 | Ga0495687_002016 | 3300047443 | Bacteria | 17193 |
| 602 | Ga0495687_002564 | 3300047443 | Bacteria | 14339 |
| 603 | Ga0495687_002722 | 3300047443 | Bacteria | 13710 |
| 604 | Ga0495675_0029964 | 3300047444 | Bacteria | 3471 |
| 605 | Ga0495675_0116302 | 3300047444 | Bacteria | 1667 |
| 606 | Ga0495677_0004924 | 3300047445 | Bacteria | 5091 |
| 607 | Ga0495679_001806 | 3300047446 | Bacteria | 11651 |
| 608 | Ga0495679_003804 | 3300047446 | Bacteria | 7146 |
| 609 | Ga0495679_013769 | 3300047446 | Bacteria | 3021 |
| 610 | Ga0495679_017758 | 3300047446 | Bacteria | 2540 |
| 611 | Ga0495679_018923 | 3300047446 | Bacteria | 2432 |
| 612 | Ga0495679_023089 | 3300047446 | Bacteria | 2116 |
| 613 | Ga0495679_048514 | 3300047446 | Bacteria | 1283 |
| 614 | Ga0495673_0000279 | 3300047469 | Bacteria | 69195 |
| 615 | Ga0495673_0000753 | 3300047469 | Bacteria | 30736 |
| 616 | Ga0495673_0001887 | 3300047469 | Bacteria | 15731 |
| 617 | Ga0495673_0006271 | 3300047469 | Bacteria | 7013 |
| 618 | Ga0495673_0008945 | 3300047469 | Bacteria | 5577 |
| 619 | Ga0495673_0011098 | 3300047469 | Bacteria | 4866 |
| 620 | Ga0495673_0012896 | 3300047469 | Bacteria | 4408 |
| 621 | Ga0495673_0017271 | 3300047469 | Bacteria | 3670 |
| 622 | Ga0495673_0020414 | 3300047469 | Bacteria | 3298 |
| 623 | Ga0495673_0023802 | 3300047469 | Bacteria | 2971 |
| 624 | Ga0495673_0039379 | 3300047469 | Bacteria | 2144 |
| 625 | Ga0495673_0040848 | 3300047469 | Bacteria | 2091 |
| 626 | Ga0495673_0041083 | 3300047469 | Bacteria | 2084 |
| 627 | Ga0495673_0062326 | 3300047469 | Bacteria | 1593 |
| 628 | Ga0495673_0066556 | 3300047469 | Bacteria | 1527 |
| 629 | Ga0495681_0000659 | 3300047470 | Bacteria | 26265 |
| 630 | Ga0495681_0000859 | 3300047470 | Bacteria | 23363 |
| 631 | Ga0495681_0001461 | 3300047470 | Bacteria | 17673 |
| 632 | Ga0495681_0001998 | 3300047470 | Bacteria | 14903 |
| 633 | Ga0495681_0002273 | 3300047470 | Bacteria | 13809 |
| 634 | Ga0495681_0004668 | 3300047470 | Bacteria | 9287 |
| 635 | Ga0495681_0007561 | 3300047470 | Bacteria | 6916 |
| 636 | Ga0495684_0158036 | 3300047471 | Bacteria | 1692 |
| 637 | Ga0495686_0002014 | 3300047472 | Bacteria | 20088 |
| 638 | Ga0495686_0076714 | 3300047472 | Bacteria | 2048 |
| 639 | Ga0495686_0109494 | 3300047472 | Bacteria | 1658 |
| 640 | Ga0495593_0018284 | 3300047673 | Bacteria | 3940 |
| 641 | Ga0495593_0026174 | 3300047673 | Bacteria | 3224 |
| 642 | Ga0495593_0055303 | 3300047673 | Bacteria | 2089 |
| 643 | Ga0495602_0005007 | 3300048088 | Bacteria | 13890 |
| 644 | Ga0495602_0074719 | 3300048088 | Bacteria | 2880 |
| 645 | Ga0495602_0109424 | 3300048088 | Bacteria | 2248 |
| 646 | Ga0495614_0015172 | 3300048089 | Bacteria | 3361 |
| 647 | Ga0495626_0000536 | 3300048091 | Bacteria | 37711 |
| 648 | Ga0495626_0001094 | 3300048091 | Bacteria | 22950 |
| 649 | Ga0495626_0001115 | 3300048091 | Bacteria | 22667 |
| 650 | Ga0495626_0001219 | 3300048091 | Bacteria | 21187 |
| 651 | Ga0495626_0001943 | 3300048091 | Bacteria | 15346 |
| 652 | Ga0495626_0005883 | 3300048091 | Bacteria | 7064 |
| 653 | Ga0495626_0013416 | 3300048091 | Bacteria | 4257 |
| 654 | Ga0495626_0017675 | 3300048091 | Bacteria | 3595 |
| 655 | Ga0495626_0020665 | 3300048091 | Bacteria | 3277 |
| 656 | Ga0495626_0036834 | 3300048091 | Bacteria | 2328 |
| 657 | Ga0495626_0057257 | 3300048091 | Bacteria | 1783 |
| 658 | Ga0495626_0078900 | 3300048091 | Bacteria | 1465 |
| 659 | Ga0495626_0138956 | 3300048091 | Bacteria | 1031 |
| 660 | Ga0496102_0002255 | 3300048905 | Bacteria | 16515 |
| 661 | Ga0496103_0007656 | 3300048906 | Bacteria | 6425 |
| 662 | Ga0496103_0094731 | 3300048906 | Bacteria | 1886 |
| 663 | Ga0496103_0230359 | 3300048906 | Bacteria | 1192 |
| 664 | Ga0496104_0289558 | 3300048907 | Bacteria | 1550 |
| 665 | Ga0496106_0020543 | 3300048909 | Bacteria | 4903 |
| 666 | Ga0496106_0094314 | 3300048909 | Bacteria | 2314 |
| 667 | Ga0496109_0199675 | 3300048912 | Bacteria | 1880 |
| 668 | Ga0496110_0065550 | 3300048913 | Bacteria | 3211 |
| 669 | Ga0496111_0005004 | 3300048914 | Bacteria | 8432 |
| 670 | Ga0496114_0152930 | 3300048917 | Bacteria | 2002 |
| 671 | Ga0496115_0052777 | 3300048918 | Bacteria | 3262 |
| 672 | Ga0496116_0000023 | 3300048919 | Bacteria | 475792 |
| 673 | Ga0496116_0000850 | 3300048919 | Bacteria | 38248 |
| 674 | Ga0496116_0077853 | 3300048919 | Bacteria | 2070 |
| 675 | Ga0496117_0000463 | 3300048920 | Bacteria | 67832 |
| 676 | Ga0496117_0026838 | 3300048920 | Bacteria | 4498 |
| 677 | Ga0496117_0085021 | 3300048920 | Bacteria | 2061 |
| 678 | Ga0496117_0096079 | 3300048920 | Bacteria | 1891 |
| 679 | Ga0496118_0003815 | 3300048921 | Bacteria | 18566 |
| 680 | Ga0496118_0012630 | 3300048921 | Bacteria | 8081 |
| 681 | Ga0496118_0059719 | 3300048921 | Bacteria | 2836 |
| 682 | Ga0496118_0090110 | 3300048921 | Bacteria | 2114 |
| 683 | Ga0496118_0151410 | 3300048921 | Bacteria | 1451 |
| 684 | Ga0496119_0001891 | 3300048922 | Bacteria | 24077 |
| 685 | Ga0496119_0006363 | 3300048922 | Bacteria | 10978 |
| 686 | Ga0496120_0000137 | 3300048923 | Bacteria | 123518 |
| 687 | Ga0496120_0002332 | 3300048923 | Bacteria | 19530 |
| 688 | Ga0496120_0044361 | 3300048923 | Bacteria | 2584 |
| 689 | Ga0496121_0079416 | 3300048924 | Bacteria | 2605 |
| 690 | Ga0496121_0187726 | 3300048924 | Bacteria | 1485 |
| 691 | Ga0496124_0000017 | 3300048927 | Bacteria | 444389 |
| 692 | Ga0496124_0001066 | 3300048927 | Bacteria | 43350 |
| 693 | Ga0496124_0001309 | 3300048927 | Bacteria | 37591 |
| 694 | Ga0496124_0070046 | 3300048927 | Bacteria | 2910 |
| 695 | Ga0496124_0132131 | 3300048927 | Bacteria | 1982 |
| 696 | Ga0496124_0154054 | 3300048927 | Bacteria | 1799 |
| 697 | Ga0496125_0000245 | 3300048928 | Bacteria | 111310 |
| 698 | Ga0496125_0034882 | 3300048928 | Bacteria | 4426 |
| 699 | Ga0496125_0056994 | 3300048928 | Bacteria | 3168 |
| 700 | Ga0496126_0505290 | 3300048929 | Bacteria | 965 |
| 701 | Ga0495678_000954 | 3300049459 | Bacteria | 25047 |
| 702 | Ga0495678_001864 | 3300049459 | Bacteria | 15356 |
| 703 | Ga0495678_002901 | 3300049459 | Bacteria | 11041 |
| 704 | Ga0495678_003162 | 3300049459 | Bacteria | 10391 |
| 705 | Ga0495678_005291 | 3300049459 | Bacteria | 7168 |
| 706 | Ga0495678_006284 | 3300049459 | Bacteria | 6339 |
| 707 | Ga0495678_006384 | 3300049459 | Bacteria | 6285 |
| 708 | Ga0495678_018244 | 3300049459 | Bacteria | 3160 |
| 709 | Ga0495678_091248 | 3300049459 | Bacteria | 1073 |
| 710 | Ga0495682_0000556 | 3300049460 | Bacteria | 25639 |
| 711 | Ga0495682_0001075 | 3300049460 | Bacteria | 16065 |
| 712 | Ga0495682_0002272 | 3300049460 | Bacteria | 9213 |
| 713 | Ga0495682_0008040 | 3300049460 | Bacteria | 4171 |
| 714 | Ga0495682_0017194 | 3300049460 | Bacteria | 2733 |
| 715 | Ga0495682_0025693 | 3300049460 | Bacteria | 2191 |
| 716 | Ga0495682_0046600 | 3300049460 | Bacteria | 1582 |
| 717 | Ga0495682_0060696 | 3300049460 | Bacteria | 1365 |
| 718 | Ga0495682_0064721 | 3300049460 | Bacteria | 1318 |
| 719 | Ga0501034_0000563 | 3300049571 | Bacteria | 58800 |
| 720 | Ga0501043_0003494 | 3300049579 | Bacteria | 12916 |
| 721 | nmdc:mga06r32_3118_c1 | 3300050510 | Bacteria | 14835 |
| 722 | Ga0500621_081523 | 3300053126 | Bacteria | 1296 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006847 | Ga0075431_100025057 | Ga0075431_1000250576 | 230 |
| 2 | 3300050510 | nmdc:mga06r32_3118_c1 | nmdc:mga06r32_3118_c1_13628_14539 | 230 |
| 3 | 3300005719 | Ga0068861_100525568 | Ga0068861_1005255682 | 234 |
| 4 | 3300025711 | Ga0207696_1000051 | Ga0207696_100005158 | 242 |
| 5 | 3300025728 | Ga0207655_1007085 | Ga0207655_10070852 | 242 |
| 6 | 3300046810 | Ga0495660_0081307 | Ga0495660_0081307_12_761 | 249 |
| 7 | 3300046794 | Ga0495589_0000580 | Ga0495589_0000580_11010_11762 | 250 |
| 8 | 3300047446 | Ga0495679_001806 | Ga0495679_001806_3367_4119 | 250 |
| 9 | 3300048920 | Ga0496117_0085021 | Ga0496117_0085021_266_1063 | 251 |
| 10 | 3300048921 | Ga0496118_0090110 | Ga0496118_0090110_622_1419 | 251 |
| 11 | 3300005288 | Ga0065714_10068325 | Ga0065714_100683255 | 253 |
| 12 | 3300017792 | Ga0163161_10002214 | Ga0163161_1000221415 | 253 |
| 13 | 3300046455 | Ga0495603_0040351 | Ga0495603_0040351_622_1425 | 253 |
| 14 | 3300047322 | Ga0495680_0329369 | Ga0495680_0329369_29_790 | 253 |
| 15 | 3300047444 | Ga0495675_0029964 | Ga0495675_0029964_19_783 | 254 |
| 16 | 3300006058 | Ga0075432_10002606 | Ga0075432_100026065 | 255 |
| 17 | 3300046460 | Ga0495638_0039599 | Ga0495638_0039599_2192_2959 | 255 |
| 18 | 3300046512 | Ga0495610_0008151 | Ga0495610_0008151_1611_2414 | 255 |
| 19 | 3300047470 | Ga0495681_0004668 | Ga0495681_0004668_4689_5492 | 255 |
| 20 | 3300046517 | Ga0495630_0150168 | Ga0495630_0150168_508_1311 | 258 |
| 21 | 3300046642 | Ga0495634_0001891 | Ga0495634_0001891_2319_3122 | 258 |
| 22 | 3300046663 | Ga0495635_0001260 | Ga0495635_0001260_14907_15710 | 258 |
| 23 | 3300047319 | Ga0495674_0066255 | Ga0495674_0066255_1927_2730 | 258 |
| 24 | 3300048088 | Ga0495602_0109424 | Ga0495602_0109424_894_1697 | 258 |
| 25 | 3300048917 | Ga0496114_0152930 | Ga0496114_0152930_678_1481 | 258 |
| 26 | 3300048918 | Ga0496115_0052777 | Ga0496115_0052777_409_1212 | 258 |
| 27 | 3300048924 | Ga0496121_0187726 | Ga0496121_0187726_34_837 | 258 |
| 28 | 3300048927 | Ga0496124_0001309 | Ga0496124_0001309_6303_7118 | 258 |
| 29 | 3300005347 | Ga0070668_100152708 | Ga0070668_1001527082 | 259 |
| 30 | 3300005365 | Ga0070688_100211651 | Ga0070688_1002116512 | 259 |
| 31 | 3300005455 | Ga0070663_100164695 | Ga0070663_1001646952 | 259 |
| 32 | 3300005456 | Ga0070678_100018247 | Ga0070678_1000182474 | 259 |
| 33 | 3300005544 | Ga0070686_100615399 | Ga0070686_1006153991 | 259 |
| 34 | 3300026067 | Ga0207678_10186354 | Ga0207678_101863542 | 259 |
| 35 | 3300026121 | Ga0207683_10111005 | Ga0207683_101110052 | 259 |
| 36 | 3300028379 | Ga0268266_10388094 | Ga0268266_103880942 | 259 |
| 37 | 3300003759 | Ga0055525_1000011 | Ga0055525_100001183 | 260 |
| 38 | 3300014326 | Ga0157380_10177597 | Ga0157380_101775972 | 260 |
| 39 | 3300025230 | Ga0209563_100005 | Ga0209563_100005408 | 260 |
| 40 | 3300046460 | Ga0495638_0002131 | Ga0495638_0002131_8519_9316 | 260 |
| 41 | 3300046615 | Ga0495656_0004627 | Ga0495656_0004627_2354_3148 | 260 |
| 42 | 3300035115 | Ga0373941_0014226 | Ga0373941_0014226_299_1090 | 261 |
| 43 | 3300039447 | Ga0436361_0770940 | Ga0436361_0770940_6123_6923 | 261 |
| 44 | 3300042006 | Ga0439432_006809 | Ga0439432_006809_3055_3855 | 261 |
| 45 | 3300042007 | Ga0439449_0038389 | Ga0439449_0038389_354_1154 | 261 |
| 46 | iso_pu_bacteria | 2511231010 | 2511291322 | 261 |
| 47 | iso_pu_bacteria | 2511231011 | 2511296510 | 261 |
| 48 | iso_pu_bacteria | 2511231023 | 2511372706 | 261 |
| 49 | iso_pu_bacteria | 2511231031 | 2511414315 | 261 |
| 50 | iso_pu_bacteria | 2600255318 | 2601796086 | 261 |
| 51 | iso_pu_bacteria | 2603880185 | 2606075061 | 261 |
| 52 | iso_pu_bacteria | 2603880199 | 2606127924 | 261 |
| 53 | iso_pu_bacteria | 2623620443 | 2624480135 | 261 |
| 54 | iso_pu_bacteria | 2643221695 | 2644528164 | 261 |
| 55 | iso_pu_bacteria | 2713897149 | 2715758470 | 261 |
| 56 | iso_pu_bacteria | 2738543025 | 2739315947 | 261 |
| 57 | iso_pu_bacteria | 2773857673 | 2774137953 | 261 |
| 58 | iso_pu_bacteria | 2852657418 | 2852659583 | 261 |
| 59 | iso_pu_bacteria | 2878029506 | 2878032046 | 261 |
| 60 | iso_pu_bacteria | 2880230671 | 2880232985 | 261 |
| 61 | iso_pu_bacteria | 2904518522 | 2904520299 | 261 |
| 62 | iso_pu_bacteria | 2919063839 | 2919068515 | 261 |
| 63 | iso_pu_bacteria | 2969304461 | 2969308032 | 261 |
| 64 | iso_pu_bacteria | 3007614139 | 3007616328 | 261 |
| 65 | iso_pu_bacteria | 8056569372 | 8056574206 | 261 |
| 66 | 2162886007 | SwRhRL2b_contig_3133948 | SwRhRL2b_0295.00005470 | 262 |
| 67 | 3300003775 | Ga0055524_1005261 | Ga0055524_10052612 | 262 |
| 68 | 3300003775 | Ga0055524_1035868 | Ga0055524_10358682 | 262 |
| 69 | 3300003775 | Ga0055524_1037096 | Ga0055524_10370962 | 262 |
| 70 | 3300003781 | Ga0055536_1003892 | Ga0055536_10038924 | 262 |
| 71 | 3300003781 | Ga0055536_1010660 | Ga0055536_10106603 | 262 |
| 72 | 3300003791 | Ga0055530_10000989 | Ga0055530_100009891 | 262 |
| 73 | 3300003794 | Ga0055531_10001774 | Ga0055531_100017743 | 262 |
| 74 | 3300003794 | Ga0055531_10005746 | Ga0055531_100057466 | 262 |
| 75 | 3300003794 | Ga0055531_10006112 | Ga0055531_100061125 | 262 |
| 76 | 3300003794 | Ga0055531_10012823 | Ga0055531_100128232 | 262 |
| 77 | 3300005289 | Ga0065704_10072534 | Ga0065704_100725346 | 262 |
| 78 | 3300005353 | Ga0070669_100018896 | Ga0070669_1000188965 | 262 |
| 79 | 3300005548 | Ga0070665_100106733 | Ga0070665_1001067333 | 262 |
| 80 | 3300009011 | Ga0105251_10006905 | Ga0105251_100069054 | 262 |
| 81 | 3300009011 | Ga0105251_10029374 | Ga0105251_100293742 | 262 |
| 82 | 3300009011 | Ga0105251_10052025 | Ga0105251_100520252 | 262 |
| 83 | 3300009036 | Ga0105244_10056666 | Ga0105244_100566661 | 262 |
| 84 | 3300009036 | Ga0105244_10103690 | Ga0105244_101036902 | 262 |
| 85 | 3300009092 | Ga0105250_10008470 | Ga0105250_100084703 | 262 |
| 86 | 3300009148 | Ga0105243_10000252 | Ga0105243_1000025235 | 262 |
| 87 | 3300011119 | Ga0105246_10000121 | Ga0105246_1000012129 | 262 |
| 88 | 3300012498 | Ga0157345_1000052 | Ga0157345_100005226 | 262 |
| 89 | 3300013100 | Ga0157373_10000588 | Ga0157373_1000058824 | 262 |
| 90 | 3300013104 | Ga0157370_10062506 | Ga0157370_100625063 | 262 |
| 91 | 3300013104 | Ga0157370_10388656 | Ga0157370_103886562 | 262 |
| 92 | 3300013105 | Ga0157369_10000310 | Ga0157369_1000031022 | 262 |
| 93 | 3300013306 | Ga0163162_10014155 | Ga0163162_100141553 | 262 |
| 94 | 3300013306 | Ga0163162_10172335 | Ga0163162_101723352 | 262 |
| 95 | 3300013306 | Ga0163162_10224332 | Ga0163162_102243322 | 262 |
| 96 | 3300017792 | Ga0163161_10000183 | Ga0163161_1000018325 | 262 |
| 97 | 3300017792 | Ga0163161_10134128 | Ga0163161_101341282 | 262 |
| 98 | 3300017792 | Ga0163161_10290143 | Ga0163161_102901432 | 262 |
| 99 | 3300025230 | Ga0209563_100920 | Ga0209563_1009203 | 262 |
| 100 | 3300025245 | Ga0207425_1025497 | Ga0207425_10254971 | 262 |
| 101 | 3300025273 | Ga0209673_1003514 | Ga0209673_10035146 | 262 |
| 102 | 3300025273 | Ga0209673_1024962 | Ga0209673_10249622 | 262 |
| 103 | 3300025284 | Ga0209130_1005337 | Ga0209130_10053372 | 262 |
| 104 | 3300025291 | Ga0209675_1001721 | Ga0209675_10017214 | 262 |
| 105 | 3300025291 | Ga0209675_1002868 | Ga0209675_10028684 | 262 |
| 106 | 3300025291 | Ga0209675_1021578 | Ga0209675_10215782 | 262 |
| 107 | 3300025292 | Ga0209676_1000400 | Ga0209676_100040022 | 262 |
| 108 | 3300025292 | Ga0209676_1001340 | Ga0209676_10013405 | 262 |
| 109 | 3300025292 | Ga0209676_1002413 | Ga0209676_10024134 | 262 |
| 110 | 3300025292 | Ga0209676_1006874 | Ga0209676_10068742 | 262 |
| 111 | 3300025292 | Ga0209676_1020237 | Ga0209676_10202373 | 262 |
| 112 | 3300025292 | Ga0209676_1031724 | Ga0209676_10317242 | 262 |
| 113 | 3300025292 | Ga0209676_1040927 | Ga0209676_10409271 | 262 |
| 114 | 3300025294 | Ga0209025_1041961 | Ga0209025_10419612 | 262 |
| 115 | 3300025294 | Ga0209025_1051145 | Ga0209025_10511452 | 262 |
| 116 | 3300025295 | Ga0209564_1005102 | Ga0209564_10051025 | 262 |
| 117 | 3300025297 | Ga0209758_1029801 | Ga0209758_10298012 | 262 |
| 118 | 3300025298 | Ga0209050_1000528 | Ga0209050_100052818 | 262 |
| 119 | 3300025298 | Ga0209050_1015172 | Ga0209050_10151723 | 262 |
| 120 | 3300025299 | Ga0209256_1001764 | Ga0209256_100176422 | 262 |
| 121 | 3300025299 | Ga0209256_1002020 | Ga0209256_100202011 | 262 |
| 122 | 3300025299 | Ga0209256_1005256 | Ga0209256_10052566 | 262 |
| 123 | 3300025303 | Ga0209051_1005323 | Ga0209051_10053234 | 262 |
| 124 | 3300025304 | Ga0209257_1000080 | Ga0209257_1000080264 | 262 |
| 125 | 3300025304 | Ga0209257_1000727 | Ga0209257_100072737 | 262 |
| 126 | 3300025304 | Ga0209257_1008260 | Ga0209257_10082605 | 262 |
| 127 | 3300025304 | Ga0209257_1010641 | Ga0209257_10106414 | 262 |
| 128 | 3300025711 | Ga0207696_1001731 | Ga0207696_10017316 | 262 |
| 129 | 3300025711 | Ga0207696_1004943 | Ga0207696_10049433 | 262 |
| 130 | 3300025728 | Ga0207655_1002984 | Ga0207655_10029845 | 262 |
| 131 | 3300025728 | Ga0207655_1019490 | Ga0207655_10194902 | 262 |
| 132 | 3300025728 | Ga0207655_1066020 | Ga0207655_10660202 | 262 |
| 133 | 3300025735 | Ga0207713_1002745 | Ga0207713_100274510 | 262 |
| 134 | 3300025735 | Ga0207713_1003122 | Ga0207713_10031226 | 262 |
| 135 | 3300025735 | Ga0207713_1006435 | Ga0207713_10064352 | 262 |
| 136 | 3300025735 | Ga0207713_1033207 | Ga0207713_10332072 | 262 |
| 137 | 3300025923 | Ga0207681_10013906 | Ga0207681_100139064 | 262 |
| 138 | 3300025935 | Ga0207709_10000011 | Ga0207709_10000011130 | 262 |
| 139 | 3300028379 | Ga0268266_10206869 | Ga0268266_102068692 | 262 |
| 140 | 3300031911 | Ga0307412_10011330 | Ga0307412_100113302 | 262 |
| 141 | 3300031911 | Ga0307412_10062413 | Ga0307412_100624133 | 262 |
| 142 | 3300032005 | Ga0307411_10106882 | Ga0307411_101068822 | 262 |
| 143 | 3300033180 | Ga0307510_10001323 | Ga0307510_100013237 | 262 |
| 144 | 3300038705 | Ga0237819_02002 | Ga0237819_02002_661_1458 | 262 |
| 145 | 3300041404 | Ga0439436_0017230 | Ga0439436_0017230_1275_2081 | 262 |
| 146 | 3300041413 | Ga0439465_0000085 | Ga0439465_0000085_8868_9674 | 262 |
| 147 | 3300042007 | Ga0439449_0000042 | Ga0439449_0000042_32394_33200 | 262 |
| 148 | 3300042532 | Ga0450893_0021031 | Ga0450893_0021031_135_932 | 262 |
| 149 | 3300046452 | Ga0495617_002981 | Ga0495617_002981_3772_4569 | 262 |
| 150 | 3300046452 | Ga0495617_004376 | Ga0495617_004376_3736_4533 | 262 |
| 151 | 3300046452 | Ga0495617_009097 | Ga0495617_009097_2269_3066 | 262 |
| 152 | 3300046452 | Ga0495617_016648 | Ga0495617_016648_411_1208 | 262 |
| 153 | 3300046452 | Ga0495617_057064 | Ga0495617_057064_194_991 | 262 |
| 154 | 3300046453 | Ga0495627_000488 | Ga0495627_000488_19604_20401 | 262 |
| 155 | 3300046453 | Ga0495627_000695 | Ga0495627_000695_2310_3107 | 262 |
| 156 | 3300046453 | Ga0495627_003025 | Ga0495627_003025_4551_5348 | 262 |
| 157 | 3300046454 | Ga0495592_0054436 | Ga0495592_0054436_1432_2229 | 262 |
| 158 | 3300046457 | Ga0495590_0000526 | Ga0495590_0000526_6806_7603 | 262 |
| 159 | 3300046457 | Ga0495590_0014688 | Ga0495590_0014688_369_1166 | 262 |
| 160 | 3300046457 | Ga0495590_0079667 | Ga0495590_0079667_104_901 | 262 |
| 161 | 3300046458 | Ga0495591_000662 | Ga0495591_000662_2610_3407 | 262 |
| 162 | 3300046458 | Ga0495591_001053 | Ga0495591_001053_15544_16341 | 262 |
| 163 | 3300046458 | Ga0495591_001801 | Ga0495591_001801_4989_5786 | 262 |
| 164 | 3300046458 | Ga0495591_009595 | Ga0495591_009595_2380_3177 | 262 |
| 165 | 3300046460 | Ga0495638_0025467 | Ga0495638_0025467_2260_3057 | 262 |
| 166 | 3300046460 | Ga0495638_0047180 | Ga0495638_0047180_1129_1926 | 262 |
| 167 | 3300046463 | Ga0495653_0002927 | Ga0495653_0002927_2142_2939 | 262 |
| 168 | 3300046463 | Ga0495653_0032117 | Ga0495653_0032117_1597_2394 | 262 |
| 169 | 3300046471 | Ga0495650_0001708 | Ga0495650_0001708_18630_19427 | 262 |
| 170 | 3300046471 | Ga0495650_0012711 | Ga0495650_0012711_2247_3044 | 262 |
| 171 | 3300046471 | Ga0495650_0022720 | Ga0495650_0022720_750_1547 | 262 |
| 172 | 3300046471 | Ga0495650_0047085 | Ga0495650_0047085_49_846 | 262 |
| 173 | 3300046471 | Ga0495650_0094991 | Ga0495650_0094991_316_1113 | 262 |
| 174 | 3300046474 | Ga0495605_0004260 | Ga0495605_0004260_6180_6992 | 262 |
| 175 | 3300046474 | Ga0495605_0005110 | Ga0495605_0005110_4539_5336 | 262 |
| 176 | 3300046474 | Ga0495605_0051810 | Ga0495605_0051810_349_1146 | 262 |
| 177 | 3300046475 | Ga0495639_0103135 | Ga0495639_0103135_321_1133 | 262 |
| 178 | 3300046491 | Ga0495584_0006321 | Ga0495584_0006321_3850_4647 | 262 |
| 179 | 3300046491 | Ga0495584_0022233 | Ga0495584_0022233_823_1620 | 262 |
| 180 | 3300046491 | Ga0495584_0024271 | Ga0495584_0024271_1790_2587 | 262 |
| 181 | 3300046492 | Ga0495585_0001045 | Ga0495585_0001045_2532_3329 | 262 |
| 182 | 3300046492 | Ga0495585_0017713 | Ga0495585_0017713_2205_3002 | 262 |
| 183 | 3300046492 | Ga0495585_0075489 | Ga0495585_0075489_551_1348 | 262 |
| 184 | 3300046492 | Ga0495585_0125111 | Ga0495585_0125111_327_1124 | 262 |
| 185 | 3300046499 | Ga0495594_0025048 | Ga0495594_0025048_406_1218 | 262 |
| 186 | 3300046500 | Ga0495596_0019395 | Ga0495596_0019395_584_1381 | 262 |
| 187 | 3300046501 | Ga0495607_0000963 | Ga0495607_0000963_7104_7901 | 262 |
| 188 | 3300046501 | Ga0495607_0003226 | Ga0495607_0003226_2375_3172 | 262 |
| 189 | 3300046501 | Ga0495607_0010078 | Ga0495607_0010078_3750_4547 | 262 |
| 190 | 3300046501 | Ga0495607_0028476 | Ga0495607_0028476_2220_3017 | 262 |
| 191 | 3300046501 | Ga0495607_0041793 | Ga0495607_0041793_680_1492 | 262 |
| 192 | 3300046501 | Ga0495607_0049085 | Ga0495607_0049085_132_944 | 262 |
| 193 | 3300046501 | Ga0495607_0059576 | Ga0495607_0059576_440_1237 | 262 |
| 194 | 3300046501 | Ga0495607_0061071 | Ga0495607_0061071_571_1368 | 262 |
| 195 | 3300046501 | Ga0495607_0079948 | Ga0495607_0079948_325_1122 | 262 |
| 196 | 3300046506 | Ga0495583_0025867 | Ga0495583_0025867_589_1386 | 262 |
| 197 | 3300046507 | Ga0495606_0001321 | Ga0495606_0001321_2645_3442 | 262 |
| 198 | 3300046507 | Ga0495606_0001801 | Ga0495606_0001801_23897_24694 | 262 |
| 199 | 3300046507 | Ga0495606_0005034 | Ga0495606_0005034_5162_5974 | 262 |
| 200 | 3300046507 | Ga0495606_0012768 | Ga0495606_0012768_3476_4273 | 262 |
| 201 | 3300046507 | Ga0495606_0017298 | Ga0495606_0017298_376_1173 | 262 |
| 202 | 3300046512 | Ga0495610_0005237 | Ga0495610_0005237_5622_6419 | 262 |
| 203 | 3300046512 | Ga0495610_0013966 | Ga0495610_0013966_1249_2046 | 262 |
| 204 | 3300046513 | Ga0495616_0000704 | Ga0495616_0000704_21426_22223 | 262 |
| 205 | 3300046513 | Ga0495616_0001304 | Ga0495616_0001304_1881_2678 | 262 |
| 206 | 3300046513 | Ga0495616_0002728 | Ga0495616_0002728_3920_4717 | 262 |
| 207 | 3300046513 | Ga0495616_0005421 | Ga0495616_0005421_2533_3330 | 262 |
| 208 | 3300046513 | Ga0495616_0087582 | Ga0495616_0087582_668_1465 | 262 |
| 209 | 3300046515 | Ga0495620_0000532 | Ga0495620_0000532_22531_23328 | 262 |
| 210 | 3300046515 | Ga0495620_0004727 | Ga0495620_0004727_2236_3033 | 262 |
| 211 | 3300046515 | Ga0495620_0048981 | Ga0495620_0048981_724_1521 | 262 |
| 212 | 3300046515 | Ga0495620_0052259 | Ga0495620_0052259_192_989 | 262 |
| 213 | 3300046518 | Ga0495631_0000547 | Ga0495631_0000547_792_1589 | 262 |
| 214 | 3300046518 | Ga0495631_0007445 | Ga0495631_0007445_2520_3317 | 262 |
| 215 | 3300046518 | Ga0495631_0083511 | Ga0495631_0083511_131_928 | 262 |
| 216 | 3300046519 | Ga0495632_0002048 | Ga0495632_0002048_12953_13750 | 262 |
| 217 | 3300046519 | Ga0495632_0007869 | Ga0495632_0007869_1438_2235 | 262 |
| 218 | 3300046519 | Ga0495632_0008734 | Ga0495632_0008734_3914_4711 | 262 |
| 219 | 3300046519 | Ga0495632_0039797 | Ga0495632_0039797_25_822 | 262 |
| 220 | 3300046519 | Ga0495632_0062120 | Ga0495632_0062120_204_1001 | 262 |
| 221 | 3300046520 | Ga0495637_0000839 | Ga0495637_0000839_17264_18061 | 262 |
| 222 | 3300046520 | Ga0495637_0002282 | Ga0495637_0002282_9400_10197 | 262 |
| 223 | 3300046520 | Ga0495637_0046467 | Ga0495637_0046467_713_1510 | 262 |
| 224 | 3300046520 | Ga0495637_0125047 | Ga0495637_0125047_167_964 | 262 |
| 225 | 3300046522 | Ga0495643_0006509 | Ga0495643_0006509_2226_3023 | 262 |
| 226 | 3300046522 | Ga0495643_0028657 | Ga0495643_0028657_1447_2244 | 262 |
| 227 | 3300046523 | Ga0495644_0004777 | Ga0495644_0004777_1663_2460 | 262 |
| 228 | 3300046524 | Ga0495648_0005373 | Ga0495648_0005373_2063_2860 | 262 |
| 229 | 3300046524 | Ga0495648_0009398 | Ga0495648_0009398_4722_5519 | 262 |
| 230 | 3300046524 | Ga0495648_0025298 | Ga0495648_0025298_508_1305 | 262 |
| 231 | 3300046524 | Ga0495648_0032693 | Ga0495648_0032693_2439_3236 | 262 |
| 232 | 3300046526 | Ga0495666_0018179 | Ga0495666_0018179_1388_2185 | 262 |
| 233 | 3300046530 | Ga0495654_0000444 | Ga0495654_0000444_12283_13080 | 262 |
| 234 | 3300046530 | Ga0495654_0041200 | Ga0495654_0041200_280_1077 | 262 |
| 235 | 3300046530 | Ga0495654_0058990 | Ga0495654_0058990_375_1172 | 262 |
| 236 | 3300046530 | Ga0495654_0073010 | Ga0495654_0073010_564_1361 | 262 |
| 237 | 3300046538 | Ga0495609_0001178 | Ga0495609_0001178_15025_15822 | 262 |
| 238 | 3300046538 | Ga0495609_0007374 | Ga0495609_0007374_2613_3410 | 262 |
| 239 | 3300046538 | Ga0495609_0034163 | Ga0495609_0034163_791_1588 | 262 |
| 240 | 3300046542 | Ga0495597_0006345 | Ga0495597_0006345_810_1607 | 262 |
| 241 | 3300046557 | Ga0495622_0007198 | Ga0495622_0007198_1709_2506 | 262 |
| 242 | 3300046558 | Ga0495633_0000867 | Ga0495633_0000867_22900_23697 | 262 |
| 243 | 3300046615 | Ga0495656_0015124 | Ga0495656_0015124_79_882 | 262 |
| 244 | 3300046615 | Ga0495656_0158112 | Ga0495656_0158112_109_912 | 262 |
| 245 | 3300046616 | Ga0495668_0002037 | Ga0495668_0002037_2568_3365 | 262 |
| 246 | 3300046616 | Ga0495668_0048617 | Ga0495668_0048617_819_1616 | 262 |
| 247 | 3300046616 | Ga0495668_0089153 | Ga0495668_0089153_295_1092 | 262 |
| 248 | 3300046648 | Ga0495611_0000468 | Ga0495611_0000468_2490_3287 | 262 |
| 249 | 3300046660 | Ga0495625_0002907 | Ga0495625_0002907_2448_3245 | 262 |
| 250 | 3300046660 | Ga0495625_0017184 | Ga0495625_0017184_2139_2936 | 262 |
| 251 | 3300046660 | Ga0495625_0067664 | Ga0495625_0067664_1045_1842 | 262 |
| 252 | 3300046660 | Ga0495625_0108893 | Ga0495625_0108893_594_1391 | 262 |
| 253 | 3300046665 | Ga0495661_0038255 | Ga0495661_0038255_1730_2527 | 262 |
| 254 | 3300046665 | Ga0495661_0040580 | Ga0495661_0040580_601_1398 | 262 |
| 255 | 3300046665 | Ga0495661_0070295 | Ga0495661_0070295_986_1783 | 262 |
| 256 | 3300046665 | Ga0495661_0138156 | Ga0495661_0138156_186_983 | 262 |
| 257 | 3300046680 | Ga0495646_0019328 | Ga0495646_0019328_613_1410 | 262 |
| 258 | 3300046689 | Ga0495613_0016685 | Ga0495613_0016685_3744_4541 | 262 |
| 259 | 3300046690 | Ga0495624_0001286 | Ga0495624_0001286_2150_2947 | 262 |
| 260 | 3300046690 | Ga0495624_0127975 | Ga0495624_0127975_466_1263 | 262 |
| 261 | 3300046691 | Ga0495670_0093026 | Ga0495670_0093026_267_1142 | 262 |
| 262 | 3300046691 | Ga0495670_0125762 | Ga0495670_0125762_317_1114 | 262 |
| 263 | 3300046692 | Ga0495671_0004200 | Ga0495671_0004200_4584_5381 | 262 |
| 264 | 3300046692 | Ga0495671_0007897 | Ga0495671_0007897_4341_5138 | 262 |
| 265 | 3300046692 | Ga0495671_0035073 | Ga0495671_0035073_485_1282 | 262 |
| 266 | 3300046692 | Ga0495671_0040241 | Ga0495671_0040241_627_1424 | 262 |
| 267 | 3300046694 | Ga0495649_0018514 | Ga0495649_0018514_996_1793 | 262 |
| 268 | 3300046694 | Ga0495649_0038544 | Ga0495649_0038544_1775_2572 | 262 |
| 269 | 3300046794 | Ga0495589_0006916 | Ga0495589_0006916_2533_3330 | 262 |
| 270 | 3300046794 | Ga0495589_0042791 | Ga0495589_0042791_146_943 | 262 |
| 271 | 3300046809 | Ga0495600_0002832 | Ga0495600_0002832_1373_2170 | 262 |
| 272 | 3300046810 | Ga0495660_0001478 | Ga0495660_0001478_2952_3749 | 262 |
| 273 | 3300046810 | Ga0495660_0010035 | Ga0495660_0010035_3905_4702 | 262 |
| 274 | 3300046810 | Ga0495660_0013641 | Ga0495660_0013641_3300_4097 | 262 |
| 275 | 3300046810 | Ga0495660_0056295 | Ga0495660_0056295_602_1399 | 262 |
| 276 | 3300047317 | Ga0495604_0087936 | Ga0495604_0087936_613_1410 | 262 |
| 277 | 3300047318 | Ga0495636_0000187 | Ga0495636_0000187_3827_4630 | 262 |
| 278 | 3300047318 | Ga0495636_0002043 | Ga0495636_0002043_1301_2104 | 262 |
| 279 | 3300047318 | Ga0495636_0033839 | Ga0495636_0033839_1215_2018 | 262 |
| 280 | 3300047318 | Ga0495636_0115825 | Ga0495636_0115825_254_1057 | 262 |
| 281 | 3300047320 | Ga0495672_0003388 | Ga0495672_0003388_2151_2948 | 262 |
| 282 | 3300047320 | Ga0495672_0011726 | Ga0495672_0011726_4100_4897 | 262 |
| 283 | 3300047320 | Ga0495672_0035749 | Ga0495672_0035749_1843_2640 | 262 |
| 284 | 3300047321 | Ga0495676_0001430 | Ga0495676_0001430_2413_3210 | 262 |
| 285 | 3300047321 | Ga0495676_0037111 | Ga0495676_0037111_1745_2542 | 262 |
| 286 | 3300047322 | Ga0495680_0052832 | Ga0495680_0052832_2015_2812 | 262 |
| 287 | 3300047323 | Ga0495683_0006160 | Ga0495683_0006160_4607_5404 | 262 |
| 288 | 3300047323 | Ga0495683_0027561 | Ga0495683_0027561_1416_2213 | 262 |
| 289 | 3300047323 | Ga0495683_0060891 | Ga0495683_0060891_599_1396 | 262 |
| 290 | 3300047323 | Ga0495683_0082249 | Ga0495683_0082249_704_1516 | 262 |
| 291 | 3300047446 | Ga0495679_017758 | Ga0495679_017758_869_1666 | 262 |
| 292 | 3300047446 | Ga0495679_018923 | Ga0495679_018923_761_1558 | 262 |
| 293 | 3300047446 | Ga0495679_023089 | Ga0495679_023089_453_1250 | 262 |
| 294 | 3300047446 | Ga0495679_048514 | Ga0495679_048514_132_929 | 262 |
| 295 | 3300047469 | Ga0495673_0000279 | Ga0495673_0000279_33890_34690 | 262 |
| 296 | 3300047469 | Ga0495673_0000753 | Ga0495673_0000753_2622_3419 | 262 |
| 297 | 3300047469 | Ga0495673_0001887 | Ga0495673_0001887_21_818 | 262 |
| 298 | 3300047469 | Ga0495673_0008945 | Ga0495673_0008945_493_1290 | 262 |
| 299 | 3300047469 | Ga0495673_0012896 | Ga0495673_0012896_2815_3612 | 262 |
| 300 | 3300047469 | Ga0495673_0062326 | Ga0495673_0062326_776_1573 | 262 |
| 301 | 3300047470 | Ga0495681_0000659 | Ga0495681_0000659_18654_19451 | 262 |
| 302 | 3300047470 | Ga0495681_0000859 | Ga0495681_0000859_14051_14848 | 262 |
| 303 | 3300047470 | Ga0495681_0001461 | Ga0495681_0001461_16723_17520 | 262 |
| 304 | 3300047470 | Ga0495681_0007561 | Ga0495681_0007561_3681_4478 | 262 |
| 305 | 3300047471 | Ga0495684_0158036 | Ga0495684_0158036_634_1431 | 262 |
| 306 | 3300047472 | Ga0495686_0002014 | Ga0495686_0002014_14646_15443 | 262 |
| 307 | 3300047472 | Ga0495686_0076714 | Ga0495686_0076714_666_1463 | 262 |
| 308 | 3300047673 | Ga0495593_0018284 | Ga0495593_0018284_913_1710 | 262 |
| 309 | 3300048088 | Ga0495602_0005007 | Ga0495602_0005007_10808_11605 | 262 |
| 310 | 3300048091 | Ga0495626_0001094 | Ga0495626_0001094_19736_20533 | 262 |
| 311 | 3300048091 | Ga0495626_0005883 | Ga0495626_0005883_3630_4427 | 262 |
| 312 | 3300048091 | Ga0495626_0013416 | Ga0495626_0013416_1387_2184 | 262 |
| 313 | 3300048091 | Ga0495626_0020665 | Ga0495626_0020665_2002_2799 | 262 |
| 314 | 3300048091 | Ga0495626_0036834 | Ga0495626_0036834_571_1368 | 262 |
| 315 | 3300048091 | Ga0495626_0057257 | Ga0495626_0057257_412_1209 | 262 |
| 316 | 3300048091 | Ga0495626_0138956 | Ga0495626_0138956_182_979 | 262 |
| 317 | 3300048919 | Ga0496116_0000850 | Ga0496116_0000850_18688_19485 | 262 |
| 318 | 3300048920 | Ga0496117_0026838 | Ga0496117_0026838_2786_3583 | 262 |
| 319 | 3300048921 | Ga0496118_0059719 | Ga0496118_0059719_915_1712 | 262 |
| 320 | 3300048927 | Ga0496124_0154054 | Ga0496124_0154054_681_1478 | 262 |
| 321 | 3300049459 | Ga0495678_000954 | Ga0495678_000954_865_1662 | 262 |
| 322 | 3300049459 | Ga0495678_002901 | Ga0495678_002901_2714_3511 | 262 |
| 323 | 3300049459 | Ga0495678_005291 | Ga0495678_005291_3998_4795 | 262 |
| 324 | 3300049459 | Ga0495678_006284 | Ga0495678_006284_1815_2612 | 262 |
| 325 | 3300049459 | Ga0495678_006384 | Ga0495678_006384_891_1688 | 262 |
| 326 | 3300049459 | Ga0495678_091248 | Ga0495678_091248_129_926 | 262 |
| 327 | 3300049460 | Ga0495682_0000556 | Ga0495682_0000556_2049_2846 | 262 |
| 328 | 3300049460 | Ga0495682_0002272 | Ga0495682_0002272_3664_4461 | 262 |
| 329 | 3300049460 | Ga0495682_0017194 | Ga0495682_0017194_1174_1971 | 262 |
| 330 | 3300049571 | Ga0501034_0000563 | Ga0501034_0000563_19885_20691 | 262 |
| 331 | 3300049579 | Ga0501043_0003494 | Ga0501043_0003494_8119_8928 | 262 |
| 332 | 3300053126 | Ga0500621_081523 | Ga0500621_081523_349_1146 | 262 |
| 333 | iso_pu_bacteria | 2571042365 | 2572255854 | 262 |
| 334 | iso_pu_bacteria | 2738541271 | 2738688027 | 262 |
| 335 | iso_pu_bacteria | 2738543016 | 2739263538 | 262 |
| 336 | iso_pu_bacteria | 2923516293 | 2923518312 | 262 |
| 337 | iso_pu_bacteria | 8003014200 | 8003015957 | 262 |
| 338 | 3300005340 | Ga0070689_100235665 | Ga0070689_1002356652 | 263 |
| 339 | 3300009011 | Ga0105251_10002336 | Ga0105251_1000233611 | 263 |
| 340 | 3300009092 | Ga0105250_10000705 | Ga0105250_1000070518 | 263 |
| 341 | 3300009101 | Ga0105247_10000025 | Ga0105247_10000025163 | 263 |
| 342 | 3300017792 | Ga0163161_10000001 | Ga0163161_10000001281 | 263 |
| 343 | 3300025711 | Ga0207696_1000001 | Ga0207696_1000001363 | 263 |
| 344 | 3300025735 | Ga0207713_1000024 | Ga0207713_1000024258 | 263 |
| 345 | 3300025900 | Ga0207710_10000140 | Ga0207710_1000014017 | 263 |
| 346 | 3300026089 | Ga0207648_10055766 | Ga0207648_100557662 | 263 |
| 347 | 3300039447 | Ga0436361_0669402 | Ga0436361_0669402_281_1087 | 263 |
| 348 | 3300046453 | Ga0495627_000018 | Ga0495627_000018_262300_263109 | 263 |
| 349 | 3300046474 | Ga0495605_0000193 | Ga0495605_0000193_38295_39110 | 263 |
| 350 | 3300046507 | Ga0495606_0000176 | Ga0495606_0000176_16931_17740 | 263 |
| 351 | 3300046513 | Ga0495616_0084021 | Ga0495616_0084021_607_1407 | 263 |
| 352 | 3300046519 | Ga0495632_0001697 | Ga0495632_0001697_7813_8613 | 263 |
| 353 | 3300046519 | Ga0495632_0122178 | Ga0495632_0122178_265_1080 | 263 |
| 354 | 3300046522 | Ga0495643_0025412 | Ga0495643_0025412_2072_2872 | 263 |
| 355 | 3300046530 | Ga0495654_0032058 | Ga0495654_0032058_1525_2340 | 263 |
| 356 | 3300046538 | Ga0495609_0055921 | Ga0495609_0055921_571_1386 | 263 |
| 357 | 3300046692 | Ga0495671_0028726 | Ga0495671_0028726_1722_2537 | 263 |
| 358 | 3300047469 | Ga0495673_0011098 | Ga0495673_0011098_1039_1854 | 263 |
| 359 | 3300048906 | Ga0496103_0094731 | Ga0496103_0094731_1065_1874 | 263 |
| 360 | 3300048919 | Ga0496116_0000023 | Ga0496116_0000023_248142_248951 | 263 |
| 361 | 3300048920 | Ga0496117_0000463 | Ga0496117_0000463_25879_26688 | 263 |
| 362 | 3300048921 | Ga0496118_0003815 | Ga0496118_0003815_1342_2151 | 263 |
| 363 | 3300048921 | Ga0496118_0151410 | Ga0496118_0151410_417_1217 | 263 |
| 364 | 3300048922 | Ga0496119_0001891 | Ga0496119_0001891_8617_9426 | 263 |
| 365 | 3300048922 | Ga0496119_0006363 | Ga0496119_0006363_3589_4389 | 263 |
| 366 | 3300048923 | Ga0496120_0000137 | Ga0496120_0000137_15761_16570 | 263 |
| 367 | 3300048923 | Ga0496120_0002332 | Ga0496120_0002332_8454_9254 | 263 |
| 368 | 3300048923 | Ga0496120_0044361 | Ga0496120_0044361_534_1343 | 263 |
| 369 | 3300048927 | Ga0496124_0000017 | Ga0496124_0000017_213851_214660 | 263 |
| 370 | 3300048927 | Ga0496124_0001066 | Ga0496124_0001066_27692_28492 | 263 |
| 371 | 3300048928 | Ga0496125_0000245 | Ga0496125_0000245_82849_83649 | 263 |
| 372 | iso_pu_bacteria | 2511231008 | 2511276773 | 263 |
| 373 | iso_pu_bacteria | 2643221559 | 2643815154 | 263 |
| 374 | iso_pu_bacteria | 2643221586 | 2643938040 | 263 |
| 375 | iso_pu_bacteria | 2643221612 | 2644076890 | 263 |
| 376 | iso_pu_bacteria | 2643221633 | 2644186806 | 263 |
| 377 | iso_pu_bacteria | 2643221727 | 2644695205 | 263 |
| 378 | iso_pu_bacteria | 2654587920 | 2656277456 | 263 |
| 379 | iso_pu_bacteria | 2654587920 | 2656279093 | 263 |
| 380 | iso_pu_bacteria | 2687453601 | 2689444047 | 263 |
| 381 | iso_pu_bacteria | 2773857670 | 2774123304 | 263 |
| 382 | iso_pu_bacteria | 2784132072 | 2784315828 | 263 |
| 383 | iso_pu_bacteria | 2808606377 | 2808932602 | 263 |
| 384 | iso_pu_bacteria | 2808606381 | 2808954723 | 263 |
| 385 | iso_pu_bacteria | 2808606445 | 2809214509 | 263 |
| 386 | iso_pu_bacteria | 2860339153 | 2860342291 | 263 |
| 387 | iso_pu_bacteria | 2919456309 | 2919458962 | 263 |
| 388 | iso_pu_bacteria | 2931396565 | 2931402374 | 263 |
| 389 | 3300005547 | Ga0070693_100210727 | Ga0070693_1002107272 | 264 |
| 390 | 3300009984 | Ga0105029_100755 | Ga0105029_1007552 | 264 |
| 391 | 3300021361 | Ga0213872_10048194 | Ga0213872_100481942 | 264 |
| 392 | 3300025918 | Ga0207662_10070937 | Ga0207662_100709372 | 264 |
| 393 | 3300025942 | Ga0207689_10064866 | Ga0207689_100648663 | 264 |
| 394 | 3300031507 | Ga0307509_10085534 | Ga0307509_100855342 | 264 |
| 395 | 3300039447 | Ga0436361_0580218 | Ga0436361_0580218_958_1764 | 264 |
| 396 | 3300042004 | Ga0439445_0006836 | Ga0439445_0006836_1777_2580 | 264 |
| 397 | 3300044658 | Ga0466972_0000313 | Ga0466972_0000313_17983_18786 | 264 |
| 398 | 3300044683 | Ga0466965_0062018 | Ga0466965_0062018_561_1364 | 264 |
| 399 | 3300048088 | Ga0495602_0074719 | Ga0495602_0074719_1752_2558 | 264 |
| 400 | 3300048912 | Ga0496109_0199675 | Ga0496109_0199675_820_1635 | 264 |
| 401 | 3300003794 | Ga0055531_10005334 | Ga0055531_100053346 | 265 |
| 402 | 3300005333 | Ga0070677_10027986 | Ga0070677_100279862 | 265 |
| 403 | 3300005334 | Ga0068869_100036341 | Ga0068869_1000363412 | 265 |
| 404 | 3300005356 | Ga0070674_100214025 | Ga0070674_1002140251 | 265 |
| 405 | 3300005367 | Ga0070667_100036766 | Ga0070667_1000367662 | 265 |
| 406 | 3300005456 | Ga0070678_100063939 | Ga0070678_1000639392 | 265 |
| 407 | 3300005459 | Ga0068867_100003939 | Ga0068867_1000039395 | 265 |
| 408 | 3300005543 | Ga0070672_100032145 | Ga0070672_1000321453 | 265 |
| 409 | 3300005548 | Ga0070665_100011801 | Ga0070665_1000118012 | 265 |
| 410 | 3300005578 | Ga0068854_100325855 | Ga0068854_1003258552 | 265 |
| 411 | 3300005617 | Ga0068859_100047623 | Ga0068859_1000476233 | 265 |
| 412 | 3300005840 | Ga0068870_10063303 | Ga0068870_100633032 | 265 |
| 413 | 3300005843 | Ga0068860_100336538 | Ga0068860_1003365382 | 265 |
| 414 | 3300006058 | Ga0075432_10008779 | Ga0075432_100087793 | 265 |
| 415 | 3300006881 | Ga0068865_100004132 | Ga0068865_1000041327 | 265 |
| 416 | 3300006931 | Ga0097620_100047623 | Ga0097620_1000476233 | 265 |
| 417 | 3300009094 | Ga0111539_10100551 | Ga0111539_101005512 | 265 |
| 418 | 3300013308 | Ga0157375_10020345 | Ga0157375_100203454 | 265 |
| 419 | 3300014325 | Ga0163163_10028846 | Ga0163163_100288464 | 265 |
| 420 | 3300014326 | Ga0157380_10372347 | Ga0157380_103723472 | 265 |
| 421 | 3300025292 | Ga0209676_1001897 | Ga0209676_100189713 | 265 |
| 422 | 3300025294 | Ga0209025_1003328 | Ga0209025_10033286 | 265 |
| 423 | 3300025297 | Ga0209758_1010771 | Ga0209758_10107711 | 265 |
| 424 | 3300025304 | Ga0209257_1001998 | Ga0209257_100199820 | 265 |
| 425 | 3300025315 | Ga0207697_10012555 | Ga0207697_100125552 | 265 |
| 426 | 3300025893 | Ga0207682_10008871 | Ga0207682_100088712 | 265 |
| 427 | 3300025907 | Ga0207645_10015138 | Ga0207645_100151383 | 265 |
| 428 | 3300025908 | Ga0207643_10021748 | Ga0207643_100217484 | 265 |
| 429 | 3300025926 | Ga0207659_10065659 | Ga0207659_100656592 | 265 |
| 430 | 3300025937 | Ga0207669_10300570 | Ga0207669_103005702 | 265 |
| 431 | 3300025938 | Ga0207704_10475435 | Ga0207704_104754351 | 265 |
| 432 | 3300025940 | Ga0207691_10001549 | Ga0207691_100015496 | 265 |
| 433 | 3300025942 | Ga0207689_10185418 | Ga0207689_101854182 | 265 |
| 434 | 3300026089 | Ga0207648_10005136 | Ga0207648_100051365 | 265 |
| 435 | 3300026121 | Ga0207683_10224353 | Ga0207683_102243532 | 265 |
| 436 | 3300027907 | Ga0207428_10152202 | Ga0207428_101522022 | 265 |
| 437 | 3300028379 | Ga0268266_10125808 | Ga0268266_101258082 | 265 |
| 438 | 3300032004 | Ga0307414_10014553 | Ga0307414_100145532 | 265 |
| 439 | 3300046452 | Ga0495617_000762 | Ga0495617_000762_4002_4808 | 265 |
| 440 | 3300046457 | Ga0495590_0002065 | Ga0495590_0002065_3902_4708 | 265 |
| 441 | 3300046471 | Ga0495650_0005686 | Ga0495650_0005686_5633_6439 | 265 |
| 442 | 3300046491 | Ga0495584_0001269 | Ga0495584_0001269_3852_4658 | 265 |
| 443 | 3300046501 | Ga0495607_0047282 | Ga0495607_0047282_1435_2241 | 265 |
| 444 | 3300046501 | Ga0495607_0137238 | Ga0495607_0137238_179_985 | 265 |
| 445 | 3300046506 | Ga0495583_0071094 | Ga0495583_0071094_48_854 | 265 |
| 446 | 3300046513 | Ga0495616_0001608 | Ga0495616_0001608_3824_4630 | 265 |
| 447 | 3300046519 | Ga0495632_0002133 | Ga0495632_0002133_10718_11524 | 265 |
| 448 | 3300046522 | Ga0495643_0010258 | Ga0495643_0010258_3896_4702 | 265 |
| 449 | 3300046524 | Ga0495648_0034742 | Ga0495648_0034742_2402_3208 | 265 |
| 450 | 3300046528 | Ga0495642_0000798 | Ga0495642_0000798_10716_11522 | 265 |
| 451 | 3300046538 | Ga0495609_0008247 | Ga0495609_0008247_1104_1910 | 265 |
| 452 | 3300046542 | Ga0495597_0007496 | Ga0495597_0007496_4010_4816 | 265 |
| 453 | 3300046648 | Ga0495611_0003233 | Ga0495611_0003233_2000_2806 | 265 |
| 454 | 3300046664 | Ga0495659_0089552 | Ga0495659_0089552_155_961 | 265 |
| 455 | 3300046691 | Ga0495670_0034972 | Ga0495670_0034972_820_1626 | 265 |
| 456 | 3300046694 | Ga0495649_0001875 | Ga0495649_0001875_3857_4663 | 265 |
| 457 | 3300046794 | Ga0495589_0001331 | Ga0495589_0001331_4043_4849 | 265 |
| 458 | 3300046810 | Ga0495660_0031273 | Ga0495660_0031273_1814_2620 | 265 |
| 459 | 3300047318 | Ga0495636_0002708 | Ga0495636_0002708_4927_5733 | 265 |
| 460 | 3300047320 | Ga0495672_0003013 | Ga0495672_0003013_4011_4817 | 265 |
| 461 | 3300047443 | Ga0495687_002016 | Ga0495687_002016_5556_6362 | 265 |
| 462 | 3300048091 | Ga0495626_0001943 | Ga0495626_0001943_3823_4629 | 265 |
| 463 | 3300049459 | Ga0495678_001864 | Ga0495678_001864_3861_4667 | 265 |
| 464 | 3300049460 | Ga0495682_0060696 | Ga0495682_0060696_180_986 | 265 |
| 465 | 3300037471 | Ga0395905_0155536 | Ga0395905_0155536_1167_1994 | 266 |
| 466 | iso_pu_bacteria | 2511231004 | 2511257766 | 266 |
| 467 | iso_pu_bacteria | 2511231007 | 2511271595 | 266 |
| 468 | iso_pu_bacteria | 2511231016 | 2511326709 | 266 |
| 469 | iso_pu_bacteria | 2511231017 | 2511331436 | 266 |
| 470 | iso_pu_bacteria | 2511231018 | 2511338214 | 266 |
| 471 | iso_pu_bacteria | 2511231019 | 2511343259 | 266 |
| 472 | iso_pu_bacteria | 2511231021 | 2511358826 | 266 |
| 473 | iso_pu_bacteria | 2511231022 | 2511360805 | 266 |
| 474 | iso_pu_bacteria | 2623620446 | 2624492603 | 266 |
| 475 | iso_pu_bacteria | 2738543004 | 2739197644 | 266 |
| 476 | iso_pu_bacteria | 2808606382 | 2808958359 | 266 |
| 477 | iso_pu_bacteria | 2904550169 | 2904550412 | 266 |
| 478 | iso_pu_bacteria | 2919697872 | 2919702713 | 266 |
| 479 | iso_pu_bacteria | 2939636861 | 2939638537 | 266 |
| 480 | iso_pu_bacteria | 3007511990 | 3007514571 | 266 |
| 481 | iso_pu_bacteria | 3007619802 | 3007621431 | 266 |
| 482 | iso_pu_bacteria | 8019775933 | 8019781640 | 266 |
| 483 | iso_pu_bacteria | 8056155041 | 8056157662 | 266 |
| 484 | 2124908027 | MRS2a_Contig_56 | MRS2a_00433850 | 267 |
| 485 | 3300005288 | Ga0065714_10000392 | Ga0065714_100003923 | 267 |
| 486 | 3300005288 | Ga0065714_10018431 | Ga0065714_100184312 | 267 |
| 487 | 3300005288 | Ga0065714_10082798 | Ga0065714_100827982 | 267 |
| 488 | 3300005288 | Ga0065714_10123256 | Ga0065714_101232562 | 267 |
| 489 | 3300005290 | Ga0065712_10003635 | Ga0065712_100036352 | 267 |
| 490 | 3300005293 | Ga0065715_10112752 | Ga0065715_101127522 | 267 |
| 491 | 3300005334 | Ga0068869_100009073 | Ga0068869_1000090733 | 267 |
| 492 | 3300005343 | Ga0070687_100252267 | Ga0070687_1002522671 | 267 |
| 493 | 3300005345 | Ga0070692_10023323 | Ga0070692_100233233 | 267 |
| 494 | 3300005353 | Ga0070669_100058797 | Ga0070669_1000587971 | 267 |
| 495 | 3300005444 | Ga0070694_100041404 | Ga0070694_1000414042 | 267 |
| 496 | 3300005455 | Ga0070663_100022875 | Ga0070663_1000228755 | 267 |
| 497 | 3300005539 | Ga0068853_100316418 | Ga0068853_1003164182 | 267 |
| 498 | 3300005543 | Ga0070672_100041658 | Ga0070672_1000416584 | 267 |
| 499 | 3300005545 | Ga0070695_100014547 | Ga0070695_1000145472 | 267 |
| 500 | 3300005841 | Ga0068863_100353126 | Ga0068863_1003531262 | 267 |
| 501 | 3300005842 | Ga0068858_100734881 | Ga0068858_1007348811 | 267 |
| 502 | 3300005843 | Ga0068860_100029960 | Ga0068860_1000299605 | 267 |
| 503 | 3300005844 | Ga0068862_100068324 | Ga0068862_1000683243 | 267 |
| 504 | 3300006946 | Ga0079104_1000901 | Ga0079104_100090111 | 267 |
| 505 | 3300009036 | Ga0105244_10037171 | Ga0105244_100371713 | 267 |
| 506 | 3300009036 | Ga0105244_10100791 | Ga0105244_101007912 | 267 |
| 507 | 3300009553 | Ga0105249_10055557 | Ga0105249_100555572 | 267 |
| 508 | 3300011119 | Ga0105246_10272648 | Ga0105246_102726482 | 267 |
| 509 | 3300013100 | Ga0157373_10028432 | Ga0157373_100284323 | 267 |
| 510 | 3300013100 | Ga0157373_10175300 | Ga0157373_101753002 | 267 |
| 511 | 3300013102 | Ga0157371_10001414 | Ga0157371_1000141412 | 267 |
| 512 | 3300013104 | Ga0157370_10443609 | Ga0157370_104436092 | 267 |
| 513 | 3300013306 | Ga0163162_10011262 | Ga0163162_100112624 | 267 |
| 514 | 3300014326 | Ga0157380_10119917 | Ga0157380_101199172 | 267 |
| 515 | 3300014497 | Ga0182008_10031705 | Ga0182008_100317051 | 267 |
| 516 | 3300014968 | Ga0157379_10018572 | Ga0157379_100185723 | 267 |
| 517 | 3300015261 | Ga0182006_1000717 | Ga0182006_100071710 | 267 |
| 518 | 3300015261 | Ga0182006_1032721 | Ga0182006_10327212 | 267 |
| 519 | 3300015262 | Ga0182007_10000511 | Ga0182007_1000051117 | 267 |
| 520 | 3300015265 | Ga0182005_1001583 | Ga0182005_10015834 | 267 |
| 521 | 3300015265 | Ga0182005_1017421 | Ga0182005_10174212 | 267 |
| 522 | 3300015265 | Ga0182005_1048350 | Ga0182005_10483502 | 267 |
| 523 | 3300017792 | Ga0163161_10008321 | Ga0163161_100083212 | 267 |
| 524 | 3300017792 | Ga0163161_10047923 | Ga0163161_100479232 | 267 |
| 525 | 3300025292 | Ga0209676_1007996 | Ga0209676_10079963 | 267 |
| 526 | 3300025711 | Ga0207696_1027071 | Ga0207696_10270712 | 267 |
| 527 | 3300025728 | Ga0207655_1070051 | Ga0207655_10700511 | 267 |
| 528 | 3300025735 | Ga0207713_1004239 | Ga0207713_10042394 | 267 |
| 529 | 3300025907 | Ga0207645_10413671 | Ga0207645_104136712 | 267 |
| 530 | 3300025933 | Ga0207706_10053376 | Ga0207706_100533762 | 267 |
| 531 | 3300025940 | Ga0207691_10064024 | Ga0207691_100640244 | 267 |
| 532 | 3300025942 | Ga0207689_10006928 | Ga0207689_100069283 | 267 |
| 533 | 3300025961 | Ga0207712_10027504 | Ga0207712_100275042 | 267 |
| 534 | 3300026035 | Ga0207703_10508367 | Ga0207703_105083671 | 267 |
| 535 | 3300026067 | Ga0207678_10043692 | Ga0207678_100436925 | 267 |
| 536 | 3300026088 | Ga0207641_10118235 | Ga0207641_101182352 | 267 |
| 537 | 3300026118 | Ga0207675_100023576 | Ga0207675_1000235765 | 267 |
| 538 | 3300027111 | Ga0209281_1000063 | Ga0209281_1000063101 | 267 |
| 539 | 3300027907 | Ga0207428_10012077 | Ga0207428_100120776 | 267 |
| 540 | 3300027907 | Ga0207428_10045837 | Ga0207428_100458374 | 267 |
| 541 | 3300028381 | Ga0268264_10111434 | Ga0268264_101114343 | 267 |
| 542 | 3300041405 | Ga0439438_008064 | Ga0439438_008064_1481_2293 | 267 |
| 543 | 3300041405 | Ga0439438_011739 | Ga0439438_011739_386_1198 | 267 |
| 544 | 3300041407 | Ga0439447_000844 | Ga0439447_000844_9800_10612 | 267 |
| 545 | 3300041407 | Ga0439447_009389 | Ga0439447_009389_589_1401 | 267 |
| 546 | 3300041411 | Ga0439466_0005274 | Ga0439466_0005274_1491_2303 | 267 |
| 547 | 3300041411 | Ga0439466_0012167 | Ga0439466_0012167_1166_1978 | 267 |
| 548 | 3300041411 | Ga0439466_0031155 | Ga0439466_0031155_704_1516 | 267 |
| 549 | 3300041411 | Ga0439466_0044669 | Ga0439466_0044669_502_1305 | 267 |
| 550 | 3300042006 | Ga0439432_007611 | Ga0439432_007611_2314_3126 | 267 |
| 551 | 3300042009 | Ga0439451_013374 | Ga0439451_013374_784_1596 | 267 |
| 552 | 3300042010 | Ga0439452_002179 | Ga0439452_002179_3840_4652 | 267 |
| 553 | 3300042010 | Ga0439452_003644 | Ga0439452_003644_708_1520 | 267 |
| 554 | 3300042010 | Ga0439452_030998 | Ga0439452_030998_406_1218 | 267 |
| 555 | 3300042013 | Ga0439456_001377 | Ga0439456_001377_254_1066 | 267 |
| 556 | 3300042121 | Ga0450919_000828 | Ga0450919_000828_2736_3548 | 267 |
| 557 | 3300042121 | Ga0450919_003633 | Ga0450919_003633_506_1318 | 267 |
| 558 | 3300042122 | Ga0450920_004629 | Ga0450920_004629_1056_1868 | 267 |
| 559 | 3300042124 | Ga0450922_000653 | Ga0450922_000653_831_1643 | 267 |
| 560 | 3300042124 | Ga0450922_002610 | Ga0450922_002610_799_1611 | 267 |
| 561 | 3300042127 | Ga0450890_003991 | Ga0450890_003991_778_1590 | 267 |
| 562 | 3300042137 | Ga0450902_015013 | Ga0450902_015013_238_1050 | 267 |
| 563 | 3300042138 | Ga0450903_000525 | Ga0450903_000525_14_826 | 267 |
| 564 | 3300042138 | Ga0450903_001400 | Ga0450903_001400_913_1725 | 267 |
| 565 | 3300042142 | Ga0450905_005349 | Ga0450905_005349_28_831 | 267 |
| 566 | 3300042145 | Ga0450906_007693 | Ga0450906_007693_876_1688 | 267 |
| 567 | 3300042146 | Ga0450907_000046 | Ga0450907_000046_44962_45765 | 267 |
| 568 | 3300042146 | Ga0450907_002605 | Ga0450907_002605_1402_2214 | 267 |
| 569 | 3300042146 | Ga0450907_005464 | Ga0450907_005464_1210_2022 | 267 |
| 570 | 3300042184 | Ga0450908_003042 | Ga0450908_003042_1971_2783 | 267 |
| 571 | 3300042185 | Ga0450909_001216 | Ga0450909_001216_1059_1871 | 267 |
| 572 | 3300042185 | Ga0450909_002620 | Ga0450909_002620_835_1638 | 267 |
| 573 | 3300042435 | Ga0439434_0000072 | Ga0439434_0000072_19604_20407 | 267 |
| 574 | 3300042435 | Ga0439434_0009625 | Ga0439434_0009625_818_1630 | 267 |
| 575 | 3300042461 | Ga0439460_0033348 | Ga0439460_0033348_461_1273 | 267 |
| 576 | 3300042461 | Ga0439460_0043132 | Ga0439460_0043132_279_1082 | 267 |
| 577 | 3300042461 | Ga0439460_0046387 | Ga0439460_0046387_243_1055 | 267 |
| 578 | 3300042532 | Ga0450893_0008750 | Ga0450893_0008750_43_855 | 267 |
| 579 | 3300042993 | Ga0439440_0000209 | Ga0439440_0000209_31_834 | 267 |
| 580 | 3300042993 | Ga0439440_0031223 | Ga0439440_0031223_141_953 | 267 |
| 581 | 3300044712 | Ga0453684_0586180 | Ga0453684_0586180_160_984 | 267 |
| 582 | 3300046452 | Ga0495617_000745 | Ga0495617_000745_14051_14863 | 267 |
| 583 | 3300046452 | Ga0495617_007588 | Ga0495617_007588_2239_3051 | 267 |
| 584 | 3300046452 | Ga0495617_019164 | Ga0495617_019164_1166_1969 | 267 |
| 585 | 3300046452 | Ga0495617_030252 | Ga0495617_030252_655_1467 | 267 |
| 586 | 3300046452 | Ga0495617_030746 | Ga0495617_030746_966_1769 | 267 |
| 587 | 3300046457 | Ga0495590_0000590 | Ga0495590_0000590_2429_3241 | 267 |
| 588 | 3300046458 | Ga0495591_006042 | Ga0495591_006042_671_1483 | 267 |
| 589 | 3300046458 | Ga0495591_007275 | Ga0495591_007275_2930_3733 | 267 |
| 590 | 3300046458 | Ga0495591_012653 | Ga0495591_012653_1228_2040 | 267 |
| 591 | 3300046458 | Ga0495591_014787 | Ga0495591_014787_1284_2087 | 267 |
| 592 | 3300046458 | Ga0495591_015807 | Ga0495591_015807_1531_2334 | 267 |
| 593 | 3300046459 | Ga0495629_0109292 | Ga0495629_0109292_1114_1917 | 267 |
| 594 | 3300046460 | Ga0495638_0040998 | Ga0495638_0040998_925_1737 | 267 |
| 595 | 3300046460 | Ga0495638_0101369 | Ga0495638_0101369_52_864 | 267 |
| 596 | 3300046460 | Ga0495638_0127633 | Ga0495638_0127633_212_1015 | 267 |
| 597 | 3300046463 | Ga0495653_0134771 | Ga0495653_0134771_631_1434 | 267 |
| 598 | 3300046471 | Ga0495650_0002550 | Ga0495650_0002550_12989_13792 | 267 |
| 599 | 3300046471 | Ga0495650_0035240 | Ga0495650_0035240_974_1777 | 267 |
| 600 | 3300046473 | Ga0495582_0009290 | Ga0495582_0009290_3978_4781 | 267 |
| 601 | 3300046474 | Ga0495605_0001045 | Ga0495605_0001045_15332_16144 | 267 |
| 602 | 3300046474 | Ga0495605_0001305 | Ga0495605_0001305_14393_15196 | 267 |
| 603 | 3300046474 | Ga0495605_0009011 | Ga0495605_0009011_31_843 | 267 |
| 604 | 3300046474 | Ga0495605_0010497 | Ga0495605_0010497_1038_1841 | 267 |
| 605 | 3300046474 | Ga0495605_0014946 | Ga0495605_0014946_1288_2100 | 267 |
| 606 | 3300046475 | Ga0495639_0006694 | Ga0495639_0006694_4080_4883 | 267 |
| 607 | 3300046477 | Ga0495664_0151700 | Ga0495664_0151700_442_1245 | 267 |
| 608 | 3300046491 | Ga0495584_0000376 | Ga0495584_0000376_3807_4724 | 267 |
| 609 | 3300046491 | Ga0495584_0000442 | Ga0495584_0000442_6083_6895 | 267 |
| 610 | 3300046491 | Ga0495584_0017355 | Ga0495584_0017355_42_845 | 267 |
| 611 | 3300046491 | Ga0495584_0030316 | Ga0495584_0030316_1530_2342 | 267 |
| 612 | 3300046491 | Ga0495584_0054354 | Ga0495584_0054354_494_1297 | 267 |
| 613 | 3300046491 | Ga0495584_0110081 | Ga0495584_0110081_42_845 | 267 |
| 614 | 3300046491 | Ga0495584_0144455 | Ga0495584_0144455_299_1102 | 267 |
| 615 | 3300046492 | Ga0495585_0003021 | Ga0495585_0003021_3600_4403 | 267 |
| 616 | 3300046492 | Ga0495585_0013590 | Ga0495585_0013590_1161_1964 | 267 |
| 617 | 3300046492 | Ga0495585_0058308 | Ga0495585_0058308_527_1339 | 267 |
| 618 | 3300046492 | Ga0495585_0064105 | Ga0495585_0064105_1127_1930 | 267 |
| 619 | 3300046499 | Ga0495594_0021296 | Ga0495594_0021296_178_981 | 267 |
| 620 | 3300046501 | Ga0495607_0005264 | Ga0495607_0005264_6950_7753 | 267 |
| 621 | 3300046501 | Ga0495607_0017684 | Ga0495607_0017684_1246_2058 | 267 |
| 622 | 3300046501 | Ga0495607_0160996 | Ga0495607_0160996_19_822 | 267 |
| 623 | 3300046506 | Ga0495583_0001715 | Ga0495583_0001715_18267_19079 | 267 |
| 624 | 3300046506 | Ga0495583_0002503 | Ga0495583_0002503_9678_10481 | 267 |
| 625 | 3300046507 | Ga0495606_0006941 | Ga0495606_0006941_4387_5199 | 267 |
| 626 | 3300046507 | Ga0495606_0041104 | Ga0495606_0041104_1719_2522 | 267 |
| 627 | 3300046507 | Ga0495606_0202990 | Ga0495606_0202990_128_931 | 267 |
| 628 | 3300046512 | Ga0495610_0007098 | Ga0495610_0007098_4368_5180 | 267 |
| 629 | 3300046512 | Ga0495610_0014192 | Ga0495610_0014192_3541_4344 | 267 |
| 630 | 3300046513 | Ga0495616_0050833 | Ga0495616_0050833_107_910 | 267 |
| 631 | 3300046513 | Ga0495616_0143474 | Ga0495616_0143474_176_979 | 267 |
| 632 | 3300046515 | Ga0495620_0004291 | Ga0495620_0004291_6930_7733 | 267 |
| 633 | 3300046515 | Ga0495620_0005775 | Ga0495620_0005775_5299_6111 | 267 |
| 634 | 3300046517 | Ga0495630_0034327 | Ga0495630_0034327_1315_2118 | 267 |
| 635 | 3300046517 | Ga0495630_0218368 | Ga0495630_0218368_583_1395 | 267 |
| 636 | 3300046518 | Ga0495631_0000401 | Ga0495631_0000401_26778_27581 | 267 |
| 637 | 3300046518 | Ga0495631_0016102 | Ga0495631_0016102_277_1089 | 267 |
| 638 | 3300046518 | Ga0495631_0048159 | Ga0495631_0048159_52_855 | 267 |
| 639 | 3300046518 | Ga0495631_0049336 | Ga0495631_0049336_804_1616 | 267 |
| 640 | 3300046519 | Ga0495632_0001346 | Ga0495632_0001346_18524_19327 | 267 |
| 641 | 3300046519 | Ga0495632_0012801 | Ga0495632_0012801_656_1468 | 267 |
| 642 | 3300046519 | Ga0495632_0137220 | Ga0495632_0137220_38_850 | 267 |
| 643 | 3300046520 | Ga0495637_0000721 | Ga0495637_0000721_19429_20232 | 267 |
| 644 | 3300046520 | Ga0495637_0002350 | Ga0495637_0002350_2486_3298 | 267 |
| 645 | 3300046520 | Ga0495637_0007192 | Ga0495637_0007192_1714_2517 | 267 |
| 646 | 3300046522 | Ga0495643_0035773 | Ga0495643_0035773_807_1610 | 267 |
| 647 | 3300046523 | Ga0495644_0017157 | Ga0495644_0017157_1225_2037 | 267 |
| 648 | 3300046523 | Ga0495644_0061504 | Ga0495644_0061504_506_1309 | 267 |
| 649 | 3300046523 | Ga0495644_0065915 | Ga0495644_0065915_25_837 | 267 |
| 650 | 3300046524 | Ga0495648_0007967 | Ga0495648_0007967_2242_3054 | 267 |
| 651 | 3300046524 | Ga0495648_0011346 | Ga0495648_0011346_3727_4539 | 267 |
| 652 | 3300046524 | Ga0495648_0030638 | Ga0495648_0030638_2205_3008 | 267 |
| 653 | 3300046524 | Ga0495648_0031368 | Ga0495648_0031368_762_1574 | 267 |
| 654 | 3300046524 | Ga0495648_0040164 | Ga0495648_0040164_977_1780 | 267 |
| 655 | 3300046524 | Ga0495648_0054761 | Ga0495648_0054761_915_1718 | 267 |
| 656 | 3300046524 | Ga0495648_0141069 | Ga0495648_0141069_63_980 | 267 |
| 657 | 3300046526 | Ga0495666_0082870 | Ga0495666_0082870_492_1295 | 267 |
| 658 | 3300046528 | Ga0495642_0000250 | Ga0495642_0000250_19802_20605 | 267 |
| 659 | 3300046528 | Ga0495642_0001543 | Ga0495642_0001543_2338_3150 | 267 |
| 660 | 3300046530 | Ga0495654_0000803 | Ga0495654_0000803_17260_18072 | 267 |
| 661 | 3300046530 | Ga0495654_0001816 | Ga0495654_0001816_303_1106 | 267 |
| 662 | 3300046530 | Ga0495654_0004000 | Ga0495654_0004000_702_1505 | 267 |
| 663 | 3300046530 | Ga0495654_0044006 | Ga0495654_0044006_673_1485 | 267 |
| 664 | 3300046535 | Ga0495586_0014731 | Ga0495586_0014731_576_1379 | 267 |
| 665 | 3300046536 | Ga0495587_0040357 | Ga0495587_0040357_1451_2254 | 267 |
| 666 | 3300046538 | Ga0495609_0005130 | Ga0495609_0005130_4583_5386 | 267 |
| 667 | 3300046538 | Ga0495609_0017110 | Ga0495609_0017110_431_1243 | 267 |
| 668 | 3300046538 | Ga0495609_0023262 | Ga0495609_0023262_945_1748 | 267 |
| 669 | 3300046538 | Ga0495609_0037671 | Ga0495609_0037671_583_1395 | 267 |
| 670 | 3300046542 | Ga0495597_0004423 | Ga0495597_0004423_2099_2911 | 267 |
| 671 | 3300046542 | Ga0495597_0011586 | Ga0495597_0011586_1814_2626 | 267 |
| 672 | 3300046542 | Ga0495597_0069246 | Ga0495597_0069246_139_951 | 267 |
| 673 | 3300046557 | Ga0495622_0004354 | Ga0495622_0004354_3540_4343 | 267 |
| 674 | 3300046557 | Ga0495622_0048933 | Ga0495622_0048933_27_839 | 267 |
| 675 | 3300046557 | Ga0495622_0052325 | Ga0495622_0052325_683_1495 | 267 |
| 676 | 3300046557 | Ga0495622_0072204 | Ga0495622_0072204_86_898 | 267 |
| 677 | 3300046557 | Ga0495622_0078867 | Ga0495622_0078867_128_931 | 267 |
| 678 | 3300046558 | Ga0495633_0006119 | Ga0495633_0006119_4137_4940 | 267 |
| 679 | 3300046558 | Ga0495633_0033814 | Ga0495633_0033814_715_1527 | 267 |
| 680 | 3300046558 | Ga0495633_0111543 | Ga0495633_0111543_201_1013 | 267 |
| 681 | 3300046615 | Ga0495656_0023484 | Ga0495656_0023484_654_1457 | 267 |
| 682 | 3300046615 | Ga0495656_0047346 | Ga0495656_0047346_527_1339 | 267 |
| 683 | 3300046616 | Ga0495668_0011417 | Ga0495668_0011417_3305_4117 | 267 |
| 684 | 3300046616 | Ga0495668_0089068 | Ga0495668_0089068_442_1245 | 267 |
| 685 | 3300046660 | Ga0495625_0004936 | Ga0495625_0004936_815_1618 | 267 |
| 686 | 3300046660 | Ga0495625_0141689 | Ga0495625_0141689_767_1579 | 267 |
| 687 | 3300046660 | Ga0495625_0204660 | Ga0495625_0204660_63_866 | 267 |
| 688 | 3300046660 | Ga0495625_0261928 | Ga0495625_0261928_169_972 | 267 |
| 689 | 3300046664 | Ga0495659_0020306 | Ga0495659_0020306_1055_1858 | 267 |
| 690 | 3300046664 | Ga0495659_0086512 | Ga0495659_0086512_169_981 | 267 |
| 691 | 3300046665 | Ga0495661_0011651 | Ga0495661_0011651_709_1521 | 267 |
| 692 | 3300046674 | Ga0495588_0020068 | Ga0495588_0020068_590_1402 | 267 |
| 693 | 3300046674 | Ga0495588_0049632 | Ga0495588_0049632_1188_2000 | 267 |
| 694 | 3300046674 | Ga0495588_0071455 | Ga0495588_0071455_254_1057 | 267 |
| 695 | 3300046674 | Ga0495588_0108228 | Ga0495588_0108228_404_1207 | 267 |
| 696 | 3300046674 | Ga0495588_0144299 | Ga0495588_0144299_340_1143 | 267 |
| 697 | 3300046679 | Ga0495623_0001367 | Ga0495623_0001367_1350_2153 | 267 |
| 698 | 3300046680 | Ga0495646_0001267 | Ga0495646_0001267_11219_12022 | 267 |
| 699 | 3300046680 | Ga0495646_0071714 | Ga0495646_0071714_389_1192 | 267 |
| 700 | 3300046684 | Ga0495669_0005602 | Ga0495669_0005602_1148_1951 | 267 |
| 701 | 3300046689 | Ga0495613_0027894 | Ga0495613_0027894_2523_3326 | 267 |
| 702 | 3300046689 | Ga0495613_0033897 | Ga0495613_0033897_333_1136 | 267 |
| 703 | 3300046691 | Ga0495670_0003476 | Ga0495670_0003476_5724_6527 | 267 |
| 704 | 3300046691 | Ga0495670_0010629 | Ga0495670_0010629_1597_2409 | 267 |
| 705 | 3300046691 | Ga0495670_0021869 | Ga0495670_0021869_1981_2793 | 267 |
| 706 | 3300046691 | Ga0495670_0123616 | Ga0495670_0123616_226_1038 | 267 |
| 707 | 3300046692 | Ga0495671_0000094 | Ga0495671_0000094_61170_61973 | 267 |
| 708 | 3300046692 | Ga0495671_0003431 | Ga0495671_0003431_6291_7103 | 267 |
| 709 | 3300046692 | Ga0495671_0005088 | Ga0495671_0005088_6224_7036 | 267 |
| 710 | 3300046692 | Ga0495671_0140952 | Ga0495671_0140952_226_1038 | 267 |
| 711 | 3300046694 | Ga0495649_0008206 | Ga0495649_0008206_797_1609 | 267 |
| 712 | 3300046694 | Ga0495649_0012389 | Ga0495649_0012389_2319_3131 | 267 |
| 713 | 3300046694 | Ga0495649_0018714 | Ga0495649_0018714_1190_1993 | 267 |
| 714 | 3300046694 | Ga0495649_0033805 | Ga0495649_0033805_784_1587 | 267 |
| 715 | 3300046794 | Ga0495589_0005527 | Ga0495589_0005527_4017_4820 | 267 |
| 716 | 3300046794 | Ga0495589_0030423 | Ga0495589_0030423_1178_1981 | 267 |
| 717 | 3300046794 | Ga0495589_0044815 | Ga0495589_0044815_680_1492 | 267 |
| 718 | 3300046809 | Ga0495600_0052523 | Ga0495600_0052523_310_1113 | 267 |
| 719 | 3300046810 | Ga0495660_0012868 | Ga0495660_0012868_2602_3414 | 267 |
| 720 | 3300046810 | Ga0495660_0019355 | Ga0495660_0019355_1900_2703 | 267 |
| 721 | 3300047315 | Ga0495581_0001153 | Ga0495581_0001153_10626_11438 | 267 |
| 722 | 3300047315 | Ga0495581_0210044 | Ga0495581_0210044_89_892 | 267 |
| 723 | 3300047320 | Ga0495672_0002470 | Ga0495672_0002470_13914_14726 | 267 |
| 724 | 3300047320 | Ga0495672_0002731 | Ga0495672_0002731_13731_14543 | 267 |
| 725 | 3300047320 | Ga0495672_0006068 | Ga0495672_0006068_7924_8736 | 267 |
| 726 | 3300047320 | Ga0495672_0007951 | Ga0495672_0007951_1047_1859 | 267 |
| 727 | 3300047320 | Ga0495672_0013597 | Ga0495672_0013597_2453_3265 | 267 |
| 728 | 3300047320 | Ga0495672_0016439 | Ga0495672_0016439_2437_3240 | 267 |
| 729 | 3300047322 | Ga0495680_0004433 | Ga0495680_0004433_10154_10966 | 267 |
| 730 | 3300047322 | Ga0495680_0004958 | Ga0495680_0004958_533_1336 | 267 |
| 731 | 3300047322 | Ga0495680_0005052 | Ga0495680_0005052_10375_11178 | 267 |
| 732 | 3300047323 | Ga0495683_0000479 | Ga0495683_0000479_2253_3056 | 267 |
| 733 | 3300047323 | Ga0495683_0010817 | Ga0495683_0010817_2476_3288 | 267 |
| 734 | 3300047443 | Ga0495687_002564 | Ga0495687_002564_10985_11797 | 267 |
| 735 | 3300047443 | Ga0495687_002722 | Ga0495687_002722_2082_2894 | 267 |
| 736 | 3300047444 | Ga0495675_0116302 | Ga0495675_0116302_478_1281 | 267 |
| 737 | 3300047445 | Ga0495677_0004924 | Ga0495677_0004924_2266_3069 | 267 |
| 738 | 3300047446 | Ga0495679_003804 | Ga0495679_003804_5172_5984 | 267 |
| 739 | 3300047446 | Ga0495679_013769 | Ga0495679_013769_501_1304 | 267 |
| 740 | 3300047469 | Ga0495673_0006271 | Ga0495673_0006271_2306_3109 | 267 |
| 741 | 3300047469 | Ga0495673_0017271 | Ga0495673_0017271_424_1236 | 267 |
| 742 | 3300047469 | Ga0495673_0020414 | Ga0495673_0020414_1999_2811 | 267 |
| 743 | 3300047469 | Ga0495673_0023802 | Ga0495673_0023802_909_1721 | 267 |
| 744 | 3300047469 | Ga0495673_0039379 | Ga0495673_0039379_790_1593 | 267 |
| 745 | 3300047469 | Ga0495673_0040848 | Ga0495673_0040848_1126_1929 | 267 |
| 746 | 3300047469 | Ga0495673_0041083 | Ga0495673_0041083_764_1576 | 267 |
| 747 | 3300047469 | Ga0495673_0066556 | Ga0495673_0066556_407_1219 | 267 |
| 748 | 3300047470 | Ga0495681_0001998 | Ga0495681_0001998_178_981 | 267 |
| 749 | 3300047470 | Ga0495681_0002273 | Ga0495681_0002273_2217_3029 | 267 |
| 750 | 3300047472 | Ga0495686_0109494 | Ga0495686_0109494_774_1577 | 267 |
| 751 | 3300047673 | Ga0495593_0026174 | Ga0495593_0026174_1696_2508 | 267 |
| 752 | 3300047673 | Ga0495593_0055303 | Ga0495593_0055303_800_1603 | 267 |
| 753 | 3300048089 | Ga0495614_0015172 | Ga0495614_0015172_721_1524 | 267 |
| 754 | 3300048091 | Ga0495626_0000536 | Ga0495626_0000536_32513_33325 | 267 |
| 755 | 3300048091 | Ga0495626_0001115 | Ga0495626_0001115_15948_16760 | 267 |
| 756 | 3300048091 | Ga0495626_0001219 | Ga0495626_0001219_2257_3069 | 267 |
| 757 | 3300048091 | Ga0495626_0017675 | Ga0495626_0017675_2508_3320 | 267 |
| 758 | 3300048091 | Ga0495626_0078900 | Ga0495626_0078900_211_1014 | 267 |
| 759 | 3300048905 | Ga0496102_0002255 | Ga0496102_0002255_2321_3124 | 267 |
| 760 | 3300048906 | Ga0496103_0007656 | Ga0496103_0007656_2228_3031 | 267 |
| 761 | 3300048906 | Ga0496103_0230359 | Ga0496103_0230359_321_1124 | 267 |
| 762 | 3300048907 | Ga0496104_0289558 | Ga0496104_0289558_269_1072 | 267 |
| 763 | 3300048909 | Ga0496106_0020543 | Ga0496106_0020543_2114_2938 | 267 |
| 764 | 3300048909 | Ga0496106_0094314 | Ga0496106_0094314_986_1789 | 267 |
| 765 | 3300048913 | Ga0496110_0065550 | Ga0496110_0065550_1445_2248 | 267 |
| 766 | 3300048914 | Ga0496111_0005004 | Ga0496111_0005004_6558_7361 | 267 |
| 767 | 3300048919 | Ga0496116_0077853 | Ga0496116_0077853_254_1057 | 267 |
| 768 | 3300048920 | Ga0496117_0096079 | Ga0496117_0096079_1029_1832 | 267 |
| 769 | 3300048921 | Ga0496118_0012630 | Ga0496118_0012630_6035_6838 | 267 |
| 770 | 3300048924 | Ga0496121_0079416 | Ga0496121_0079416_740_1543 | 267 |
| 771 | 3300048927 | Ga0496124_0070046 | Ga0496124_0070046_1383_2186 | 267 |
| 772 | 3300048927 | Ga0496124_0132131 | Ga0496124_0132131_921_1724 | 267 |
| 773 | 3300048928 | Ga0496125_0034882 | Ga0496125_0034882_1742_2545 | 267 |
| 774 | 3300048928 | Ga0496125_0056994 | Ga0496125_0056994_241_1044 | 267 |
| 775 | 3300048929 | Ga0496126_0505290 | Ga0496126_0505290_85_888 | 267 |
| 776 | 3300049459 | Ga0495678_003162 | Ga0495678_003162_2496_3308 | 267 |
| 777 | 3300049459 | Ga0495678_018244 | Ga0495678_018244_1634_2446 | 267 |
| 778 | 3300049460 | Ga0495682_0001075 | Ga0495682_0001075_14021_14833 | 267 |
| 779 | 3300049460 | Ga0495682_0008040 | Ga0495682_0008040_2602_3414 | 267 |
| 780 | 3300049460 | Ga0495682_0025693 | Ga0495682_0025693_369_1172 | 267 |
| 781 | 3300049460 | Ga0495682_0046600 | Ga0495682_0046600_577_1389 | 267 |
| 782 | 3300049460 | Ga0495682_0064721 | Ga0495682_0064721_286_1098 | 267 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mg4-assembly4.cif.gz_D | crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 | 0.9377 | 2 | 234 |
| 4mg4-assembly2.cif.gz_F | crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 | 0.9307 | 2 | 235 |
| 4mg4-assembly1.cif.gz_H | crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 | 0.9098 | 2 | 235 |
| 4mg4-assembly1.cif.gz_A | crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 | 0.8962 | 2 | 240 |
| 2qiw-assembly1.cif.gz_B | crystal structure of a putative phosphoenolpyruvate phosphonomutase (ncgl1015, cgl1060) from corynebacterium glutamicum atcc 13032 at 1.80 a resolution | 0.8898 | 2 | 238 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ze3A01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9431 | 2 | 218 | 3.20.20.60 |
| 4lsbB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9089 | 2 | 218 | 3.20.20.60 |
| 4mg4B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8976 | 2 | 240 | 3.20.20.60 |
| 2ze3A01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8805 | 2 | 218 | 3.20.20.60 |
| 2qiwB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8801 | 2 | 218 | 3.20.20.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H1MMA1-F1-model_v4 | 2-Methylisocitrate lyase, PEP mutase family | 0.9975 | 2 | 261 |
GO:0016829
|
| AF-A0A3L8CC07-F1-model_v4 | PEP phosphonomutase | 0.9974 | 2 | 261 |
GO:0003824
|
| AF-A0A5E6RYB2-F1-model_v4 | PEP phosphonomutase | 0.9957 | 2 | 259 |
GO:0003824
|
| AF-A0A7V8RGX8-F1-model_v4 | Isocitrate lyase/phosphoenolpyruvate mutase family protein | 0.9956 | 2 | 260 |
GO:0016829
|
| AF-A0A7U9GSB7-F1-model_v4 | PEP phosphonomutase | 0.9954 | 2 | 259 |
GO:0003824
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar