F480631

General Info

Members Datasets Scaffolds Average Seq Length
782 381 677 549

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0120103|Ga0495645_0120103_64_1707
Length 503
Sequence VSDGPLIVQSFAELERAPEHVHSYRLTPLGLWNARAAGLDAEKVLDTLLRYSRFPVPHSLLIDIEETMSRYGRLRLEKDPQHGLVMRTTDYPVLEEVIRAKKIAPLLGPRIDGETVVVHSSQRGQLKQLLLKLGWPAEDLAGYVDGTPHLIALNEDGWHLRPYQKLATENFWAGGSGVVVLPCGAGKTLVGQWKDELLKRTSLTEEEIGEYSGAVKEVRPVTIATYQVLTTKRGGLYPHLELVDGHDWGLIIYDEVHLLPAPIFRMTADLQARRRLGLTATLVREDGREGEVFSLIGPKRYDAPWKDIEAQGYIAPADCVEVRVDLPRDERVAYAMAEDADKYRLCATSETKTHLVEQLVALHQGEQLLVIGQYIDQLDEIGERLDAPVIKGDTTVKVRQKLFDAFRAGDIKTLVVSKVANFSIDLPEASVAIQVSGSFGSRQEEAQRLGRLLRPKQDGRAARFYSLVARDTLDQDFAAKRQRFLAEQGYAYRIMDAKDVPAA

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2547132424 Nocardia nova SH22a Isolate Unclassified
3 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
4 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
5 2558860280 Kutzneria sp. 744 Isolate Unclassified
6 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
7 2582580736 Prauserella sp. Am3 Isolate Unclassified
8 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
9 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
10 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
11 2643221575 Microbacterium sp. Root61 Isolate Unclassified
12 2643221597 Microbacterium sp. Root180 Isolate Unclassified
13 2643221613 Oerskovia sp. Root22 Isolate Unclassified
14 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
15 2643221692 Nocardia sp. Root136 Isolate Unclassified
16 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
17 2643221721 Oerskovia sp. Root918 Isolate Unclassified
18 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
19 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
20 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
21 2738541305 Nocardioides sp. CF167 Isolate Unclassified
22 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
23 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
24 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
25 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
26 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
27 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
28 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
29 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
30 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
31 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
32 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
33 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
34 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
35 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
36 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
37 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
38 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
39 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
40 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
41 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
42 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
43 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
44 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
45 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
46 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
47 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
48 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
49 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
50 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
51 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
52 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
53 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
54 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
55 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
56 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
57 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
58 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
59 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
60 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
61 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
62 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
63 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
64 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
65 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
66 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
67 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
68 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
69 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
70 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
71 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
72 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
73 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
74 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
75 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
76 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
77 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
78 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
79 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
80 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
81 2922554459 Rhodococcus sp. 66b Isolate Unclassified
82 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
83 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
84 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
85 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
86 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
87 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
88 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
89 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
90 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
91 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
92 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
93 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
94 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
95 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
96 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
97 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
98 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
99 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
100 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
101 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
102 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
103 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
104 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
105 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
107 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
108 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
109 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
110 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
111 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
112 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
113 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
114 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
115 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
116 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
117 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
118 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
119 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
120 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
121 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
122 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
123 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
124 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
125 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
126 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
127 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
128 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
129 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
130 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
131 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
132 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
133 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
134 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
135 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
136 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
137 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
138 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
139 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
140 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
141 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
142 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
143 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
144 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
145 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
146 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
147 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
148 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
149 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
150 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
151 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
152 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
153 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
154 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
155 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
156 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
157 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
158 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
159 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
160 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
161 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
162 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
163 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
164 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
165 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
166 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
167 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
168 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
169 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
170 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
171 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
172 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
173 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
174 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
175 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
176 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
177 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
178 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
179 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
180 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
181 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
182 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
183 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
184 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
185 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
186 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
187 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
188 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
189 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
190 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
191 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
192 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
193 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
194 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
195 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
196 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
197 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
198 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
199 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
200 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
201 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
202 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
203 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
204 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
256 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
260 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
261 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
262 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
263 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
264 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
265 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
266 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
267 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
268 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
269 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
270 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
271 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
272 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
273 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
274 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
275 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
276 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
277 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
278 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
279 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
280 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
281 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
282 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
283 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
284 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
285 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
286 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
287 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
288 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
289 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
290 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
291 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
292 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
293 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
294 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
295 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
296 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
297 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
298 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
301 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
302 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
303 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
308 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
311 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
327 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
331 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
332 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
333 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
334 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
335 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
336 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
337 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
358 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
362 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
363 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
364 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
365 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
371 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
372 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
373 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
374 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
375 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
376 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
377 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
378 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
379 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
380 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
381 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.57
Metatranscriptomes 0
Isolates 13.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 7.42
Nodule 0.13
Rhizoplane 11.13
Rhizosphere 64.07
Stem 0
Stem Tuber 0.13
Unclassified 17.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1004648 3300000549 Bacteria 1779
2 JGI24738J21930_10010039 3300002075 Bacteria 2117
3 JGI24744J21845_10000243 3300002077 Bacteria 8793
4 JGI24751J29686_10003232 3300002459 Bacteria 3277
5 JGI25406J46586_10001670 3300003203 Bacteria 10483
6 Ga0055540_1000022 3300003792 Bacteria 201257
7 Ga0055540_1001171 3300003792 Bacteria 16270
8 Ga0055540_1003464 3300003792 Bacteria 7619
9 Ga0055540_1007294 3300003792 Bacteria 4209
10 Ga0070682_100004581 3300005337 Bacteria 7685
11 Ga0070682_100018264 3300005337 Bacteria 4096
12 Ga0070682_100067463 3300005337 Bacteria 2278
13 Ga0068868_100008941 3300005338 Bacteria 7187
14 Ga0068868_100071612 3300005338 Bacteria 2764
15 Ga0070660_100072079 3300005339 Bacteria 2698
16 Ga0070660_100123226 3300005339 Bacteria 2070
17 Ga0070691_10001429 3300005341 Bacteria 10199
18 Ga0070687_100039272 3300005343 Bacteria 2377
19 Ga0070692_10006310 3300005345 Bacteria 5142
20 Ga0070668_100000201 3300005347 Bacteria 39161
21 Ga0070668_100000615 3300005347 Bacteria 23889
22 Ga0070668_100001887 3300005347 Bacteria 15322
23 Ga0070668_100011457 3300005347 Bacteria 6602
24 Ga0070668_100014548 3300005347 Bacteria 5879
25 Ga0070668_100038806 3300005347 Bacteria 3642
26 Ga0070671_100001715 3300005355 Bacteria 16641
27 Ga0070671_100005961 3300005355 Bacteria 9709
28 Ga0070671_100008029 3300005355 Bacteria 8448
29 Ga0070674_100002301 3300005356 Bacteria 10550
30 Ga0070674_100075845 3300005356 Bacteria 2389
31 Ga0070673_100133591 3300005364 Bacteria 2086
32 Ga0070659_100035727 3300005366 Bacteria 3871
33 Ga0070659_100070461 3300005366 Bacteria 2777
34 Ga0070667_100000142 3300005367 Bacteria 90696
35 Ga0070667_100019542 3300005367 Bacteria 5621
36 Ga0070667_100022439 3300005367 Bacteria 5235
37 Ga0070667_100032084 3300005367 Bacteria 4380
38 Ga0070714_100003715 3300005435 Bacteria 11438
39 Ga0070714_100005353 3300005435 Bacteria 9788
40 Ga0070714_100067900 3300005435 Bacteria 3076
41 Ga0070710_10001113 3300005437 Bacteria 12705
42 Ga0070710_10001176 3300005437 Bacteria 12351
43 Ga0070701_10007457 3300005438 Bacteria 4676
44 Ga0070711_100002471 3300005439 Bacteria 10552
45 Ga0070700_100000060 3300005441 Bacteria 82198
46 Ga0070700_100000263 3300005441 Bacteria 28075
47 Ga0070700_100018484 3300005441 Bacteria 4007
48 Ga0070663_100015748 3300005455 Bacteria 4891
49 Ga0070678_100001503 3300005456 Bacteria 12453
50 Ga0070678_100001635 3300005456 Bacteria 11996
51 Ga0070678_100017625 3300005456 Bacteria 4606
52 Ga0070678_100115369 3300005456 Bacteria 2108
53 Ga0070662_100001803 3300005457 Bacteria 13163
54 Ga0070681_10010877 3300005458 Bacteria 8995
55 Ga0068867_100000537 3300005459 Bacteria 24926
56 Ga0070685_10032022 3300005466 Bacteria 2943
57 Ga0070685_10055451 3300005466 Bacteria 2303
58 Ga0070684_100005591 3300005535 Bacteria 9655
59 Ga0068853_100001294 3300005539 Bacteria 17970
60 Ga0068853_100073585 3300005539 Bacteria 2980
61 Ga0068853_100086433 3300005539 Bacteria 2750
62 Ga0070686_100067740 3300005544 Bacteria 2327
63 Ga0070693_100016333 3300005547 Bacteria 3841
64 Ga0070665_100002109 3300005548 Bacteria 22245
65 Ga0070665_100003879 3300005548 Bacteria 15797
66 Ga0070665_100003927 3300005548 Bacteria 15691
67 Ga0070665_100014928 3300005548 Bacteria 7798
68 Ga0070704_100001099 3300005549 Bacteria 14040
69 Ga0070664_100052437 3300005564 Bacteria 3455
70 Ga0068857_100019728 3300005577 Bacteria 5922
71 Ga0068854_100001607 3300005578 Bacteria 13732
72 Ga0068856_100007085 3300005614 Bacteria 10948
73 Ga0068856_100031944 3300005614 Bacteria 5151
74 Ga0070702_100000302 3300005615 Bacteria 16928
75 Ga0070702_100000348 3300005615 Bacteria 16132
76 Ga0070702_100011550 3300005615 Bacteria 4395
77 Ga0070702_100014383 3300005615 Bacteria 4014
78 Ga0068852_100009739 3300005616 Bacteria 7142
79 Ga0068852_100013644 3300005616 Bacteria 6223
80 Ga0068859_100001155 3300005617 Bacteria 26941
81 Ga0068859_100002067 3300005617 Bacteria 20487
82 Ga0068859_100010099 3300005617 Bacteria 9514
83 Ga0068859_100023208 3300005617 Bacteria 6225
84 Ga0068864_100031268 3300005618 Bacteria 4516
85 Ga0068864_100033276 3300005618 Bacteria 4382
86 Ga0068866_10001689 3300005718 Bacteria 9291
87 Ga0068861_100000739 3300005719 Bacteria 19591
88 Ga0068870_10009251 3300005840 Bacteria 4473
89 Ga0068870_10017456 3300005840 Bacteria 3447
90 Ga0068863_100005764 3300005841 Bacteria 12154
91 Ga0068863_100033523 3300005841 Bacteria 4892
92 Ga0068863_100055722 3300005841 Bacteria 3743
93 Ga0068863_100122301 3300005841 Bacteria 2482
94 Ga0068858_100000001 3300005842 Bacteria 417735
95 Ga0068858_100002363 3300005842 Bacteria 19075
96 Ga0068858_100032090 3300005842 Bacteria 4878
97 Ga0068858_100054643 3300005842 Bacteria 3692
98 Ga0068858_100131561 3300005842 Bacteria 2347
99 Ga0068858_100226976 3300005842 Bacteria 1770
100 Ga0068860_100000160 3300005843 Bacteria 110266
101 Ga0068860_100001185 3300005843 Bacteria 28525
102 Ga0068860_100004520 3300005843 Bacteria 14197
103 Ga0068860_100006970 3300005843 Bacteria 11324
104 Ga0068860_100050073 3300005843 Bacteria 3978
105 Ga0068860_100073226 3300005843 Bacteria 3257
106 Ga0068862_100001362 3300005844 Bacteria 22694
107 Ga0068862_100018762 3300005844 Bacteria 5763
108 Ga0081455_10000037 3300005937 Bacteria 136059
109 Ga0081455_10086756 3300005937 Bacteria 2549
110 Ga0081540_1000721 3300005983 Bacteria 30491
111 Ga0081539_10000027 3300005985 Bacteria 328691
112 Ga0081539_10004065 3300005985 Bacteria 16734
113 Ga0070717_10075208 3300006028 Bacteria 2825
114 Ga0075365_10004459 3300006038 Bacteria 7419
115 Ga0075365_10021804 3300006038 Bacteria 4002
116 Ga0075365_10058065 3300006038 Bacteria 2575
117 Ga0075363_100005102 3300006048 Bacteria 5808
118 Ga0075363_100015345 3300006048 Bacteria 3764
119 Ga0075363_100016072 3300006048 Bacteria 3692
120 Ga0075363_100070037 3300006048 Bacteria 1904
121 Ga0075364_10000909 3300006051 Bacteria 15613
122 Ga0075364_10003441 3300006051 Bacteria 9003
123 Ga0075364_10003959 3300006051 Bacteria 8501
124 Ga0075364_10004852 3300006051 Bacteria 7792
125 Ga0075364_10005541 3300006051 Bacteria 7351
126 Ga0075364_10005904 3300006051 Bacteria 7153
127 Ga0075364_10015218 3300006051 Bacteria 4766
128 Ga0070716_100004733 3300006173 Bacteria 6528
129 Ga0070712_100000495 3300006175 Bacteria 22525
130 Ga0075362_10026509 3300006177 Bacteria 2476
131 Ga0075367_10004255 3300006178 Bacteria 6957
132 Ga0075369_10009876 3300006186 Bacteria 3723
133 Ga0075369_10010596 3300006186 Bacteria 3610
134 Ga0075369_10015319 3300006186 Bacteria 3075
135 Ga0075369_10016601 3300006186 Bacteria 2974
136 Ga0075370_10002764 3300006353 Bacteria 8218
137 Ga0075370_10009460 3300006353 Bacteria 5063
138 Ga0075428_100009516 3300006844 Bacteria 10789
139 Ga0075430_100002400 3300006846 Bacteria 15582
140 Ga0075433_10002276 3300006852 Bacteria 14605
141 Ga0075433_10067874 3300006852 Bacteria 3130
142 Ga0075434_100010515 3300006871 Bacteria 8677
143 Ga0075434_100025012 3300006871 Bacteria 5840
144 Ga0075429_100003965 3300006880 Bacteria 12658
145 Ga0068865_100000670 3300006881 Bacteria 19290
146 Ga0068865_100024875 3300006881 Bacteria 3932
147 Ga0068865_100066572 3300006881 Bacteria 2542
148 Ga0075436_100049293 3300006914 Bacteria 2905
149 Ga0097620_100001155 3300006931 Bacteria 26941
150 Ga0097620_100002067 3300006931 Bacteria 20487
151 Ga0097620_100010099 3300006931 Bacteria 9514
152 Ga0097620_100023209 3300006931 Bacteria 6225
153 Ga0075435_100059771 3300007076 Bacteria 3089
154 Ga0105251_10028937 3300009011 Bacteria 2795
155 Ga0105240_10145346 3300009093 Bacteria 2830
156 Ga0111539_10067342 3300009094 Bacteria 4229
157 Ga0111539_10079610 3300009094 Bacteria 3855
158 Ga0105245_10001945 3300009098 Bacteria 18742
159 Ga0105245_10010076 3300009098 Bacteria 8235
160 Ga0105245_10010496 3300009098 Bacteria 8060
161 Ga0105247_10000078 3300009101 Bacteria 110404
162 Ga0105247_10000433 3300009101 Bacteria 35512
163 Ga0105247_10002992 3300009101 Bacteria 11205
164 Ga0105247_10034572 3300009101 Bacteria 3078
165 Ga0105247_10061113 3300009101 Bacteria 2336
166 Ga0114129_10024424 3300009147 Bacteria 8563
167 Ga0105243_10001024 3300009148 Bacteria 25840
168 Ga0105243_10001959 3300009148 Bacteria 17537
169 Ga0105243_10012407 3300009148 Bacteria 6441
170 Ga0105241_10018126 3300009174 Bacteria 5177
171 Ga0105241_10144966 3300009174 Bacteria 1937
172 Ga0105242_10000858 3300009176 Bacteria 23563
173 Ga0105248_10000082 3300009177 Bacteria 110759
174 Ga0105248_10000529 3300009177 Bacteria 43587
175 Ga0105248_10001630 3300009177 Bacteria 24938
176 Ga0105248_10019600 3300009177 Bacteria 7486
177 Ga0105237_10016390 3300009545 Bacteria 7702
178 Ga0105237_10062552 3300009545 Bacteria 3722
179 Ga0105237_10066578 3300009545 Bacteria 3597
180 Ga0105238_10110263 3300009551 Bacteria 2733
181 Ga0105238_10175641 3300009551 Bacteria 2118
182 Ga0105249_10000031 3300009553 Bacteria 220006
183 Ga0105249_10002952 3300009553 Bacteria 14673
184 Ga0105249_10027800 3300009553 Bacteria 5104
185 Ga0105239_10022402 3300010375 Bacteria 6964
186 Ga0105239_10022852 3300010375 Bacteria 6894
187 Ga0105239_10030418 3300010375 Bacteria 5937
188 Ga0157371_10049584 3300013102 Bacteria 2982
189 Ga0157369_10058658 3300013105 Bacteria 4152
190 Ga0157374_10041716 3300013296 Bacteria 4231
191 Ga0157378_10002386 3300013297 Bacteria 16682
192 Ga0163162_10005790 3300013306 Bacteria 11961
193 Ga0157372_10000043 3300013307 Bacteria 153958
194 Ga0157372_10006566 3300013307 Bacteria 12376
195 Ga0157372_10291277 3300013307 Bacteria 1899
196 Ga0157375_10000849 3300013308 Bacteria 26601
197 Ga0157375_10076209 3300013308 Bacteria 3380
198 Ga0163163_10126191 3300014325 Bacteria 2597
199 Ga0157380_10000339 3300014326 Bacteria 27956
200 Ga0157377_10049674 3300014745 Bacteria 2359
201 Ga0157379_10000059 3300014968 Bacteria 69772
202 Ga0157379_10034320 3300014968 Bacteria 4523
203 Ga0157376_10054823 3300014969 Bacteria 3325
204 Ga0157376_10096996 3300014969 Bacteria 2567
205 Ga0163161_10000520 3300017792 Bacteria 31388
206 Ga0163161_10006431 3300017792 Bacteria 8133
207 Ga0213873_10000029 3300021358 Bacteria 59669
208 Ga0213876_10003631 3300021384 Bacteria 8775
209 Ga0213876_10009868 3300021384 Bacteria 5137
210 Ga0213875_10000107 3300021388 Bacteria 95120
211 Ga0209646_1000013 3300025246 Bacteria 565830
212 Ga0209051_1000033 3300025303 Bacteria 380540
213 Ga0209051_1000522 3300025303 Bacteria 48068
214 Ga0207692_10001017 3300025898 Bacteria 10238
215 Ga0207692_10008372 3300025898 Bacteria 4276
216 Ga0207642_10000168 3300025899 Bacteria 18725
217 Ga0207642_10006957 3300025899 Bacteria 3791
218 Ga0207710_10000022 3300025900 Bacteria 335632
219 Ga0207710_10001549 3300025900 Bacteria 11317
220 Ga0207710_10003170 3300025900 Bacteria 7361
221 Ga0207688_10001068 3300025901 Bacteria 14029
222 Ga0207688_10004452 3300025901 Bacteria 7628
223 Ga0207688_10012472 3300025901 Bacteria 4625
224 Ga0207688_10021944 3300025901 Bacteria 3491
225 Ga0207685_10026226 3300025905 Bacteria 2024
226 Ga0207645_10012204 3300025907 Bacteria 5835
227 Ga0207643_10003801 3300025908 Bacteria 8118
228 Ga0207643_10008726 3300025908 Bacteria 5438
229 Ga0207707_10025790 3300025912 Bacteria 5140
230 Ga0207695_10108612 3300025913 Bacteria 2758
231 Ga0207671_10039228 3300025914 Bacteria 3507
232 Ga0207671_10040164 3300025914 Bacteria 3463
233 Ga0207693_10000660 3300025915 Bacteria 30957
234 Ga0207693_10006124 3300025915 Bacteria 9969
235 Ga0207663_10009121 3300025916 Bacteria 5230
236 Ga0207662_10015525 3300025918 Bacteria 4285
237 Ga0207657_10005196 3300025919 Bacteria 13648
238 Ga0207657_10033559 3300025919 Bacteria 4625
239 Ga0207657_10051157 3300025919 Bacteria 3591
240 Ga0207657_10090275 3300025919 Bacteria 2557
241 Ga0207681_10002764 3300025923 Bacteria 11101
242 Ga0207650_10122133 3300025925 Bacteria 2029
243 Ga0207659_10011879 3300025926 Bacteria 5516
244 Ga0207659_10021377 3300025926 Bacteria 4294
245 Ga0207687_10002929 3300025927 Bacteria 11592
246 Ga0207687_10031545 3300025927 Bacteria 3582
247 Ga0207664_10003887 3300025929 Bacteria 10037
248 Ga0207664_10012443 3300025929 Bacteria 6083
249 Ga0207644_10001206 3300025931 Bacteria 16653
250 Ga0207644_10130833 3300025931 Bacteria 1921
251 Ga0207690_10027585 3300025932 Bacteria 3590
252 Ga0207706_10030916 3300025933 Bacteria 4775
253 Ga0207706_10043240 3300025933 Bacteria 3993
254 Ga0207686_10019544 3300025934 Bacteria 3856
255 Ga0207709_10000403 3300025935 Bacteria 42327
256 Ga0207709_10002099 3300025935 Bacteria 12841
257 Ga0207670_10078589 3300025936 Bacteria 2301
258 Ga0207669_10000218 3300025937 Bacteria 26144
259 Ga0207669_10012363 3300025937 Bacteria 4194
260 Ga0207704_10000179 3300025938 Bacteria 33399
261 Ga0207665_10001092 3300025939 Bacteria 18256
262 Ga0207665_10022418 3300025939 Bacteria 4154
263 Ga0207691_10114480 3300025940 Bacteria 2396
264 Ga0207711_10000537 3300025941 Bacteria 38776
265 Ga0207711_10000984 3300025941 Bacteria 27321
266 Ga0207711_10052620 3300025941 Bacteria 3490
267 Ga0207689_10005136 3300025942 Bacteria 11771
268 Ga0207689_10007350 3300025942 Bacteria 9661
269 Ga0207689_10078010 3300025942 Bacteria 2722
270 Ga0207661_10000336 3300025944 Bacteria 29965
271 Ga0207661_10007063 3300025944 Bacteria 7970
272 Ga0207667_10048085 3300025949 Bacteria 4512
273 Ga0207712_10000029 3300025961 Bacteria 220014
274 Ga0207712_10007142 3300025961 Bacteria 7045
275 Ga0207712_10011992 3300025961 Bacteria 5530
276 Ga0207712_10112856 3300025961 Bacteria 2042
277 Ga0207668_10021344 3300025972 Bacteria 4129
278 Ga0207668_10023553 3300025972 Bacteria 3960
279 Ga0207668_10030405 3300025972 Bacteria 3549
280 Ga0207668_10031722 3300025972 Bacteria 3484
281 Ga0207668_10039325 3300025972 Bacteria 3183
282 Ga0207668_10066456 3300025972 Bacteria 2556
283 Ga0207640_10011928 3300025981 Bacteria 4936
284 Ga0207640_10025372 3300025981 Bacteria 3587
285 Ga0207658_10000113 3300025986 Bacteria 88960
286 Ga0207658_10005096 3300025986 Bacteria 9041
287 Ga0207658_10005645 3300025986 Bacteria 8564
288 Ga0207658_10007864 3300025986 Bacteria 7261
289 Ga0207658_10049078 3300025986 Bacteria 3100
290 Ga0207677_10003639 3300026023 Bacteria 8177
291 Ga0207703_10000007 3300026035 Bacteria 418220
292 Ga0207703_10002619 3300026035 Bacteria 15524
293 Ga0207703_10018063 3300026035 Bacteria 5508
294 Ga0207703_10108834 3300026035 Bacteria 2361
295 Ga0207639_10002773 3300026041 Bacteria 11772
296 Ga0207639_10006160 3300026041 Bacteria 8142
297 Ga0207639_10017635 3300026041 Bacteria 5063
298 Ga0207678_10001699 3300026067 Bacteria 20192
299 Ga0207678_10001762 3300026067 Bacteria 19813
300 Ga0207678_10016730 3300026067 Bacteria 6441
301 Ga0207678_10032838 3300026067 Bacteria 4523
302 Ga0207678_10120046 3300026067 Bacteria 2243
303 Ga0207678_10152661 3300026067 Bacteria 1972
304 Ga0207708_10000011 3300026075 Bacteria 214227
305 Ga0207708_10000787 3300026075 Bacteria 23921
306 Ga0207708_10015233 3300026075 Bacteria 5765
307 Ga0207708_10019442 3300026075 Bacteria 5120
308 Ga0207708_10023482 3300026075 Bacteria 4662
309 Ga0207702_10006673 3300026078 Bacteria 9922
310 Ga0207702_10012393 3300026078 Bacteria 7100
311 Ga0207641_10001078 3300026088 Bacteria 27457
312 Ga0207641_10003451 3300026088 Bacteria 13997
313 Ga0207641_10007179 3300026088 Bacteria 9289
314 Ga0207641_10036367 3300026088 Bacteria 4110
315 Ga0207641_10199888 3300026088 Bacteria 1842
316 Ga0207648_10001756 3300026089 Bacteria 23738
317 Ga0207676_10000648 3300026095 Bacteria 27886
318 Ga0207676_10040766 3300026095 Bacteria 3560
319 Ga0207674_10087561 3300026116 Bacteria 3108
320 Ga0207675_100012899 3300026118 Bacteria 7804
321 Ga0207675_100013553 3300026118 Bacteria 7608
322 Ga0207675_100025670 3300026118 Bacteria 5483
323 Ga0207675_100054188 3300026118 Bacteria 3741
324 Ga0207683_10000990 3300026121 Bacteria 26040
325 Ga0207683_10010775 3300026121 Bacteria 7796
326 Ga0207698_10082103 3300026142 Bacteria 2604
327 Ga0207428_10003435 3300027907 Bacteria 15399
328 Ga0268266_10009419 3300028379 Bacteria 8602
329 Ga0268266_10077071 3300028379 Bacteria 2898
330 Ga0268265_10000040 3300028380 Bacteria 194156
331 Ga0268265_10089979 3300028380 Bacteria 2450
332 Ga0268264_10000017 3300028381 Bacteria 498037
333 Ga0268264_10001011 3300028381 Bacteria 28540
334 Ga0268264_10002402 3300028381 Bacteria 16495
335 Ga0268264_10012556 3300028381 Bacteria 6977
336 Ga0268264_10025689 3300028381 Bacteria 4811
337 Ga0307515_10076325 3300028794 Bacteria 4448
338 Ga0307515_10181759 3300028794 Bacteria 2050
339 Ga0307511_10004169 3300030521 Bacteria 14748
340 Ga0265327_10000001 3300031251 Bacteria 894475
341 Ga0265327_10000246 3300031251 Bacteria 107698
342 Ga0265327_10004008 3300031251 Bacteria 13407
343 Ga0265327_10007848 3300031251 Bacteria 8120
344 Ga0307513_10013872 3300031456 Bacteria 9876
345 Ga0307513_10015902 3300031456 Bacteria 9100
346 Ga0307513_10030020 3300031456 Bacteria 6182
347 Ga0307513_10194970 3300031456 Bacteria 1873
348 Ga0307509_10128169 3300031507 Bacteria 2499
349 Ga0316576_10062456 3300031727 Bacteria 2732
350 Ga0316578_10073153 3300031728 Bacteria 2031
351 Ga0307413_10013873 3300031824 Bacteria 4072
352 Ga0307413_10035375 3300031824 Bacteria 2864
353 Ga0307413_10060523 3300031824 Bacteria 2332
354 Ga0307518_10001174 3300031838 Bacteria 19654
355 Ga0307406_10002217 3300031901 Bacteria 10578
356 Ga0307406_10039914 3300031901 Bacteria 2915
357 Ga0307406_10049904 3300031901 Bacteria 2650
358 Ga0307407_10035838 3300031903 Bacteria 2729
359 Ga0307409_100125553 3300031995 Bacteria 2182
360 Ga0307414_10005384 3300032004 Bacteria 7047
361 Ga0307414_10087370 3300032004 Bacteria 2304
362 Ga0307411_10053252 3300032005 Bacteria 2650
363 Ga0307507_10032585 3300033179 Bacteria 5435
364 Ga0307507_10055053 3300033179 Bacteria 3775
365 Ga0307507_10069783 3300033179 Bacteria 3194
366 Ga0373929_0008480 3300035085 Bacteria 1895
367 Ga0373932_0002256 3300035112 Bacteria 4929
368 Ga0373939_0007946 3300035114 Bacteria 2590
369 Ga0373956_0008848 3300035119 Bacteria 4079
370 Ga0373931_0005726 3300035691 Bacteria 5774
371 Ga0373935_0013072 3300035692 Bacteria 5005
372 Ga0316584_0029064 3300036712 Bacteria 4080
373 Ga0395898_0073122 3300037466 Bacteria 3311
374 Ga0436364_0027535 3300037853 Bacteria 18218
375 Ga0436364_0176067 3300037853 Bacteria 29049
376 Ga0436364_0199133 3300037853 Bacteria 11894
377 Ga0436364_0588322 3300037853 Bacteria 80195
378 Ga0436364_1272092 3300037853 Bacteria 3454
379 Ga0436364_1442134 3300037853 Bacteria 6633
380 Ga0395901_0049692 3300038443 Bacteria 4358
381 Ga0436365_0469598 3300039437 Bacteria 28546
382 Ga0436365_1752709 3300039437 Bacteria 4445
383 Ga0436365_1937384 3300039437 Bacteria 8653
384 Ga0436362_1138695 3300039453 Bacteria 75889
385 Ga0439466_0013297 3300041411 Bacteria 3013
386 Ga0439466_0021325 3300041411 Bacteria 2298
387 Ga0439465_0000494 3300041413 Bacteria 11749
388 Ga0439465_0014233 3300041413 Bacteria 2479
389 Ga0439465_0014375 3300041413 Bacteria 2466
390 Ga0439442_002799 3300042002 Bacteria 3428
391 Ga0439463_010926 3300042016 Bacteria 2230
392 Ga0466969_0005292 3300044656 Bacteria 6865
393 Ga0466969_0046570 3300044656 Bacteria 2150
394 Ga0466972_0004319 3300044658 Bacteria 7102
395 Ga0466972_0027626 3300044658 Bacteria 2807
396 Ga0466972_0029218 3300044658 Bacteria 2714
397 Ga0466965_0000275 3300044683 Bacteria 16932
398 Ga0466965_0004062 3300044683 Bacteria 6492
399 Ga0466965_0007407 3300044683 Bacteria 5036
400 Ga0466965_0017991 3300044683 Bacteria 3382
401 Ga0466965_0028032 3300044683 Bacteria 2734
402 Ga0466966_0000383 3300044684 Bacteria 28757
403 Ga0466966_0002032 3300044684 Bacteria 13139
404 Ga0466966_0008971 3300044684 Bacteria 6627
405 Ga0466966_0012074 3300044684 Bacteria 5723
406 Ga0466966_0021938 3300044684 Bacteria 4192
407 Ga0466961_0015417 3300044693 Bacteria 4906
408 Ga0466961_0025106 3300044693 Bacteria 3835
409 Ga0466961_0034187 3300044693 Bacteria 3264
410 Ga0466963_0002388 3300044694 Bacteria 10498
411 Ga0466963_0021084 3300044694 Bacteria 4106
412 Ga0466963_0099438 3300044694 Bacteria 1990
413 Ga0466971_0007997 3300044719 Bacteria 4610
414 Ga0466971_0013303 3300044719 Bacteria 3613
415 Ga0466968_0000430 3300044735 Bacteria 14028
416 Ga0466970_0004625 3300044765 Bacteria 6790
417 Ga0466970_0005929 3300044765 Bacteria 6091
418 Ga0466970_0013380 3300044765 Bacteria 4206
419 Ga0466970_0031333 3300044765 Bacteria 2809
420 Ga0466957_0002803 3300044842 Bacteria 9429
421 Ga0466957_0003491 3300044842 Bacteria 8636
422 Ga0466957_0004855 3300044842 Bacteria 7523
423 Ga0466957_0021211 3300044842 Bacteria 3827
424 Ga0466957_0090270 3300044842 Bacteria 1919
425 Ga0466960_0000814 3300044901 Bacteria 10975
426 Ga0466960_0004932 3300044901 Bacteria 5250
427 Ga0466960_0034982 3300044901 Bacteria 2344
428 Ga0466959_0003979 3300045049 Bacteria 9821
429 Ga0466959_0043527 3300045049 Bacteria 3309
430 Ga0466959_0046062 3300045049 Bacteria 3210
431 Ga0466959_0082318 3300045049 Bacteria 2318
432 Ga0466958_0000206 3300045836 Bacteria 21886
433 Ga0466958_0021001 3300045836 Bacteria 3812
434 Ga0466958_0039218 3300045836 Bacteria 2845
435 Ga0466967_0000826 3300045976 Bacteria 16303
436 Ga0466967_0000939 3300045976 Bacteria 15697
437 Ga0466967_0010955 3300045976 Bacteria 6835
438 Ga0466967_0011444 3300045976 Bacteria 6720
439 Ga0466967_0013978 3300045976 Bacteria 6231
440 Ga0466967_0033305 3300045976 Bacteria 4360
441 Ga0466967_0041422 3300045976 Bacteria 3971
442 Ga0466967_0041684 3300045976 Bacteria 3961
443 Ga0466967_0042430 3300045976 Bacteria 3931
444 Ga0466967_0057635 3300045976 Bacteria 3430
445 Ga0466967_0064898 3300045976 Bacteria 3248
446 Ga0466967_0104156 3300045976 Bacteria 2597
447 Ga0466967_0119455 3300045976 Bacteria 2433
448 Ga0495638_0014115 3300046460 Bacteria 5410
449 Ga0495607_0070804 3300046501 Bacteria 1947
450 Ga0495645_0016336 3300046543 Bacteria 5297
451 Ga0495645_0120103 3300046543 Bacteria 1851
452 Ga0495668_0000416 3300046616 Bacteria 55560
453 Ga0495672_0014117 3300047320 Bacteria 5480
454 Ga0495680_0120966 3300047322 Bacteria 1933
455 Ga0495683_0001820 3300047323 Bacteria 13415
456 Ga0495673_0009180 3300047469 Bacteria 5489
457 Ga0495686_0020947 3300047472 Bacteria 4353
458 Ga0495593_0012739 3300047673 Bacteria 4801
459 Ga0496100_0000349 3300048903 Bacteria 22460
460 Ga0496100_0001640 3300048903 Bacteria 11082
461 Ga0496100_0002069 3300048903 Bacteria 10081
462 Ga0496100_0002259 3300048903 Bacteria 9734
463 Ga0496100_0004837 3300048903 Bacteria 7194
464 Ga0496101_0000032 3300048904 Bacteria 186783
465 Ga0496101_0000395 3300048904 Bacteria 28467
466 Ga0496101_0002865 3300048904 Bacteria 10603
467 Ga0496101_0004338 3300048904 Bacteria 8900
468 Ga0496101_0009675 3300048904 Bacteria 6342
469 Ga0496102_0000011 3300048905 Bacteria 321716
470 Ga0496102_0000023 3300048905 Bacteria 237015
471 Ga0496102_0000197 3300048905 Bacteria 81788
472 Ga0496102_0000574 3300048905 Bacteria 39023
473 Ga0496102_0000843 3300048905 Bacteria 29444
474 Ga0496102_0002308 3300048905 Bacteria 16298
475 Ga0496102_0006976 3300048905 Bacteria 9638
476 Ga0496102_0018773 3300048905 Bacteria 6082
477 Ga0496102_0018834 3300048905 Bacteria 6072
478 Ga0496102_0069154 3300048905 Bacteria 3241
479 Ga0496102_0071876 3300048905 Bacteria 3177
480 Ga0496102_0142337 3300048905 Bacteria 2249
481 Ga0496103_0000380 3300048906 Bacteria 39723
482 Ga0496103_0000431 3300048906 Bacteria 36468
483 Ga0496103_0000601 3300048906 Bacteria 28248
484 Ga0496103_0001721 3300048906 Bacteria 14296
485 Ga0496103_0002336 3300048906 Bacteria 11987
486 Ga0496103_0002956 3300048906 Bacteria 10534
487 Ga0496103_0004680 3300048906 Bacteria 8281
488 Ga0496104_0006108 3300048907 Bacteria 10574
489 Ga0496104_0067546 3300048907 Bacteria 3396
490 Ga0496105_0001822 3300048908 Bacteria 15267
491 Ga0496105_0007333 3300048908 Bacteria 8523
492 Ga0496105_0007729 3300048908 Bacteria 8342
493 Ga0496105_0012058 3300048908 Bacteria 6842
494 Ga0496105_0022610 3300048908 Bacteria 5093
495 Ga0496105_0113769 3300048908 Bacteria 2232
496 Ga0496106_0001288 3300048909 Bacteria 18824
497 Ga0496106_0002693 3300048909 Bacteria 13194
498 Ga0496106_0004909 3300048909 Bacteria 9897
499 Ga0496106_0009349 3300048909 Bacteria 7246
500 Ga0496106_0016797 3300048909 Bacteria 5415
501 Ga0496106_0076602 3300048909 Bacteria 2564
502 Ga0496107_0000825 3300048910 Bacteria 18053
503 Ga0496107_0002530 3300048910 Bacteria 11903
504 Ga0496107_0007236 3300048910 Bacteria 7647
505 Ga0496107_0014387 3300048910 Bacteria 5541
506 Ga0496107_0058117 3300048910 Bacteria 2796
507 Ga0496108_0001112 3300048911 Bacteria 21027
508 Ga0496108_0003052 3300048911 Bacteria 13459
509 Ga0496108_0003096 3300048911 Bacteria 13370
510 Ga0496108_0008237 3300048911 Bacteria 8460
511 Ga0496108_0029168 3300048911 Bacteria 4568
512 Ga0496108_0051738 3300048911 Bacteria 3441
513 Ga0496109_0000030 3300048912 Bacteria 164120
514 Ga0496109_0004746 3300048912 Bacteria 11362
515 Ga0496109_0011438 3300048912 Bacteria 7630
516 Ga0496109_0017265 3300048912 Bacteria 6323
517 Ga0496109_0028087 3300048912 Bacteria 5030
518 Ga0496109_0051500 3300048912 Bacteria 3750
519 Ga0496109_0062928 3300048912 Bacteria 3393
520 Ga0496109_0244742 3300048912 Bacteria 1688
521 Ga0496110_0011169 3300048913 Bacteria 7340
522 Ga0496110_0014954 3300048913 Bacteria 6452
523 Ga0496110_0015646 3300048913 Bacteria 6319
524 Ga0496110_0023908 3300048913 Bacteria 5203
525 Ga0496110_0036623 3300048913 Bacteria 4261
526 Ga0496111_0000966 3300048914 Bacteria 15698
527 Ga0496111_0008352 3300048914 Bacteria 6846
528 Ga0496111_0068076 3300048914 Bacteria 2587
529 Ga0496111_0074693 3300048914 Bacteria 2469
530 Ga0496112_0019350 3300048915 Bacteria 6425
531 Ga0496112_0073110 3300048915 Bacteria 3389
532 Ga0496112_0127879 3300048915 Bacteria 2511
533 Ga0496113_0003716 3300048916 Bacteria 9201
534 Ga0496113_0010464 3300048916 Bacteria 6133
535 Ga0496113_0026461 3300048916 Bacteria 4148
536 Ga0496113_0037112 3300048916 Bacteria 3574
537 Ga0496113_0047728 3300048916 Bacteria 3183
538 Ga0496114_0000312 3300048917 Bacteria 35518
539 Ga0496114_0003137 3300048917 Bacteria 12682
540 Ga0496114_0033633 3300048917 Bacteria 4225
541 Ga0496114_0083411 3300048917 Bacteria 2704
542 Ga0496115_0006543 3300048918 Bacteria 8541
543 Ga0496115_0016805 3300048918 Bacteria 5578
544 Ga0496115_0032165 3300048918 Bacteria 4138
545 Ga0496115_0095828 3300048918 Bacteria 2429
546 Ga0496116_0000072 3300048919 Bacteria 238158
547 Ga0496116_0000183 3300048919 Bacteria 124744
548 Ga0496116_0005015 3300048919 Bacteria 12469
549 Ga0496117_0000039 3300048920 Bacteria 322143
550 Ga0496117_0000059 3300048920 Bacteria 260163
551 Ga0496117_0000160 3300048920 Bacteria 141709
552 Ga0496117_0001520 3300048920 Bacteria 33158
553 Ga0496117_0008919 3300048920 Bacteria 9444
554 Ga0496118_0000035 3300048921 Bacteria 322143
555 Ga0496118_0000391 3300048921 Bacteria 74169
556 Ga0496118_0001225 3300048921 Bacteria 39433
557 Ga0496118_0001938 3300048921 Bacteria 29323
558 Ga0496118_0002342 3300048921 Bacteria 25692
559 Ga0496118_0008772 3300048921 Bacteria 10365
560 Ga0496118_0011076 3300048921 Bacteria 8852
561 Ga0496118_0041278 3300048921 Bacteria 3655
562 Ga0496119_0000091 3300048922 Bacteria 133090
563 Ga0496119_0000517 3300048922 Bacteria 52595
564 Ga0496119_0000955 3300048922 Bacteria 37211
565 Ga0496119_0002122 3300048922 Bacteria 22313
566 Ga0496119_0009193 3300048922 Bacteria 8530
567 Ga0496120_0000631 3300048923 Bacteria 52495
568 Ga0496120_0003122 3300048923 Bacteria 15534
569 Ga0496120_0004323 3300048923 Bacteria 12017
570 Ga0496120_0029527 3300048923 Bacteria 3346
571 Ga0496121_0000004 3300048924 Bacteria 1139011
572 Ga0496121_0002639 3300048924 Bacteria 26992
573 Ga0496121_0009366 3300048924 Bacteria 11279
574 Ga0496122_0000173 3300048925 Bacteria 153768
575 Ga0496122_0035996 3300048925 Bacteria 4014
576 Ga0496123_0000112 3300048926 Bacteria 163990
577 Ga0496123_0029542 3300048926 Bacteria 4031
578 Ga0496123_0045539 3300048926 Bacteria 2987
579 Ga0496124_0000012 3300048927 Bacteria 512581
580 Ga0496124_0000198 3300048927 Bacteria 119277
581 Ga0496124_0001981 3300048927 Bacteria 27911
582 Ga0496124_0014868 3300048927 Bacteria 7498
583 Ga0496124_0085754 3300048927 Bacteria 2579
584 Ga0496125_0000003 3300048928 Bacteria 1189767
585 Ga0496125_0004177 3300048928 Bacteria 16833
586 Ga0496125_0008481 3300048928 Bacteria 10755
587 Ga0496125_0016337 3300048928 Bacteria 7132
588 Ga0496125_0039512 3300048928 Bacteria 4060
589 Ga0496126_0000001 3300048929 Bacteria 1139011
590 Ga0496126_0000003 3300048929 Bacteria 961576
591 Ga0496126_0001443 3300048929 Bacteria 37279
592 Ga0496126_0002899 3300048929 Bacteria 22357
593 Ga0496126_0003942 3300048929 Bacteria 18162
594 Ga0496126_0047978 3300048929 Bacteria 3907
595 Ga0496126_0084227 3300048929 Bacteria 2804
596 Ga0501032_0004394 3300049569 Bacteria 10643
597 Ga0501032_0011902 3300049569 Bacteria 6231
598 Ga0501032_0020513 3300049569 Bacteria 4601
599 Ga0501033_0023356 3300049570 Bacteria 4664
600 Ga0501034_0006718 3300049571 Bacteria 12334
601 Ga0501034_0032801 3300049571 Bacteria 5273
602 Ga0501034_0042485 3300049571 Bacteria 4602
603 Ga0501036_0009567 3300049572 Bacteria 7973
604 Ga0501036_0057046 3300049572 Bacteria 3308
605 Ga0501037_0000472 3300049573 Bacteria 32649
606 Ga0501038_0021465 3300049574 Bacteria 5795
607 Ga0501038_0022457 3300049574 Bacteria 5653
608 Ga0501038_0050901 3300049574 Bacteria 3577
609 Ga0501039_0026706 3300049575 Bacteria 4437
610 Ga0501042_0013571 3300049578 Bacteria 5546
611 Ga0501043_0009851 3300049579 Bacteria 7492
612 Ga0501043_0010216 3300049579 Bacteria 7358
613 Ga0501046_0002992 3300049580 Bacteria 15622
614 Ga0501046_0030155 3300049580 Bacteria 4403
615 Ga0501047_0016518 3300049581 Bacteria 7046
616 Ga0501047_0030201 3300049581 Bacteria 5226
617 Ga0501047_0090558 3300049581 Bacteria 2936
618 Ga0501070_0001241 3300049586 Bacteria 22855
619 Ga0501070_0014359 3300049586 Bacteria 6665
620 Ga0501070_0070490 3300049586 Bacteria 2894
621 Ga0501073_0024507 3300049589 Bacteria 4332
622 Ga0501083_0000096 3300049744 Bacteria 59671
623 Ga0501035_0001109 3300049822 Bacteria 28210
624 Ga0501035_0016404 3300049822 Bacteria 6832
625 Ga0501035_0125425 3300049822 Bacteria 2241
626 Ga0501044_0000797 3300049823 Bacteria 38010
627 Ga0501044_0002911 3300049823 Bacteria 19485
628 Ga0501044_0015830 3300049823 Bacteria 8115
629 Ga0501044_0018439 3300049823 Bacteria 7477
630 Ga0501044_0025322 3300049823 Bacteria 6288
631 Ga0501044_0075399 3300049823 Bacteria 3425
632 nmdc:mga03683_26362_c1 3300050489 Bacteria 2292
633 nmdc:mga03683_41148_c1 3300050489 Bacteria 1898
634 nmdc:mga03n38_22049_c1 3300050490 Bacteria 2572
635 nmdc:mga03n38_25115_c1 3300050490 Bacteria 2443
636 nmdc:mga03n38_36106_c1 3300050490 Bacteria 2123
637 nmdc:mga00v17_11207_c1 3300050491 Bacteria 4923
638 nmdc:mga00v17_13555_c2 3300050491 Bacteria 3608
639 nmdc:mga00v17_18058_c1 3300050491 Bacteria 4004
640 nmdc:mga00v17_27447_c1 3300050491 Bacteria 3324
641 nmdc:mga00v17_3655_c1 3300050491 Bacteria 7947
642 nmdc:mga00v17_9321_c1 3300050491 Bacteria 5309
643 nmdc:mga0yw44_1098_c1 3300050492 Bacteria 10401
644 nmdc:mga0yw44_11042_c1 3300050492 Bacteria 4640
645 nmdc:mga0yw44_12878_c1 3300050492 Bacteria 4379
646 nmdc:mga0yw44_2411_c1 3300050492 Bacteria 7956
647 nmdc:mga0yw44_64387_c1 3300050492 Bacteria 2256
648 nmdc:mga04h51_18621_c1 3300050495 Bacteria 2047
649 nmdc:mga07m45_10742_c2 3300050496 Bacteria 4177
650 nmdc:mga07m45_41765_c1 3300050496 Bacteria 2569
651 nmdc:mga05p37_26066_c1 3300050507 Bacteria 7108
652 nmdc:mga05p37_57408_c1 3300050507 Bacteria 4795
653 nmdc:mga05p37_90130_c1 3300050507 Bacteria 3779
654 nmdc:mga0qj67_19159_c1 3300050509 Bacteria 5226
655 nmdc:mga0qj67_625_c1 3300050509 Bacteria 24268
656 nmdc:mga06r32_6912_c1 3300050510 Bacteria 10200
657 nmdc:mga0n895_37484_c1 3300050512 Bacteria 4691
658 nmdc:mga0n895_7764_c1 3300050512 Bacteria 9243
659 nmdc:mga0rr50_3031_c1 3300050513 Bacteria 9611
660 nmdc:mga0rr50_4305_c1 3300050513 Bacteria 8339
661 nmdc:mga08x19_34101_c1 3300050514 Bacteria 3216
662 nmdc:mga08x19_45646_c1 3300050514 Bacteria 2800
663 nmdc:mga0a205_11234_c1 3300050515 Bacteria 8241
664 nmdc:mga0a205_618_c1 3300050515 Bacteria 28265
665 nmdc:mga0sz30_15725_c1 3300050516 Bacteria 2993
666 nmdc:mga0sz30_2686_c1 3300050516 Bacteria 6338
667 nmdc:mga0sz30_32252_c1 3300050516 Bacteria 2172
668 Ga0500635_0002464 3300053080 Bacteria 4590
669 Ga0500643_005081 3300053087 Bacteria 5752
670 Ga0500643_013401 3300053087 Bacteria 2895
671 Ga0500652_004008 3300053131 Bacteria 4510
672 Ga0500616_0000775 3300053153 Bacteria 36758
673 Ga0500616_0004319 3300053153 Bacteria 10188
674 Ga0500616_0011037 3300053153 Bacteria 5375
675 Ga0500645_000025 3300053730 Bacteria 125835
676 Ga0466962_0002665 3300061719 Bacteria 8490
677 Ga0466962_0008336 3300061719 Bacteria 4966

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005841 Ga0068863_100122301 Ga0068863_1001223012 496
2 3300046543 Ga0495645_0120103 Ga0495645_0120103_64_1707 502
3 3300031456 Ga0307513_10194970 Ga0307513_101949701 503
4 3300003792 Ga0055540_1001171 Ga0055540_100117115 504
5 3300048910 Ga0496107_0002530 Ga0496107_0002530_10369_11892 507
6 3300049574 Ga0501038_0050901 Ga0501038_0050901_103_1749 522
7 3300038443 Ga0395901_0049692 Ga0395901_0049692_691_2274 527
8 3300031824 Ga0307413_10013873 Ga0307413_100138732 528
9 3300031903 Ga0307407_10035838 Ga0307407_100358382 528
10 3300032004 Ga0307414_10005384 Ga0307414_100053846 528
11 3300005435 Ga0070714_100005353 Ga0070714_1000053535 529
12 3300005614 Ga0068856_100031944 Ga0068856_1000319444 529
13 3300006028 Ga0070717_10075208 Ga0070717_100752082 529
14 3300049578 Ga0501042_0013571 Ga0501042_0013571_2477_4126 529
15 3300049744 Ga0501083_0000096 Ga0501083_0000096_18768_20417 529
16 3300025246 Ga0209646_1000013 Ga0209646_100001375 532
17 3300031901 Ga0307406_10002217 Ga0307406_100022176 532
18 3300048920 Ga0496117_0001520 Ga0496117_0001520_26368_28008 532
19 3300048921 Ga0496118_0011076 Ga0496118_0011076_6846_8486 532
20 3300048928 Ga0496125_0008481 Ga0496125_0008481_1159_2799 532
21 3300048929 Ga0496126_0047978 Ga0496126_0047978_12_1652 532
22 3300049574 Ga0501038_0021465 Ga0501038_0021465_137_1777 532
23 3300048911 Ga0496108_0001112 Ga0496108_0001112_13223_14884 534
24 3300013308 Ga0157375_10076209 Ga0157375_100762094 537
25 3300045976 Ga0466967_0041684 Ga0466967_0041684_2219_3934 537
26 iso_pu_bacteria 2738541305 2738869968 537
27 3300046543 Ga0495645_0016336 Ga0495645_0016336_2228_3862 538
28 3300031456 Ga0307513_10013872 Ga0307513_100138724 539
29 3300044683 Ga0466965_0017991 Ga0466965_0017991_1674_3326 539
30 iso_pu_bacteria 2643221575 2643886288 540
31 iso_pu_bacteria 2818991462 2819690571 540
32 iso_pu_bacteria 2818991469 2819728116 540
33 iso_pu_bacteria 2643221597 2643995235 541
34 iso_pu_bacteria 2866612099 2866612691 541
35 iso_pu_bacteria 2870628048 2870630962 541
36 3300025919 Ga0207657_10033559 Ga0207657_100335591 542
37 3300031507 Ga0307509_10128169 Ga0307509_101281692 542
38 3300048928 Ga0496125_0004177 Ga0496125_0004177_383_2113 542
39 3300050489 nmdc:mga03683_41148_c1 nmdc:mga03683_41148_c1_255_1883 542
40 3300050516 nmdc:mga0sz30_32252_c1 nmdc:mga0sz30_32252_c1_528_2156 542
41 iso_pu_bacteria 2791354901 2791911658 542
42 iso_pu_bacteria 2919391150 2919395329 542
43 iso_pu_bacteria 2945956166 2945957329 542
44 iso_pu_bacteria 8002811521 8002813521 542
45 3300005435 Ga0070714_100003715 Ga0070714_1000037156 543
46 3300025929 Ga0207664_10003887 Ga0207664_100038876 543
47 iso_pu_bacteria 2643221613 2644080790 543
48 iso_pu_bacteria 2643221721 2644663893 543
49 iso_pu_bacteria 2690315906 2691512766 543
50 iso_pu_bacteria 2775506735 2775658513 543
51 iso_pu_bacteria 2808606357 2808830047 543
52 iso_pu_bacteria 2808606360 2808851222 543
53 iso_pu_bacteria 2808606366 2808876253 543
54 iso_pu_bacteria 2808606371 2808897756 543
55 iso_pu_bacteria 2811994871 2812318178 543
56 iso_pu_bacteria 2935890801 2935893825 543
57 iso_pu_bacteria 2939598168 2939599347 543
58 iso_pu_bacteria 2945916053 2945920279 543
59 iso_pu_bacteria 2945941187 2945944478 543
60 iso_pu_bacteria 2946059875 2946063996 543
61 iso_pu_bacteria 2974302888 2974303828 543
62 3300009545 Ga0105237_10062552 Ga0105237_100625522 544
63 3300010375 Ga0105239_10030418 Ga0105239_100304182 544
64 3300049571 Ga0501034_0032801 Ga0501034_0032801_3417_5072 544
65 3300049572 Ga0501036_0057046 Ga0501036_0057046_251_1906 544
66 3300049580 Ga0501046_0030155 Ga0501046_0030155_805_2460 544
67 3300049822 Ga0501035_0125425 Ga0501035_0125425_118_1773 544
68 3300049823 Ga0501044_0018439 Ga0501044_0018439_386_2041 544
69 iso_pu_bacteria 2585428157 2588109303 544
70 iso_pu_bacteria 2899359706 2899365985 544
71 iso_pu_bacteria 2915768154 2915768655 544
72 iso_pu_bacteria 2917736166 2917740946 544
73 iso_pu_bacteria 8003314358 8003319707 544
74 3300006048 Ga0075363_100070037 Ga0075363_1000700371 545
75 3300009148 Ga0105243_10001024 Ga0105243_1000102412 545
76 3300021358 Ga0213873_10000029 Ga0213873_1000002914 545
77 3300021388 Ga0213875_10000107 Ga0213875_1000010730 545
78 3300025933 Ga0207706_10043240 Ga0207706_100432404 545
79 3300025935 Ga0207709_10000403 Ga0207709_1000040325 545
80 3300026067 Ga0207678_10016730 Ga0207678_100167302 545
81 3300026067 Ga0207678_10152661 Ga0207678_101526611 545
82 3300031901 Ga0307406_10049904 Ga0307406_100499042 545
83 3300037853 Ga0436364_0588322 Ga0436364_0588322_53580_55229 545
84 3300039453 Ga0436362_1138695 Ga0436362_1138695_30223_31872 545
85 3300044684 Ga0466966_0000383 Ga0466966_0000383_9103_10752 545
86 3300044694 Ga0466963_0002388 Ga0466963_0002388_3551_5200 545
87 3300044735 Ga0466968_0000430 Ga0466968_0000430_3797_5446 545
88 3300044842 Ga0466957_0004855 Ga0466957_0004855_2142_3791 545
89 3300045049 Ga0466959_0003979 Ga0466959_0003979_4725_6374 545
90 3300045836 Ga0466958_0000206 Ga0466958_0000206_3859_5508 545
91 3300045976 Ga0466967_0011444 Ga0466967_0011444_4815_6464 545
92 3300046616 Ga0495668_0000416 Ga0495668_0000416_18872_20530 545
93 3300048909 Ga0496106_0076602 Ga0496106_0076602_432_2111 545
94 3300048921 Ga0496118_0001938 Ga0496118_0001938_16326_18023 545
95 3300048922 Ga0496119_0002122 Ga0496119_0002122_89_1747 545
96 3300048925 Ga0496122_0035996 Ga0496122_0035996_1831_3528 545
97 3300048926 Ga0496123_0045539 Ga0496123_0045539_377_2074 545
98 3300048927 Ga0496124_0000198 Ga0496124_0000198_22792_24489 545
99 3300048928 Ga0496125_0016337 Ga0496125_0016337_1386_3044 545
100 3300049586 Ga0501070_0070490 Ga0501070_0070490_706_2364 545
101 3300050492 nmdc:mga0yw44_11042_c1 nmdc:mga0yw44_11042_c1_141_1784 545
102 3300050496 nmdc:mga07m45_10742_c2 nmdc:mga07m45_10742_c2_668_2326 545
103 3300050510 nmdc:mga06r32_6912_c1 nmdc:mga06r32_6912_c1_442_2082 545
104 3300061719 Ga0466962_0002665 Ga0466962_0002665_1715_3364 545
105 iso_pu_bacteria 2643221687 2644491186 545
106 iso_pu_bacteria 2738541264 2738667265 545
107 iso_pu_bacteria 2738541274 2738707390 545
108 iso_pu_bacteria 2738541356 2739146108 545
109 iso_pu_bacteria 2738543028 2739328696 545
110 iso_pu_bacteria 2738543034 2739364620 545
111 iso_pu_bacteria 2808606700 2810363123 545
112 iso_pu_bacteria 2842134933 2842139573 545
113 iso_pu_bacteria 2902792274 2902797341 545
114 iso_pu_bacteria 2902799365 2902799754 545
115 iso_pu_bacteria 2902810491 2902814637 545
116 iso_pu_bacteria 2902837492 2902843038 545
117 iso_pu_bacteria 2904765812 2904766710 545
118 iso_pu_bacteria 2904770941 2904775278 545
119 iso_pu_bacteria 2908811453 2908811674 545
120 iso_pu_bacteria 2919420072 2919420854 545
121 iso_pu_bacteria 2919432681 2919433388 545
122 iso_pu_bacteria 2929212328 2929217767 545
123 iso_pu_bacteria 2939582691 2939585007 545
124 iso_pu_bacteria 2974315732 2974318682 545
125 iso_pu_bacteria 2984523437 2984526924 545
126 iso_pu_bacteria 8054107350 8054109721 545
127 3300005343 Ga0070687_100039272 Ga0070687_1000392721 546
128 3300005347 Ga0070668_100014548 Ga0070668_1000145484 546
129 3300005437 Ga0070710_10001113 Ga0070710_100011133 546
130 3300005456 Ga0070678_100115369 Ga0070678_1001153692 546
131 3300005564 Ga0070664_100052437 Ga0070664_1000524372 546
132 3300005840 Ga0068870_10009251 Ga0068870_100092515 546
133 3300009094 Ga0111539_10067342 Ga0111539_100673422 546
134 3300009147 Ga0114129_10024424 Ga0114129_100244246 546
135 3300025898 Ga0207692_10008372 Ga0207692_100083723 546
136 3300025899 Ga0207642_10006957 Ga0207642_100069572 546
137 3300025908 Ga0207643_10008726 Ga0207643_100087262 546
138 3300025918 Ga0207662_10015525 Ga0207662_100155252 546
139 3300025926 Ga0207659_10011879 Ga0207659_100118795 546
140 3300025931 Ga0207644_10130833 Ga0207644_101308331 546
141 3300025940 Ga0207691_10114480 Ga0207691_101144802 546
142 3300025942 Ga0207689_10078010 Ga0207689_100780101 546
143 3300025972 Ga0207668_10030405 Ga0207668_100304052 546
144 3300025981 Ga0207640_10011928 Ga0207640_100119282 546
145 3300025986 Ga0207658_10049078 Ga0207658_100490782 546
146 3300026067 Ga0207678_10032838 Ga0207678_100328383 546
147 3300026088 Ga0207641_10199888 Ga0207641_101998881 546
148 3300026116 Ga0207674_10087561 Ga0207674_100875612 546
149 3300026118 Ga0207675_100054188 Ga0207675_1000541882 546
150 3300037466 Ga0395898_0073122 Ga0395898_0073122_1212_2852 546
151 3300044658 Ga0466972_0004319 Ga0466972_0004319_1473_3113 546
152 3300044683 Ga0466965_0000275 Ga0466965_0000275_8913_10553 546
153 3300044765 Ga0466970_0005929 Ga0466970_0005929_2188_3867 546
154 3300048905 Ga0496102_0142337 Ga0496102_0142337_84_1742 546
155 3300048912 Ga0496109_0244742 Ga0496109_0244742_12_1670 546
156 3300049579 Ga0501043_0010216 Ga0501043_0010216_1667_3310 546
157 iso_pu_bacteria 2547132424 2548692954 546
158 iso_pu_bacteria 2551306166 2552105624 546
159 iso_pu_bacteria 2558860112 2558911629 546
160 iso_pu_bacteria 2565956761 2566995597 546
161 iso_pu_bacteria 2738541308 2738888530 546
162 iso_pu_bacteria 2738543005 2739204473 546
163 iso_pu_bacteria 2738543011 2739240380 546
164 iso_pu_bacteria 2751185725 2753037436 546
165 iso_pu_bacteria 2751185792 2753325304 546
166 iso_pu_bacteria 2857740372 2857740860 546
167 iso_pu_bacteria 2870782633 2870782994 546
168 iso_pu_bacteria 2889300758 2889303483 546
169 iso_pu_bacteria 2899370129 2899374847 546
170 iso_pu_bacteria 2904497146 2904501529 546
171 iso_pu_bacteria 2904535858 2904537787 546
172 iso_pu_bacteria 2904776348 2904778161 546
173 iso_pu_bacteria 2910809715 2910809845 546
174 iso_pu_bacteria 2919034639 2919035537 546
175 iso_pu_bacteria 2919059106 2919060208 546
176 iso_pu_bacteria 2919538618 2919539244 546
177 iso_pu_bacteria 2919713450 2919717836 546
178 iso_pu_bacteria 2922554459 2922556977 546
179 iso_pu_bacteria 2928142448 2928145294 546
180 iso_pu_bacteria 2932426870 2932427833 546
181 iso_pu_bacteria 2933418574 2933418593 546
182 iso_pu_bacteria 2939647034 2939650278 546
183 iso_pu_bacteria 2939743619 2939748680 546
184 3300005535 Ga0070684_100005591 Ga0070684_1000055918 547
185 3300005842 Ga0068858_100000001 Ga0068858_10000000140 547
186 3300009177 Ga0105248_10000529 Ga0105248_1000052940 547
187 3300014968 Ga0157379_10000059 Ga0157379_1000005934 547
188 3300025941 Ga0207711_10000537 Ga0207711_1000053740 547
189 3300025944 Ga0207661_10007063 Ga0207661_100070635 547
190 3300026035 Ga0207703_10000007 Ga0207703_1000000740 547
191 3300031456 Ga0307513_10015902 Ga0307513_100159022 547
192 3300031727 Ga0316576_10062456 Ga0316576_100624561 547
193 3300031728 Ga0316578_10073153 Ga0316578_100731531 547
194 3300033179 Ga0307507_10069783 Ga0307507_100697832 547
195 3300035085 Ga0373929_0008480 Ga0373929_0008480_52_1698 547
196 3300036712 Ga0316584_0029064 Ga0316584_0029064_556_2199 547
197 3300042016 Ga0439463_010926 Ga0439463_010926_266_1927 547
198 3300005337 Ga0070682_100067463 Ga0070682_1000674631 548
199 3300005338 Ga0068868_100071612 Ga0068868_1000716122 548
200 3300005339 Ga0070660_100072079 Ga0070660_1000720792 548
201 3300005345 Ga0070692_10006310 Ga0070692_100063102 548
202 3300005347 Ga0070668_100000615 Ga0070668_10000061515 548
203 3300005347 Ga0070668_100011457 Ga0070668_1000114574 548
204 3300005347 Ga0070668_100038806 Ga0070668_1000388062 548
205 3300005355 Ga0070671_100005961 Ga0070671_1000059613 548
206 3300005364 Ga0070673_100133591 Ga0070673_1001335912 548
207 3300005366 Ga0070659_100035727 Ga0070659_1000357272 548
208 3300005366 Ga0070659_100070461 Ga0070659_1000704611 548
209 3300005367 Ga0070667_100019542 Ga0070667_1000195424 548
210 3300005441 Ga0070700_100018484 Ga0070700_1000184844 548
211 3300005455 Ga0070663_100015748 Ga0070663_1000157485 548
212 3300005456 Ga0070678_100001635 Ga0070678_1000016359 548
213 3300005456 Ga0070678_100017625 Ga0070678_1000176251 548
214 3300005458 Ga0070681_10010877 Ga0070681_100108779 548
215 3300005466 Ga0070685_10055451 Ga0070685_100554512 548
216 3300005539 Ga0068853_100073585 Ga0068853_1000735851 548
217 3300005539 Ga0068853_100086433 Ga0068853_1000864331 548
218 3300005544 Ga0070686_100067740 Ga0070686_1000677402 548
219 3300005547 Ga0070693_100016333 Ga0070693_1000163333 548
220 3300005548 Ga0070665_100002109 Ga0070665_10000210920 548
221 3300005614 Ga0068856_100007085 Ga0068856_1000070859 548
222 3300005615 Ga0070702_100000348 Ga0070702_1000003489 548
223 3300005615 Ga0070702_100011550 Ga0070702_1000115502 548
224 3300005616 Ga0068852_100009739 Ga0068852_1000097395 548
225 3300005616 Ga0068852_100013644 Ga0068852_1000136445 548
226 3300005617 Ga0068859_100010099 Ga0068859_1000100993 548
227 3300005618 Ga0068864_100033276 Ga0068864_1000332764 548
228 3300005840 Ga0068870_10017456 Ga0068870_100174563 548
229 3300005841 Ga0068863_100055722 Ga0068863_1000557224 548
230 3300005842 Ga0068858_100032090 Ga0068858_1000320902 548
231 3300005842 Ga0068858_100131561 Ga0068858_1001315612 548
232 3300005843 Ga0068860_100001185 Ga0068860_1000011852 548
233 3300005843 Ga0068860_100050073 Ga0068860_1000500732 548
234 3300005843 Ga0068860_100073226 Ga0068860_1000732262 548
235 3300005937 Ga0081455_10086756 Ga0081455_100867562 548
236 3300005983 Ga0081540_1000721 Ga0081540_100072115 548
237 3300006038 Ga0075365_10058065 Ga0075365_100580652 548
238 3300006051 Ga0075364_10004852 Ga0075364_100048527 548
239 3300006173 Ga0070716_100004733 Ga0070716_1000047335 548
240 3300006852 Ga0075433_10002276 Ga0075433_100022762 548
241 3300006852 Ga0075433_10067874 Ga0075433_100678742 548
242 3300006871 Ga0075434_100010515 Ga0075434_1000105154 548
243 3300006871 Ga0075434_100025012 Ga0075434_1000250125 548
244 3300006881 Ga0068865_100066572 Ga0068865_1000665722 548
245 3300006914 Ga0075436_100049293 Ga0075436_1000492932 548
246 3300006931 Ga0097620_100010099 Ga0097620_1000100993 548
247 3300007076 Ga0075435_100059771 Ga0075435_1000597712 548
248 3300009011 Ga0105251_10028937 Ga0105251_100289373 548
249 3300009093 Ga0105240_10145346 Ga0105240_101453462 548
250 3300009094 Ga0111539_10079610 Ga0111539_100796102 548
251 3300009098 Ga0105245_10010076 Ga0105245_100100767 548
252 3300009098 Ga0105245_10010496 Ga0105245_100104968 548
253 3300009101 Ga0105247_10002992 Ga0105247_100029923 548
254 3300009101 Ga0105247_10034572 Ga0105247_100345722 548
255 3300009101 Ga0105247_10061113 Ga0105247_100611131 548
256 3300009148 Ga0105243_10012407 Ga0105243_100124074 548
257 3300009174 Ga0105241_10018126 Ga0105241_100181264 548
258 3300009545 Ga0105237_10066578 Ga0105237_100665782 548
259 3300009551 Ga0105238_10110263 Ga0105238_101102632 548
260 3300009553 Ga0105249_10027800 Ga0105249_100278002 548
261 3300013102 Ga0157371_10049584 Ga0157371_100495842 548
262 3300013105 Ga0157369_10058658 Ga0157369_100586582 548
263 3300013296 Ga0157374_10041716 Ga0157374_100417163 548
264 3300013307 Ga0157372_10291277 Ga0157372_102912771 548
265 3300014325 Ga0163163_10126191 Ga0163163_101261912 548
266 3300014745 Ga0157377_10049674 Ga0157377_100496742 548
267 3300014969 Ga0157376_10054823 Ga0157376_100548231 548
268 3300014969 Ga0157376_10096996 Ga0157376_100969962 548
269 3300017792 Ga0163161_10006431 Ga0163161_100064314 548
270 3300025900 Ga0207710_10001549 Ga0207710_100015498 548
271 3300025901 Ga0207688_10012472 Ga0207688_100124723 548
272 3300025901 Ga0207688_10021944 Ga0207688_100219442 548
273 3300025908 Ga0207643_10003801 Ga0207643_100038014 548
274 3300025912 Ga0207707_10025790 Ga0207707_100257904 548
275 3300025913 Ga0207695_10108612 Ga0207695_101086122 548
276 3300025914 Ga0207671_10039228 Ga0207671_100392284 548
277 3300025915 Ga0207693_10006124 Ga0207693_100061243 548
278 3300025919 Ga0207657_10005196 Ga0207657_100051964 548
279 3300025919 Ga0207657_10090275 Ga0207657_100902751 548
280 3300025925 Ga0207650_10122133 Ga0207650_101221332 548
281 3300025926 Ga0207659_10021377 Ga0207659_100213773 548
282 3300025927 Ga0207687_10031545 Ga0207687_100315452 548
283 3300025929 Ga0207664_10012443 Ga0207664_100124433 548
284 3300025939 Ga0207665_10001092 Ga0207665_100010925 548
285 3300025942 Ga0207689_10005136 Ga0207689_100051367 548
286 3300025944 Ga0207661_10000336 Ga0207661_1000033627 548
287 3300025949 Ga0207667_10048085 Ga0207667_100480852 548
288 3300025961 Ga0207712_10011992 Ga0207712_100119922 548
289 3300025972 Ga0207668_10023553 Ga0207668_100235532 548
290 3300025972 Ga0207668_10031722 Ga0207668_100317222 548
291 3300026035 Ga0207703_10108834 Ga0207703_101088342 548
292 3300026041 Ga0207639_10017635 Ga0207639_100176354 548
293 3300026067 Ga0207678_10001699 Ga0207678_100016994 548
294 3300026067 Ga0207678_10001762 Ga0207678_100017624 548
295 3300026075 Ga0207708_10019442 Ga0207708_100194422 548
296 3300026075 Ga0207708_10023482 Ga0207708_100234822 548
297 3300026078 Ga0207702_10006673 Ga0207702_100066735 548
298 3300026078 Ga0207702_10012393 Ga0207702_100123934 548
299 3300026088 Ga0207641_10036367 Ga0207641_100363672 548
300 3300026095 Ga0207676_10000648 Ga0207676_100006488 548
301 3300026118 Ga0207675_100025670 Ga0207675_1000256705 548
302 3300026121 Ga0207683_10010775 Ga0207683_100107754 548
303 3300026142 Ga0207698_10082103 Ga0207698_100821032 548
304 3300027907 Ga0207428_10003435 Ga0207428_1000343514 548
305 3300028381 Ga0268264_10001011 Ga0268264_1000101127 548
306 3300028794 Ga0307515_10076325 Ga0307515_100763251 548
307 3300031824 Ga0307413_10060523 Ga0307413_100605232 548
308 3300031838 Ga0307518_10001174 Ga0307518_1000117411 548
309 3300031995 Ga0307409_100125553 Ga0307409_1001255532 548
310 3300032004 Ga0307414_10087370 Ga0307414_100873702 548
311 3300033179 Ga0307507_10032585 Ga0307507_100325854 548
312 3300035112 Ga0373932_0002256 Ga0373932_0002256_2712_4361 548
313 3300035114 Ga0373939_0007946 Ga0373939_0007946_551_2200 548
314 3300044656 Ga0466969_0046570 Ga0466969_0046570_161_1810 548
315 3300044684 Ga0466966_0012074 Ga0466966_0012074_2350_3999 548
316 3300044693 Ga0466961_0025106 Ga0466961_0025106_1716_3365 548
317 3300044694 Ga0466963_0021084 Ga0466963_0021084_1093_2742 548
318 3300044694 Ga0466963_0099438 Ga0466963_0099438_60_1706 548
319 3300044719 Ga0466971_0013303 Ga0466971_0013303_1803_3452 548
320 3300044765 Ga0466970_0031333 Ga0466970_0031333_994_2643 548
321 3300044842 Ga0466957_0002803 Ga0466957_0002803_7708_9357 548
322 3300044901 Ga0466960_0034982 Ga0466960_0034982_331_1980 548
323 3300045836 Ga0466958_0021001 Ga0466958_0021001_999_2648 548
324 3300045836 Ga0466958_0039218 Ga0466958_0039218_740_2389 548
325 3300045976 Ga0466967_0000939 Ga0466967_0000939_10936_12585 548
326 3300045976 Ga0466967_0010955 Ga0466967_0010955_4947_6596 548
327 3300045976 Ga0466967_0013978 Ga0466967_0013978_3456_5105 548
328 3300045976 Ga0466967_0033305 Ga0466967_0033305_649_2298 548
329 3300045976 Ga0466967_0042430 Ga0466967_0042430_1852_3501 548
330 3300045976 Ga0466967_0057635 Ga0466967_0057635_203_1852 548
331 3300045976 Ga0466967_0104156 Ga0466967_0104156_243_1925 548
332 3300048905 Ga0496102_0000023 Ga0496102_0000023_128111_129796 548
333 3300048905 Ga0496102_0018834 Ga0496102_0018834_253_1899 548
334 3300048905 Ga0496102_0069154 Ga0496102_0069154_1176_2825 548
335 3300048906 Ga0496103_0004680 Ga0496103_0004680_5471_7156 548
336 3300048907 Ga0496104_0006108 Ga0496104_0006108_4054_5700 548
337 3300048908 Ga0496105_0012058 Ga0496105_0012058_1176_2822 548
338 3300048909 Ga0496106_0004909 Ga0496106_0004909_4959_6605 548
339 3300048910 Ga0496107_0014387 Ga0496107_0014387_465_2111 548
340 3300048911 Ga0496108_0029168 Ga0496108_0029168_643_2292 548
341 3300048912 Ga0496109_0062928 Ga0496109_0062928_615_2264 548
342 3300048913 Ga0496110_0011169 Ga0496110_0011169_1522_3168 548
343 3300048913 Ga0496110_0036623 Ga0496110_0036623_920_2569 548
344 3300048914 Ga0496111_0000966 Ga0496111_0000966_9244_10890 548
345 3300048916 Ga0496113_0047728 Ga0496113_0047728_366_2015 548
346 3300048918 Ga0496115_0032165 Ga0496115_0032165_2380_4029 548
347 3300048921 Ga0496118_0041278 Ga0496118_0041278_1058_2743 548
348 3300048922 Ga0496119_0000091 Ga0496119_0000091_75641_77290 548
349 3300048923 Ga0496120_0004323 Ga0496120_0004323_4306_5955 548
350 3300049581 Ga0501047_0030201 Ga0501047_0030201_281_1930 548
351 3300050491 nmdc:mga00v17_9321_c1 nmdc:mga00v17_9321_c1_425_2095 548
352 3300050512 nmdc:mga0n895_37484_c1 nmdc:mga0n895_37484_c1_831_2480 548
353 3300050512 nmdc:mga0n895_7764_c1 nmdc:mga0n895_7764_c1_5683_7329 548
354 3300050513 nmdc:mga0rr50_3031_c1 nmdc:mga0rr50_3031_c1_2402_4051 548
355 3300050513 nmdc:mga0rr50_4305_c1 nmdc:mga0rr50_4305_c1_1030_2676 548
356 3300050514 nmdc:mga08x19_34101_c1 nmdc:mga08x19_34101_c1_1052_2698 548
357 3300050514 nmdc:mga08x19_45646_c1 nmdc:mga08x19_45646_c1_830_2479 548
358 3300050515 nmdc:mga0a205_11234_c1 nmdc:mga0a205_11234_c1_811_2460 548
359 3300050515 nmdc:mga0a205_618_c1 nmdc:mga0a205_618_c1_14858_16504 548
360 iso_pu_bacteria 2582580736 2583149253 548
361 iso_pu_bacteria 2585427649 2586057830 548
362 iso_pu_bacteria 2643221715 2644637229 548
363 iso_pu_bacteria 2758568621 2760625593 548
364 iso_pu_bacteria 2808606522 2809593336 548
365 3300002075 JGI24738J21930_10010039 JGI24738J21930_100100392 549
366 3300002077 JGI24744J21845_10000243 JGI24744J21845_100002434 549
367 3300002459 JGI24751J29686_10003232 JGI24751J29686_100032322 549
368 3300003792 Ga0055540_1000022 Ga0055540_1000022186 549
369 3300003792 Ga0055540_1003464 Ga0055540_10034646 549
370 3300003792 Ga0055540_1007294 Ga0055540_10072943 549
371 3300005337 Ga0070682_100004581 Ga0070682_1000045814 549
372 3300005337 Ga0070682_100018264 Ga0070682_1000182642 549
373 3300005338 Ga0068868_100008941 Ga0068868_1000089414 549
374 3300005339 Ga0070660_100123226 Ga0070660_1001232261 549
375 3300005341 Ga0070691_10001429 Ga0070691_100014298 549
376 3300005347 Ga0070668_100000201 Ga0070668_1000002019 549
377 3300005347 Ga0070668_100001887 Ga0070668_10000188716 549
378 3300005355 Ga0070671_100008029 Ga0070671_1000080292 549
379 3300005356 Ga0070674_100002301 Ga0070674_1000023016 549
380 3300005356 Ga0070674_100075845 Ga0070674_1000758451 549
381 3300005367 Ga0070667_100000142 Ga0070667_10000014288 549
382 3300005367 Ga0070667_100022439 Ga0070667_1000224394 549
383 3300005367 Ga0070667_100032084 Ga0070667_1000320842 549
384 3300005437 Ga0070710_10001176 Ga0070710_100011767 549
385 3300005438 Ga0070701_10007457 Ga0070701_100074571 549
386 3300005439 Ga0070711_100002471 Ga0070711_1000024716 549
387 3300005441 Ga0070700_100000263 Ga0070700_10000026321 549
388 3300005456 Ga0070678_100001503 Ga0070678_1000015038 549
389 3300005457 Ga0070662_100001803 Ga0070662_1000018038 549
390 3300005459 Ga0068867_100000537 Ga0068867_1000005374 549
391 3300005466 Ga0070685_10032022 Ga0070685_100320222 549
392 3300005539 Ga0068853_100001294 Ga0068853_1000012943 549
393 3300005548 Ga0070665_100003879 Ga0070665_1000038798 549
394 3300005548 Ga0070665_100014928 Ga0070665_1000149283 549
395 3300005549 Ga0070704_100001099 Ga0070704_1000010998 549
396 3300005578 Ga0068854_100001607 Ga0068854_1000016078 549
397 3300005615 Ga0070702_100000302 Ga0070702_1000003022 549
398 3300005615 Ga0070702_100014383 Ga0070702_1000143833 549
399 3300005617 Ga0068859_100001155 Ga0068859_1000011559 549
400 3300005617 Ga0068859_100002067 Ga0068859_1000020679 549
401 3300005617 Ga0068859_100023208 Ga0068859_1000232082 549
402 3300005718 Ga0068866_10001689 Ga0068866_100016895 549
403 3300005719 Ga0068861_100000739 Ga0068861_1000007398 549
404 3300005841 Ga0068863_100005764 Ga0068863_1000057649 549
405 3300005842 Ga0068858_100002363 Ga0068858_10000236316 549
406 3300005842 Ga0068858_100054643 Ga0068858_1000546433 549
407 3300005843 Ga0068860_100000160 Ga0068860_10000016012 549
408 3300005843 Ga0068860_100006970 Ga0068860_1000069707 549
409 3300005844 Ga0068862_100001362 Ga0068862_10000136218 549
410 3300005844 Ga0068862_100018762 Ga0068862_1000187626 549
411 3300006038 Ga0075365_10004459 Ga0075365_100044599 549
412 3300006038 Ga0075365_10021804 Ga0075365_100218042 549
413 3300006048 Ga0075363_100005102 Ga0075363_1000051022 549
414 3300006048 Ga0075363_100015345 Ga0075363_1000153454 549
415 3300006048 Ga0075363_100016072 Ga0075363_1000160723 549
416 3300006051 Ga0075364_10000909 Ga0075364_1000090916 549
417 3300006051 Ga0075364_10003441 Ga0075364_100034418 549
418 3300006051 Ga0075364_10003959 Ga0075364_100039596 549
419 3300006051 Ga0075364_10005541 Ga0075364_100055419 549
420 3300006051 Ga0075364_10005904 Ga0075364_100059042 549
421 3300006051 Ga0075364_10015218 Ga0075364_100152186 549
422 3300006175 Ga0070712_100000495 Ga0070712_1000004958 549
423 3300006177 Ga0075362_10026509 Ga0075362_100265092 549
424 3300006178 Ga0075367_10004255 Ga0075367_100042557 549
425 3300006186 Ga0075369_10009876 Ga0075369_100098762 549
426 3300006186 Ga0075369_10010596 Ga0075369_100105962 549
427 3300006186 Ga0075369_10015319 Ga0075369_100153192 549
428 3300006186 Ga0075369_10016601 Ga0075369_100166012 549
429 3300006353 Ga0075370_10002764 Ga0075370_100027644 549
430 3300006353 Ga0075370_10009460 Ga0075370_100094602 549
431 3300006844 Ga0075428_100009516 Ga0075428_10000951612 549
432 3300006880 Ga0075429_100003965 Ga0075429_1000039657 549
433 3300006881 Ga0068865_100000670 Ga0068865_10000067016 549
434 3300006881 Ga0068865_100024875 Ga0068865_1000248753 549
435 3300006931 Ga0097620_100001155 Ga0097620_1000011559 549
436 3300006931 Ga0097620_100002067 Ga0097620_1000020679 549
437 3300006931 Ga0097620_100023209 Ga0097620_1000232092 549
438 3300009098 Ga0105245_10001945 Ga0105245_1000194516 549
439 3300009101 Ga0105247_10000078 Ga0105247_1000007812 549
440 3300009101 Ga0105247_10000433 Ga0105247_1000043316 549
441 3300009148 Ga0105243_10001959 Ga0105243_1000195915 549
442 3300009174 Ga0105241_10144966 Ga0105241_101449661 549
443 3300009176 Ga0105242_10000858 Ga0105242_1000085820 549
444 3300009177 Ga0105248_10000082 Ga0105248_1000008212 549
445 3300009177 Ga0105248_10001630 Ga0105248_100016303 549
446 3300009545 Ga0105237_10016390 Ga0105237_100163903 549
447 3300009551 Ga0105238_10175641 Ga0105238_101756411 549
448 3300009553 Ga0105249_10000031 Ga0105249_10000031107 549
449 3300009553 Ga0105249_10002952 Ga0105249_1000295215 549
450 3300010375 Ga0105239_10022402 Ga0105239_100224024 549
451 3300010375 Ga0105239_10022852 Ga0105239_100228524 549
452 3300013297 Ga0157378_10002386 Ga0157378_100023868 549
453 3300013306 Ga0163162_10005790 Ga0163162_100057908 549
454 3300013308 Ga0157375_10000849 Ga0157375_1000084916 549
455 3300014326 Ga0157380_10000339 Ga0157380_100003398 549
456 3300017792 Ga0163161_10000520 Ga0163161_1000052020 549
457 3300021384 Ga0213876_10003631 Ga0213876_100036318 549
458 3300021384 Ga0213876_10009868 Ga0213876_100098685 549
459 3300025303 Ga0209051_1000033 Ga0209051_1000033187 549
460 3300025303 Ga0209051_1000522 Ga0209051_10005222 549
461 3300025898 Ga0207692_10001017 Ga0207692_100010176 549
462 3300025899 Ga0207642_10000168 Ga0207642_1000016816 549
463 3300025900 Ga0207710_10000022 Ga0207710_1000002258 549
464 3300025900 Ga0207710_10003170 Ga0207710_100031702 549
465 3300025901 Ga0207688_10001068 Ga0207688_1000106812 549
466 3300025901 Ga0207688_10004452 Ga0207688_100044526 549
467 3300025905 Ga0207685_10026226 Ga0207685_100262261 549
468 3300025907 Ga0207645_10012204 Ga0207645_100122046 549
469 3300025914 Ga0207671_10040164 Ga0207671_100401643 549
470 3300025915 Ga0207693_10000660 Ga0207693_1000066027 549
471 3300025919 Ga0207657_10051157 Ga0207657_100511573 549
472 3300025923 Ga0207681_10002764 Ga0207681_1000276410 549
473 3300025927 Ga0207687_10002929 Ga0207687_100029298 549
474 3300025932 Ga0207690_10027585 Ga0207690_100275853 549
475 3300025934 Ga0207686_10019544 Ga0207686_100195442 549
476 3300025935 Ga0207709_10002099 Ga0207709_1000209910 549
477 3300025936 Ga0207670_10078589 Ga0207670_100785892 549
478 3300025937 Ga0207669_10000218 Ga0207669_100002188 549
479 3300025937 Ga0207669_10012363 Ga0207669_100123632 549
480 3300025938 Ga0207704_10000179 Ga0207704_100001797 549
481 3300025939 Ga0207665_10022418 Ga0207665_100224182 549
482 3300025941 Ga0207711_10000984 Ga0207711_1000098431 549
483 3300025941 Ga0207711_10052620 Ga0207711_100526203 549
484 3300025942 Ga0207689_10007350 Ga0207689_100073502 549
485 3300025961 Ga0207712_10000029 Ga0207712_10000029107 549
486 3300025961 Ga0207712_10007142 Ga0207712_100071422 549
487 3300025961 Ga0207712_10112856 Ga0207712_101128561 549
488 3300025972 Ga0207668_10021344 Ga0207668_100213442 549
489 3300025972 Ga0207668_10039325 Ga0207668_100393253 549
490 3300025981 Ga0207640_10025372 Ga0207640_100253721 549
491 3300025986 Ga0207658_10000113 Ga0207658_1000011385 549
492 3300025986 Ga0207658_10005096 Ga0207658_100050967 549
493 3300025986 Ga0207658_10005645 Ga0207658_100056456 549
494 3300025986 Ga0207658_10007864 Ga0207658_100078643 549
495 3300026023 Ga0207677_10003639 Ga0207677_100036394 549
496 3300026035 Ga0207703_10002619 Ga0207703_100026193 549
497 3300026035 Ga0207703_10018063 Ga0207703_100180636 549
498 3300026041 Ga0207639_10002773 Ga0207639_100027738 549
499 3300026041 Ga0207639_10006160 Ga0207639_100061603 549
500 3300026067 Ga0207678_10120046 Ga0207678_101200462 549
501 3300026075 Ga0207708_10000787 Ga0207708_100007873 549
502 3300026075 Ga0207708_10015233 Ga0207708_100152334 549
503 3300026088 Ga0207641_10003451 Ga0207641_100034519 549
504 3300026088 Ga0207641_10007179 Ga0207641_1000717912 549
505 3300026089 Ga0207648_10001756 Ga0207648_100017564 549
506 3300026118 Ga0207675_100012899 Ga0207675_1000128994 549
507 3300026118 Ga0207675_100013553 Ga0207675_1000135535 549
508 3300026121 Ga0207683_10000990 Ga0207683_100009904 549
509 3300028379 Ga0268266_10009419 Ga0268266_100094198 549
510 3300028379 Ga0268266_10077071 Ga0268266_100770712 549
511 3300028380 Ga0268265_10000040 Ga0268265_1000004084 549
512 3300028380 Ga0268265_10089979 Ga0268265_100899792 549
513 3300028381 Ga0268264_10000017 Ga0268264_10000017263 549
514 3300028381 Ga0268264_10002402 Ga0268264_100024028 549
515 3300028381 Ga0268264_10012556 Ga0268264_100125567 549
516 3300031251 Ga0265327_10004008 Ga0265327_100040088 549
517 3300031824 Ga0307413_10035375 Ga0307413_100353752 549
518 3300031901 Ga0307406_10039914 Ga0307406_100399142 549
519 3300035691 Ga0373931_0005726 Ga0373931_0005726_2255_3904 549
520 3300037853 Ga0436364_0176067 Ga0436364_0176067_10436_12085 549
521 3300037853 Ga0436364_0199133 Ga0436364_0199133_4330_5982 549
522 3300037853 Ga0436364_1442134 Ga0436364_1442134_496_2145 549
523 3300039437 Ga0436365_0469598 Ga0436365_0469598_9720_11372 549
524 3300039437 Ga0436365_1752709 Ga0436365_1752709_1436_3085 549
525 3300039437 Ga0436365_1937384 Ga0436365_1937384_99_1748 549
526 3300041411 Ga0439466_0013297 Ga0439466_0013297_171_1829 549
527 3300041411 Ga0439466_0021325 Ga0439466_0021325_175_1833 549
528 3300041413 Ga0439465_0000494 Ga0439465_0000494_9280_10938 549
529 3300041413 Ga0439465_0014233 Ga0439465_0014233_441_2099 549
530 3300041413 Ga0439465_0014375 Ga0439465_0014375_558_2216 549
531 3300042002 Ga0439442_002799 Ga0439442_002799_135_1793 549
532 3300044658 Ga0466972_0027626 Ga0466972_0027626_939_2588 549
533 3300044658 Ga0466972_0029218 Ga0466972_0029218_16_1665 549
534 3300044683 Ga0466965_0007407 Ga0466965_0007407_2572_4221 549
535 3300044683 Ga0466965_0028032 Ga0466965_0028032_615_2264 549
536 3300044684 Ga0466966_0008971 Ga0466966_0008971_3433_5082 549
537 3300044684 Ga0466966_0021938 Ga0466966_0021938_1361_3010 549
538 3300044693 Ga0466961_0034187 Ga0466961_0034187_1402_3051 549
539 3300044719 Ga0466971_0007997 Ga0466971_0007997_1336_2985 549
540 3300044842 Ga0466957_0003491 Ga0466957_0003491_4693_6342 549
541 3300044842 Ga0466957_0090270 Ga0466957_0090270_244_1905 549
542 3300044901 Ga0466960_0000814 Ga0466960_0000814_4482_6131 549
543 3300045049 Ga0466959_0046062 Ga0466959_0046062_1195_2844 549
544 3300045049 Ga0466959_0082318 Ga0466959_0082318_655_2304 549
545 3300045976 Ga0466967_0064898 Ga0466967_0064898_1354_3003 549
546 3300046460 Ga0495638_0014115 Ga0495638_0014115_2154_3803 549
547 3300047320 Ga0495672_0014117 Ga0495672_0014117_1665_3314 549
548 3300047469 Ga0495673_0009180 Ga0495673_0009180_2613_4262 549
549 3300047472 Ga0495686_0020947 Ga0495686_0020947_59_1708 549
550 3300047673 Ga0495593_0012739 Ga0495593_0012739_1405_3054 549
551 3300048903 Ga0496100_0000349 Ga0496100_0000349_16068_17717 549
552 3300048903 Ga0496100_0001640 Ga0496100_0001640_241_1890 549
553 3300048903 Ga0496100_0002069 Ga0496100_0002069_3650_5299 549
554 3300048903 Ga0496100_0002259 Ga0496100_0002259_6763_8421 549
555 3300048903 Ga0496100_0004837 Ga0496100_0004837_1402_3051 549
556 3300048904 Ga0496101_0000032 Ga0496101_0000032_180872_182521 549
557 3300048904 Ga0496101_0000395 Ga0496101_0000395_3734_5383 549
558 3300048904 Ga0496101_0002865 Ga0496101_0002865_3163_4821 549
559 3300048904 Ga0496101_0004338 Ga0496101_0004338_4643_6292 549
560 3300048905 Ga0496102_0000011 Ga0496102_0000011_87152_88801 549
561 3300048905 Ga0496102_0000197 Ga0496102_0000197_58759_60408 549
562 3300048905 Ga0496102_0000843 Ga0496102_0000843_23235_24884 549
563 3300048905 Ga0496102_0002308 Ga0496102_0002308_7607_9256 549
564 3300048905 Ga0496102_0006976 Ga0496102_0006976_4474_6126 549
565 3300048905 Ga0496102_0018773 Ga0496102_0018773_1985_3634 549
566 3300048906 Ga0496103_0000431 Ga0496103_0000431_31576_33225 549
567 3300048906 Ga0496103_0000601 Ga0496103_0000601_4454_6103 549
568 3300048906 Ga0496103_0001721 Ga0496103_0001721_10955_12604 549
569 3300048906 Ga0496103_0002336 Ga0496103_0002336_7566_9218 549
570 3300048906 Ga0496103_0002956 Ga0496103_0002956_6591_8240 549
571 3300048908 Ga0496105_0001822 Ga0496105_0001822_7242_8891 549
572 3300048908 Ga0496105_0007333 Ga0496105_0007333_876_2534 549
573 3300048909 Ga0496106_0001288 Ga0496106_0001288_4217_5866 549
574 3300048909 Ga0496106_0002693 Ga0496106_0002693_4062_5711 549
575 3300048909 Ga0496106_0009349 Ga0496106_0009349_4795_6444 549
576 3300048909 Ga0496106_0016797 Ga0496106_0016797_2762_4420 549
577 3300048910 Ga0496107_0000825 Ga0496107_0000825_12093_13742 549
578 3300048910 Ga0496107_0007236 Ga0496107_0007236_2751_4400 549
579 3300048910 Ga0496107_0058117 Ga0496107_0058117_271_1920 549
580 3300048911 Ga0496108_0003052 Ga0496108_0003052_10124_11782 549
581 3300048912 Ga0496109_0000030 Ga0496109_0000030_148779_150428 549
582 3300048912 Ga0496109_0011438 Ga0496109_0011438_1779_3437 549
583 3300048912 Ga0496109_0017265 Ga0496109_0017265_1933_3591 549
584 3300048912 Ga0496109_0051500 Ga0496109_0051500_1357_3006 549
585 3300048913 Ga0496110_0015646 Ga0496110_0015646_4587_6236 549
586 3300048913 Ga0496110_0023908 Ga0496110_0023908_2658_4316 549
587 3300048915 Ga0496112_0019350 Ga0496112_0019350_3314_4963 549
588 3300048915 Ga0496112_0127879 Ga0496112_0127879_826_2475 549
589 3300048916 Ga0496113_0010464 Ga0496113_0010464_565_2214 549
590 3300048916 Ga0496113_0037112 Ga0496113_0037112_1642_3300 549
591 3300048917 Ga0496114_0000312 Ga0496114_0000312_19574_21223 549
592 3300048917 Ga0496114_0003137 Ga0496114_0003137_8746_10395 549
593 3300048918 Ga0496115_0006543 Ga0496115_0006543_4924_6573 549
594 3300048918 Ga0496115_0016805 Ga0496115_0016805_2760_4409 549
595 3300048919 Ga0496116_0000072 Ga0496116_0000072_3566_5215 549
596 3300048919 Ga0496116_0005015 Ga0496116_0005015_4744_6393 549
597 3300048920 Ga0496117_0000039 Ga0496117_0000039_232944_234593 549
598 3300048920 Ga0496117_0000160 Ga0496117_0000160_71428_73077 549
599 3300048920 Ga0496117_0008919 Ga0496117_0008919_3533_5182 549
600 3300048921 Ga0496118_0000035 Ga0496118_0000035_87551_89200 549
601 3300048921 Ga0496118_0000391 Ga0496118_0000391_21253_22902 549
602 3300048921 Ga0496118_0002342 Ga0496118_0002342_2652_4310 549
603 3300048921 Ga0496118_0008772 Ga0496118_0008772_4330_5979 549
604 3300048922 Ga0496119_0000517 Ga0496119_0000517_47580_49229 549
605 3300048922 Ga0496119_0009193 Ga0496119_0009193_6724_8373 549
606 3300048923 Ga0496120_0000631 Ga0496120_0000631_47889_49538 549
607 3300048923 Ga0496120_0029527 Ga0496120_0029527_51_1709 549
608 3300048924 Ga0496121_0000004 Ga0496121_0000004_471597_473246 549
609 3300048924 Ga0496121_0002639 Ga0496121_0002639_2376_4025 549
610 3300048924 Ga0496121_0009366 Ga0496121_0009366_832_2490 549
611 3300048925 Ga0496122_0000173 Ga0496122_0000173_4263_5912 549
612 3300048926 Ga0496123_0029542 Ga0496123_0029542_2126_3775 549
613 3300048927 Ga0496124_0000012 Ga0496124_0000012_196390_198039 549
614 3300048927 Ga0496124_0085754 Ga0496124_0085754_57_1715 549
615 3300048928 Ga0496125_0000003 Ga0496125_0000003_716522_718171 549
616 3300048928 Ga0496125_0039512 Ga0496125_0039512_832_2490 549
617 3300048929 Ga0496126_0000001 Ga0496126_0000001_471597_473246 549
618 3300048929 Ga0496126_0002899 Ga0496126_0002899_12082_13731 549
619 3300048929 Ga0496126_0003942 Ga0496126_0003942_8003_9661 549
620 3300048929 Ga0496126_0084227 Ga0496126_0084227_869_2518 549
621 3300049569 Ga0501032_0004394 Ga0501032_0004394_3293_4942 549
622 3300049569 Ga0501032_0011902 Ga0501032_0011902_2617_4266 549
623 3300049569 Ga0501032_0020513 Ga0501032_0020513_531_2180 549
624 3300049570 Ga0501033_0023356 Ga0501033_0023356_134_1783 549
625 3300049571 Ga0501034_0006718 Ga0501034_0006718_4968_6617 549
626 3300049571 Ga0501034_0042485 Ga0501034_0042485_2613_4262 549
627 3300049572 Ga0501036_0009567 Ga0501036_0009567_3339_4988 549
628 3300049573 Ga0501037_0000472 Ga0501037_0000472_9033_10682 549
629 3300049574 Ga0501038_0022457 Ga0501038_0022457_2380_4029 549
630 3300049575 Ga0501039_0026706 Ga0501039_0026706_1164_2813 549
631 3300049579 Ga0501043_0009851 Ga0501043_0009851_2380_4029 549
632 3300049580 Ga0501046_0002992 Ga0501046_0002992_8571_10220 549
633 3300049581 Ga0501047_0016518 Ga0501047_0016518_3751_5400 549
634 3300049581 Ga0501047_0090558 Ga0501047_0090558_805_2457 549
635 3300049586 Ga0501070_0001241 Ga0501070_0001241_8619_10268 549
636 3300049586 Ga0501070_0014359 Ga0501070_0014359_1404_3053 549
637 3300049589 Ga0501073_0024507 Ga0501073_0024507_470_2119 549
638 3300049822 Ga0501035_0001109 Ga0501035_0001109_163_1812 549
639 3300049822 Ga0501035_0016404 Ga0501035_0016404_4550_6199 549
640 3300049823 Ga0501044_0000797 Ga0501044_0000797_1402_3051 549
641 3300049823 Ga0501044_0002911 Ga0501044_0002911_16062_17711 549
642 3300049823 Ga0501044_0015830 Ga0501044_0015830_3615_5264 549
643 3300049823 Ga0501044_0025322 Ga0501044_0025322_1522_3171 549
644 3300050489 nmdc:mga03683_26362_c1 nmdc:mga03683_26362_c1_136_1785 549
645 3300050490 nmdc:mga03n38_22049_c1 nmdc:mga03n38_22049_c1_653_2311 549
646 3300050490 nmdc:mga03n38_25115_c1 nmdc:mga03n38_25115_c1_142_1800 549
647 3300050490 nmdc:mga03n38_36106_c1 nmdc:mga03n38_36106_c1_277_1926 549
648 3300050491 nmdc:mga00v17_11207_c1 nmdc:mga00v17_11207_c1_575_2224 549
649 3300050491 nmdc:mga00v17_13555_c2 nmdc:mga00v17_13555_c2_367_2016 549
650 3300050491 nmdc:mga00v17_18058_c1 nmdc:mga00v17_18058_c1_1069_2727 549
651 3300050491 nmdc:mga00v17_27447_c1 nmdc:mga00v17_27447_c1_1531_3189 549
652 3300050491 nmdc:mga00v17_3655_c1 nmdc:mga00v17_3655_c1_305_1954 549
653 3300050492 nmdc:mga0yw44_1098_c1 nmdc:mga0yw44_1098_c1_7989_9647 549
654 3300050492 nmdc:mga0yw44_12878_c1 nmdc:mga0yw44_12878_c1_2006_3655 549
655 3300050492 nmdc:mga0yw44_2411_c1 nmdc:mga0yw44_2411_c1_6030_7688 549
656 3300050492 nmdc:mga0yw44_64387_c1 nmdc:mga0yw44_64387_c1_411_2060 549
657 3300050495 nmdc:mga04h51_18621_c1 nmdc:mga04h51_18621_c1_364_2022 549
658 3300050496 nmdc:mga07m45_41765_c1 nmdc:mga07m45_41765_c1_619_2277 549
659 3300050507 nmdc:mga05p37_26066_c1 nmdc:mga05p37_26066_c1_3990_5648 549
660 3300050507 nmdc:mga05p37_57408_c1 nmdc:mga05p37_57408_c1_2280_3929 549
661 3300050509 nmdc:mga0qj67_19159_c1 nmdc:mga0qj67_19159_c1_1340_2998 549
662 3300050516 nmdc:mga0sz30_15725_c1 nmdc:mga0sz30_15725_c1_1288_2946 549
663 3300050516 nmdc:mga0sz30_2686_c1 nmdc:mga0sz30_2686_c1_3447_5105 549
664 3300053080 Ga0500635_0002464 Ga0500635_0002464_968_2617 549
665 3300053087 Ga0500643_005081 Ga0500643_005081_560_2209 549
666 3300053087 Ga0500643_013401 Ga0500643_013401_890_2539 549
667 3300053131 Ga0500652_004008 Ga0500652_004008_795_2444 549
668 3300053153 Ga0500616_0004319 Ga0500616_0004319_7550_9199 549
669 3300053153 Ga0500616_0011037 Ga0500616_0011037_383_2032 549
670 3300053730 Ga0500645_000025 Ga0500645_000025_110685_112334 549
671 3300061719 Ga0466962_0008336 Ga0466962_0008336_46_1695 549
672 iso_pu_bacteria 2558860280 2559427403 549
673 iso_pu_bacteria 2643221692 2644515518 549
674 iso_pu_bacteria 2751185734 2753076296 549
675 iso_pu_bacteria 2751185782 2753269563 549
676 iso_pu_bacteria 2795385470 2795780246 549
677 iso_pu_bacteria 2795385472 2795793664 549
678 iso_pu_bacteria 2816332139 2816505890 549
679 iso_pu_bacteria 2842888712 2842890733 549
680 iso_pu_bacteria 2866552031 2866557508 549
681 iso_pu_bacteria 2870721527 2870728702 549
682 iso_pu_bacteria 2891326441 2891331099 549
683 iso_pu_bacteria 2915358134 2915363879 549
684 iso_pu_bacteria 2932398195 2932398215 549
685 iso_pu_bacteria 8054472261 8054476912 549
686 iso_pu_bacteria 8056207758 8056209408 549
687 3300005435 Ga0070714_100067900 Ga0070714_1000679003 550
688 3300031251 Ga0265327_10000246 Ga0265327_100002469 550
689 3300031251 Ga0265327_10007848 Ga0265327_100078483 550
690 3300037853 Ga0436364_1272092 Ga0436364_1272092_1636_3288 550
691 3300046501 Ga0495607_0070804 Ga0495607_0070804_123_1796 550
692 3300047323 Ga0495683_0001820 Ga0495683_0001820_5821_7494 550
693 3300049823 Ga0501044_0075399 Ga0501044_0075399_1113_2942 550
694 iso_pu_bacteria 2744054611 2744958480 550
695 3300005937 Ga0081455_10000037 Ga0081455_10000037117 551
696 3300025916 Ga0207663_10009121 Ga0207663_100091216 551
697 3300048905 Ga0496102_0071876 Ga0496102_0071876_1346_3004 551
698 iso_pu_bacteria 2956939328 2956942038 551
699 iso_pu_bacteria 3001119090 3001119393 551
700 3300025933 Ga0207706_10030916 Ga0207706_100309162 552
701 3300028794 Ga0307515_10181759 Ga0307515_101817592 552
702 3300045976 Ga0466967_0119455 Ga0466967_0119455_52_1710 552
703 3300003203 JGI25406J46586_10001670 JGI25406J46586_100016706 553
704 3300005355 Ga0070671_100001715 Ga0070671_1000017152 553
705 3300005548 Ga0070665_100003927 Ga0070665_1000039272 553
706 3300005577 Ga0068857_100019728 Ga0068857_1000197284 553
707 3300005618 Ga0068864_100031268 Ga0068864_1000312685 553
708 3300005841 Ga0068863_100033523 Ga0068863_1000335236 553
709 3300005842 Ga0068858_100226976 Ga0068858_1002269761 553
710 3300005843 Ga0068860_100004520 Ga0068860_1000045208 553
711 3300005985 Ga0081539_10000027 Ga0081539_1000002758 553
712 3300005985 Ga0081539_10004065 Ga0081539_100040659 553
713 3300006846 Ga0075430_100002400 Ga0075430_1000024001 553
714 3300009177 Ga0105248_10019600 Ga0105248_100196004 553
715 3300014968 Ga0157379_10034320 Ga0157379_100343202 553
716 3300025931 Ga0207644_10001206 Ga0207644_100012062 553
717 3300025972 Ga0207668_10066456 Ga0207668_100664563 553
718 3300026088 Ga0207641_10001078 Ga0207641_1000107827 553
719 3300026095 Ga0207676_10040766 Ga0207676_100407662 553
720 3300028381 Ga0268264_10025689 Ga0268264_100256895 553
721 3300030521 Ga0307511_10004169 Ga0307511_100041697 553
722 3300032005 Ga0307411_10053252 Ga0307411_100532521 553
723 3300033179 Ga0307507_10055053 Ga0307507_100550533 553
724 3300035119 Ga0373956_0008848 Ga0373956_0008848_628_2304 553
725 3300035692 Ga0373935_0013072 Ga0373935_0013072_2161_3822 553
726 3300037853 Ga0436364_0027535 Ga0436364_0027535_10469_12130 553
727 3300044656 Ga0466969_0005292 Ga0466969_0005292_1785_3446 553
728 3300044683 Ga0466965_0004062 Ga0466965_0004062_3407_5068 553
729 3300044684 Ga0466966_0002032 Ga0466966_0002032_5896_7557 553
730 3300044693 Ga0466961_0015417 Ga0466961_0015417_342_2003 553
731 3300044765 Ga0466970_0004625 Ga0466970_0004625_1835_3496 553
732 3300044765 Ga0466970_0013380 Ga0466970_0013380_2447_4108 553
733 3300044842 Ga0466957_0021211 Ga0466957_0021211_1451_3112 553
734 3300044901 Ga0466960_0004932 Ga0466960_0004932_2416_4077 553
735 3300045049 Ga0466959_0043527 Ga0466959_0043527_1133_2794 553
736 3300045976 Ga0466967_0041422 Ga0466967_0041422_2226_3887 553
737 3300048904 Ga0496101_0009675 Ga0496101_0009675_1126_2787 553
738 3300048905 Ga0496102_0000574 Ga0496102_0000574_2490_4151 553
739 3300048906 Ga0496103_0000380 Ga0496103_0000380_3190_4851 553
740 3300048908 Ga0496105_0022610 Ga0496105_0022610_2601_4262 553
741 3300048908 Ga0496105_0113769 Ga0496105_0113769_76_1737 553
742 3300048911 Ga0496108_0003096 Ga0496108_0003096_6331_7992 553
743 3300048911 Ga0496108_0051738 Ga0496108_0051738_774_2435 553
744 3300048912 Ga0496109_0028087 Ga0496109_0028087_958_2619 553
745 3300048913 Ga0496110_0014954 Ga0496110_0014954_2409_4070 553
746 3300048914 Ga0496111_0074693 Ga0496111_0074693_228_1889 553
747 3300048915 Ga0496112_0073110 Ga0496112_0073110_1519_3180 553
748 3300048916 Ga0496113_0003716 Ga0496113_0003716_3517_5178 553
749 3300048917 Ga0496114_0083411 Ga0496114_0083411_90_1751 553
750 3300048918 Ga0496115_0095828 Ga0496115_0095828_507_2168 553
751 3300048919 Ga0496116_0000183 Ga0496116_0000183_2518_4179 553
752 3300048920 Ga0496117_0000059 Ga0496117_0000059_2497_4158 553
753 3300048921 Ga0496118_0001225 Ga0496118_0001225_35255_36916 553
754 3300048922 Ga0496119_0000955 Ga0496119_0000955_2491_4152 553
755 3300048923 Ga0496120_0003122 Ga0496120_0003122_1245_2906 553
756 3300048927 Ga0496124_0014868 Ga0496124_0014868_4567_6228 553
757 3300048929 Ga0496126_0001443 Ga0496126_0001443_2518_4179 553
758 3300050507 nmdc:mga05p37_90130_c1 nmdc:mga05p37_90130_c1_1079_2740 553
759 3300050509 nmdc:mga0qj67_625_c1 nmdc:mga0qj67_625_c1_22496_24157 553
760 iso_pu_bacteria 2523231044 2523382508 553
761 iso_pu_bacteria 2622736605 2623499235 553
762 3300031251 Ga0265327_10000001 Ga0265327_10000001785 554
763 3300031456 Ga0307513_10030020 Ga0307513_100300205 554
764 3300047322 Ga0495680_0120966 Ga0495680_0120966_125_1789 554
765 3300048907 Ga0496104_0067546 Ga0496104_0067546_378_2042 554
766 3300048908 Ga0496105_0007729 Ga0496105_0007729_2551_4215 554
767 3300048911 Ga0496108_0008237 Ga0496108_0008237_2680_4344 554
768 3300048914 Ga0496111_0008352 Ga0496111_0008352_3809_5473 554
769 3300048917 Ga0496114_0033633 Ga0496114_0033633_88_1752 554
770 3300048926 Ga0496123_0000112 Ga0496123_0000112_43723_45426 554
771 3300048927 Ga0496124_0001981 Ga0496124_0001981_7366_9069 554
772 3300053153 Ga0500616_0000775 Ga0500616_0000775_34212_35915 554
773 3300013307 Ga0157372_10006566 Ga0157372_100065662 555
774 3300048912 Ga0496109_0004746 Ga0496109_0004746_5022_6725 555
775 3300048914 Ga0496111_0068076 Ga0496111_0068076_741_2444 555
776 3300048916 Ga0496113_0026461 Ga0496113_0026461_1457_3166 555
777 3300000549 LJQas_1004648 LJQas_10046481 557
778 3300005441 Ga0070700_100000060 Ga0070700_10000006051 557
779 3300013307 Ga0157372_10000043 Ga0157372_1000004319 557
780 3300026075 Ga0207708_10000011 Ga0207708_1000001197 557
781 3300045976 Ga0466967_0000826 Ga0466967_0000826_10849_12552 557
782 3300048929 Ga0496126_0000003 Ga0496126_0000003_692765_694441 557

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16203

ERCC3_RAD25_C

ERCC3/RAD25/XPB C-terminal helicase

308

501

0.97

PF13625

Helicase_C_3

Helicase conserved C-terminal domain

7

112

0.96

PF00271

Helicase_C

Helicase conserved C-terminal domain

351

456

0.91

PF04851

ResIII

Type III restriction enzyme, res subunit

188

284

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ern-assembly1.cif.gz_A crystal structure of the c-terminal domain of human xpb/ercc-3 excision repair protein at 1.80 a 0.8635 358 555
2fzl-assembly1.cif.gz_A structure of c-terminal domain of archaeoglobus fulgidus xpb 0.8489 358 514
5of4-assembly1.cif.gz_A the cryo-em structure of human tfiih 0.7955 144 555
6nmi-assembly1.cif.gz_A cryo-em structure of the human tfiih core complex 0.7871 4 555
8byq-assembly1.cif.gz_0 rna polymerase ii pre-initiation complex with the proximal +1 nucleosome (pic-nuc10w) 0.7812 2 555
ID Description Score Start End Superfamily
af_O53873_347_537_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9634 355 543 3.40.50.300
af_O53873_347_537_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9487 355 543 3.40.50.300
af_A4I8L0_446_682_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9247 355 540 3.40.50.300
af_Q4DHR0_563_781_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9074 354 545 3.40.50.300
af_K7MUR9_1_82_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8926 391 462 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6B3ENH7-F1-model_v4 Helicase-associated domain-containing protein 1.001 4 88 GO:0004386
AF-A0A7I7QHU4-F1-model_v4 Helicase XPB/Ssl2 N-terminal domain-containing protein 0.9923 1 76
AF-A0A3D3KWG4-F1-model_v4 Helicase 0.9849 32 168 GO:0004386
AF-A0A7C2KI15-F1-model_v4 Helicase 0.9791 2 76 GO:0004386
AF-A0A519GKV0-F1-model_v4 Helicase 0.974 1 110 GO:0004386

Feature Viewer

pLDDT pTM Quality
79.68 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map