F480631
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 782 | 381 | 677 | 549 |
Family's Representative Sequence
| Representative Sequence | 3300046543|Ga0495645_0120103|Ga0495645_0120103_64_1707 |
| Length | 503 |
| Sequence | VSDGPLIVQSFAELERAPEHVHSYRLTPLGLWNARAAGLDAEKVLDTLLRYSRFPVPHSLLIDIEETMSRYGRLRLEKDPQHGLVMRTTDYPVLEEVIRAKKIAPLLGPRIDGETVVVHSSQRGQLKQLLLKLGWPAEDLAGYVDGTPHLIALNEDGWHLRPYQKLATENFWAGGSGVVVLPCGAGKTLVGQWKDELLKRTSLTEEEIGEYSGAVKEVRPVTIATYQVLTTKRGGLYPHLELVDGHDWGLIIYDEVHLLPAPIFRMTADLQARRRLGLTATLVREDGREGEVFSLIGPKRYDAPWKDIEAQGYIAPADCVEVRVDLPRDERVAYAMAEDADKYRLCATSETKTHLVEQLVALHQGEQLLVIGQYIDQLDEIGERLDAPVIKGDTTVKVRQKLFDAFRAGDIKTLVVSKVANFSIDLPEASVAIQVSGSFGSRQEEAQRLGRLLRPKQDGRAARFYSLVARDTLDQDFAAKRQRFLAEQGYAYRIMDAKDVPAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 2 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 3 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 4 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 5 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 6 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 7 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 8 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 9 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 10 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 11 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 12 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 13 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 14 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 15 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 16 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 17 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 18 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 19 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 20 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 21 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 22 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 23 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 24 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 25 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 26 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 27 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 28 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 29 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 30 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 31 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 32 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 33 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 34 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 35 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 36 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 37 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 38 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 39 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 40 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 41 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 42 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 43 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 44 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 45 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 46 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 47 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 48 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 49 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 50 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 51 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 52 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 53 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 54 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 55 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 56 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 57 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 58 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 59 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 60 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 61 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 62 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 63 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 64 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 65 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 66 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 67 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 68 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 69 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 70 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 71 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 72 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 73 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 74 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 75 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 76 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 77 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 78 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 79 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 80 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 81 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 82 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 83 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 84 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 85 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 86 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 87 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 88 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 89 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 90 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 91 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 92 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 93 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 94 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 95 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 96 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 97 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 98 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 99 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 100 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 101 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 102 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 103 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 104 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 105 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 106 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 107 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 109 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 128 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 129 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 130 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 131 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 132 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 133 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 136 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 138 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 139 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 140 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 142 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 143 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 144 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 145 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 146 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 147 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 148 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 149 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 150 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 151 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 152 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 153 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 154 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 156 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 157 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 158 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 159 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 160 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 161 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 162 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 163 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 164 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 165 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 166 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 167 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 168 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 169 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 170 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 171 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 173 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 201 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 202 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 203 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 204 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 256 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 260 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 261 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 262 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 263 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 264 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 265 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 266 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 267 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 268 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 269 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 270 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 271 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 272 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 273 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 274 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 275 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 277 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 280 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 281 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 282 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 283 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 284 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 285 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 286 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 287 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 288 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 289 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 290 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 291 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 292 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 293 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 294 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 295 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 296 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 297 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 298 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 299 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 300 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 301 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 302 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 303 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 304 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 321 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 322 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 326 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 327 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 331 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 332 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 333 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 334 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 335 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 336 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 337 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 338 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 339 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 358 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 359 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 362 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 372 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 373 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 374 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 375 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 376 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 377 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 378 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 379 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 380 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 381 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.57 |
| Metatranscriptomes | 0 |
| Isolates | 13.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.13 |
| Bulb | 0 |
| Endosphere | 7.42 |
| Nodule | 0.13 |
| Rhizoplane | 11.13 |
| Rhizosphere | 64.07 |
| Stem | 0 |
| Stem Tuber | 0.13 |
| Unclassified | 17.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1004648 | 3300000549 | Bacteria | 1779 |
| 2 | JGI24738J21930_10010039 | 3300002075 | Bacteria | 2117 |
| 3 | JGI24744J21845_10000243 | 3300002077 | Bacteria | 8793 |
| 4 | JGI24751J29686_10003232 | 3300002459 | Bacteria | 3277 |
| 5 | JGI25406J46586_10001670 | 3300003203 | Bacteria | 10483 |
| 6 | Ga0055540_1000022 | 3300003792 | Bacteria | 201257 |
| 7 | Ga0055540_1001171 | 3300003792 | Bacteria | 16270 |
| 8 | Ga0055540_1003464 | 3300003792 | Bacteria | 7619 |
| 9 | Ga0055540_1007294 | 3300003792 | Bacteria | 4209 |
| 10 | Ga0070682_100004581 | 3300005337 | Bacteria | 7685 |
| 11 | Ga0070682_100018264 | 3300005337 | Bacteria | 4096 |
| 12 | Ga0070682_100067463 | 3300005337 | Bacteria | 2278 |
| 13 | Ga0068868_100008941 | 3300005338 | Bacteria | 7187 |
| 14 | Ga0068868_100071612 | 3300005338 | Bacteria | 2764 |
| 15 | Ga0070660_100072079 | 3300005339 | Bacteria | 2698 |
| 16 | Ga0070660_100123226 | 3300005339 | Bacteria | 2070 |
| 17 | Ga0070691_10001429 | 3300005341 | Bacteria | 10199 |
| 18 | Ga0070687_100039272 | 3300005343 | Bacteria | 2377 |
| 19 | Ga0070692_10006310 | 3300005345 | Bacteria | 5142 |
| 20 | Ga0070668_100000201 | 3300005347 | Bacteria | 39161 |
| 21 | Ga0070668_100000615 | 3300005347 | Bacteria | 23889 |
| 22 | Ga0070668_100001887 | 3300005347 | Bacteria | 15322 |
| 23 | Ga0070668_100011457 | 3300005347 | Bacteria | 6602 |
| 24 | Ga0070668_100014548 | 3300005347 | Bacteria | 5879 |
| 25 | Ga0070668_100038806 | 3300005347 | Bacteria | 3642 |
| 26 | Ga0070671_100001715 | 3300005355 | Bacteria | 16641 |
| 27 | Ga0070671_100005961 | 3300005355 | Bacteria | 9709 |
| 28 | Ga0070671_100008029 | 3300005355 | Bacteria | 8448 |
| 29 | Ga0070674_100002301 | 3300005356 | Bacteria | 10550 |
| 30 | Ga0070674_100075845 | 3300005356 | Bacteria | 2389 |
| 31 | Ga0070673_100133591 | 3300005364 | Bacteria | 2086 |
| 32 | Ga0070659_100035727 | 3300005366 | Bacteria | 3871 |
| 33 | Ga0070659_100070461 | 3300005366 | Bacteria | 2777 |
| 34 | Ga0070667_100000142 | 3300005367 | Bacteria | 90696 |
| 35 | Ga0070667_100019542 | 3300005367 | Bacteria | 5621 |
| 36 | Ga0070667_100022439 | 3300005367 | Bacteria | 5235 |
| 37 | Ga0070667_100032084 | 3300005367 | Bacteria | 4380 |
| 38 | Ga0070714_100003715 | 3300005435 | Bacteria | 11438 |
| 39 | Ga0070714_100005353 | 3300005435 | Bacteria | 9788 |
| 40 | Ga0070714_100067900 | 3300005435 | Bacteria | 3076 |
| 41 | Ga0070710_10001113 | 3300005437 | Bacteria | 12705 |
| 42 | Ga0070710_10001176 | 3300005437 | Bacteria | 12351 |
| 43 | Ga0070701_10007457 | 3300005438 | Bacteria | 4676 |
| 44 | Ga0070711_100002471 | 3300005439 | Bacteria | 10552 |
| 45 | Ga0070700_100000060 | 3300005441 | Bacteria | 82198 |
| 46 | Ga0070700_100000263 | 3300005441 | Bacteria | 28075 |
| 47 | Ga0070700_100018484 | 3300005441 | Bacteria | 4007 |
| 48 | Ga0070663_100015748 | 3300005455 | Bacteria | 4891 |
| 49 | Ga0070678_100001503 | 3300005456 | Bacteria | 12453 |
| 50 | Ga0070678_100001635 | 3300005456 | Bacteria | 11996 |
| 51 | Ga0070678_100017625 | 3300005456 | Bacteria | 4606 |
| 52 | Ga0070678_100115369 | 3300005456 | Bacteria | 2108 |
| 53 | Ga0070662_100001803 | 3300005457 | Bacteria | 13163 |
| 54 | Ga0070681_10010877 | 3300005458 | Bacteria | 8995 |
| 55 | Ga0068867_100000537 | 3300005459 | Bacteria | 24926 |
| 56 | Ga0070685_10032022 | 3300005466 | Bacteria | 2943 |
| 57 | Ga0070685_10055451 | 3300005466 | Bacteria | 2303 |
| 58 | Ga0070684_100005591 | 3300005535 | Bacteria | 9655 |
| 59 | Ga0068853_100001294 | 3300005539 | Bacteria | 17970 |
| 60 | Ga0068853_100073585 | 3300005539 | Bacteria | 2980 |
| 61 | Ga0068853_100086433 | 3300005539 | Bacteria | 2750 |
| 62 | Ga0070686_100067740 | 3300005544 | Bacteria | 2327 |
| 63 | Ga0070693_100016333 | 3300005547 | Bacteria | 3841 |
| 64 | Ga0070665_100002109 | 3300005548 | Bacteria | 22245 |
| 65 | Ga0070665_100003879 | 3300005548 | Bacteria | 15797 |
| 66 | Ga0070665_100003927 | 3300005548 | Bacteria | 15691 |
| 67 | Ga0070665_100014928 | 3300005548 | Bacteria | 7798 |
| 68 | Ga0070704_100001099 | 3300005549 | Bacteria | 14040 |
| 69 | Ga0070664_100052437 | 3300005564 | Bacteria | 3455 |
| 70 | Ga0068857_100019728 | 3300005577 | Bacteria | 5922 |
| 71 | Ga0068854_100001607 | 3300005578 | Bacteria | 13732 |
| 72 | Ga0068856_100007085 | 3300005614 | Bacteria | 10948 |
| 73 | Ga0068856_100031944 | 3300005614 | Bacteria | 5151 |
| 74 | Ga0070702_100000302 | 3300005615 | Bacteria | 16928 |
| 75 | Ga0070702_100000348 | 3300005615 | Bacteria | 16132 |
| 76 | Ga0070702_100011550 | 3300005615 | Bacteria | 4395 |
| 77 | Ga0070702_100014383 | 3300005615 | Bacteria | 4014 |
| 78 | Ga0068852_100009739 | 3300005616 | Bacteria | 7142 |
| 79 | Ga0068852_100013644 | 3300005616 | Bacteria | 6223 |
| 80 | Ga0068859_100001155 | 3300005617 | Bacteria | 26941 |
| 81 | Ga0068859_100002067 | 3300005617 | Bacteria | 20487 |
| 82 | Ga0068859_100010099 | 3300005617 | Bacteria | 9514 |
| 83 | Ga0068859_100023208 | 3300005617 | Bacteria | 6225 |
| 84 | Ga0068864_100031268 | 3300005618 | Bacteria | 4516 |
| 85 | Ga0068864_100033276 | 3300005618 | Bacteria | 4382 |
| 86 | Ga0068866_10001689 | 3300005718 | Bacteria | 9291 |
| 87 | Ga0068861_100000739 | 3300005719 | Bacteria | 19591 |
| 88 | Ga0068870_10009251 | 3300005840 | Bacteria | 4473 |
| 89 | Ga0068870_10017456 | 3300005840 | Bacteria | 3447 |
| 90 | Ga0068863_100005764 | 3300005841 | Bacteria | 12154 |
| 91 | Ga0068863_100033523 | 3300005841 | Bacteria | 4892 |
| 92 | Ga0068863_100055722 | 3300005841 | Bacteria | 3743 |
| 93 | Ga0068863_100122301 | 3300005841 | Bacteria | 2482 |
| 94 | Ga0068858_100000001 | 3300005842 | Bacteria | 417735 |
| 95 | Ga0068858_100002363 | 3300005842 | Bacteria | 19075 |
| 96 | Ga0068858_100032090 | 3300005842 | Bacteria | 4878 |
| 97 | Ga0068858_100054643 | 3300005842 | Bacteria | 3692 |
| 98 | Ga0068858_100131561 | 3300005842 | Bacteria | 2347 |
| 99 | Ga0068858_100226976 | 3300005842 | Bacteria | 1770 |
| 100 | Ga0068860_100000160 | 3300005843 | Bacteria | 110266 |
| 101 | Ga0068860_100001185 | 3300005843 | Bacteria | 28525 |
| 102 | Ga0068860_100004520 | 3300005843 | Bacteria | 14197 |
| 103 | Ga0068860_100006970 | 3300005843 | Bacteria | 11324 |
| 104 | Ga0068860_100050073 | 3300005843 | Bacteria | 3978 |
| 105 | Ga0068860_100073226 | 3300005843 | Bacteria | 3257 |
| 106 | Ga0068862_100001362 | 3300005844 | Bacteria | 22694 |
| 107 | Ga0068862_100018762 | 3300005844 | Bacteria | 5763 |
| 108 | Ga0081455_10000037 | 3300005937 | Bacteria | 136059 |
| 109 | Ga0081455_10086756 | 3300005937 | Bacteria | 2549 |
| 110 | Ga0081540_1000721 | 3300005983 | Bacteria | 30491 |
| 111 | Ga0081539_10000027 | 3300005985 | Bacteria | 328691 |
| 112 | Ga0081539_10004065 | 3300005985 | Bacteria | 16734 |
| 113 | Ga0070717_10075208 | 3300006028 | Bacteria | 2825 |
| 114 | Ga0075365_10004459 | 3300006038 | Bacteria | 7419 |
| 115 | Ga0075365_10021804 | 3300006038 | Bacteria | 4002 |
| 116 | Ga0075365_10058065 | 3300006038 | Bacteria | 2575 |
| 117 | Ga0075363_100005102 | 3300006048 | Bacteria | 5808 |
| 118 | Ga0075363_100015345 | 3300006048 | Bacteria | 3764 |
| 119 | Ga0075363_100016072 | 3300006048 | Bacteria | 3692 |
| 120 | Ga0075363_100070037 | 3300006048 | Bacteria | 1904 |
| 121 | Ga0075364_10000909 | 3300006051 | Bacteria | 15613 |
| 122 | Ga0075364_10003441 | 3300006051 | Bacteria | 9003 |
| 123 | Ga0075364_10003959 | 3300006051 | Bacteria | 8501 |
| 124 | Ga0075364_10004852 | 3300006051 | Bacteria | 7792 |
| 125 | Ga0075364_10005541 | 3300006051 | Bacteria | 7351 |
| 126 | Ga0075364_10005904 | 3300006051 | Bacteria | 7153 |
| 127 | Ga0075364_10015218 | 3300006051 | Bacteria | 4766 |
| 128 | Ga0070716_100004733 | 3300006173 | Bacteria | 6528 |
| 129 | Ga0070712_100000495 | 3300006175 | Bacteria | 22525 |
| 130 | Ga0075362_10026509 | 3300006177 | Bacteria | 2476 |
| 131 | Ga0075367_10004255 | 3300006178 | Bacteria | 6957 |
| 132 | Ga0075369_10009876 | 3300006186 | Bacteria | 3723 |
| 133 | Ga0075369_10010596 | 3300006186 | Bacteria | 3610 |
| 134 | Ga0075369_10015319 | 3300006186 | Bacteria | 3075 |
| 135 | Ga0075369_10016601 | 3300006186 | Bacteria | 2974 |
| 136 | Ga0075370_10002764 | 3300006353 | Bacteria | 8218 |
| 137 | Ga0075370_10009460 | 3300006353 | Bacteria | 5063 |
| 138 | Ga0075428_100009516 | 3300006844 | Bacteria | 10789 |
| 139 | Ga0075430_100002400 | 3300006846 | Bacteria | 15582 |
| 140 | Ga0075433_10002276 | 3300006852 | Bacteria | 14605 |
| 141 | Ga0075433_10067874 | 3300006852 | Bacteria | 3130 |
| 142 | Ga0075434_100010515 | 3300006871 | Bacteria | 8677 |
| 143 | Ga0075434_100025012 | 3300006871 | Bacteria | 5840 |
| 144 | Ga0075429_100003965 | 3300006880 | Bacteria | 12658 |
| 145 | Ga0068865_100000670 | 3300006881 | Bacteria | 19290 |
| 146 | Ga0068865_100024875 | 3300006881 | Bacteria | 3932 |
| 147 | Ga0068865_100066572 | 3300006881 | Bacteria | 2542 |
| 148 | Ga0075436_100049293 | 3300006914 | Bacteria | 2905 |
| 149 | Ga0097620_100001155 | 3300006931 | Bacteria | 26941 |
| 150 | Ga0097620_100002067 | 3300006931 | Bacteria | 20487 |
| 151 | Ga0097620_100010099 | 3300006931 | Bacteria | 9514 |
| 152 | Ga0097620_100023209 | 3300006931 | Bacteria | 6225 |
| 153 | Ga0075435_100059771 | 3300007076 | Bacteria | 3089 |
| 154 | Ga0105251_10028937 | 3300009011 | Bacteria | 2795 |
| 155 | Ga0105240_10145346 | 3300009093 | Bacteria | 2830 |
| 156 | Ga0111539_10067342 | 3300009094 | Bacteria | 4229 |
| 157 | Ga0111539_10079610 | 3300009094 | Bacteria | 3855 |
| 158 | Ga0105245_10001945 | 3300009098 | Bacteria | 18742 |
| 159 | Ga0105245_10010076 | 3300009098 | Bacteria | 8235 |
| 160 | Ga0105245_10010496 | 3300009098 | Bacteria | 8060 |
| 161 | Ga0105247_10000078 | 3300009101 | Bacteria | 110404 |
| 162 | Ga0105247_10000433 | 3300009101 | Bacteria | 35512 |
| 163 | Ga0105247_10002992 | 3300009101 | Bacteria | 11205 |
| 164 | Ga0105247_10034572 | 3300009101 | Bacteria | 3078 |
| 165 | Ga0105247_10061113 | 3300009101 | Bacteria | 2336 |
| 166 | Ga0114129_10024424 | 3300009147 | Bacteria | 8563 |
| 167 | Ga0105243_10001024 | 3300009148 | Bacteria | 25840 |
| 168 | Ga0105243_10001959 | 3300009148 | Bacteria | 17537 |
| 169 | Ga0105243_10012407 | 3300009148 | Bacteria | 6441 |
| 170 | Ga0105241_10018126 | 3300009174 | Bacteria | 5177 |
| 171 | Ga0105241_10144966 | 3300009174 | Bacteria | 1937 |
| 172 | Ga0105242_10000858 | 3300009176 | Bacteria | 23563 |
| 173 | Ga0105248_10000082 | 3300009177 | Bacteria | 110759 |
| 174 | Ga0105248_10000529 | 3300009177 | Bacteria | 43587 |
| 175 | Ga0105248_10001630 | 3300009177 | Bacteria | 24938 |
| 176 | Ga0105248_10019600 | 3300009177 | Bacteria | 7486 |
| 177 | Ga0105237_10016390 | 3300009545 | Bacteria | 7702 |
| 178 | Ga0105237_10062552 | 3300009545 | Bacteria | 3722 |
| 179 | Ga0105237_10066578 | 3300009545 | Bacteria | 3597 |
| 180 | Ga0105238_10110263 | 3300009551 | Bacteria | 2733 |
| 181 | Ga0105238_10175641 | 3300009551 | Bacteria | 2118 |
| 182 | Ga0105249_10000031 | 3300009553 | Bacteria | 220006 |
| 183 | Ga0105249_10002952 | 3300009553 | Bacteria | 14673 |
| 184 | Ga0105249_10027800 | 3300009553 | Bacteria | 5104 |
| 185 | Ga0105239_10022402 | 3300010375 | Bacteria | 6964 |
| 186 | Ga0105239_10022852 | 3300010375 | Bacteria | 6894 |
| 187 | Ga0105239_10030418 | 3300010375 | Bacteria | 5937 |
| 188 | Ga0157371_10049584 | 3300013102 | Bacteria | 2982 |
| 189 | Ga0157369_10058658 | 3300013105 | Bacteria | 4152 |
| 190 | Ga0157374_10041716 | 3300013296 | Bacteria | 4231 |
| 191 | Ga0157378_10002386 | 3300013297 | Bacteria | 16682 |
| 192 | Ga0163162_10005790 | 3300013306 | Bacteria | 11961 |
| 193 | Ga0157372_10000043 | 3300013307 | Bacteria | 153958 |
| 194 | Ga0157372_10006566 | 3300013307 | Bacteria | 12376 |
| 195 | Ga0157372_10291277 | 3300013307 | Bacteria | 1899 |
| 196 | Ga0157375_10000849 | 3300013308 | Bacteria | 26601 |
| 197 | Ga0157375_10076209 | 3300013308 | Bacteria | 3380 |
| 198 | Ga0163163_10126191 | 3300014325 | Bacteria | 2597 |
| 199 | Ga0157380_10000339 | 3300014326 | Bacteria | 27956 |
| 200 | Ga0157377_10049674 | 3300014745 | Bacteria | 2359 |
| 201 | Ga0157379_10000059 | 3300014968 | Bacteria | 69772 |
| 202 | Ga0157379_10034320 | 3300014968 | Bacteria | 4523 |
| 203 | Ga0157376_10054823 | 3300014969 | Bacteria | 3325 |
| 204 | Ga0157376_10096996 | 3300014969 | Bacteria | 2567 |
| 205 | Ga0163161_10000520 | 3300017792 | Bacteria | 31388 |
| 206 | Ga0163161_10006431 | 3300017792 | Bacteria | 8133 |
| 207 | Ga0213873_10000029 | 3300021358 | Bacteria | 59669 |
| 208 | Ga0213876_10003631 | 3300021384 | Bacteria | 8775 |
| 209 | Ga0213876_10009868 | 3300021384 | Bacteria | 5137 |
| 210 | Ga0213875_10000107 | 3300021388 | Bacteria | 95120 |
| 211 | Ga0209646_1000013 | 3300025246 | Bacteria | 565830 |
| 212 | Ga0209051_1000033 | 3300025303 | Bacteria | 380540 |
| 213 | Ga0209051_1000522 | 3300025303 | Bacteria | 48068 |
| 214 | Ga0207692_10001017 | 3300025898 | Bacteria | 10238 |
| 215 | Ga0207692_10008372 | 3300025898 | Bacteria | 4276 |
| 216 | Ga0207642_10000168 | 3300025899 | Bacteria | 18725 |
| 217 | Ga0207642_10006957 | 3300025899 | Bacteria | 3791 |
| 218 | Ga0207710_10000022 | 3300025900 | Bacteria | 335632 |
| 219 | Ga0207710_10001549 | 3300025900 | Bacteria | 11317 |
| 220 | Ga0207710_10003170 | 3300025900 | Bacteria | 7361 |
| 221 | Ga0207688_10001068 | 3300025901 | Bacteria | 14029 |
| 222 | Ga0207688_10004452 | 3300025901 | Bacteria | 7628 |
| 223 | Ga0207688_10012472 | 3300025901 | Bacteria | 4625 |
| 224 | Ga0207688_10021944 | 3300025901 | Bacteria | 3491 |
| 225 | Ga0207685_10026226 | 3300025905 | Bacteria | 2024 |
| 226 | Ga0207645_10012204 | 3300025907 | Bacteria | 5835 |
| 227 | Ga0207643_10003801 | 3300025908 | Bacteria | 8118 |
| 228 | Ga0207643_10008726 | 3300025908 | Bacteria | 5438 |
| 229 | Ga0207707_10025790 | 3300025912 | Bacteria | 5140 |
| 230 | Ga0207695_10108612 | 3300025913 | Bacteria | 2758 |
| 231 | Ga0207671_10039228 | 3300025914 | Bacteria | 3507 |
| 232 | Ga0207671_10040164 | 3300025914 | Bacteria | 3463 |
| 233 | Ga0207693_10000660 | 3300025915 | Bacteria | 30957 |
| 234 | Ga0207693_10006124 | 3300025915 | Bacteria | 9969 |
| 235 | Ga0207663_10009121 | 3300025916 | Bacteria | 5230 |
| 236 | Ga0207662_10015525 | 3300025918 | Bacteria | 4285 |
| 237 | Ga0207657_10005196 | 3300025919 | Bacteria | 13648 |
| 238 | Ga0207657_10033559 | 3300025919 | Bacteria | 4625 |
| 239 | Ga0207657_10051157 | 3300025919 | Bacteria | 3591 |
| 240 | Ga0207657_10090275 | 3300025919 | Bacteria | 2557 |
| 241 | Ga0207681_10002764 | 3300025923 | Bacteria | 11101 |
| 242 | Ga0207650_10122133 | 3300025925 | Bacteria | 2029 |
| 243 | Ga0207659_10011879 | 3300025926 | Bacteria | 5516 |
| 244 | Ga0207659_10021377 | 3300025926 | Bacteria | 4294 |
| 245 | Ga0207687_10002929 | 3300025927 | Bacteria | 11592 |
| 246 | Ga0207687_10031545 | 3300025927 | Bacteria | 3582 |
| 247 | Ga0207664_10003887 | 3300025929 | Bacteria | 10037 |
| 248 | Ga0207664_10012443 | 3300025929 | Bacteria | 6083 |
| 249 | Ga0207644_10001206 | 3300025931 | Bacteria | 16653 |
| 250 | Ga0207644_10130833 | 3300025931 | Bacteria | 1921 |
| 251 | Ga0207690_10027585 | 3300025932 | Bacteria | 3590 |
| 252 | Ga0207706_10030916 | 3300025933 | Bacteria | 4775 |
| 253 | Ga0207706_10043240 | 3300025933 | Bacteria | 3993 |
| 254 | Ga0207686_10019544 | 3300025934 | Bacteria | 3856 |
| 255 | Ga0207709_10000403 | 3300025935 | Bacteria | 42327 |
| 256 | Ga0207709_10002099 | 3300025935 | Bacteria | 12841 |
| 257 | Ga0207670_10078589 | 3300025936 | Bacteria | 2301 |
| 258 | Ga0207669_10000218 | 3300025937 | Bacteria | 26144 |
| 259 | Ga0207669_10012363 | 3300025937 | Bacteria | 4194 |
| 260 | Ga0207704_10000179 | 3300025938 | Bacteria | 33399 |
| 261 | Ga0207665_10001092 | 3300025939 | Bacteria | 18256 |
| 262 | Ga0207665_10022418 | 3300025939 | Bacteria | 4154 |
| 263 | Ga0207691_10114480 | 3300025940 | Bacteria | 2396 |
| 264 | Ga0207711_10000537 | 3300025941 | Bacteria | 38776 |
| 265 | Ga0207711_10000984 | 3300025941 | Bacteria | 27321 |
| 266 | Ga0207711_10052620 | 3300025941 | Bacteria | 3490 |
| 267 | Ga0207689_10005136 | 3300025942 | Bacteria | 11771 |
| 268 | Ga0207689_10007350 | 3300025942 | Bacteria | 9661 |
| 269 | Ga0207689_10078010 | 3300025942 | Bacteria | 2722 |
| 270 | Ga0207661_10000336 | 3300025944 | Bacteria | 29965 |
| 271 | Ga0207661_10007063 | 3300025944 | Bacteria | 7970 |
| 272 | Ga0207667_10048085 | 3300025949 | Bacteria | 4512 |
| 273 | Ga0207712_10000029 | 3300025961 | Bacteria | 220014 |
| 274 | Ga0207712_10007142 | 3300025961 | Bacteria | 7045 |
| 275 | Ga0207712_10011992 | 3300025961 | Bacteria | 5530 |
| 276 | Ga0207712_10112856 | 3300025961 | Bacteria | 2042 |
| 277 | Ga0207668_10021344 | 3300025972 | Bacteria | 4129 |
| 278 | Ga0207668_10023553 | 3300025972 | Bacteria | 3960 |
| 279 | Ga0207668_10030405 | 3300025972 | Bacteria | 3549 |
| 280 | Ga0207668_10031722 | 3300025972 | Bacteria | 3484 |
| 281 | Ga0207668_10039325 | 3300025972 | Bacteria | 3183 |
| 282 | Ga0207668_10066456 | 3300025972 | Bacteria | 2556 |
| 283 | Ga0207640_10011928 | 3300025981 | Bacteria | 4936 |
| 284 | Ga0207640_10025372 | 3300025981 | Bacteria | 3587 |
| 285 | Ga0207658_10000113 | 3300025986 | Bacteria | 88960 |
| 286 | Ga0207658_10005096 | 3300025986 | Bacteria | 9041 |
| 287 | Ga0207658_10005645 | 3300025986 | Bacteria | 8564 |
| 288 | Ga0207658_10007864 | 3300025986 | Bacteria | 7261 |
| 289 | Ga0207658_10049078 | 3300025986 | Bacteria | 3100 |
| 290 | Ga0207677_10003639 | 3300026023 | Bacteria | 8177 |
| 291 | Ga0207703_10000007 | 3300026035 | Bacteria | 418220 |
| 292 | Ga0207703_10002619 | 3300026035 | Bacteria | 15524 |
| 293 | Ga0207703_10018063 | 3300026035 | Bacteria | 5508 |
| 294 | Ga0207703_10108834 | 3300026035 | Bacteria | 2361 |
| 295 | Ga0207639_10002773 | 3300026041 | Bacteria | 11772 |
| 296 | Ga0207639_10006160 | 3300026041 | Bacteria | 8142 |
| 297 | Ga0207639_10017635 | 3300026041 | Bacteria | 5063 |
| 298 | Ga0207678_10001699 | 3300026067 | Bacteria | 20192 |
| 299 | Ga0207678_10001762 | 3300026067 | Bacteria | 19813 |
| 300 | Ga0207678_10016730 | 3300026067 | Bacteria | 6441 |
| 301 | Ga0207678_10032838 | 3300026067 | Bacteria | 4523 |
| 302 | Ga0207678_10120046 | 3300026067 | Bacteria | 2243 |
| 303 | Ga0207678_10152661 | 3300026067 | Bacteria | 1972 |
| 304 | Ga0207708_10000011 | 3300026075 | Bacteria | 214227 |
| 305 | Ga0207708_10000787 | 3300026075 | Bacteria | 23921 |
| 306 | Ga0207708_10015233 | 3300026075 | Bacteria | 5765 |
| 307 | Ga0207708_10019442 | 3300026075 | Bacteria | 5120 |
| 308 | Ga0207708_10023482 | 3300026075 | Bacteria | 4662 |
| 309 | Ga0207702_10006673 | 3300026078 | Bacteria | 9922 |
| 310 | Ga0207702_10012393 | 3300026078 | Bacteria | 7100 |
| 311 | Ga0207641_10001078 | 3300026088 | Bacteria | 27457 |
| 312 | Ga0207641_10003451 | 3300026088 | Bacteria | 13997 |
| 313 | Ga0207641_10007179 | 3300026088 | Bacteria | 9289 |
| 314 | Ga0207641_10036367 | 3300026088 | Bacteria | 4110 |
| 315 | Ga0207641_10199888 | 3300026088 | Bacteria | 1842 |
| 316 | Ga0207648_10001756 | 3300026089 | Bacteria | 23738 |
| 317 | Ga0207676_10000648 | 3300026095 | Bacteria | 27886 |
| 318 | Ga0207676_10040766 | 3300026095 | Bacteria | 3560 |
| 319 | Ga0207674_10087561 | 3300026116 | Bacteria | 3108 |
| 320 | Ga0207675_100012899 | 3300026118 | Bacteria | 7804 |
| 321 | Ga0207675_100013553 | 3300026118 | Bacteria | 7608 |
| 322 | Ga0207675_100025670 | 3300026118 | Bacteria | 5483 |
| 323 | Ga0207675_100054188 | 3300026118 | Bacteria | 3741 |
| 324 | Ga0207683_10000990 | 3300026121 | Bacteria | 26040 |
| 325 | Ga0207683_10010775 | 3300026121 | Bacteria | 7796 |
| 326 | Ga0207698_10082103 | 3300026142 | Bacteria | 2604 |
| 327 | Ga0207428_10003435 | 3300027907 | Bacteria | 15399 |
| 328 | Ga0268266_10009419 | 3300028379 | Bacteria | 8602 |
| 329 | Ga0268266_10077071 | 3300028379 | Bacteria | 2898 |
| 330 | Ga0268265_10000040 | 3300028380 | Bacteria | 194156 |
| 331 | Ga0268265_10089979 | 3300028380 | Bacteria | 2450 |
| 332 | Ga0268264_10000017 | 3300028381 | Bacteria | 498037 |
| 333 | Ga0268264_10001011 | 3300028381 | Bacteria | 28540 |
| 334 | Ga0268264_10002402 | 3300028381 | Bacteria | 16495 |
| 335 | Ga0268264_10012556 | 3300028381 | Bacteria | 6977 |
| 336 | Ga0268264_10025689 | 3300028381 | Bacteria | 4811 |
| 337 | Ga0307515_10076325 | 3300028794 | Bacteria | 4448 |
| 338 | Ga0307515_10181759 | 3300028794 | Bacteria | 2050 |
| 339 | Ga0307511_10004169 | 3300030521 | Bacteria | 14748 |
| 340 | Ga0265327_10000001 | 3300031251 | Bacteria | 894475 |
| 341 | Ga0265327_10000246 | 3300031251 | Bacteria | 107698 |
| 342 | Ga0265327_10004008 | 3300031251 | Bacteria | 13407 |
| 343 | Ga0265327_10007848 | 3300031251 | Bacteria | 8120 |
| 344 | Ga0307513_10013872 | 3300031456 | Bacteria | 9876 |
| 345 | Ga0307513_10015902 | 3300031456 | Bacteria | 9100 |
| 346 | Ga0307513_10030020 | 3300031456 | Bacteria | 6182 |
| 347 | Ga0307513_10194970 | 3300031456 | Bacteria | 1873 |
| 348 | Ga0307509_10128169 | 3300031507 | Bacteria | 2499 |
| 349 | Ga0316576_10062456 | 3300031727 | Bacteria | 2732 |
| 350 | Ga0316578_10073153 | 3300031728 | Bacteria | 2031 |
| 351 | Ga0307413_10013873 | 3300031824 | Bacteria | 4072 |
| 352 | Ga0307413_10035375 | 3300031824 | Bacteria | 2864 |
| 353 | Ga0307413_10060523 | 3300031824 | Bacteria | 2332 |
| 354 | Ga0307518_10001174 | 3300031838 | Bacteria | 19654 |
| 355 | Ga0307406_10002217 | 3300031901 | Bacteria | 10578 |
| 356 | Ga0307406_10039914 | 3300031901 | Bacteria | 2915 |
| 357 | Ga0307406_10049904 | 3300031901 | Bacteria | 2650 |
| 358 | Ga0307407_10035838 | 3300031903 | Bacteria | 2729 |
| 359 | Ga0307409_100125553 | 3300031995 | Bacteria | 2182 |
| 360 | Ga0307414_10005384 | 3300032004 | Bacteria | 7047 |
| 361 | Ga0307414_10087370 | 3300032004 | Bacteria | 2304 |
| 362 | Ga0307411_10053252 | 3300032005 | Bacteria | 2650 |
| 363 | Ga0307507_10032585 | 3300033179 | Bacteria | 5435 |
| 364 | Ga0307507_10055053 | 3300033179 | Bacteria | 3775 |
| 365 | Ga0307507_10069783 | 3300033179 | Bacteria | 3194 |
| 366 | Ga0373929_0008480 | 3300035085 | Bacteria | 1895 |
| 367 | Ga0373932_0002256 | 3300035112 | Bacteria | 4929 |
| 368 | Ga0373939_0007946 | 3300035114 | Bacteria | 2590 |
| 369 | Ga0373956_0008848 | 3300035119 | Bacteria | 4079 |
| 370 | Ga0373931_0005726 | 3300035691 | Bacteria | 5774 |
| 371 | Ga0373935_0013072 | 3300035692 | Bacteria | 5005 |
| 372 | Ga0316584_0029064 | 3300036712 | Bacteria | 4080 |
| 373 | Ga0395898_0073122 | 3300037466 | Bacteria | 3311 |
| 374 | Ga0436364_0027535 | 3300037853 | Bacteria | 18218 |
| 375 | Ga0436364_0176067 | 3300037853 | Bacteria | 29049 |
| 376 | Ga0436364_0199133 | 3300037853 | Bacteria | 11894 |
| 377 | Ga0436364_0588322 | 3300037853 | Bacteria | 80195 |
| 378 | Ga0436364_1272092 | 3300037853 | Bacteria | 3454 |
| 379 | Ga0436364_1442134 | 3300037853 | Bacteria | 6633 |
| 380 | Ga0395901_0049692 | 3300038443 | Bacteria | 4358 |
| 381 | Ga0436365_0469598 | 3300039437 | Bacteria | 28546 |
| 382 | Ga0436365_1752709 | 3300039437 | Bacteria | 4445 |
| 383 | Ga0436365_1937384 | 3300039437 | Bacteria | 8653 |
| 384 | Ga0436362_1138695 | 3300039453 | Bacteria | 75889 |
| 385 | Ga0439466_0013297 | 3300041411 | Bacteria | 3013 |
| 386 | Ga0439466_0021325 | 3300041411 | Bacteria | 2298 |
| 387 | Ga0439465_0000494 | 3300041413 | Bacteria | 11749 |
| 388 | Ga0439465_0014233 | 3300041413 | Bacteria | 2479 |
| 389 | Ga0439465_0014375 | 3300041413 | Bacteria | 2466 |
| 390 | Ga0439442_002799 | 3300042002 | Bacteria | 3428 |
| 391 | Ga0439463_010926 | 3300042016 | Bacteria | 2230 |
| 392 | Ga0466969_0005292 | 3300044656 | Bacteria | 6865 |
| 393 | Ga0466969_0046570 | 3300044656 | Bacteria | 2150 |
| 394 | Ga0466972_0004319 | 3300044658 | Bacteria | 7102 |
| 395 | Ga0466972_0027626 | 3300044658 | Bacteria | 2807 |
| 396 | Ga0466972_0029218 | 3300044658 | Bacteria | 2714 |
| 397 | Ga0466965_0000275 | 3300044683 | Bacteria | 16932 |
| 398 | Ga0466965_0004062 | 3300044683 | Bacteria | 6492 |
| 399 | Ga0466965_0007407 | 3300044683 | Bacteria | 5036 |
| 400 | Ga0466965_0017991 | 3300044683 | Bacteria | 3382 |
| 401 | Ga0466965_0028032 | 3300044683 | Bacteria | 2734 |
| 402 | Ga0466966_0000383 | 3300044684 | Bacteria | 28757 |
| 403 | Ga0466966_0002032 | 3300044684 | Bacteria | 13139 |
| 404 | Ga0466966_0008971 | 3300044684 | Bacteria | 6627 |
| 405 | Ga0466966_0012074 | 3300044684 | Bacteria | 5723 |
| 406 | Ga0466966_0021938 | 3300044684 | Bacteria | 4192 |
| 407 | Ga0466961_0015417 | 3300044693 | Bacteria | 4906 |
| 408 | Ga0466961_0025106 | 3300044693 | Bacteria | 3835 |
| 409 | Ga0466961_0034187 | 3300044693 | Bacteria | 3264 |
| 410 | Ga0466963_0002388 | 3300044694 | Bacteria | 10498 |
| 411 | Ga0466963_0021084 | 3300044694 | Bacteria | 4106 |
| 412 | Ga0466963_0099438 | 3300044694 | Bacteria | 1990 |
| 413 | Ga0466971_0007997 | 3300044719 | Bacteria | 4610 |
| 414 | Ga0466971_0013303 | 3300044719 | Bacteria | 3613 |
| 415 | Ga0466968_0000430 | 3300044735 | Bacteria | 14028 |
| 416 | Ga0466970_0004625 | 3300044765 | Bacteria | 6790 |
| 417 | Ga0466970_0005929 | 3300044765 | Bacteria | 6091 |
| 418 | Ga0466970_0013380 | 3300044765 | Bacteria | 4206 |
| 419 | Ga0466970_0031333 | 3300044765 | Bacteria | 2809 |
| 420 | Ga0466957_0002803 | 3300044842 | Bacteria | 9429 |
| 421 | Ga0466957_0003491 | 3300044842 | Bacteria | 8636 |
| 422 | Ga0466957_0004855 | 3300044842 | Bacteria | 7523 |
| 423 | Ga0466957_0021211 | 3300044842 | Bacteria | 3827 |
| 424 | Ga0466957_0090270 | 3300044842 | Bacteria | 1919 |
| 425 | Ga0466960_0000814 | 3300044901 | Bacteria | 10975 |
| 426 | Ga0466960_0004932 | 3300044901 | Bacteria | 5250 |
| 427 | Ga0466960_0034982 | 3300044901 | Bacteria | 2344 |
| 428 | Ga0466959_0003979 | 3300045049 | Bacteria | 9821 |
| 429 | Ga0466959_0043527 | 3300045049 | Bacteria | 3309 |
| 430 | Ga0466959_0046062 | 3300045049 | Bacteria | 3210 |
| 431 | Ga0466959_0082318 | 3300045049 | Bacteria | 2318 |
| 432 | Ga0466958_0000206 | 3300045836 | Bacteria | 21886 |
| 433 | Ga0466958_0021001 | 3300045836 | Bacteria | 3812 |
| 434 | Ga0466958_0039218 | 3300045836 | Bacteria | 2845 |
| 435 | Ga0466967_0000826 | 3300045976 | Bacteria | 16303 |
| 436 | Ga0466967_0000939 | 3300045976 | Bacteria | 15697 |
| 437 | Ga0466967_0010955 | 3300045976 | Bacteria | 6835 |
| 438 | Ga0466967_0011444 | 3300045976 | Bacteria | 6720 |
| 439 | Ga0466967_0013978 | 3300045976 | Bacteria | 6231 |
| 440 | Ga0466967_0033305 | 3300045976 | Bacteria | 4360 |
| 441 | Ga0466967_0041422 | 3300045976 | Bacteria | 3971 |
| 442 | Ga0466967_0041684 | 3300045976 | Bacteria | 3961 |
| 443 | Ga0466967_0042430 | 3300045976 | Bacteria | 3931 |
| 444 | Ga0466967_0057635 | 3300045976 | Bacteria | 3430 |
| 445 | Ga0466967_0064898 | 3300045976 | Bacteria | 3248 |
| 446 | Ga0466967_0104156 | 3300045976 | Bacteria | 2597 |
| 447 | Ga0466967_0119455 | 3300045976 | Bacteria | 2433 |
| 448 | Ga0495638_0014115 | 3300046460 | Bacteria | 5410 |
| 449 | Ga0495607_0070804 | 3300046501 | Bacteria | 1947 |
| 450 | Ga0495645_0016336 | 3300046543 | Bacteria | 5297 |
| 451 | Ga0495645_0120103 | 3300046543 | Bacteria | 1851 |
| 452 | Ga0495668_0000416 | 3300046616 | Bacteria | 55560 |
| 453 | Ga0495672_0014117 | 3300047320 | Bacteria | 5480 |
| 454 | Ga0495680_0120966 | 3300047322 | Bacteria | 1933 |
| 455 | Ga0495683_0001820 | 3300047323 | Bacteria | 13415 |
| 456 | Ga0495673_0009180 | 3300047469 | Bacteria | 5489 |
| 457 | Ga0495686_0020947 | 3300047472 | Bacteria | 4353 |
| 458 | Ga0495593_0012739 | 3300047673 | Bacteria | 4801 |
| 459 | Ga0496100_0000349 | 3300048903 | Bacteria | 22460 |
| 460 | Ga0496100_0001640 | 3300048903 | Bacteria | 11082 |
| 461 | Ga0496100_0002069 | 3300048903 | Bacteria | 10081 |
| 462 | Ga0496100_0002259 | 3300048903 | Bacteria | 9734 |
| 463 | Ga0496100_0004837 | 3300048903 | Bacteria | 7194 |
| 464 | Ga0496101_0000032 | 3300048904 | Bacteria | 186783 |
| 465 | Ga0496101_0000395 | 3300048904 | Bacteria | 28467 |
| 466 | Ga0496101_0002865 | 3300048904 | Bacteria | 10603 |
| 467 | Ga0496101_0004338 | 3300048904 | Bacteria | 8900 |
| 468 | Ga0496101_0009675 | 3300048904 | Bacteria | 6342 |
| 469 | Ga0496102_0000011 | 3300048905 | Bacteria | 321716 |
| 470 | Ga0496102_0000023 | 3300048905 | Bacteria | 237015 |
| 471 | Ga0496102_0000197 | 3300048905 | Bacteria | 81788 |
| 472 | Ga0496102_0000574 | 3300048905 | Bacteria | 39023 |
| 473 | Ga0496102_0000843 | 3300048905 | Bacteria | 29444 |
| 474 | Ga0496102_0002308 | 3300048905 | Bacteria | 16298 |
| 475 | Ga0496102_0006976 | 3300048905 | Bacteria | 9638 |
| 476 | Ga0496102_0018773 | 3300048905 | Bacteria | 6082 |
| 477 | Ga0496102_0018834 | 3300048905 | Bacteria | 6072 |
| 478 | Ga0496102_0069154 | 3300048905 | Bacteria | 3241 |
| 479 | Ga0496102_0071876 | 3300048905 | Bacteria | 3177 |
| 480 | Ga0496102_0142337 | 3300048905 | Bacteria | 2249 |
| 481 | Ga0496103_0000380 | 3300048906 | Bacteria | 39723 |
| 482 | Ga0496103_0000431 | 3300048906 | Bacteria | 36468 |
| 483 | Ga0496103_0000601 | 3300048906 | Bacteria | 28248 |
| 484 | Ga0496103_0001721 | 3300048906 | Bacteria | 14296 |
| 485 | Ga0496103_0002336 | 3300048906 | Bacteria | 11987 |
| 486 | Ga0496103_0002956 | 3300048906 | Bacteria | 10534 |
| 487 | Ga0496103_0004680 | 3300048906 | Bacteria | 8281 |
| 488 | Ga0496104_0006108 | 3300048907 | Bacteria | 10574 |
| 489 | Ga0496104_0067546 | 3300048907 | Bacteria | 3396 |
| 490 | Ga0496105_0001822 | 3300048908 | Bacteria | 15267 |
| 491 | Ga0496105_0007333 | 3300048908 | Bacteria | 8523 |
| 492 | Ga0496105_0007729 | 3300048908 | Bacteria | 8342 |
| 493 | Ga0496105_0012058 | 3300048908 | Bacteria | 6842 |
| 494 | Ga0496105_0022610 | 3300048908 | Bacteria | 5093 |
| 495 | Ga0496105_0113769 | 3300048908 | Bacteria | 2232 |
| 496 | Ga0496106_0001288 | 3300048909 | Bacteria | 18824 |
| 497 | Ga0496106_0002693 | 3300048909 | Bacteria | 13194 |
| 498 | Ga0496106_0004909 | 3300048909 | Bacteria | 9897 |
| 499 | Ga0496106_0009349 | 3300048909 | Bacteria | 7246 |
| 500 | Ga0496106_0016797 | 3300048909 | Bacteria | 5415 |
| 501 | Ga0496106_0076602 | 3300048909 | Bacteria | 2564 |
| 502 | Ga0496107_0000825 | 3300048910 | Bacteria | 18053 |
| 503 | Ga0496107_0002530 | 3300048910 | Bacteria | 11903 |
| 504 | Ga0496107_0007236 | 3300048910 | Bacteria | 7647 |
| 505 | Ga0496107_0014387 | 3300048910 | Bacteria | 5541 |
| 506 | Ga0496107_0058117 | 3300048910 | Bacteria | 2796 |
| 507 | Ga0496108_0001112 | 3300048911 | Bacteria | 21027 |
| 508 | Ga0496108_0003052 | 3300048911 | Bacteria | 13459 |
| 509 | Ga0496108_0003096 | 3300048911 | Bacteria | 13370 |
| 510 | Ga0496108_0008237 | 3300048911 | Bacteria | 8460 |
| 511 | Ga0496108_0029168 | 3300048911 | Bacteria | 4568 |
| 512 | Ga0496108_0051738 | 3300048911 | Bacteria | 3441 |
| 513 | Ga0496109_0000030 | 3300048912 | Bacteria | 164120 |
| 514 | Ga0496109_0004746 | 3300048912 | Bacteria | 11362 |
| 515 | Ga0496109_0011438 | 3300048912 | Bacteria | 7630 |
| 516 | Ga0496109_0017265 | 3300048912 | Bacteria | 6323 |
| 517 | Ga0496109_0028087 | 3300048912 | Bacteria | 5030 |
| 518 | Ga0496109_0051500 | 3300048912 | Bacteria | 3750 |
| 519 | Ga0496109_0062928 | 3300048912 | Bacteria | 3393 |
| 520 | Ga0496109_0244742 | 3300048912 | Bacteria | 1688 |
| 521 | Ga0496110_0011169 | 3300048913 | Bacteria | 7340 |
| 522 | Ga0496110_0014954 | 3300048913 | Bacteria | 6452 |
| 523 | Ga0496110_0015646 | 3300048913 | Bacteria | 6319 |
| 524 | Ga0496110_0023908 | 3300048913 | Bacteria | 5203 |
| 525 | Ga0496110_0036623 | 3300048913 | Bacteria | 4261 |
| 526 | Ga0496111_0000966 | 3300048914 | Bacteria | 15698 |
| 527 | Ga0496111_0008352 | 3300048914 | Bacteria | 6846 |
| 528 | Ga0496111_0068076 | 3300048914 | Bacteria | 2587 |
| 529 | Ga0496111_0074693 | 3300048914 | Bacteria | 2469 |
| 530 | Ga0496112_0019350 | 3300048915 | Bacteria | 6425 |
| 531 | Ga0496112_0073110 | 3300048915 | Bacteria | 3389 |
| 532 | Ga0496112_0127879 | 3300048915 | Bacteria | 2511 |
| 533 | Ga0496113_0003716 | 3300048916 | Bacteria | 9201 |
| 534 | Ga0496113_0010464 | 3300048916 | Bacteria | 6133 |
| 535 | Ga0496113_0026461 | 3300048916 | Bacteria | 4148 |
| 536 | Ga0496113_0037112 | 3300048916 | Bacteria | 3574 |
| 537 | Ga0496113_0047728 | 3300048916 | Bacteria | 3183 |
| 538 | Ga0496114_0000312 | 3300048917 | Bacteria | 35518 |
| 539 | Ga0496114_0003137 | 3300048917 | Bacteria | 12682 |
| 540 | Ga0496114_0033633 | 3300048917 | Bacteria | 4225 |
| 541 | Ga0496114_0083411 | 3300048917 | Bacteria | 2704 |
| 542 | Ga0496115_0006543 | 3300048918 | Bacteria | 8541 |
| 543 | Ga0496115_0016805 | 3300048918 | Bacteria | 5578 |
| 544 | Ga0496115_0032165 | 3300048918 | Bacteria | 4138 |
| 545 | Ga0496115_0095828 | 3300048918 | Bacteria | 2429 |
| 546 | Ga0496116_0000072 | 3300048919 | Bacteria | 238158 |
| 547 | Ga0496116_0000183 | 3300048919 | Bacteria | 124744 |
| 548 | Ga0496116_0005015 | 3300048919 | Bacteria | 12469 |
| 549 | Ga0496117_0000039 | 3300048920 | Bacteria | 322143 |
| 550 | Ga0496117_0000059 | 3300048920 | Bacteria | 260163 |
| 551 | Ga0496117_0000160 | 3300048920 | Bacteria | 141709 |
| 552 | Ga0496117_0001520 | 3300048920 | Bacteria | 33158 |
| 553 | Ga0496117_0008919 | 3300048920 | Bacteria | 9444 |
| 554 | Ga0496118_0000035 | 3300048921 | Bacteria | 322143 |
| 555 | Ga0496118_0000391 | 3300048921 | Bacteria | 74169 |
| 556 | Ga0496118_0001225 | 3300048921 | Bacteria | 39433 |
| 557 | Ga0496118_0001938 | 3300048921 | Bacteria | 29323 |
| 558 | Ga0496118_0002342 | 3300048921 | Bacteria | 25692 |
| 559 | Ga0496118_0008772 | 3300048921 | Bacteria | 10365 |
| 560 | Ga0496118_0011076 | 3300048921 | Bacteria | 8852 |
| 561 | Ga0496118_0041278 | 3300048921 | Bacteria | 3655 |
| 562 | Ga0496119_0000091 | 3300048922 | Bacteria | 133090 |
| 563 | Ga0496119_0000517 | 3300048922 | Bacteria | 52595 |
| 564 | Ga0496119_0000955 | 3300048922 | Bacteria | 37211 |
| 565 | Ga0496119_0002122 | 3300048922 | Bacteria | 22313 |
| 566 | Ga0496119_0009193 | 3300048922 | Bacteria | 8530 |
| 567 | Ga0496120_0000631 | 3300048923 | Bacteria | 52495 |
| 568 | Ga0496120_0003122 | 3300048923 | Bacteria | 15534 |
| 569 | Ga0496120_0004323 | 3300048923 | Bacteria | 12017 |
| 570 | Ga0496120_0029527 | 3300048923 | Bacteria | 3346 |
| 571 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 572 | Ga0496121_0002639 | 3300048924 | Bacteria | 26992 |
| 573 | Ga0496121_0009366 | 3300048924 | Bacteria | 11279 |
| 574 | Ga0496122_0000173 | 3300048925 | Bacteria | 153768 |
| 575 | Ga0496122_0035996 | 3300048925 | Bacteria | 4014 |
| 576 | Ga0496123_0000112 | 3300048926 | Bacteria | 163990 |
| 577 | Ga0496123_0029542 | 3300048926 | Bacteria | 4031 |
| 578 | Ga0496123_0045539 | 3300048926 | Bacteria | 2987 |
| 579 | Ga0496124_0000012 | 3300048927 | Bacteria | 512581 |
| 580 | Ga0496124_0000198 | 3300048927 | Bacteria | 119277 |
| 581 | Ga0496124_0001981 | 3300048927 | Bacteria | 27911 |
| 582 | Ga0496124_0014868 | 3300048927 | Bacteria | 7498 |
| 583 | Ga0496124_0085754 | 3300048927 | Bacteria | 2579 |
| 584 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 585 | Ga0496125_0004177 | 3300048928 | Bacteria | 16833 |
| 586 | Ga0496125_0008481 | 3300048928 | Bacteria | 10755 |
| 587 | Ga0496125_0016337 | 3300048928 | Bacteria | 7132 |
| 588 | Ga0496125_0039512 | 3300048928 | Bacteria | 4060 |
| 589 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 590 | Ga0496126_0000003 | 3300048929 | Bacteria | 961576 |
| 591 | Ga0496126_0001443 | 3300048929 | Bacteria | 37279 |
| 592 | Ga0496126_0002899 | 3300048929 | Bacteria | 22357 |
| 593 | Ga0496126_0003942 | 3300048929 | Bacteria | 18162 |
| 594 | Ga0496126_0047978 | 3300048929 | Bacteria | 3907 |
| 595 | Ga0496126_0084227 | 3300048929 | Bacteria | 2804 |
| 596 | Ga0501032_0004394 | 3300049569 | Bacteria | 10643 |
| 597 | Ga0501032_0011902 | 3300049569 | Bacteria | 6231 |
| 598 | Ga0501032_0020513 | 3300049569 | Bacteria | 4601 |
| 599 | Ga0501033_0023356 | 3300049570 | Bacteria | 4664 |
| 600 | Ga0501034_0006718 | 3300049571 | Bacteria | 12334 |
| 601 | Ga0501034_0032801 | 3300049571 | Bacteria | 5273 |
| 602 | Ga0501034_0042485 | 3300049571 | Bacteria | 4602 |
| 603 | Ga0501036_0009567 | 3300049572 | Bacteria | 7973 |
| 604 | Ga0501036_0057046 | 3300049572 | Bacteria | 3308 |
| 605 | Ga0501037_0000472 | 3300049573 | Bacteria | 32649 |
| 606 | Ga0501038_0021465 | 3300049574 | Bacteria | 5795 |
| 607 | Ga0501038_0022457 | 3300049574 | Bacteria | 5653 |
| 608 | Ga0501038_0050901 | 3300049574 | Bacteria | 3577 |
| 609 | Ga0501039_0026706 | 3300049575 | Bacteria | 4437 |
| 610 | Ga0501042_0013571 | 3300049578 | Bacteria | 5546 |
| 611 | Ga0501043_0009851 | 3300049579 | Bacteria | 7492 |
| 612 | Ga0501043_0010216 | 3300049579 | Bacteria | 7358 |
| 613 | Ga0501046_0002992 | 3300049580 | Bacteria | 15622 |
| 614 | Ga0501046_0030155 | 3300049580 | Bacteria | 4403 |
| 615 | Ga0501047_0016518 | 3300049581 | Bacteria | 7046 |
| 616 | Ga0501047_0030201 | 3300049581 | Bacteria | 5226 |
| 617 | Ga0501047_0090558 | 3300049581 | Bacteria | 2936 |
| 618 | Ga0501070_0001241 | 3300049586 | Bacteria | 22855 |
| 619 | Ga0501070_0014359 | 3300049586 | Bacteria | 6665 |
| 620 | Ga0501070_0070490 | 3300049586 | Bacteria | 2894 |
| 621 | Ga0501073_0024507 | 3300049589 | Bacteria | 4332 |
| 622 | Ga0501083_0000096 | 3300049744 | Bacteria | 59671 |
| 623 | Ga0501035_0001109 | 3300049822 | Bacteria | 28210 |
| 624 | Ga0501035_0016404 | 3300049822 | Bacteria | 6832 |
| 625 | Ga0501035_0125425 | 3300049822 | Bacteria | 2241 |
| 626 | Ga0501044_0000797 | 3300049823 | Bacteria | 38010 |
| 627 | Ga0501044_0002911 | 3300049823 | Bacteria | 19485 |
| 628 | Ga0501044_0015830 | 3300049823 | Bacteria | 8115 |
| 629 | Ga0501044_0018439 | 3300049823 | Bacteria | 7477 |
| 630 | Ga0501044_0025322 | 3300049823 | Bacteria | 6288 |
| 631 | Ga0501044_0075399 | 3300049823 | Bacteria | 3425 |
| 632 | nmdc:mga03683_26362_c1 | 3300050489 | Bacteria | 2292 |
| 633 | nmdc:mga03683_41148_c1 | 3300050489 | Bacteria | 1898 |
| 634 | nmdc:mga03n38_22049_c1 | 3300050490 | Bacteria | 2572 |
| 635 | nmdc:mga03n38_25115_c1 | 3300050490 | Bacteria | 2443 |
| 636 | nmdc:mga03n38_36106_c1 | 3300050490 | Bacteria | 2123 |
| 637 | nmdc:mga00v17_11207_c1 | 3300050491 | Bacteria | 4923 |
| 638 | nmdc:mga00v17_13555_c2 | 3300050491 | Bacteria | 3608 |
| 639 | nmdc:mga00v17_18058_c1 | 3300050491 | Bacteria | 4004 |
| 640 | nmdc:mga00v17_27447_c1 | 3300050491 | Bacteria | 3324 |
| 641 | nmdc:mga00v17_3655_c1 | 3300050491 | Bacteria | 7947 |
| 642 | nmdc:mga00v17_9321_c1 | 3300050491 | Bacteria | 5309 |
| 643 | nmdc:mga0yw44_1098_c1 | 3300050492 | Bacteria | 10401 |
| 644 | nmdc:mga0yw44_11042_c1 | 3300050492 | Bacteria | 4640 |
| 645 | nmdc:mga0yw44_12878_c1 | 3300050492 | Bacteria | 4379 |
| 646 | nmdc:mga0yw44_2411_c1 | 3300050492 | Bacteria | 7956 |
| 647 | nmdc:mga0yw44_64387_c1 | 3300050492 | Bacteria | 2256 |
| 648 | nmdc:mga04h51_18621_c1 | 3300050495 | Bacteria | 2047 |
| 649 | nmdc:mga07m45_10742_c2 | 3300050496 | Bacteria | 4177 |
| 650 | nmdc:mga07m45_41765_c1 | 3300050496 | Bacteria | 2569 |
| 651 | nmdc:mga05p37_26066_c1 | 3300050507 | Bacteria | 7108 |
| 652 | nmdc:mga05p37_57408_c1 | 3300050507 | Bacteria | 4795 |
| 653 | nmdc:mga05p37_90130_c1 | 3300050507 | Bacteria | 3779 |
| 654 | nmdc:mga0qj67_19159_c1 | 3300050509 | Bacteria | 5226 |
| 655 | nmdc:mga0qj67_625_c1 | 3300050509 | Bacteria | 24268 |
| 656 | nmdc:mga06r32_6912_c1 | 3300050510 | Bacteria | 10200 |
| 657 | nmdc:mga0n895_37484_c1 | 3300050512 | Bacteria | 4691 |
| 658 | nmdc:mga0n895_7764_c1 | 3300050512 | Bacteria | 9243 |
| 659 | nmdc:mga0rr50_3031_c1 | 3300050513 | Bacteria | 9611 |
| 660 | nmdc:mga0rr50_4305_c1 | 3300050513 | Bacteria | 8339 |
| 661 | nmdc:mga08x19_34101_c1 | 3300050514 | Bacteria | 3216 |
| 662 | nmdc:mga08x19_45646_c1 | 3300050514 | Bacteria | 2800 |
| 663 | nmdc:mga0a205_11234_c1 | 3300050515 | Bacteria | 8241 |
| 664 | nmdc:mga0a205_618_c1 | 3300050515 | Bacteria | 28265 |
| 665 | nmdc:mga0sz30_15725_c1 | 3300050516 | Bacteria | 2993 |
| 666 | nmdc:mga0sz30_2686_c1 | 3300050516 | Bacteria | 6338 |
| 667 | nmdc:mga0sz30_32252_c1 | 3300050516 | Bacteria | 2172 |
| 668 | Ga0500635_0002464 | 3300053080 | Bacteria | 4590 |
| 669 | Ga0500643_005081 | 3300053087 | Bacteria | 5752 |
| 670 | Ga0500643_013401 | 3300053087 | Bacteria | 2895 |
| 671 | Ga0500652_004008 | 3300053131 | Bacteria | 4510 |
| 672 | Ga0500616_0000775 | 3300053153 | Bacteria | 36758 |
| 673 | Ga0500616_0004319 | 3300053153 | Bacteria | 10188 |
| 674 | Ga0500616_0011037 | 3300053153 | Bacteria | 5375 |
| 675 | Ga0500645_000025 | 3300053730 | Bacteria | 125835 |
| 676 | Ga0466962_0002665 | 3300061719 | Bacteria | 8490 |
| 677 | Ga0466962_0008336 | 3300061719 | Bacteria | 4966 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005841 | Ga0068863_100122301 | Ga0068863_1001223012 | 496 |
| 2 | 3300046543 | Ga0495645_0120103 | Ga0495645_0120103_64_1707 | 502 |
| 3 | 3300031456 | Ga0307513_10194970 | Ga0307513_101949701 | 503 |
| 4 | 3300003792 | Ga0055540_1001171 | Ga0055540_100117115 | 504 |
| 5 | 3300048910 | Ga0496107_0002530 | Ga0496107_0002530_10369_11892 | 507 |
| 6 | 3300049574 | Ga0501038_0050901 | Ga0501038_0050901_103_1749 | 522 |
| 7 | 3300038443 | Ga0395901_0049692 | Ga0395901_0049692_691_2274 | 527 |
| 8 | 3300031824 | Ga0307413_10013873 | Ga0307413_100138732 | 528 |
| 9 | 3300031903 | Ga0307407_10035838 | Ga0307407_100358382 | 528 |
| 10 | 3300032004 | Ga0307414_10005384 | Ga0307414_100053846 | 528 |
| 11 | 3300005435 | Ga0070714_100005353 | Ga0070714_1000053535 | 529 |
| 12 | 3300005614 | Ga0068856_100031944 | Ga0068856_1000319444 | 529 |
| 13 | 3300006028 | Ga0070717_10075208 | Ga0070717_100752082 | 529 |
| 14 | 3300049578 | Ga0501042_0013571 | Ga0501042_0013571_2477_4126 | 529 |
| 15 | 3300049744 | Ga0501083_0000096 | Ga0501083_0000096_18768_20417 | 529 |
| 16 | 3300025246 | Ga0209646_1000013 | Ga0209646_100001375 | 532 |
| 17 | 3300031901 | Ga0307406_10002217 | Ga0307406_100022176 | 532 |
| 18 | 3300048920 | Ga0496117_0001520 | Ga0496117_0001520_26368_28008 | 532 |
| 19 | 3300048921 | Ga0496118_0011076 | Ga0496118_0011076_6846_8486 | 532 |
| 20 | 3300048928 | Ga0496125_0008481 | Ga0496125_0008481_1159_2799 | 532 |
| 21 | 3300048929 | Ga0496126_0047978 | Ga0496126_0047978_12_1652 | 532 |
| 22 | 3300049574 | Ga0501038_0021465 | Ga0501038_0021465_137_1777 | 532 |
| 23 | 3300048911 | Ga0496108_0001112 | Ga0496108_0001112_13223_14884 | 534 |
| 24 | 3300013308 | Ga0157375_10076209 | Ga0157375_100762094 | 537 |
| 25 | 3300045976 | Ga0466967_0041684 | Ga0466967_0041684_2219_3934 | 537 |
| 26 | iso_pu_bacteria | 2738541305 | 2738869968 | 537 |
| 27 | 3300046543 | Ga0495645_0016336 | Ga0495645_0016336_2228_3862 | 538 |
| 28 | 3300031456 | Ga0307513_10013872 | Ga0307513_100138724 | 539 |
| 29 | 3300044683 | Ga0466965_0017991 | Ga0466965_0017991_1674_3326 | 539 |
| 30 | iso_pu_bacteria | 2643221575 | 2643886288 | 540 |
| 31 | iso_pu_bacteria | 2818991462 | 2819690571 | 540 |
| 32 | iso_pu_bacteria | 2818991469 | 2819728116 | 540 |
| 33 | iso_pu_bacteria | 2643221597 | 2643995235 | 541 |
| 34 | iso_pu_bacteria | 2866612099 | 2866612691 | 541 |
| 35 | iso_pu_bacteria | 2870628048 | 2870630962 | 541 |
| 36 | 3300025919 | Ga0207657_10033559 | Ga0207657_100335591 | 542 |
| 37 | 3300031507 | Ga0307509_10128169 | Ga0307509_101281692 | 542 |
| 38 | 3300048928 | Ga0496125_0004177 | Ga0496125_0004177_383_2113 | 542 |
| 39 | 3300050489 | nmdc:mga03683_41148_c1 | nmdc:mga03683_41148_c1_255_1883 | 542 |
| 40 | 3300050516 | nmdc:mga0sz30_32252_c1 | nmdc:mga0sz30_32252_c1_528_2156 | 542 |
| 41 | iso_pu_bacteria | 2791354901 | 2791911658 | 542 |
| 42 | iso_pu_bacteria | 2919391150 | 2919395329 | 542 |
| 43 | iso_pu_bacteria | 2945956166 | 2945957329 | 542 |
| 44 | iso_pu_bacteria | 8002811521 | 8002813521 | 542 |
| 45 | 3300005435 | Ga0070714_100003715 | Ga0070714_1000037156 | 543 |
| 46 | 3300025929 | Ga0207664_10003887 | Ga0207664_100038876 | 543 |
| 47 | iso_pu_bacteria | 2643221613 | 2644080790 | 543 |
| 48 | iso_pu_bacteria | 2643221721 | 2644663893 | 543 |
| 49 | iso_pu_bacteria | 2690315906 | 2691512766 | 543 |
| 50 | iso_pu_bacteria | 2775506735 | 2775658513 | 543 |
| 51 | iso_pu_bacteria | 2808606357 | 2808830047 | 543 |
| 52 | iso_pu_bacteria | 2808606360 | 2808851222 | 543 |
| 53 | iso_pu_bacteria | 2808606366 | 2808876253 | 543 |
| 54 | iso_pu_bacteria | 2808606371 | 2808897756 | 543 |
| 55 | iso_pu_bacteria | 2811994871 | 2812318178 | 543 |
| 56 | iso_pu_bacteria | 2935890801 | 2935893825 | 543 |
| 57 | iso_pu_bacteria | 2939598168 | 2939599347 | 543 |
| 58 | iso_pu_bacteria | 2945916053 | 2945920279 | 543 |
| 59 | iso_pu_bacteria | 2945941187 | 2945944478 | 543 |
| 60 | iso_pu_bacteria | 2946059875 | 2946063996 | 543 |
| 61 | iso_pu_bacteria | 2974302888 | 2974303828 | 543 |
| 62 | 3300009545 | Ga0105237_10062552 | Ga0105237_100625522 | 544 |
| 63 | 3300010375 | Ga0105239_10030418 | Ga0105239_100304182 | 544 |
| 64 | 3300049571 | Ga0501034_0032801 | Ga0501034_0032801_3417_5072 | 544 |
| 65 | 3300049572 | Ga0501036_0057046 | Ga0501036_0057046_251_1906 | 544 |
| 66 | 3300049580 | Ga0501046_0030155 | Ga0501046_0030155_805_2460 | 544 |
| 67 | 3300049822 | Ga0501035_0125425 | Ga0501035_0125425_118_1773 | 544 |
| 68 | 3300049823 | Ga0501044_0018439 | Ga0501044_0018439_386_2041 | 544 |
| 69 | iso_pu_bacteria | 2585428157 | 2588109303 | 544 |
| 70 | iso_pu_bacteria | 2899359706 | 2899365985 | 544 |
| 71 | iso_pu_bacteria | 2915768154 | 2915768655 | 544 |
| 72 | iso_pu_bacteria | 2917736166 | 2917740946 | 544 |
| 73 | iso_pu_bacteria | 8003314358 | 8003319707 | 544 |
| 74 | 3300006048 | Ga0075363_100070037 | Ga0075363_1000700371 | 545 |
| 75 | 3300009148 | Ga0105243_10001024 | Ga0105243_1000102412 | 545 |
| 76 | 3300021358 | Ga0213873_10000029 | Ga0213873_1000002914 | 545 |
| 77 | 3300021388 | Ga0213875_10000107 | Ga0213875_1000010730 | 545 |
| 78 | 3300025933 | Ga0207706_10043240 | Ga0207706_100432404 | 545 |
| 79 | 3300025935 | Ga0207709_10000403 | Ga0207709_1000040325 | 545 |
| 80 | 3300026067 | Ga0207678_10016730 | Ga0207678_100167302 | 545 |
| 81 | 3300026067 | Ga0207678_10152661 | Ga0207678_101526611 | 545 |
| 82 | 3300031901 | Ga0307406_10049904 | Ga0307406_100499042 | 545 |
| 83 | 3300037853 | Ga0436364_0588322 | Ga0436364_0588322_53580_55229 | 545 |
| 84 | 3300039453 | Ga0436362_1138695 | Ga0436362_1138695_30223_31872 | 545 |
| 85 | 3300044684 | Ga0466966_0000383 | Ga0466966_0000383_9103_10752 | 545 |
| 86 | 3300044694 | Ga0466963_0002388 | Ga0466963_0002388_3551_5200 | 545 |
| 87 | 3300044735 | Ga0466968_0000430 | Ga0466968_0000430_3797_5446 | 545 |
| 88 | 3300044842 | Ga0466957_0004855 | Ga0466957_0004855_2142_3791 | 545 |
| 89 | 3300045049 | Ga0466959_0003979 | Ga0466959_0003979_4725_6374 | 545 |
| 90 | 3300045836 | Ga0466958_0000206 | Ga0466958_0000206_3859_5508 | 545 |
| 91 | 3300045976 | Ga0466967_0011444 | Ga0466967_0011444_4815_6464 | 545 |
| 92 | 3300046616 | Ga0495668_0000416 | Ga0495668_0000416_18872_20530 | 545 |
| 93 | 3300048909 | Ga0496106_0076602 | Ga0496106_0076602_432_2111 | 545 |
| 94 | 3300048921 | Ga0496118_0001938 | Ga0496118_0001938_16326_18023 | 545 |
| 95 | 3300048922 | Ga0496119_0002122 | Ga0496119_0002122_89_1747 | 545 |
| 96 | 3300048925 | Ga0496122_0035996 | Ga0496122_0035996_1831_3528 | 545 |
| 97 | 3300048926 | Ga0496123_0045539 | Ga0496123_0045539_377_2074 | 545 |
| 98 | 3300048927 | Ga0496124_0000198 | Ga0496124_0000198_22792_24489 | 545 |
| 99 | 3300048928 | Ga0496125_0016337 | Ga0496125_0016337_1386_3044 | 545 |
| 100 | 3300049586 | Ga0501070_0070490 | Ga0501070_0070490_706_2364 | 545 |
| 101 | 3300050492 | nmdc:mga0yw44_11042_c1 | nmdc:mga0yw44_11042_c1_141_1784 | 545 |
| 102 | 3300050496 | nmdc:mga07m45_10742_c2 | nmdc:mga07m45_10742_c2_668_2326 | 545 |
| 103 | 3300050510 | nmdc:mga06r32_6912_c1 | nmdc:mga06r32_6912_c1_442_2082 | 545 |
| 104 | 3300061719 | Ga0466962_0002665 | Ga0466962_0002665_1715_3364 | 545 |
| 105 | iso_pu_bacteria | 2643221687 | 2644491186 | 545 |
| 106 | iso_pu_bacteria | 2738541264 | 2738667265 | 545 |
| 107 | iso_pu_bacteria | 2738541274 | 2738707390 | 545 |
| 108 | iso_pu_bacteria | 2738541356 | 2739146108 | 545 |
| 109 | iso_pu_bacteria | 2738543028 | 2739328696 | 545 |
| 110 | iso_pu_bacteria | 2738543034 | 2739364620 | 545 |
| 111 | iso_pu_bacteria | 2808606700 | 2810363123 | 545 |
| 112 | iso_pu_bacteria | 2842134933 | 2842139573 | 545 |
| 113 | iso_pu_bacteria | 2902792274 | 2902797341 | 545 |
| 114 | iso_pu_bacteria | 2902799365 | 2902799754 | 545 |
| 115 | iso_pu_bacteria | 2902810491 | 2902814637 | 545 |
| 116 | iso_pu_bacteria | 2902837492 | 2902843038 | 545 |
| 117 | iso_pu_bacteria | 2904765812 | 2904766710 | 545 |
| 118 | iso_pu_bacteria | 2904770941 | 2904775278 | 545 |
| 119 | iso_pu_bacteria | 2908811453 | 2908811674 | 545 |
| 120 | iso_pu_bacteria | 2919420072 | 2919420854 | 545 |
| 121 | iso_pu_bacteria | 2919432681 | 2919433388 | 545 |
| 122 | iso_pu_bacteria | 2929212328 | 2929217767 | 545 |
| 123 | iso_pu_bacteria | 2939582691 | 2939585007 | 545 |
| 124 | iso_pu_bacteria | 2974315732 | 2974318682 | 545 |
| 125 | iso_pu_bacteria | 2984523437 | 2984526924 | 545 |
| 126 | iso_pu_bacteria | 8054107350 | 8054109721 | 545 |
| 127 | 3300005343 | Ga0070687_100039272 | Ga0070687_1000392721 | 546 |
| 128 | 3300005347 | Ga0070668_100014548 | Ga0070668_1000145484 | 546 |
| 129 | 3300005437 | Ga0070710_10001113 | Ga0070710_100011133 | 546 |
| 130 | 3300005456 | Ga0070678_100115369 | Ga0070678_1001153692 | 546 |
| 131 | 3300005564 | Ga0070664_100052437 | Ga0070664_1000524372 | 546 |
| 132 | 3300005840 | Ga0068870_10009251 | Ga0068870_100092515 | 546 |
| 133 | 3300009094 | Ga0111539_10067342 | Ga0111539_100673422 | 546 |
| 134 | 3300009147 | Ga0114129_10024424 | Ga0114129_100244246 | 546 |
| 135 | 3300025898 | Ga0207692_10008372 | Ga0207692_100083723 | 546 |
| 136 | 3300025899 | Ga0207642_10006957 | Ga0207642_100069572 | 546 |
| 137 | 3300025908 | Ga0207643_10008726 | Ga0207643_100087262 | 546 |
| 138 | 3300025918 | Ga0207662_10015525 | Ga0207662_100155252 | 546 |
| 139 | 3300025926 | Ga0207659_10011879 | Ga0207659_100118795 | 546 |
| 140 | 3300025931 | Ga0207644_10130833 | Ga0207644_101308331 | 546 |
| 141 | 3300025940 | Ga0207691_10114480 | Ga0207691_101144802 | 546 |
| 142 | 3300025942 | Ga0207689_10078010 | Ga0207689_100780101 | 546 |
| 143 | 3300025972 | Ga0207668_10030405 | Ga0207668_100304052 | 546 |
| 144 | 3300025981 | Ga0207640_10011928 | Ga0207640_100119282 | 546 |
| 145 | 3300025986 | Ga0207658_10049078 | Ga0207658_100490782 | 546 |
| 146 | 3300026067 | Ga0207678_10032838 | Ga0207678_100328383 | 546 |
| 147 | 3300026088 | Ga0207641_10199888 | Ga0207641_101998881 | 546 |
| 148 | 3300026116 | Ga0207674_10087561 | Ga0207674_100875612 | 546 |
| 149 | 3300026118 | Ga0207675_100054188 | Ga0207675_1000541882 | 546 |
| 150 | 3300037466 | Ga0395898_0073122 | Ga0395898_0073122_1212_2852 | 546 |
| 151 | 3300044658 | Ga0466972_0004319 | Ga0466972_0004319_1473_3113 | 546 |
| 152 | 3300044683 | Ga0466965_0000275 | Ga0466965_0000275_8913_10553 | 546 |
| 153 | 3300044765 | Ga0466970_0005929 | Ga0466970_0005929_2188_3867 | 546 |
| 154 | 3300048905 | Ga0496102_0142337 | Ga0496102_0142337_84_1742 | 546 |
| 155 | 3300048912 | Ga0496109_0244742 | Ga0496109_0244742_12_1670 | 546 |
| 156 | 3300049579 | Ga0501043_0010216 | Ga0501043_0010216_1667_3310 | 546 |
| 157 | iso_pu_bacteria | 2547132424 | 2548692954 | 546 |
| 158 | iso_pu_bacteria | 2551306166 | 2552105624 | 546 |
| 159 | iso_pu_bacteria | 2558860112 | 2558911629 | 546 |
| 160 | iso_pu_bacteria | 2565956761 | 2566995597 | 546 |
| 161 | iso_pu_bacteria | 2738541308 | 2738888530 | 546 |
| 162 | iso_pu_bacteria | 2738543005 | 2739204473 | 546 |
| 163 | iso_pu_bacteria | 2738543011 | 2739240380 | 546 |
| 164 | iso_pu_bacteria | 2751185725 | 2753037436 | 546 |
| 165 | iso_pu_bacteria | 2751185792 | 2753325304 | 546 |
| 166 | iso_pu_bacteria | 2857740372 | 2857740860 | 546 |
| 167 | iso_pu_bacteria | 2870782633 | 2870782994 | 546 |
| 168 | iso_pu_bacteria | 2889300758 | 2889303483 | 546 |
| 169 | iso_pu_bacteria | 2899370129 | 2899374847 | 546 |
| 170 | iso_pu_bacteria | 2904497146 | 2904501529 | 546 |
| 171 | iso_pu_bacteria | 2904535858 | 2904537787 | 546 |
| 172 | iso_pu_bacteria | 2904776348 | 2904778161 | 546 |
| 173 | iso_pu_bacteria | 2910809715 | 2910809845 | 546 |
| 174 | iso_pu_bacteria | 2919034639 | 2919035537 | 546 |
| 175 | iso_pu_bacteria | 2919059106 | 2919060208 | 546 |
| 176 | iso_pu_bacteria | 2919538618 | 2919539244 | 546 |
| 177 | iso_pu_bacteria | 2919713450 | 2919717836 | 546 |
| 178 | iso_pu_bacteria | 2922554459 | 2922556977 | 546 |
| 179 | iso_pu_bacteria | 2928142448 | 2928145294 | 546 |
| 180 | iso_pu_bacteria | 2932426870 | 2932427833 | 546 |
| 181 | iso_pu_bacteria | 2933418574 | 2933418593 | 546 |
| 182 | iso_pu_bacteria | 2939647034 | 2939650278 | 546 |
| 183 | iso_pu_bacteria | 2939743619 | 2939748680 | 546 |
| 184 | 3300005535 | Ga0070684_100005591 | Ga0070684_1000055918 | 547 |
| 185 | 3300005842 | Ga0068858_100000001 | Ga0068858_10000000140 | 547 |
| 186 | 3300009177 | Ga0105248_10000529 | Ga0105248_1000052940 | 547 |
| 187 | 3300014968 | Ga0157379_10000059 | Ga0157379_1000005934 | 547 |
| 188 | 3300025941 | Ga0207711_10000537 | Ga0207711_1000053740 | 547 |
| 189 | 3300025944 | Ga0207661_10007063 | Ga0207661_100070635 | 547 |
| 190 | 3300026035 | Ga0207703_10000007 | Ga0207703_1000000740 | 547 |
| 191 | 3300031456 | Ga0307513_10015902 | Ga0307513_100159022 | 547 |
| 192 | 3300031727 | Ga0316576_10062456 | Ga0316576_100624561 | 547 |
| 193 | 3300031728 | Ga0316578_10073153 | Ga0316578_100731531 | 547 |
| 194 | 3300033179 | Ga0307507_10069783 | Ga0307507_100697832 | 547 |
| 195 | 3300035085 | Ga0373929_0008480 | Ga0373929_0008480_52_1698 | 547 |
| 196 | 3300036712 | Ga0316584_0029064 | Ga0316584_0029064_556_2199 | 547 |
| 197 | 3300042016 | Ga0439463_010926 | Ga0439463_010926_266_1927 | 547 |
| 198 | 3300005337 | Ga0070682_100067463 | Ga0070682_1000674631 | 548 |
| 199 | 3300005338 | Ga0068868_100071612 | Ga0068868_1000716122 | 548 |
| 200 | 3300005339 | Ga0070660_100072079 | Ga0070660_1000720792 | 548 |
| 201 | 3300005345 | Ga0070692_10006310 | Ga0070692_100063102 | 548 |
| 202 | 3300005347 | Ga0070668_100000615 | Ga0070668_10000061515 | 548 |
| 203 | 3300005347 | Ga0070668_100011457 | Ga0070668_1000114574 | 548 |
| 204 | 3300005347 | Ga0070668_100038806 | Ga0070668_1000388062 | 548 |
| 205 | 3300005355 | Ga0070671_100005961 | Ga0070671_1000059613 | 548 |
| 206 | 3300005364 | Ga0070673_100133591 | Ga0070673_1001335912 | 548 |
| 207 | 3300005366 | Ga0070659_100035727 | Ga0070659_1000357272 | 548 |
| 208 | 3300005366 | Ga0070659_100070461 | Ga0070659_1000704611 | 548 |
| 209 | 3300005367 | Ga0070667_100019542 | Ga0070667_1000195424 | 548 |
| 210 | 3300005441 | Ga0070700_100018484 | Ga0070700_1000184844 | 548 |
| 211 | 3300005455 | Ga0070663_100015748 | Ga0070663_1000157485 | 548 |
| 212 | 3300005456 | Ga0070678_100001635 | Ga0070678_1000016359 | 548 |
| 213 | 3300005456 | Ga0070678_100017625 | Ga0070678_1000176251 | 548 |
| 214 | 3300005458 | Ga0070681_10010877 | Ga0070681_100108779 | 548 |
| 215 | 3300005466 | Ga0070685_10055451 | Ga0070685_100554512 | 548 |
| 216 | 3300005539 | Ga0068853_100073585 | Ga0068853_1000735851 | 548 |
| 217 | 3300005539 | Ga0068853_100086433 | Ga0068853_1000864331 | 548 |
| 218 | 3300005544 | Ga0070686_100067740 | Ga0070686_1000677402 | 548 |
| 219 | 3300005547 | Ga0070693_100016333 | Ga0070693_1000163333 | 548 |
| 220 | 3300005548 | Ga0070665_100002109 | Ga0070665_10000210920 | 548 |
| 221 | 3300005614 | Ga0068856_100007085 | Ga0068856_1000070859 | 548 |
| 222 | 3300005615 | Ga0070702_100000348 | Ga0070702_1000003489 | 548 |
| 223 | 3300005615 | Ga0070702_100011550 | Ga0070702_1000115502 | 548 |
| 224 | 3300005616 | Ga0068852_100009739 | Ga0068852_1000097395 | 548 |
| 225 | 3300005616 | Ga0068852_100013644 | Ga0068852_1000136445 | 548 |
| 226 | 3300005617 | Ga0068859_100010099 | Ga0068859_1000100993 | 548 |
| 227 | 3300005618 | Ga0068864_100033276 | Ga0068864_1000332764 | 548 |
| 228 | 3300005840 | Ga0068870_10017456 | Ga0068870_100174563 | 548 |
| 229 | 3300005841 | Ga0068863_100055722 | Ga0068863_1000557224 | 548 |
| 230 | 3300005842 | Ga0068858_100032090 | Ga0068858_1000320902 | 548 |
| 231 | 3300005842 | Ga0068858_100131561 | Ga0068858_1001315612 | 548 |
| 232 | 3300005843 | Ga0068860_100001185 | Ga0068860_1000011852 | 548 |
| 233 | 3300005843 | Ga0068860_100050073 | Ga0068860_1000500732 | 548 |
| 234 | 3300005843 | Ga0068860_100073226 | Ga0068860_1000732262 | 548 |
| 235 | 3300005937 | Ga0081455_10086756 | Ga0081455_100867562 | 548 |
| 236 | 3300005983 | Ga0081540_1000721 | Ga0081540_100072115 | 548 |
| 237 | 3300006038 | Ga0075365_10058065 | Ga0075365_100580652 | 548 |
| 238 | 3300006051 | Ga0075364_10004852 | Ga0075364_100048527 | 548 |
| 239 | 3300006173 | Ga0070716_100004733 | Ga0070716_1000047335 | 548 |
| 240 | 3300006852 | Ga0075433_10002276 | Ga0075433_100022762 | 548 |
| 241 | 3300006852 | Ga0075433_10067874 | Ga0075433_100678742 | 548 |
| 242 | 3300006871 | Ga0075434_100010515 | Ga0075434_1000105154 | 548 |
| 243 | 3300006871 | Ga0075434_100025012 | Ga0075434_1000250125 | 548 |
| 244 | 3300006881 | Ga0068865_100066572 | Ga0068865_1000665722 | 548 |
| 245 | 3300006914 | Ga0075436_100049293 | Ga0075436_1000492932 | 548 |
| 246 | 3300006931 | Ga0097620_100010099 | Ga0097620_1000100993 | 548 |
| 247 | 3300007076 | Ga0075435_100059771 | Ga0075435_1000597712 | 548 |
| 248 | 3300009011 | Ga0105251_10028937 | Ga0105251_100289373 | 548 |
| 249 | 3300009093 | Ga0105240_10145346 | Ga0105240_101453462 | 548 |
| 250 | 3300009094 | Ga0111539_10079610 | Ga0111539_100796102 | 548 |
| 251 | 3300009098 | Ga0105245_10010076 | Ga0105245_100100767 | 548 |
| 252 | 3300009098 | Ga0105245_10010496 | Ga0105245_100104968 | 548 |
| 253 | 3300009101 | Ga0105247_10002992 | Ga0105247_100029923 | 548 |
| 254 | 3300009101 | Ga0105247_10034572 | Ga0105247_100345722 | 548 |
| 255 | 3300009101 | Ga0105247_10061113 | Ga0105247_100611131 | 548 |
| 256 | 3300009148 | Ga0105243_10012407 | Ga0105243_100124074 | 548 |
| 257 | 3300009174 | Ga0105241_10018126 | Ga0105241_100181264 | 548 |
| 258 | 3300009545 | Ga0105237_10066578 | Ga0105237_100665782 | 548 |
| 259 | 3300009551 | Ga0105238_10110263 | Ga0105238_101102632 | 548 |
| 260 | 3300009553 | Ga0105249_10027800 | Ga0105249_100278002 | 548 |
| 261 | 3300013102 | Ga0157371_10049584 | Ga0157371_100495842 | 548 |
| 262 | 3300013105 | Ga0157369_10058658 | Ga0157369_100586582 | 548 |
| 263 | 3300013296 | Ga0157374_10041716 | Ga0157374_100417163 | 548 |
| 264 | 3300013307 | Ga0157372_10291277 | Ga0157372_102912771 | 548 |
| 265 | 3300014325 | Ga0163163_10126191 | Ga0163163_101261912 | 548 |
| 266 | 3300014745 | Ga0157377_10049674 | Ga0157377_100496742 | 548 |
| 267 | 3300014969 | Ga0157376_10054823 | Ga0157376_100548231 | 548 |
| 268 | 3300014969 | Ga0157376_10096996 | Ga0157376_100969962 | 548 |
| 269 | 3300017792 | Ga0163161_10006431 | Ga0163161_100064314 | 548 |
| 270 | 3300025900 | Ga0207710_10001549 | Ga0207710_100015498 | 548 |
| 271 | 3300025901 | Ga0207688_10012472 | Ga0207688_100124723 | 548 |
| 272 | 3300025901 | Ga0207688_10021944 | Ga0207688_100219442 | 548 |
| 273 | 3300025908 | Ga0207643_10003801 | Ga0207643_100038014 | 548 |
| 274 | 3300025912 | Ga0207707_10025790 | Ga0207707_100257904 | 548 |
| 275 | 3300025913 | Ga0207695_10108612 | Ga0207695_101086122 | 548 |
| 276 | 3300025914 | Ga0207671_10039228 | Ga0207671_100392284 | 548 |
| 277 | 3300025915 | Ga0207693_10006124 | Ga0207693_100061243 | 548 |
| 278 | 3300025919 | Ga0207657_10005196 | Ga0207657_100051964 | 548 |
| 279 | 3300025919 | Ga0207657_10090275 | Ga0207657_100902751 | 548 |
| 280 | 3300025925 | Ga0207650_10122133 | Ga0207650_101221332 | 548 |
| 281 | 3300025926 | Ga0207659_10021377 | Ga0207659_100213773 | 548 |
| 282 | 3300025927 | Ga0207687_10031545 | Ga0207687_100315452 | 548 |
| 283 | 3300025929 | Ga0207664_10012443 | Ga0207664_100124433 | 548 |
| 284 | 3300025939 | Ga0207665_10001092 | Ga0207665_100010925 | 548 |
| 285 | 3300025942 | Ga0207689_10005136 | Ga0207689_100051367 | 548 |
| 286 | 3300025944 | Ga0207661_10000336 | Ga0207661_1000033627 | 548 |
| 287 | 3300025949 | Ga0207667_10048085 | Ga0207667_100480852 | 548 |
| 288 | 3300025961 | Ga0207712_10011992 | Ga0207712_100119922 | 548 |
| 289 | 3300025972 | Ga0207668_10023553 | Ga0207668_100235532 | 548 |
| 290 | 3300025972 | Ga0207668_10031722 | Ga0207668_100317222 | 548 |
| 291 | 3300026035 | Ga0207703_10108834 | Ga0207703_101088342 | 548 |
| 292 | 3300026041 | Ga0207639_10017635 | Ga0207639_100176354 | 548 |
| 293 | 3300026067 | Ga0207678_10001699 | Ga0207678_100016994 | 548 |
| 294 | 3300026067 | Ga0207678_10001762 | Ga0207678_100017624 | 548 |
| 295 | 3300026075 | Ga0207708_10019442 | Ga0207708_100194422 | 548 |
| 296 | 3300026075 | Ga0207708_10023482 | Ga0207708_100234822 | 548 |
| 297 | 3300026078 | Ga0207702_10006673 | Ga0207702_100066735 | 548 |
| 298 | 3300026078 | Ga0207702_10012393 | Ga0207702_100123934 | 548 |
| 299 | 3300026088 | Ga0207641_10036367 | Ga0207641_100363672 | 548 |
| 300 | 3300026095 | Ga0207676_10000648 | Ga0207676_100006488 | 548 |
| 301 | 3300026118 | Ga0207675_100025670 | Ga0207675_1000256705 | 548 |
| 302 | 3300026121 | Ga0207683_10010775 | Ga0207683_100107754 | 548 |
| 303 | 3300026142 | Ga0207698_10082103 | Ga0207698_100821032 | 548 |
| 304 | 3300027907 | Ga0207428_10003435 | Ga0207428_1000343514 | 548 |
| 305 | 3300028381 | Ga0268264_10001011 | Ga0268264_1000101127 | 548 |
| 306 | 3300028794 | Ga0307515_10076325 | Ga0307515_100763251 | 548 |
| 307 | 3300031824 | Ga0307413_10060523 | Ga0307413_100605232 | 548 |
| 308 | 3300031838 | Ga0307518_10001174 | Ga0307518_1000117411 | 548 |
| 309 | 3300031995 | Ga0307409_100125553 | Ga0307409_1001255532 | 548 |
| 310 | 3300032004 | Ga0307414_10087370 | Ga0307414_100873702 | 548 |
| 311 | 3300033179 | Ga0307507_10032585 | Ga0307507_100325854 | 548 |
| 312 | 3300035112 | Ga0373932_0002256 | Ga0373932_0002256_2712_4361 | 548 |
| 313 | 3300035114 | Ga0373939_0007946 | Ga0373939_0007946_551_2200 | 548 |
| 314 | 3300044656 | Ga0466969_0046570 | Ga0466969_0046570_161_1810 | 548 |
| 315 | 3300044684 | Ga0466966_0012074 | Ga0466966_0012074_2350_3999 | 548 |
| 316 | 3300044693 | Ga0466961_0025106 | Ga0466961_0025106_1716_3365 | 548 |
| 317 | 3300044694 | Ga0466963_0021084 | Ga0466963_0021084_1093_2742 | 548 |
| 318 | 3300044694 | Ga0466963_0099438 | Ga0466963_0099438_60_1706 | 548 |
| 319 | 3300044719 | Ga0466971_0013303 | Ga0466971_0013303_1803_3452 | 548 |
| 320 | 3300044765 | Ga0466970_0031333 | Ga0466970_0031333_994_2643 | 548 |
| 321 | 3300044842 | Ga0466957_0002803 | Ga0466957_0002803_7708_9357 | 548 |
| 322 | 3300044901 | Ga0466960_0034982 | Ga0466960_0034982_331_1980 | 548 |
| 323 | 3300045836 | Ga0466958_0021001 | Ga0466958_0021001_999_2648 | 548 |
| 324 | 3300045836 | Ga0466958_0039218 | Ga0466958_0039218_740_2389 | 548 |
| 325 | 3300045976 | Ga0466967_0000939 | Ga0466967_0000939_10936_12585 | 548 |
| 326 | 3300045976 | Ga0466967_0010955 | Ga0466967_0010955_4947_6596 | 548 |
| 327 | 3300045976 | Ga0466967_0013978 | Ga0466967_0013978_3456_5105 | 548 |
| 328 | 3300045976 | Ga0466967_0033305 | Ga0466967_0033305_649_2298 | 548 |
| 329 | 3300045976 | Ga0466967_0042430 | Ga0466967_0042430_1852_3501 | 548 |
| 330 | 3300045976 | Ga0466967_0057635 | Ga0466967_0057635_203_1852 | 548 |
| 331 | 3300045976 | Ga0466967_0104156 | Ga0466967_0104156_243_1925 | 548 |
| 332 | 3300048905 | Ga0496102_0000023 | Ga0496102_0000023_128111_129796 | 548 |
| 333 | 3300048905 | Ga0496102_0018834 | Ga0496102_0018834_253_1899 | 548 |
| 334 | 3300048905 | Ga0496102_0069154 | Ga0496102_0069154_1176_2825 | 548 |
| 335 | 3300048906 | Ga0496103_0004680 | Ga0496103_0004680_5471_7156 | 548 |
| 336 | 3300048907 | Ga0496104_0006108 | Ga0496104_0006108_4054_5700 | 548 |
| 337 | 3300048908 | Ga0496105_0012058 | Ga0496105_0012058_1176_2822 | 548 |
| 338 | 3300048909 | Ga0496106_0004909 | Ga0496106_0004909_4959_6605 | 548 |
| 339 | 3300048910 | Ga0496107_0014387 | Ga0496107_0014387_465_2111 | 548 |
| 340 | 3300048911 | Ga0496108_0029168 | Ga0496108_0029168_643_2292 | 548 |
| 341 | 3300048912 | Ga0496109_0062928 | Ga0496109_0062928_615_2264 | 548 |
| 342 | 3300048913 | Ga0496110_0011169 | Ga0496110_0011169_1522_3168 | 548 |
| 343 | 3300048913 | Ga0496110_0036623 | Ga0496110_0036623_920_2569 | 548 |
| 344 | 3300048914 | Ga0496111_0000966 | Ga0496111_0000966_9244_10890 | 548 |
| 345 | 3300048916 | Ga0496113_0047728 | Ga0496113_0047728_366_2015 | 548 |
| 346 | 3300048918 | Ga0496115_0032165 | Ga0496115_0032165_2380_4029 | 548 |
| 347 | 3300048921 | Ga0496118_0041278 | Ga0496118_0041278_1058_2743 | 548 |
| 348 | 3300048922 | Ga0496119_0000091 | Ga0496119_0000091_75641_77290 | 548 |
| 349 | 3300048923 | Ga0496120_0004323 | Ga0496120_0004323_4306_5955 | 548 |
| 350 | 3300049581 | Ga0501047_0030201 | Ga0501047_0030201_281_1930 | 548 |
| 351 | 3300050491 | nmdc:mga00v17_9321_c1 | nmdc:mga00v17_9321_c1_425_2095 | 548 |
| 352 | 3300050512 | nmdc:mga0n895_37484_c1 | nmdc:mga0n895_37484_c1_831_2480 | 548 |
| 353 | 3300050512 | nmdc:mga0n895_7764_c1 | nmdc:mga0n895_7764_c1_5683_7329 | 548 |
| 354 | 3300050513 | nmdc:mga0rr50_3031_c1 | nmdc:mga0rr50_3031_c1_2402_4051 | 548 |
| 355 | 3300050513 | nmdc:mga0rr50_4305_c1 | nmdc:mga0rr50_4305_c1_1030_2676 | 548 |
| 356 | 3300050514 | nmdc:mga08x19_34101_c1 | nmdc:mga08x19_34101_c1_1052_2698 | 548 |
| 357 | 3300050514 | nmdc:mga08x19_45646_c1 | nmdc:mga08x19_45646_c1_830_2479 | 548 |
| 358 | 3300050515 | nmdc:mga0a205_11234_c1 | nmdc:mga0a205_11234_c1_811_2460 | 548 |
| 359 | 3300050515 | nmdc:mga0a205_618_c1 | nmdc:mga0a205_618_c1_14858_16504 | 548 |
| 360 | iso_pu_bacteria | 2582580736 | 2583149253 | 548 |
| 361 | iso_pu_bacteria | 2585427649 | 2586057830 | 548 |
| 362 | iso_pu_bacteria | 2643221715 | 2644637229 | 548 |
| 363 | iso_pu_bacteria | 2758568621 | 2760625593 | 548 |
| 364 | iso_pu_bacteria | 2808606522 | 2809593336 | 548 |
| 365 | 3300002075 | JGI24738J21930_10010039 | JGI24738J21930_100100392 | 549 |
| 366 | 3300002077 | JGI24744J21845_10000243 | JGI24744J21845_100002434 | 549 |
| 367 | 3300002459 | JGI24751J29686_10003232 | JGI24751J29686_100032322 | 549 |
| 368 | 3300003792 | Ga0055540_1000022 | Ga0055540_1000022186 | 549 |
| 369 | 3300003792 | Ga0055540_1003464 | Ga0055540_10034646 | 549 |
| 370 | 3300003792 | Ga0055540_1007294 | Ga0055540_10072943 | 549 |
| 371 | 3300005337 | Ga0070682_100004581 | Ga0070682_1000045814 | 549 |
| 372 | 3300005337 | Ga0070682_100018264 | Ga0070682_1000182642 | 549 |
| 373 | 3300005338 | Ga0068868_100008941 | Ga0068868_1000089414 | 549 |
| 374 | 3300005339 | Ga0070660_100123226 | Ga0070660_1001232261 | 549 |
| 375 | 3300005341 | Ga0070691_10001429 | Ga0070691_100014298 | 549 |
| 376 | 3300005347 | Ga0070668_100000201 | Ga0070668_1000002019 | 549 |
| 377 | 3300005347 | Ga0070668_100001887 | Ga0070668_10000188716 | 549 |
| 378 | 3300005355 | Ga0070671_100008029 | Ga0070671_1000080292 | 549 |
| 379 | 3300005356 | Ga0070674_100002301 | Ga0070674_1000023016 | 549 |
| 380 | 3300005356 | Ga0070674_100075845 | Ga0070674_1000758451 | 549 |
| 381 | 3300005367 | Ga0070667_100000142 | Ga0070667_10000014288 | 549 |
| 382 | 3300005367 | Ga0070667_100022439 | Ga0070667_1000224394 | 549 |
| 383 | 3300005367 | Ga0070667_100032084 | Ga0070667_1000320842 | 549 |
| 384 | 3300005437 | Ga0070710_10001176 | Ga0070710_100011767 | 549 |
| 385 | 3300005438 | Ga0070701_10007457 | Ga0070701_100074571 | 549 |
| 386 | 3300005439 | Ga0070711_100002471 | Ga0070711_1000024716 | 549 |
| 387 | 3300005441 | Ga0070700_100000263 | Ga0070700_10000026321 | 549 |
| 388 | 3300005456 | Ga0070678_100001503 | Ga0070678_1000015038 | 549 |
| 389 | 3300005457 | Ga0070662_100001803 | Ga0070662_1000018038 | 549 |
| 390 | 3300005459 | Ga0068867_100000537 | Ga0068867_1000005374 | 549 |
| 391 | 3300005466 | Ga0070685_10032022 | Ga0070685_100320222 | 549 |
| 392 | 3300005539 | Ga0068853_100001294 | Ga0068853_1000012943 | 549 |
| 393 | 3300005548 | Ga0070665_100003879 | Ga0070665_1000038798 | 549 |
| 394 | 3300005548 | Ga0070665_100014928 | Ga0070665_1000149283 | 549 |
| 395 | 3300005549 | Ga0070704_100001099 | Ga0070704_1000010998 | 549 |
| 396 | 3300005578 | Ga0068854_100001607 | Ga0068854_1000016078 | 549 |
| 397 | 3300005615 | Ga0070702_100000302 | Ga0070702_1000003022 | 549 |
| 398 | 3300005615 | Ga0070702_100014383 | Ga0070702_1000143833 | 549 |
| 399 | 3300005617 | Ga0068859_100001155 | Ga0068859_1000011559 | 549 |
| 400 | 3300005617 | Ga0068859_100002067 | Ga0068859_1000020679 | 549 |
| 401 | 3300005617 | Ga0068859_100023208 | Ga0068859_1000232082 | 549 |
| 402 | 3300005718 | Ga0068866_10001689 | Ga0068866_100016895 | 549 |
| 403 | 3300005719 | Ga0068861_100000739 | Ga0068861_1000007398 | 549 |
| 404 | 3300005841 | Ga0068863_100005764 | Ga0068863_1000057649 | 549 |
| 405 | 3300005842 | Ga0068858_100002363 | Ga0068858_10000236316 | 549 |
| 406 | 3300005842 | Ga0068858_100054643 | Ga0068858_1000546433 | 549 |
| 407 | 3300005843 | Ga0068860_100000160 | Ga0068860_10000016012 | 549 |
| 408 | 3300005843 | Ga0068860_100006970 | Ga0068860_1000069707 | 549 |
| 409 | 3300005844 | Ga0068862_100001362 | Ga0068862_10000136218 | 549 |
| 410 | 3300005844 | Ga0068862_100018762 | Ga0068862_1000187626 | 549 |
| 411 | 3300006038 | Ga0075365_10004459 | Ga0075365_100044599 | 549 |
| 412 | 3300006038 | Ga0075365_10021804 | Ga0075365_100218042 | 549 |
| 413 | 3300006048 | Ga0075363_100005102 | Ga0075363_1000051022 | 549 |
| 414 | 3300006048 | Ga0075363_100015345 | Ga0075363_1000153454 | 549 |
| 415 | 3300006048 | Ga0075363_100016072 | Ga0075363_1000160723 | 549 |
| 416 | 3300006051 | Ga0075364_10000909 | Ga0075364_1000090916 | 549 |
| 417 | 3300006051 | Ga0075364_10003441 | Ga0075364_100034418 | 549 |
| 418 | 3300006051 | Ga0075364_10003959 | Ga0075364_100039596 | 549 |
| 419 | 3300006051 | Ga0075364_10005541 | Ga0075364_100055419 | 549 |
| 420 | 3300006051 | Ga0075364_10005904 | Ga0075364_100059042 | 549 |
| 421 | 3300006051 | Ga0075364_10015218 | Ga0075364_100152186 | 549 |
| 422 | 3300006175 | Ga0070712_100000495 | Ga0070712_1000004958 | 549 |
| 423 | 3300006177 | Ga0075362_10026509 | Ga0075362_100265092 | 549 |
| 424 | 3300006178 | Ga0075367_10004255 | Ga0075367_100042557 | 549 |
| 425 | 3300006186 | Ga0075369_10009876 | Ga0075369_100098762 | 549 |
| 426 | 3300006186 | Ga0075369_10010596 | Ga0075369_100105962 | 549 |
| 427 | 3300006186 | Ga0075369_10015319 | Ga0075369_100153192 | 549 |
| 428 | 3300006186 | Ga0075369_10016601 | Ga0075369_100166012 | 549 |
| 429 | 3300006353 | Ga0075370_10002764 | Ga0075370_100027644 | 549 |
| 430 | 3300006353 | Ga0075370_10009460 | Ga0075370_100094602 | 549 |
| 431 | 3300006844 | Ga0075428_100009516 | Ga0075428_10000951612 | 549 |
| 432 | 3300006880 | Ga0075429_100003965 | Ga0075429_1000039657 | 549 |
| 433 | 3300006881 | Ga0068865_100000670 | Ga0068865_10000067016 | 549 |
| 434 | 3300006881 | Ga0068865_100024875 | Ga0068865_1000248753 | 549 |
| 435 | 3300006931 | Ga0097620_100001155 | Ga0097620_1000011559 | 549 |
| 436 | 3300006931 | Ga0097620_100002067 | Ga0097620_1000020679 | 549 |
| 437 | 3300006931 | Ga0097620_100023209 | Ga0097620_1000232092 | 549 |
| 438 | 3300009098 | Ga0105245_10001945 | Ga0105245_1000194516 | 549 |
| 439 | 3300009101 | Ga0105247_10000078 | Ga0105247_1000007812 | 549 |
| 440 | 3300009101 | Ga0105247_10000433 | Ga0105247_1000043316 | 549 |
| 441 | 3300009148 | Ga0105243_10001959 | Ga0105243_1000195915 | 549 |
| 442 | 3300009174 | Ga0105241_10144966 | Ga0105241_101449661 | 549 |
| 443 | 3300009176 | Ga0105242_10000858 | Ga0105242_1000085820 | 549 |
| 444 | 3300009177 | Ga0105248_10000082 | Ga0105248_1000008212 | 549 |
| 445 | 3300009177 | Ga0105248_10001630 | Ga0105248_100016303 | 549 |
| 446 | 3300009545 | Ga0105237_10016390 | Ga0105237_100163903 | 549 |
| 447 | 3300009551 | Ga0105238_10175641 | Ga0105238_101756411 | 549 |
| 448 | 3300009553 | Ga0105249_10000031 | Ga0105249_10000031107 | 549 |
| 449 | 3300009553 | Ga0105249_10002952 | Ga0105249_1000295215 | 549 |
| 450 | 3300010375 | Ga0105239_10022402 | Ga0105239_100224024 | 549 |
| 451 | 3300010375 | Ga0105239_10022852 | Ga0105239_100228524 | 549 |
| 452 | 3300013297 | Ga0157378_10002386 | Ga0157378_100023868 | 549 |
| 453 | 3300013306 | Ga0163162_10005790 | Ga0163162_100057908 | 549 |
| 454 | 3300013308 | Ga0157375_10000849 | Ga0157375_1000084916 | 549 |
| 455 | 3300014326 | Ga0157380_10000339 | Ga0157380_100003398 | 549 |
| 456 | 3300017792 | Ga0163161_10000520 | Ga0163161_1000052020 | 549 |
| 457 | 3300021384 | Ga0213876_10003631 | Ga0213876_100036318 | 549 |
| 458 | 3300021384 | Ga0213876_10009868 | Ga0213876_100098685 | 549 |
| 459 | 3300025303 | Ga0209051_1000033 | Ga0209051_1000033187 | 549 |
| 460 | 3300025303 | Ga0209051_1000522 | Ga0209051_10005222 | 549 |
| 461 | 3300025898 | Ga0207692_10001017 | Ga0207692_100010176 | 549 |
| 462 | 3300025899 | Ga0207642_10000168 | Ga0207642_1000016816 | 549 |
| 463 | 3300025900 | Ga0207710_10000022 | Ga0207710_1000002258 | 549 |
| 464 | 3300025900 | Ga0207710_10003170 | Ga0207710_100031702 | 549 |
| 465 | 3300025901 | Ga0207688_10001068 | Ga0207688_1000106812 | 549 |
| 466 | 3300025901 | Ga0207688_10004452 | Ga0207688_100044526 | 549 |
| 467 | 3300025905 | Ga0207685_10026226 | Ga0207685_100262261 | 549 |
| 468 | 3300025907 | Ga0207645_10012204 | Ga0207645_100122046 | 549 |
| 469 | 3300025914 | Ga0207671_10040164 | Ga0207671_100401643 | 549 |
| 470 | 3300025915 | Ga0207693_10000660 | Ga0207693_1000066027 | 549 |
| 471 | 3300025919 | Ga0207657_10051157 | Ga0207657_100511573 | 549 |
| 472 | 3300025923 | Ga0207681_10002764 | Ga0207681_1000276410 | 549 |
| 473 | 3300025927 | Ga0207687_10002929 | Ga0207687_100029298 | 549 |
| 474 | 3300025932 | Ga0207690_10027585 | Ga0207690_100275853 | 549 |
| 475 | 3300025934 | Ga0207686_10019544 | Ga0207686_100195442 | 549 |
| 476 | 3300025935 | Ga0207709_10002099 | Ga0207709_1000209910 | 549 |
| 477 | 3300025936 | Ga0207670_10078589 | Ga0207670_100785892 | 549 |
| 478 | 3300025937 | Ga0207669_10000218 | Ga0207669_100002188 | 549 |
| 479 | 3300025937 | Ga0207669_10012363 | Ga0207669_100123632 | 549 |
| 480 | 3300025938 | Ga0207704_10000179 | Ga0207704_100001797 | 549 |
| 481 | 3300025939 | Ga0207665_10022418 | Ga0207665_100224182 | 549 |
| 482 | 3300025941 | Ga0207711_10000984 | Ga0207711_1000098431 | 549 |
| 483 | 3300025941 | Ga0207711_10052620 | Ga0207711_100526203 | 549 |
| 484 | 3300025942 | Ga0207689_10007350 | Ga0207689_100073502 | 549 |
| 485 | 3300025961 | Ga0207712_10000029 | Ga0207712_10000029107 | 549 |
| 486 | 3300025961 | Ga0207712_10007142 | Ga0207712_100071422 | 549 |
| 487 | 3300025961 | Ga0207712_10112856 | Ga0207712_101128561 | 549 |
| 488 | 3300025972 | Ga0207668_10021344 | Ga0207668_100213442 | 549 |
| 489 | 3300025972 | Ga0207668_10039325 | Ga0207668_100393253 | 549 |
| 490 | 3300025981 | Ga0207640_10025372 | Ga0207640_100253721 | 549 |
| 491 | 3300025986 | Ga0207658_10000113 | Ga0207658_1000011385 | 549 |
| 492 | 3300025986 | Ga0207658_10005096 | Ga0207658_100050967 | 549 |
| 493 | 3300025986 | Ga0207658_10005645 | Ga0207658_100056456 | 549 |
| 494 | 3300025986 | Ga0207658_10007864 | Ga0207658_100078643 | 549 |
| 495 | 3300026023 | Ga0207677_10003639 | Ga0207677_100036394 | 549 |
| 496 | 3300026035 | Ga0207703_10002619 | Ga0207703_100026193 | 549 |
| 497 | 3300026035 | Ga0207703_10018063 | Ga0207703_100180636 | 549 |
| 498 | 3300026041 | Ga0207639_10002773 | Ga0207639_100027738 | 549 |
| 499 | 3300026041 | Ga0207639_10006160 | Ga0207639_100061603 | 549 |
| 500 | 3300026067 | Ga0207678_10120046 | Ga0207678_101200462 | 549 |
| 501 | 3300026075 | Ga0207708_10000787 | Ga0207708_100007873 | 549 |
| 502 | 3300026075 | Ga0207708_10015233 | Ga0207708_100152334 | 549 |
| 503 | 3300026088 | Ga0207641_10003451 | Ga0207641_100034519 | 549 |
| 504 | 3300026088 | Ga0207641_10007179 | Ga0207641_1000717912 | 549 |
| 505 | 3300026089 | Ga0207648_10001756 | Ga0207648_100017564 | 549 |
| 506 | 3300026118 | Ga0207675_100012899 | Ga0207675_1000128994 | 549 |
| 507 | 3300026118 | Ga0207675_100013553 | Ga0207675_1000135535 | 549 |
| 508 | 3300026121 | Ga0207683_10000990 | Ga0207683_100009904 | 549 |
| 509 | 3300028379 | Ga0268266_10009419 | Ga0268266_100094198 | 549 |
| 510 | 3300028379 | Ga0268266_10077071 | Ga0268266_100770712 | 549 |
| 511 | 3300028380 | Ga0268265_10000040 | Ga0268265_1000004084 | 549 |
| 512 | 3300028380 | Ga0268265_10089979 | Ga0268265_100899792 | 549 |
| 513 | 3300028381 | Ga0268264_10000017 | Ga0268264_10000017263 | 549 |
| 514 | 3300028381 | Ga0268264_10002402 | Ga0268264_100024028 | 549 |
| 515 | 3300028381 | Ga0268264_10012556 | Ga0268264_100125567 | 549 |
| 516 | 3300031251 | Ga0265327_10004008 | Ga0265327_100040088 | 549 |
| 517 | 3300031824 | Ga0307413_10035375 | Ga0307413_100353752 | 549 |
| 518 | 3300031901 | Ga0307406_10039914 | Ga0307406_100399142 | 549 |
| 519 | 3300035691 | Ga0373931_0005726 | Ga0373931_0005726_2255_3904 | 549 |
| 520 | 3300037853 | Ga0436364_0176067 | Ga0436364_0176067_10436_12085 | 549 |
| 521 | 3300037853 | Ga0436364_0199133 | Ga0436364_0199133_4330_5982 | 549 |
| 522 | 3300037853 | Ga0436364_1442134 | Ga0436364_1442134_496_2145 | 549 |
| 523 | 3300039437 | Ga0436365_0469598 | Ga0436365_0469598_9720_11372 | 549 |
| 524 | 3300039437 | Ga0436365_1752709 | Ga0436365_1752709_1436_3085 | 549 |
| 525 | 3300039437 | Ga0436365_1937384 | Ga0436365_1937384_99_1748 | 549 |
| 526 | 3300041411 | Ga0439466_0013297 | Ga0439466_0013297_171_1829 | 549 |
| 527 | 3300041411 | Ga0439466_0021325 | Ga0439466_0021325_175_1833 | 549 |
| 528 | 3300041413 | Ga0439465_0000494 | Ga0439465_0000494_9280_10938 | 549 |
| 529 | 3300041413 | Ga0439465_0014233 | Ga0439465_0014233_441_2099 | 549 |
| 530 | 3300041413 | Ga0439465_0014375 | Ga0439465_0014375_558_2216 | 549 |
| 531 | 3300042002 | Ga0439442_002799 | Ga0439442_002799_135_1793 | 549 |
| 532 | 3300044658 | Ga0466972_0027626 | Ga0466972_0027626_939_2588 | 549 |
| 533 | 3300044658 | Ga0466972_0029218 | Ga0466972_0029218_16_1665 | 549 |
| 534 | 3300044683 | Ga0466965_0007407 | Ga0466965_0007407_2572_4221 | 549 |
| 535 | 3300044683 | Ga0466965_0028032 | Ga0466965_0028032_615_2264 | 549 |
| 536 | 3300044684 | Ga0466966_0008971 | Ga0466966_0008971_3433_5082 | 549 |
| 537 | 3300044684 | Ga0466966_0021938 | Ga0466966_0021938_1361_3010 | 549 |
| 538 | 3300044693 | Ga0466961_0034187 | Ga0466961_0034187_1402_3051 | 549 |
| 539 | 3300044719 | Ga0466971_0007997 | Ga0466971_0007997_1336_2985 | 549 |
| 540 | 3300044842 | Ga0466957_0003491 | Ga0466957_0003491_4693_6342 | 549 |
| 541 | 3300044842 | Ga0466957_0090270 | Ga0466957_0090270_244_1905 | 549 |
| 542 | 3300044901 | Ga0466960_0000814 | Ga0466960_0000814_4482_6131 | 549 |
| 543 | 3300045049 | Ga0466959_0046062 | Ga0466959_0046062_1195_2844 | 549 |
| 544 | 3300045049 | Ga0466959_0082318 | Ga0466959_0082318_655_2304 | 549 |
| 545 | 3300045976 | Ga0466967_0064898 | Ga0466967_0064898_1354_3003 | 549 |
| 546 | 3300046460 | Ga0495638_0014115 | Ga0495638_0014115_2154_3803 | 549 |
| 547 | 3300047320 | Ga0495672_0014117 | Ga0495672_0014117_1665_3314 | 549 |
| 548 | 3300047469 | Ga0495673_0009180 | Ga0495673_0009180_2613_4262 | 549 |
| 549 | 3300047472 | Ga0495686_0020947 | Ga0495686_0020947_59_1708 | 549 |
| 550 | 3300047673 | Ga0495593_0012739 | Ga0495593_0012739_1405_3054 | 549 |
| 551 | 3300048903 | Ga0496100_0000349 | Ga0496100_0000349_16068_17717 | 549 |
| 552 | 3300048903 | Ga0496100_0001640 | Ga0496100_0001640_241_1890 | 549 |
| 553 | 3300048903 | Ga0496100_0002069 | Ga0496100_0002069_3650_5299 | 549 |
| 554 | 3300048903 | Ga0496100_0002259 | Ga0496100_0002259_6763_8421 | 549 |
| 555 | 3300048903 | Ga0496100_0004837 | Ga0496100_0004837_1402_3051 | 549 |
| 556 | 3300048904 | Ga0496101_0000032 | Ga0496101_0000032_180872_182521 | 549 |
| 557 | 3300048904 | Ga0496101_0000395 | Ga0496101_0000395_3734_5383 | 549 |
| 558 | 3300048904 | Ga0496101_0002865 | Ga0496101_0002865_3163_4821 | 549 |
| 559 | 3300048904 | Ga0496101_0004338 | Ga0496101_0004338_4643_6292 | 549 |
| 560 | 3300048905 | Ga0496102_0000011 | Ga0496102_0000011_87152_88801 | 549 |
| 561 | 3300048905 | Ga0496102_0000197 | Ga0496102_0000197_58759_60408 | 549 |
| 562 | 3300048905 | Ga0496102_0000843 | Ga0496102_0000843_23235_24884 | 549 |
| 563 | 3300048905 | Ga0496102_0002308 | Ga0496102_0002308_7607_9256 | 549 |
| 564 | 3300048905 | Ga0496102_0006976 | Ga0496102_0006976_4474_6126 | 549 |
| 565 | 3300048905 | Ga0496102_0018773 | Ga0496102_0018773_1985_3634 | 549 |
| 566 | 3300048906 | Ga0496103_0000431 | Ga0496103_0000431_31576_33225 | 549 |
| 567 | 3300048906 | Ga0496103_0000601 | Ga0496103_0000601_4454_6103 | 549 |
| 568 | 3300048906 | Ga0496103_0001721 | Ga0496103_0001721_10955_12604 | 549 |
| 569 | 3300048906 | Ga0496103_0002336 | Ga0496103_0002336_7566_9218 | 549 |
| 570 | 3300048906 | Ga0496103_0002956 | Ga0496103_0002956_6591_8240 | 549 |
| 571 | 3300048908 | Ga0496105_0001822 | Ga0496105_0001822_7242_8891 | 549 |
| 572 | 3300048908 | Ga0496105_0007333 | Ga0496105_0007333_876_2534 | 549 |
| 573 | 3300048909 | Ga0496106_0001288 | Ga0496106_0001288_4217_5866 | 549 |
| 574 | 3300048909 | Ga0496106_0002693 | Ga0496106_0002693_4062_5711 | 549 |
| 575 | 3300048909 | Ga0496106_0009349 | Ga0496106_0009349_4795_6444 | 549 |
| 576 | 3300048909 | Ga0496106_0016797 | Ga0496106_0016797_2762_4420 | 549 |
| 577 | 3300048910 | Ga0496107_0000825 | Ga0496107_0000825_12093_13742 | 549 |
| 578 | 3300048910 | Ga0496107_0007236 | Ga0496107_0007236_2751_4400 | 549 |
| 579 | 3300048910 | Ga0496107_0058117 | Ga0496107_0058117_271_1920 | 549 |
| 580 | 3300048911 | Ga0496108_0003052 | Ga0496108_0003052_10124_11782 | 549 |
| 581 | 3300048912 | Ga0496109_0000030 | Ga0496109_0000030_148779_150428 | 549 |
| 582 | 3300048912 | Ga0496109_0011438 | Ga0496109_0011438_1779_3437 | 549 |
| 583 | 3300048912 | Ga0496109_0017265 | Ga0496109_0017265_1933_3591 | 549 |
| 584 | 3300048912 | Ga0496109_0051500 | Ga0496109_0051500_1357_3006 | 549 |
| 585 | 3300048913 | Ga0496110_0015646 | Ga0496110_0015646_4587_6236 | 549 |
| 586 | 3300048913 | Ga0496110_0023908 | Ga0496110_0023908_2658_4316 | 549 |
| 587 | 3300048915 | Ga0496112_0019350 | Ga0496112_0019350_3314_4963 | 549 |
| 588 | 3300048915 | Ga0496112_0127879 | Ga0496112_0127879_826_2475 | 549 |
| 589 | 3300048916 | Ga0496113_0010464 | Ga0496113_0010464_565_2214 | 549 |
| 590 | 3300048916 | Ga0496113_0037112 | Ga0496113_0037112_1642_3300 | 549 |
| 591 | 3300048917 | Ga0496114_0000312 | Ga0496114_0000312_19574_21223 | 549 |
| 592 | 3300048917 | Ga0496114_0003137 | Ga0496114_0003137_8746_10395 | 549 |
| 593 | 3300048918 | Ga0496115_0006543 | Ga0496115_0006543_4924_6573 | 549 |
| 594 | 3300048918 | Ga0496115_0016805 | Ga0496115_0016805_2760_4409 | 549 |
| 595 | 3300048919 | Ga0496116_0000072 | Ga0496116_0000072_3566_5215 | 549 |
| 596 | 3300048919 | Ga0496116_0005015 | Ga0496116_0005015_4744_6393 | 549 |
| 597 | 3300048920 | Ga0496117_0000039 | Ga0496117_0000039_232944_234593 | 549 |
| 598 | 3300048920 | Ga0496117_0000160 | Ga0496117_0000160_71428_73077 | 549 |
| 599 | 3300048920 | Ga0496117_0008919 | Ga0496117_0008919_3533_5182 | 549 |
| 600 | 3300048921 | Ga0496118_0000035 | Ga0496118_0000035_87551_89200 | 549 |
| 601 | 3300048921 | Ga0496118_0000391 | Ga0496118_0000391_21253_22902 | 549 |
| 602 | 3300048921 | Ga0496118_0002342 | Ga0496118_0002342_2652_4310 | 549 |
| 603 | 3300048921 | Ga0496118_0008772 | Ga0496118_0008772_4330_5979 | 549 |
| 604 | 3300048922 | Ga0496119_0000517 | Ga0496119_0000517_47580_49229 | 549 |
| 605 | 3300048922 | Ga0496119_0009193 | Ga0496119_0009193_6724_8373 | 549 |
| 606 | 3300048923 | Ga0496120_0000631 | Ga0496120_0000631_47889_49538 | 549 |
| 607 | 3300048923 | Ga0496120_0029527 | Ga0496120_0029527_51_1709 | 549 |
| 608 | 3300048924 | Ga0496121_0000004 | Ga0496121_0000004_471597_473246 | 549 |
| 609 | 3300048924 | Ga0496121_0002639 | Ga0496121_0002639_2376_4025 | 549 |
| 610 | 3300048924 | Ga0496121_0009366 | Ga0496121_0009366_832_2490 | 549 |
| 611 | 3300048925 | Ga0496122_0000173 | Ga0496122_0000173_4263_5912 | 549 |
| 612 | 3300048926 | Ga0496123_0029542 | Ga0496123_0029542_2126_3775 | 549 |
| 613 | 3300048927 | Ga0496124_0000012 | Ga0496124_0000012_196390_198039 | 549 |
| 614 | 3300048927 | Ga0496124_0085754 | Ga0496124_0085754_57_1715 | 549 |
| 615 | 3300048928 | Ga0496125_0000003 | Ga0496125_0000003_716522_718171 | 549 |
| 616 | 3300048928 | Ga0496125_0039512 | Ga0496125_0039512_832_2490 | 549 |
| 617 | 3300048929 | Ga0496126_0000001 | Ga0496126_0000001_471597_473246 | 549 |
| 618 | 3300048929 | Ga0496126_0002899 | Ga0496126_0002899_12082_13731 | 549 |
| 619 | 3300048929 | Ga0496126_0003942 | Ga0496126_0003942_8003_9661 | 549 |
| 620 | 3300048929 | Ga0496126_0084227 | Ga0496126_0084227_869_2518 | 549 |
| 621 | 3300049569 | Ga0501032_0004394 | Ga0501032_0004394_3293_4942 | 549 |
| 622 | 3300049569 | Ga0501032_0011902 | Ga0501032_0011902_2617_4266 | 549 |
| 623 | 3300049569 | Ga0501032_0020513 | Ga0501032_0020513_531_2180 | 549 |
| 624 | 3300049570 | Ga0501033_0023356 | Ga0501033_0023356_134_1783 | 549 |
| 625 | 3300049571 | Ga0501034_0006718 | Ga0501034_0006718_4968_6617 | 549 |
| 626 | 3300049571 | Ga0501034_0042485 | Ga0501034_0042485_2613_4262 | 549 |
| 627 | 3300049572 | Ga0501036_0009567 | Ga0501036_0009567_3339_4988 | 549 |
| 628 | 3300049573 | Ga0501037_0000472 | Ga0501037_0000472_9033_10682 | 549 |
| 629 | 3300049574 | Ga0501038_0022457 | Ga0501038_0022457_2380_4029 | 549 |
| 630 | 3300049575 | Ga0501039_0026706 | Ga0501039_0026706_1164_2813 | 549 |
| 631 | 3300049579 | Ga0501043_0009851 | Ga0501043_0009851_2380_4029 | 549 |
| 632 | 3300049580 | Ga0501046_0002992 | Ga0501046_0002992_8571_10220 | 549 |
| 633 | 3300049581 | Ga0501047_0016518 | Ga0501047_0016518_3751_5400 | 549 |
| 634 | 3300049581 | Ga0501047_0090558 | Ga0501047_0090558_805_2457 | 549 |
| 635 | 3300049586 | Ga0501070_0001241 | Ga0501070_0001241_8619_10268 | 549 |
| 636 | 3300049586 | Ga0501070_0014359 | Ga0501070_0014359_1404_3053 | 549 |
| 637 | 3300049589 | Ga0501073_0024507 | Ga0501073_0024507_470_2119 | 549 |
| 638 | 3300049822 | Ga0501035_0001109 | Ga0501035_0001109_163_1812 | 549 |
| 639 | 3300049822 | Ga0501035_0016404 | Ga0501035_0016404_4550_6199 | 549 |
| 640 | 3300049823 | Ga0501044_0000797 | Ga0501044_0000797_1402_3051 | 549 |
| 641 | 3300049823 | Ga0501044_0002911 | Ga0501044_0002911_16062_17711 | 549 |
| 642 | 3300049823 | Ga0501044_0015830 | Ga0501044_0015830_3615_5264 | 549 |
| 643 | 3300049823 | Ga0501044_0025322 | Ga0501044_0025322_1522_3171 | 549 |
| 644 | 3300050489 | nmdc:mga03683_26362_c1 | nmdc:mga03683_26362_c1_136_1785 | 549 |
| 645 | 3300050490 | nmdc:mga03n38_22049_c1 | nmdc:mga03n38_22049_c1_653_2311 | 549 |
| 646 | 3300050490 | nmdc:mga03n38_25115_c1 | nmdc:mga03n38_25115_c1_142_1800 | 549 |
| 647 | 3300050490 | nmdc:mga03n38_36106_c1 | nmdc:mga03n38_36106_c1_277_1926 | 549 |
| 648 | 3300050491 | nmdc:mga00v17_11207_c1 | nmdc:mga00v17_11207_c1_575_2224 | 549 |
| 649 | 3300050491 | nmdc:mga00v17_13555_c2 | nmdc:mga00v17_13555_c2_367_2016 | 549 |
| 650 | 3300050491 | nmdc:mga00v17_18058_c1 | nmdc:mga00v17_18058_c1_1069_2727 | 549 |
| 651 | 3300050491 | nmdc:mga00v17_27447_c1 | nmdc:mga00v17_27447_c1_1531_3189 | 549 |
| 652 | 3300050491 | nmdc:mga00v17_3655_c1 | nmdc:mga00v17_3655_c1_305_1954 | 549 |
| 653 | 3300050492 | nmdc:mga0yw44_1098_c1 | nmdc:mga0yw44_1098_c1_7989_9647 | 549 |
| 654 | 3300050492 | nmdc:mga0yw44_12878_c1 | nmdc:mga0yw44_12878_c1_2006_3655 | 549 |
| 655 | 3300050492 | nmdc:mga0yw44_2411_c1 | nmdc:mga0yw44_2411_c1_6030_7688 | 549 |
| 656 | 3300050492 | nmdc:mga0yw44_64387_c1 | nmdc:mga0yw44_64387_c1_411_2060 | 549 |
| 657 | 3300050495 | nmdc:mga04h51_18621_c1 | nmdc:mga04h51_18621_c1_364_2022 | 549 |
| 658 | 3300050496 | nmdc:mga07m45_41765_c1 | nmdc:mga07m45_41765_c1_619_2277 | 549 |
| 659 | 3300050507 | nmdc:mga05p37_26066_c1 | nmdc:mga05p37_26066_c1_3990_5648 | 549 |
| 660 | 3300050507 | nmdc:mga05p37_57408_c1 | nmdc:mga05p37_57408_c1_2280_3929 | 549 |
| 661 | 3300050509 | nmdc:mga0qj67_19159_c1 | nmdc:mga0qj67_19159_c1_1340_2998 | 549 |
| 662 | 3300050516 | nmdc:mga0sz30_15725_c1 | nmdc:mga0sz30_15725_c1_1288_2946 | 549 |
| 663 | 3300050516 | nmdc:mga0sz30_2686_c1 | nmdc:mga0sz30_2686_c1_3447_5105 | 549 |
| 664 | 3300053080 | Ga0500635_0002464 | Ga0500635_0002464_968_2617 | 549 |
| 665 | 3300053087 | Ga0500643_005081 | Ga0500643_005081_560_2209 | 549 |
| 666 | 3300053087 | Ga0500643_013401 | Ga0500643_013401_890_2539 | 549 |
| 667 | 3300053131 | Ga0500652_004008 | Ga0500652_004008_795_2444 | 549 |
| 668 | 3300053153 | Ga0500616_0004319 | Ga0500616_0004319_7550_9199 | 549 |
| 669 | 3300053153 | Ga0500616_0011037 | Ga0500616_0011037_383_2032 | 549 |
| 670 | 3300053730 | Ga0500645_000025 | Ga0500645_000025_110685_112334 | 549 |
| 671 | 3300061719 | Ga0466962_0008336 | Ga0466962_0008336_46_1695 | 549 |
| 672 | iso_pu_bacteria | 2558860280 | 2559427403 | 549 |
| 673 | iso_pu_bacteria | 2643221692 | 2644515518 | 549 |
| 674 | iso_pu_bacteria | 2751185734 | 2753076296 | 549 |
| 675 | iso_pu_bacteria | 2751185782 | 2753269563 | 549 |
| 676 | iso_pu_bacteria | 2795385470 | 2795780246 | 549 |
| 677 | iso_pu_bacteria | 2795385472 | 2795793664 | 549 |
| 678 | iso_pu_bacteria | 2816332139 | 2816505890 | 549 |
| 679 | iso_pu_bacteria | 2842888712 | 2842890733 | 549 |
| 680 | iso_pu_bacteria | 2866552031 | 2866557508 | 549 |
| 681 | iso_pu_bacteria | 2870721527 | 2870728702 | 549 |
| 682 | iso_pu_bacteria | 2891326441 | 2891331099 | 549 |
| 683 | iso_pu_bacteria | 2915358134 | 2915363879 | 549 |
| 684 | iso_pu_bacteria | 2932398195 | 2932398215 | 549 |
| 685 | iso_pu_bacteria | 8054472261 | 8054476912 | 549 |
| 686 | iso_pu_bacteria | 8056207758 | 8056209408 | 549 |
| 687 | 3300005435 | Ga0070714_100067900 | Ga0070714_1000679003 | 550 |
| 688 | 3300031251 | Ga0265327_10000246 | Ga0265327_100002469 | 550 |
| 689 | 3300031251 | Ga0265327_10007848 | Ga0265327_100078483 | 550 |
| 690 | 3300037853 | Ga0436364_1272092 | Ga0436364_1272092_1636_3288 | 550 |
| 691 | 3300046501 | Ga0495607_0070804 | Ga0495607_0070804_123_1796 | 550 |
| 692 | 3300047323 | Ga0495683_0001820 | Ga0495683_0001820_5821_7494 | 550 |
| 693 | 3300049823 | Ga0501044_0075399 | Ga0501044_0075399_1113_2942 | 550 |
| 694 | iso_pu_bacteria | 2744054611 | 2744958480 | 550 |
| 695 | 3300005937 | Ga0081455_10000037 | Ga0081455_10000037117 | 551 |
| 696 | 3300025916 | Ga0207663_10009121 | Ga0207663_100091216 | 551 |
| 697 | 3300048905 | Ga0496102_0071876 | Ga0496102_0071876_1346_3004 | 551 |
| 698 | iso_pu_bacteria | 2956939328 | 2956942038 | 551 |
| 699 | iso_pu_bacteria | 3001119090 | 3001119393 | 551 |
| 700 | 3300025933 | Ga0207706_10030916 | Ga0207706_100309162 | 552 |
| 701 | 3300028794 | Ga0307515_10181759 | Ga0307515_101817592 | 552 |
| 702 | 3300045976 | Ga0466967_0119455 | Ga0466967_0119455_52_1710 | 552 |
| 703 | 3300003203 | JGI25406J46586_10001670 | JGI25406J46586_100016706 | 553 |
| 704 | 3300005355 | Ga0070671_100001715 | Ga0070671_1000017152 | 553 |
| 705 | 3300005548 | Ga0070665_100003927 | Ga0070665_1000039272 | 553 |
| 706 | 3300005577 | Ga0068857_100019728 | Ga0068857_1000197284 | 553 |
| 707 | 3300005618 | Ga0068864_100031268 | Ga0068864_1000312685 | 553 |
| 708 | 3300005841 | Ga0068863_100033523 | Ga0068863_1000335236 | 553 |
| 709 | 3300005842 | Ga0068858_100226976 | Ga0068858_1002269761 | 553 |
| 710 | 3300005843 | Ga0068860_100004520 | Ga0068860_1000045208 | 553 |
| 711 | 3300005985 | Ga0081539_10000027 | Ga0081539_1000002758 | 553 |
| 712 | 3300005985 | Ga0081539_10004065 | Ga0081539_100040659 | 553 |
| 713 | 3300006846 | Ga0075430_100002400 | Ga0075430_1000024001 | 553 |
| 714 | 3300009177 | Ga0105248_10019600 | Ga0105248_100196004 | 553 |
| 715 | 3300014968 | Ga0157379_10034320 | Ga0157379_100343202 | 553 |
| 716 | 3300025931 | Ga0207644_10001206 | Ga0207644_100012062 | 553 |
| 717 | 3300025972 | Ga0207668_10066456 | Ga0207668_100664563 | 553 |
| 718 | 3300026088 | Ga0207641_10001078 | Ga0207641_1000107827 | 553 |
| 719 | 3300026095 | Ga0207676_10040766 | Ga0207676_100407662 | 553 |
| 720 | 3300028381 | Ga0268264_10025689 | Ga0268264_100256895 | 553 |
| 721 | 3300030521 | Ga0307511_10004169 | Ga0307511_100041697 | 553 |
| 722 | 3300032005 | Ga0307411_10053252 | Ga0307411_100532521 | 553 |
| 723 | 3300033179 | Ga0307507_10055053 | Ga0307507_100550533 | 553 |
| 724 | 3300035119 | Ga0373956_0008848 | Ga0373956_0008848_628_2304 | 553 |
| 725 | 3300035692 | Ga0373935_0013072 | Ga0373935_0013072_2161_3822 | 553 |
| 726 | 3300037853 | Ga0436364_0027535 | Ga0436364_0027535_10469_12130 | 553 |
| 727 | 3300044656 | Ga0466969_0005292 | Ga0466969_0005292_1785_3446 | 553 |
| 728 | 3300044683 | Ga0466965_0004062 | Ga0466965_0004062_3407_5068 | 553 |
| 729 | 3300044684 | Ga0466966_0002032 | Ga0466966_0002032_5896_7557 | 553 |
| 730 | 3300044693 | Ga0466961_0015417 | Ga0466961_0015417_342_2003 | 553 |
| 731 | 3300044765 | Ga0466970_0004625 | Ga0466970_0004625_1835_3496 | 553 |
| 732 | 3300044765 | Ga0466970_0013380 | Ga0466970_0013380_2447_4108 | 553 |
| 733 | 3300044842 | Ga0466957_0021211 | Ga0466957_0021211_1451_3112 | 553 |
| 734 | 3300044901 | Ga0466960_0004932 | Ga0466960_0004932_2416_4077 | 553 |
| 735 | 3300045049 | Ga0466959_0043527 | Ga0466959_0043527_1133_2794 | 553 |
| 736 | 3300045976 | Ga0466967_0041422 | Ga0466967_0041422_2226_3887 | 553 |
| 737 | 3300048904 | Ga0496101_0009675 | Ga0496101_0009675_1126_2787 | 553 |
| 738 | 3300048905 | Ga0496102_0000574 | Ga0496102_0000574_2490_4151 | 553 |
| 739 | 3300048906 | Ga0496103_0000380 | Ga0496103_0000380_3190_4851 | 553 |
| 740 | 3300048908 | Ga0496105_0022610 | Ga0496105_0022610_2601_4262 | 553 |
| 741 | 3300048908 | Ga0496105_0113769 | Ga0496105_0113769_76_1737 | 553 |
| 742 | 3300048911 | Ga0496108_0003096 | Ga0496108_0003096_6331_7992 | 553 |
| 743 | 3300048911 | Ga0496108_0051738 | Ga0496108_0051738_774_2435 | 553 |
| 744 | 3300048912 | Ga0496109_0028087 | Ga0496109_0028087_958_2619 | 553 |
| 745 | 3300048913 | Ga0496110_0014954 | Ga0496110_0014954_2409_4070 | 553 |
| 746 | 3300048914 | Ga0496111_0074693 | Ga0496111_0074693_228_1889 | 553 |
| 747 | 3300048915 | Ga0496112_0073110 | Ga0496112_0073110_1519_3180 | 553 |
| 748 | 3300048916 | Ga0496113_0003716 | Ga0496113_0003716_3517_5178 | 553 |
| 749 | 3300048917 | Ga0496114_0083411 | Ga0496114_0083411_90_1751 | 553 |
| 750 | 3300048918 | Ga0496115_0095828 | Ga0496115_0095828_507_2168 | 553 |
| 751 | 3300048919 | Ga0496116_0000183 | Ga0496116_0000183_2518_4179 | 553 |
| 752 | 3300048920 | Ga0496117_0000059 | Ga0496117_0000059_2497_4158 | 553 |
| 753 | 3300048921 | Ga0496118_0001225 | Ga0496118_0001225_35255_36916 | 553 |
| 754 | 3300048922 | Ga0496119_0000955 | Ga0496119_0000955_2491_4152 | 553 |
| 755 | 3300048923 | Ga0496120_0003122 | Ga0496120_0003122_1245_2906 | 553 |
| 756 | 3300048927 | Ga0496124_0014868 | Ga0496124_0014868_4567_6228 | 553 |
| 757 | 3300048929 | Ga0496126_0001443 | Ga0496126_0001443_2518_4179 | 553 |
| 758 | 3300050507 | nmdc:mga05p37_90130_c1 | nmdc:mga05p37_90130_c1_1079_2740 | 553 |
| 759 | 3300050509 | nmdc:mga0qj67_625_c1 | nmdc:mga0qj67_625_c1_22496_24157 | 553 |
| 760 | iso_pu_bacteria | 2523231044 | 2523382508 | 553 |
| 761 | iso_pu_bacteria | 2622736605 | 2623499235 | 553 |
| 762 | 3300031251 | Ga0265327_10000001 | Ga0265327_10000001785 | 554 |
| 763 | 3300031456 | Ga0307513_10030020 | Ga0307513_100300205 | 554 |
| 764 | 3300047322 | Ga0495680_0120966 | Ga0495680_0120966_125_1789 | 554 |
| 765 | 3300048907 | Ga0496104_0067546 | Ga0496104_0067546_378_2042 | 554 |
| 766 | 3300048908 | Ga0496105_0007729 | Ga0496105_0007729_2551_4215 | 554 |
| 767 | 3300048911 | Ga0496108_0008237 | Ga0496108_0008237_2680_4344 | 554 |
| 768 | 3300048914 | Ga0496111_0008352 | Ga0496111_0008352_3809_5473 | 554 |
| 769 | 3300048917 | Ga0496114_0033633 | Ga0496114_0033633_88_1752 | 554 |
| 770 | 3300048926 | Ga0496123_0000112 | Ga0496123_0000112_43723_45426 | 554 |
| 771 | 3300048927 | Ga0496124_0001981 | Ga0496124_0001981_7366_9069 | 554 |
| 772 | 3300053153 | Ga0500616_0000775 | Ga0500616_0000775_34212_35915 | 554 |
| 773 | 3300013307 | Ga0157372_10006566 | Ga0157372_100065662 | 555 |
| 774 | 3300048912 | Ga0496109_0004746 | Ga0496109_0004746_5022_6725 | 555 |
| 775 | 3300048914 | Ga0496111_0068076 | Ga0496111_0068076_741_2444 | 555 |
| 776 | 3300048916 | Ga0496113_0026461 | Ga0496113_0026461_1457_3166 | 555 |
| 777 | 3300000549 | LJQas_1004648 | LJQas_10046481 | 557 |
| 778 | 3300005441 | Ga0070700_100000060 | Ga0070700_10000006051 | 557 |
| 779 | 3300013307 | Ga0157372_10000043 | Ga0157372_1000004319 | 557 |
| 780 | 3300026075 | Ga0207708_10000011 | Ga0207708_1000001197 | 557 |
| 781 | 3300045976 | Ga0466967_0000826 | Ga0466967_0000826_10849_12552 | 557 |
| 782 | 3300048929 | Ga0496126_0000003 | Ga0496126_0000003_692765_694441 | 557 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ern-assembly1.cif.gz_A | crystal structure of the c-terminal domain of human xpb/ercc-3 excision repair protein at 1.80 a | 0.8635 | 358 | 555 |
| 2fzl-assembly1.cif.gz_A | structure of c-terminal domain of archaeoglobus fulgidus xpb | 0.8489 | 358 | 514 |
| 5of4-assembly1.cif.gz_A | the cryo-em structure of human tfiih | 0.7955 | 144 | 555 |
| 6nmi-assembly1.cif.gz_A | cryo-em structure of the human tfiih core complex | 0.7871 | 4 | 555 |
| 8byq-assembly1.cif.gz_0 | rna polymerase ii pre-initiation complex with the proximal +1 nucleosome (pic-nuc10w) | 0.7812 | 2 | 555 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53873_347_537_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9634 | 355 | 543 | 3.40.50.300 |
| af_O53873_347_537_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9487 | 355 | 543 | 3.40.50.300 |
| af_A4I8L0_446_682_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9247 | 355 | 540 | 3.40.50.300 |
| af_Q4DHR0_563_781_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9074 | 354 | 545 | 3.40.50.300 |
| af_K7MUR9_1_82_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8926 | 391 | 462 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3ENH7-F1-model_v4 | Helicase-associated domain-containing protein | 1.001 | 4 | 88 |
GO:0004386
|
| AF-A0A7I7QHU4-F1-model_v4 | Helicase XPB/Ssl2 N-terminal domain-containing protein | 0.9923 | 1 | 76 |
|
| AF-A0A3D3KWG4-F1-model_v4 | Helicase | 0.9849 | 32 | 168 |
GO:0004386
|
| AF-A0A7C2KI15-F1-model_v4 | Helicase | 0.9791 | 2 | 76 |
GO:0004386
|
| AF-A0A519GKV0-F1-model_v4 | Helicase | 0.974 | 1 | 110 |
GO:0004386
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar