F480610
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 782 | 360 | 1564 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_10995329|Ga0105242_109953292 |
| Length | 135 |
| Sequence | MIRRLGRTGTFNGRFREVSPMRSLWLAVALLALAXSXATAQDRRGMRFWNLTLYTITSLQMSPAGQDTWGPDQCQNDRDGTVDHDERLRITGVEPGRYDVKLADRIGRICIVRDVEVKAAAVFTIEEKQLTDCRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 9 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 115 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 116 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 117 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 118 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 119 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 120 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 133 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 201 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 206 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 207 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 208 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 209 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 210 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 211 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 212 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 214 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 228 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 235 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 249 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 250 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 251 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 252 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 256 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 343 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 346 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 360 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.07 |
| Nodule | 0 |
| Rhizoplane | 8.57 |
| Rhizosphere | 86.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 27.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105242_10995329 | 3300009176 | Unclassified | 846 |
| 2 | 2214817448 | 2209111006 | Unclassified | 672 |
| 3 | ARcpr5oldR_c024750 | 3300000041 | Unclassified | 548 |
| 4 | ARcpr5yngRDRAFT_c012710 | 3300000043 | Unclassified | 709 |
| 5 | JGI24740J21852_10107259 | 3300001979 | Unclassified | 707 |
| 6 | JGI24743J22301_10001539 | 3300001991 | Bacteria | 3226 |
| 7 | JGI25404J52841_10009138 | 3300003659 | Bacteria | 2118 |
| 8 | JGI25405J52794_10015261 | 3300003911 | Bacteria | 1508 |
| 9 | JGI25405J52794_10073986 | 3300003911 | Unclassified | 745 |
| 10 | Ga0065717_1006076 | 3300005276 | Unclassified | 827 |
| 11 | Ga0070658_10480903 | 3300005327 | Unclassified | 1072 |
| 12 | Ga0070683_100553412 | 3300005329 | Bacteria | 1100 |
| 13 | Ga0070683_100831334 | 3300005329 | Unclassified | 886 |
| 14 | Ga0070690_100153880 | 3300005330 | Unclassified | 1571 |
| 15 | Ga0070690_100236831 | 3300005330 | Bacteria | 1286 |
| 16 | Ga0070670_100039820 | 3300005331 | Bacteria | 4041 |
| 17 | Ga0070670_100123660 | 3300005331 | Unclassified | 2232 |
| 18 | Ga0070670_100200782 | 3300005331 | Bacteria | 1732 |
| 19 | Ga0068869_100388027 | 3300005334 | Bacteria | 1146 |
| 20 | Ga0070682_100012793 | 3300005337 | Bacteria | 4818 |
| 21 | Ga0070682_100757437 | 3300005337 | Unclassified | 785 |
| 22 | Ga0068868_100004763 | 3300005338 | Bacteria | 9528 |
| 23 | Ga0068868_100168960 | 3300005338 | Unclassified | 1810 |
| 24 | Ga0070660_100035139 | 3300005339 | Bacteria | 3793 |
| 25 | Ga0070660_100562557 | 3300005339 | Bacteria | 952 |
| 26 | Ga0070689_100004926 | 3300005340 | Bacteria | 9061 |
| 27 | Ga0070689_100228178 | 3300005340 | Unclassified | 1530 |
| 28 | Ga0070689_100230558 | 3300005340 | Unclassified | 1522 |
| 29 | Ga0070691_10413216 | 3300005341 | Unclassified | 763 |
| 30 | Ga0070691_10417859 | 3300005341 | Unclassified | 759 |
| 31 | Ga0070687_100050547 | 3300005343 | Bacteria | 2147 |
| 32 | Ga0070687_100556972 | 3300005343 | Unclassified | 781 |
| 33 | Ga0070687_100643851 | 3300005343 | Unclassified | 734 |
| 34 | Ga0070687_101464255 | 3300005343 | Bacteria | 512 |
| 35 | Ga0070661_100679429 | 3300005344 | Unclassified | 838 |
| 36 | Ga0070661_100800369 | 3300005344 | Unclassified | 773 |
| 37 | Ga0070668_100051305 | 3300005347 | Bacteria | 3178 |
| 38 | Ga0070668_100054312 | 3300005347 | Bacteria | 3090 |
| 39 | Ga0070668_100277331 | 3300005347 | Bacteria | 1399 |
| 40 | Ga0070671_100022886 | 3300005355 | Bacteria | 5107 |
| 41 | Ga0070674_100075774 | 3300005356 | Bacteria | 2390 |
| 42 | Ga0070674_100401904 | 3300005356 | Unclassified | 1119 |
| 43 | Ga0070674_100635367 | 3300005356 | Bacteria | 906 |
| 44 | Ga0070673_100294291 | 3300005364 | Bacteria | 1427 |
| 45 | Ga0070688_100085753 | 3300005365 | Bacteria | 2047 |
| 46 | Ga0070659_100559597 | 3300005366 | Bacteria | 979 |
| 47 | Ga0070659_100636547 | 3300005366 | Unclassified | 919 |
| 48 | Ga0070659_101328138 | 3300005366 | Bacteria | 638 |
| 49 | Ga0070667_100079544 | 3300005367 | Bacteria | 2803 |
| 50 | Ga0070667_100172967 | 3300005367 | Bacteria | 1907 |
| 51 | Ga0070709_10231250 | 3300005434 | Bacteria | 1323 |
| 52 | Ga0070709_10710629 | 3300005434 | Unclassified | 783 |
| 53 | Ga0070714_100172158 | 3300005435 | Bacteria | 1965 |
| 54 | Ga0070713_100273175 | 3300005436 | Bacteria | 1548 |
| 55 | Ga0070713_100313755 | 3300005436 | Unclassified | 1447 |
| 56 | Ga0070713_101577413 | 3300005436 | Unclassified | 637 |
| 57 | Ga0070710_10373076 | 3300005437 | Bacteria | 950 |
| 58 | Ga0070701_10005855 | 3300005438 | Bacteria | 5125 |
| 59 | Ga0070701_10641654 | 3300005438 | Bacteria | 708 |
| 60 | Ga0070711_100400100 | 3300005439 | Unclassified | 1114 |
| 61 | Ga0070711_100402795 | 3300005439 | Bacteria | 1111 |
| 62 | Ga0070711_100916460 | 3300005439 | Unclassified | 748 |
| 63 | Ga0070700_100327876 | 3300005441 | Bacteria | 1127 |
| 64 | Ga0070700_100617636 | 3300005441 | Unclassified | 851 |
| 65 | Ga0070694_100065469 | 3300005444 | Unclassified | 2490 |
| 66 | Ga0070694_100068350 | 3300005444 | Bacteria | 2441 |
| 67 | Ga0070708_100458922 | 3300005445 | Bacteria | 1202 |
| 68 | Ga0070663_100025385 | 3300005455 | Bacteria | 4000 |
| 69 | Ga0070663_100296703 | 3300005455 | Bacteria | 1292 |
| 70 | Ga0070678_100073097 | 3300005456 | Plasmid | 2572 |
| 71 | Ga0070678_100509957 | 3300005456 | Unclassified | 1062 |
| 72 | Ga0070662_100020789 | 3300005457 | Bacteria | 4475 |
| 73 | Ga0070662_101422191 | 3300005457 | Unclassified | 598 |
| 74 | Ga0070681_10003489 | 3300005458 | Bacteria | 14719 |
| 75 | Ga0068867_101733150 | 3300005459 | Unclassified | 586 |
| 76 | Ga0070685_10581623 | 3300005466 | Bacteria | 803 |
| 77 | Ga0070706_100219097 | 3300005467 | Bacteria | 1776 |
| 78 | Ga0070706_100469611 | 3300005467 | Bacteria | 1170 |
| 79 | Ga0070706_100713907 | 3300005467 | Bacteria | 929 |
| 80 | Ga0070706_101048006 | 3300005467 | Bacteria | 751 |
| 81 | Ga0070707_100359470 | 3300005468 | Bacteria | 1414 |
| 82 | Ga0070707_100439301 | 3300005468 | Bacteria | 1265 |
| 83 | Ga0070707_100530225 | 3300005468 | Bacteria | 1139 |
| 84 | Ga0070707_100956643 | 3300005468 | Bacteria | 821 |
| 85 | Ga0070698_100237277 | 3300005471 | Bacteria | 1756 |
| 86 | Ga0070698_100735291 | 3300005471 | Bacteria | 929 |
| 87 | Ga0070698_100795628 | 3300005471 | Bacteria | 889 |
| 88 | Ga0070699_100182343 | 3300005518 | Bacteria | 1863 |
| 89 | Ga0070699_100656129 | 3300005518 | Bacteria | 958 |
| 90 | Ga0070699_100768337 | 3300005518 | Bacteria | 881 |
| 91 | Ga0070699_100793717 | 3300005518 | Bacteria | 866 |
| 92 | Ga0070679_100007580 | 3300005530 | Bacteria | 10152 |
| 93 | Ga0070684_100486397 | 3300005535 | Bacteria | 1143 |
| 94 | Ga0070697_100235832 | 3300005536 | Bacteria | 1561 |
| 95 | Ga0070697_100289602 | 3300005536 | Bacteria | 1406 |
| 96 | Ga0070697_100562892 | 3300005536 | Bacteria | 1000 |
| 97 | Ga0070697_101020677 | 3300005536 | Bacteria | 735 |
| 98 | Ga0070697_101336763 | 3300005536 | Bacteria | 639 |
| 99 | Ga0070697_101495322 | 3300005536 | Bacteria | 603 |
| 100 | Ga0070697_101784064 | 3300005536 | Unclassified | 550 |
| 101 | Ga0068853_100026879 | 3300005539 | Bacteria | 4834 |
| 102 | Ga0070672_100001330 | 3300005543 | Bacteria | 15234 |
| 103 | Ga0070672_100541790 | 3300005543 | Unclassified | 1010 |
| 104 | Ga0070686_100056117 | 3300005544 | Plasmid | 2525 |
| 105 | Ga0070686_100105067 | 3300005544 | Bacteria | 1914 |
| 106 | Ga0070686_100412596 | 3300005544 | Unclassified | 1030 |
| 107 | Ga0070695_100193200 | 3300005545 | Unclassified | 1450 |
| 108 | Ga0070695_101072265 | 3300005545 | Bacteria | 658 |
| 109 | Ga0070696_100057041 | 3300005546 | Bacteria | 2725 |
| 110 | Ga0070696_100371338 | 3300005546 | Bacteria | 1112 |
| 111 | Ga0070696_100530881 | 3300005546 | Unclassified | 940 |
| 112 | Ga0070693_100179691 | 3300005547 | Bacteria | 1361 |
| 113 | Ga0070693_101242477 | 3300005547 | Unclassified | 574 |
| 114 | Ga0070665_100042174 | 3300005548 | Bacteria | 4586 |
| 115 | Ga0070665_100215818 | 3300005548 | Bacteria | 1919 |
| 116 | Ga0070704_100297778 | 3300005549 | Unclassified | 1343 |
| 117 | Ga0068855_100616508 | 3300005563 | Unclassified | 1169 |
| 118 | Ga0070664_100200809 | 3300005564 | Bacteria | 1779 |
| 119 | Ga0070664_100583625 | 3300005564 | Unclassified | 1036 |
| 120 | Ga0068857_100130556 | 3300005577 | Bacteria | 2266 |
| 121 | Ga0068854_100265351 | 3300005578 | Bacteria | 1376 |
| 122 | Ga0068856_101506058 | 3300005614 | Unclassified | 687 |
| 123 | Ga0070702_100004417 | 3300005615 | Bacteria | 6419 |
| 124 | Ga0070702_100212463 | 3300005615 | Unclassified | 1288 |
| 125 | Ga0070702_100547822 | 3300005615 | Bacteria | 858 |
| 126 | Ga0070702_101098954 | 3300005615 | Unclassified | 635 |
| 127 | Ga0068852_100008788 | 3300005616 | Bacteria | 7474 |
| 128 | Ga0068852_101167429 | 3300005616 | Bacteria | 791 |
| 129 | Ga0068859_100076930 | 3300005617 | Bacteria | 3377 |
| 130 | Ga0068864_100146892 | 3300005618 | Bacteria | 2132 |
| 131 | Ga0068864_100353953 | 3300005618 | Bacteria | 1386 |
| 132 | Ga0068866_10008330 | 3300005718 | Bacteria | 4362 |
| 133 | Ga0068866_10049261 | 3300005718 | Unclassified | 2134 |
| 134 | Ga0068866_11418713 | 3300005718 | Unclassified | 508 |
| 135 | Ga0068861_100012963 | 3300005719 | Bacteria | 5822 |
| 136 | Ga0068870_10009661 | 3300005840 | Bacteria | 4396 |
| 137 | Ga0068863_100034411 | 3300005841 | Bacteria | 4826 |
| 138 | Ga0068863_100120575 | 3300005841 | Unclassified | 2500 |
| 139 | Ga0068858_100086985 | 3300005842 | Bacteria | 2907 |
| 140 | Ga0068858_100554664 | 3300005842 | Unclassified | 1112 |
| 141 | Ga0068860_100151101 | 3300005843 | Unclassified | 2236 |
| 142 | Ga0068860_101794141 | 3300005843 | Unclassified | 635 |
| 143 | Ga0068862_100384022 | 3300005844 | Unclassified | 1310 |
| 144 | Ga0068862_101236631 | 3300005844 | Unclassified | 746 |
| 145 | Ga0081455_10003946 | 3300005937 | Bacteria | 16854 |
| 146 | Ga0081455_10008930 | 3300005937 | Bacteria | 10359 |
| 147 | Ga0081455_10030119 | 3300005937 | Bacteria | 4937 |
| 148 | Ga0081455_10055314 | 3300005937 | Bacteria | 3376 |
| 149 | Ga0081455_10081547 | 3300005937 | Bacteria | 2649 |
| 150 | Ga0081455_10491206 | 3300005937 | Bacteria | 827 |
| 151 | Ga0081455_10650787 | 3300005937 | Bacteria | 679 |
| 152 | Ga0081538_10051086 | 3300005981 | Bacteria | 2487 |
| 153 | Ga0081540_1000081 | 3300005983 | Bacteria | 102423 |
| 154 | Ga0081540_1005331 | 3300005983 | Bacteria | 9623 |
| 155 | Ga0081540_1023133 | 3300005983 | Bacteria | 3646 |
| 156 | Ga0070717_10097025 | 3300006028 | Bacteria | 2497 |
| 157 | Ga0070717_10330636 | 3300006028 | Bacteria | 1359 |
| 158 | Ga0070717_10348028 | 3300006028 | Bacteria | 1324 |
| 159 | Ga0070717_10618310 | 3300006028 | Bacteria | 983 |
| 160 | Ga0070717_10639912 | 3300006028 | Bacteria | 965 |
| 161 | Ga0070717_11020399 | 3300006028 | Bacteria | 753 |
| 162 | Ga0075365_10005560 | 3300006038 | Bacteria | 6812 |
| 163 | Ga0075365_10040381 | 3300006038 | Bacteria | 3043 |
| 164 | Ga0075365_10137635 | 3300006038 | Bacteria | 1693 |
| 165 | Ga0075365_10142223 | 3300006038 | Bacteria | 1666 |
| 166 | Ga0075365_10143752 | 3300006038 | Bacteria | 1657 |
| 167 | Ga0075365_10162658 | 3300006038 | Bacteria | 1556 |
| 168 | Ga0075365_10500092 | 3300006038 | Bacteria | 859 |
| 169 | Ga0075363_100132288 | 3300006048 | Bacteria | 1400 |
| 170 | Ga0075364_10624798 | 3300006051 | Bacteria | 736 |
| 171 | Ga0075432_10274635 | 3300006058 | Bacteria | 691 |
| 172 | Ga0070715_10004618 | 3300006163 | Bacteria | 4539 |
| 173 | Ga0070715_10056490 | 3300006163 | Bacteria | 1708 |
| 174 | Ga0070715_10238861 | 3300006163 | Unclassified | 944 |
| 175 | Ga0070715_10424128 | 3300006163 | Bacteria | 745 |
| 176 | Ga0070716_100020156 | 3300006173 | Bacteria | 3497 |
| 177 | Ga0070716_100045533 | 3300006173 | Bacteria | 2463 |
| 178 | Ga0070716_100141109 | 3300006173 | Bacteria | 1536 |
| 179 | Ga0070716_100942793 | 3300006173 | Bacteria | 679 |
| 180 | Ga0070712_100314995 | 3300006175 | Bacteria | 1271 |
| 181 | Ga0070712_101268814 | 3300006175 | Unclassified | 642 |
| 182 | Ga0075369_10643499 | 3300006186 | Unclassified | 509 |
| 183 | Ga0097621_100319730 | 3300006237 | Unclassified | 1374 |
| 184 | Ga0097621_100392207 | 3300006237 | Bacteria | 1242 |
| 185 | Ga0068871_100199055 | 3300006358 | Bacteria | 1729 |
| 186 | Ga0068871_100241821 | 3300006358 | Bacteria | 1569 |
| 187 | Ga0075428_100044859 | 3300006844 | Bacteria | 4858 |
| 188 | Ga0075428_100057884 | 3300006844 | Bacteria | 4243 |
| 189 | Ga0075428_100141905 | 3300006844 | Bacteria | 2611 |
| 190 | Ga0075428_100321922 | 3300006844 | Bacteria | 1661 |
| 191 | Ga0075428_100643347 | 3300006844 | Bacteria | 1131 |
| 192 | Ga0075428_100680493 | 3300006844 | Bacteria | 1096 |
| 193 | Ga0075428_100698707 | 3300006844 | Unclassified | 1080 |
| 194 | Ga0075430_100069563 | 3300006846 | Bacteria | 2953 |
| 195 | Ga0075431_100071503 | 3300006847 | Bacteria | 3579 |
| 196 | Ga0075431_100149930 | 3300006847 | Unclassified | 2402 |
| 197 | Ga0075433_10331475 | 3300006852 | Bacteria | 1346 |
| 198 | Ga0075433_10337406 | 3300006852 | Bacteria | 1332 |
| 199 | Ga0075434_100111077 | 3300006871 | Bacteria | 2752 |
| 200 | Ga0075434_100214118 | 3300006871 | Bacteria | 1946 |
| 201 | Ga0075434_100323557 | 3300006871 | Bacteria | 1562 |
| 202 | Ga0075434_100401552 | 3300006871 | Bacteria | 1392 |
| 203 | Ga0075434_101701569 | 3300006871 | Unclassified | 638 |
| 204 | Ga0075429_100391043 | 3300006880 | Unclassified | 1218 |
| 205 | Ga0075429_101435382 | 3300006880 | Unclassified | 601 |
| 206 | Ga0068865_100935657 | 3300006881 | Unclassified | 755 |
| 207 | Ga0075436_100243561 | 3300006914 | Bacteria | 1279 |
| 208 | Ga0075436_100265979 | 3300006914 | Unclassified | 1223 |
| 209 | Ga0075436_100413504 | 3300006914 | Bacteria | 979 |
| 210 | Ga0075436_100688718 | 3300006914 | Unclassified | 757 |
| 211 | Ga0097620_100076936 | 3300006931 | Bacteria | 3377 |
| 212 | Ga0075435_100005977 | 3300007076 | Bacteria | 8565 |
| 213 | Ga0075435_100062514 | 3300007076 | Bacteria | 3022 |
| 214 | Ga0075435_100178798 | 3300007076 | Bacteria | 1793 |
| 215 | Ga0075435_100491102 | 3300007076 | Bacteria | 1061 |
| 216 | Ga0075435_100584830 | 3300007076 | Bacteria | 968 |
| 217 | Ga0099794_10032010 | 3300007265 | Bacteria | 2466 |
| 218 | Ga0105251_10424117 | 3300009011 | Bacteria | 614 |
| 219 | Ga0105250_10132538 | 3300009092 | Unclassified | 1029 |
| 220 | Ga0111539_10114513 | 3300009094 | Bacteria | 3163 |
| 221 | Ga0111539_10344533 | 3300009094 | Bacteria | 1734 |
| 222 | Ga0111539_10387212 | 3300009094 | Bacteria | 1628 |
| 223 | Ga0111539_10981579 | 3300009094 | Unclassified | 982 |
| 224 | Ga0111539_11101473 | 3300009094 | Bacteria | 923 |
| 225 | Ga0105245_10037180 | 3300009098 | Bacteria | 4328 |
| 226 | Ga0105245_10092205 | 3300009098 | Bacteria | 2789 |
| 227 | Ga0105245_11093570 | 3300009098 | Unclassified | 843 |
| 228 | Ga0105245_12861612 | 3300009098 | Unclassified | 535 |
| 229 | Ga0105247_10004123 | 3300009101 | Bacteria | 9326 |
| 230 | Ga0105247_10095790 | 3300009101 | Bacteria | 1890 |
| 231 | Ga0105247_10117226 | 3300009101 | Unclassified | 1721 |
| 232 | Ga0105247_10554603 | 3300009101 | Bacteria | 845 |
| 233 | Ga0105247_11748455 | 3300009101 | Unclassified | 516 |
| 234 | Ga0114129_10224269 | 3300009147 | Plasmid | 2534 |
| 235 | Ga0114129_10344044 | 3300009147 | Bacteria | 1977 |
| 236 | Ga0114129_10468026 | 3300009147 | Bacteria | 1651 |
| 237 | Ga0105243_10024687 | 3300009148 | Bacteria | 4587 |
| 238 | Ga0105243_10091236 | 3300009148 | Bacteria | 2509 |
| 239 | Ga0105242_10066660 | 3300009176 | Bacteria | 2974 |
| 240 | Ga0105242_10522338 | 3300009176 | Bacteria | 1133 |
| 241 | Ga0105248_10154592 | 3300009177 | Bacteria | 2589 |
| 242 | Ga0105248_10644321 | 3300009177 | Bacteria | 1195 |
| 243 | Ga0105237_10331319 | 3300009545 | Unclassified | 1526 |
| 244 | Ga0105237_11056995 | 3300009545 | Bacteria | 819 |
| 245 | Ga0105238_10098673 | 3300009551 | Bacteria | 2905 |
| 246 | Ga0105238_11473494 | 3300009551 | Bacteria | 709 |
| 247 | Ga0105249_10034925 | 3300009553 | Bacteria | 4558 |
| 248 | Ga0105249_10070280 | 3300009553 | Bacteria | 3231 |
| 249 | Ga0099796_10276922 | 3300010159 | Unclassified | 704 |
| 250 | Ga0105239_10079166 | 3300010375 | Bacteria | 3616 |
| 251 | Ga0105239_10263013 | 3300010375 | Unclassified | 1939 |
| 252 | Ga0105239_10346909 | 3300010375 | Bacteria | 1676 |
| 253 | Ga0105239_12690833 | 3300010375 | Bacteria | 580 |
| 254 | Ga0105239_13401546 | 3300010375 | Bacteria | 517 |
| 255 | Ga0105246_10035470 | 3300011119 | Bacteria | 3334 |
| 256 | Ga0105246_10047375 | 3300011119 | Bacteria | 2935 |
| 257 | Ga0105246_10109292 | 3300011119 | Bacteria | 2028 |
| 258 | Ga0105246_10862295 | 3300011119 | Bacteria | 809 |
| 259 | Ga0157344_1004741 | 3300012476 | Unclassified | 820 |
| 260 | Ga0157336_1011267 | 3300012477 | Unclassified | 693 |
| 261 | Ga0157328_1002162 | 3300012478 | Unclassified | 919 |
| 262 | Ga0157320_1001735 | 3300012481 | Unclassified | 1147 |
| 263 | Ga0157339_1018644 | 3300012505 | Unclassified | 716 |
| 264 | Ga0157342_1000251 | 3300012507 | Bacteria | 2973 |
| 265 | Ga0157315_1008187 | 3300012508 | Unclassified | 868 |
| 266 | Ga0157373_10281398 | 3300013100 | Bacteria | 1179 |
| 267 | Ga0157374_10033949 | 3300013296 | Bacteria | 4657 |
| 268 | Ga0157374_10342625 | 3300013296 | Bacteria | 1484 |
| 269 | Ga0157378_10182190 | 3300013297 | Bacteria | 1976 |
| 270 | Ga0157378_10601040 | 3300013297 | Bacteria | 1111 |
| 271 | Ga0163162_10284756 | 3300013306 | Unclassified | 1784 |
| 272 | Ga0163162_10654472 | 3300013306 | Bacteria | 1174 |
| 273 | Ga0163162_10698048 | 3300013306 | Bacteria | 1136 |
| 274 | Ga0163162_10914960 | 3300013306 | Bacteria | 990 |
| 275 | Ga0163162_10920680 | 3300013306 | Bacteria | 986 |
| 276 | Ga0157375_10266819 | 3300013308 | Bacteria | 1873 |
| 277 | Ga0157375_10415343 | 3300013308 | Bacteria | 1512 |
| 278 | Ga0157375_11661220 | 3300013308 | Bacteria | 756 |
| 279 | Ga0157375_13403898 | 3300013308 | Unclassified | 530 |
| 280 | Ga0163163_10012664 | 3300014325 | Bacteria | 7691 |
| 281 | Ga0163163_10154621 | 3300014325 | Bacteria | 2338 |
| 282 | Ga0163163_10197636 | 3300014325 | Bacteria | 2059 |
| 283 | Ga0157380_10150668 | 3300014326 | Bacteria | 2010 |
| 284 | Ga0157380_12022999 | 3300014326 | Bacteria | 638 |
| 285 | Ga0157377_10002072 | 3300014745 | Bacteria | 8802 |
| 286 | Ga0157379_10222152 | 3300014968 | Bacteria | 1712 |
| 287 | Ga0157379_10731267 | 3300014968 | Unclassified | 930 |
| 288 | Ga0157379_10743494 | 3300014968 | Bacteria | 923 |
| 289 | Ga0157376_10090497 | 3300014969 | Bacteria | 2648 |
| 290 | Ga0157376_10301067 | 3300014969 | Bacteria | 1518 |
| 291 | Ga0163161_10478255 | 3300017792 | Unclassified | 1011 |
| 292 | Ga0163161_10752310 | 3300017792 | Unclassified | 815 |
| 293 | Ga0213873_10036599 | 3300021358 | Bacteria | 1247 |
| 294 | Ga0213874_10116118 | 3300021377 | Bacteria | 905 |
| 295 | Ga0213876_10031780 | 3300021384 | Bacteria | 2785 |
| 296 | Ga0213876_10338404 | 3300021384 | Bacteria | 800 |
| 297 | Ga0207697_10032971 | 3300025315 | Bacteria | 2120 |
| 298 | Ga0207696_1117830 | 3300025711 | Unclassified | 717 |
| 299 | Ga0207692_10694846 | 3300025898 | Bacteria | 660 |
| 300 | Ga0207692_10709524 | 3300025898 | Bacteria | 653 |
| 301 | Ga0207692_10918568 | 3300025898 | Unclassified | 576 |
| 302 | Ga0207642_10290325 | 3300025899 | Bacteria | 944 |
| 303 | Ga0207642_10905734 | 3300025899 | Unclassified | 565 |
| 304 | Ga0207710_10003493 | 3300025900 | Bacteria | 6996 |
| 305 | Ga0207710_10061808 | 3300025900 | Bacteria | 1701 |
| 306 | Ga0207688_10003162 | 3300025901 | Bacteria | 8980 |
| 307 | Ga0207688_10226461 | 3300025901 | Bacteria | 1128 |
| 308 | Ga0207680_10323799 | 3300025903 | Unclassified | 1078 |
| 309 | Ga0207685_10012558 | 3300025905 | Bacteria | 2589 |
| 310 | Ga0207685_10018081 | 3300025905 | Bacteria | 2294 |
| 311 | Ga0207685_10034787 | 3300025905 | Bacteria | 1833 |
| 312 | Ga0207699_11059582 | 3300025906 | Bacteria | 600 |
| 313 | Ga0207645_10027456 | 3300025907 | Bacteria | 3675 |
| 314 | Ga0207643_10023614 | 3300025908 | Bacteria | 3391 |
| 315 | Ga0207684_10229354 | 3300025910 | Bacteria | 1602 |
| 316 | Ga0207684_10774315 | 3300025910 | Bacteria | 812 |
| 317 | Ga0207684_11419998 | 3300025910 | Bacteria | 567 |
| 318 | Ga0207654_10070256 | 3300025911 | Bacteria | 2078 |
| 319 | Ga0207707_10079085 | 3300025912 | Bacteria | 2871 |
| 320 | Ga0207693_10237155 | 3300025915 | Bacteria | 1432 |
| 321 | Ga0207693_10273832 | 3300025915 | Bacteria | 1323 |
| 322 | Ga0207663_10050434 | 3300025916 | Bacteria | 2586 |
| 323 | Ga0207662_10001805 | 3300025918 | Bacteria | 10509 |
| 324 | Ga0207662_10327496 | 3300025918 | Bacteria | 1024 |
| 325 | Ga0207657_10084361 | 3300025919 | Bacteria | 2663 |
| 326 | Ga0207657_10132376 | 3300025919 | Bacteria | 2043 |
| 327 | Ga0207649_10227820 | 3300025920 | Unclassified | 1331 |
| 328 | Ga0207649_10977682 | 3300025920 | Unclassified | 665 |
| 329 | Ga0207652_10018578 | 3300025921 | Bacteria | 5704 |
| 330 | Ga0207646_10691370 | 3300025922 | Bacteria | 912 |
| 331 | Ga0207646_11150162 | 3300025922 | Bacteria | 682 |
| 332 | Ga0207681_10374436 | 3300025923 | Unclassified | 1145 |
| 333 | Ga0207650_10048297 | 3300025925 | Bacteria | 3139 |
| 334 | Ga0207650_10222614 | 3300025925 | Bacteria | 1519 |
| 335 | Ga0207659_10272352 | 3300025926 | Unclassified | 1381 |
| 336 | Ga0207659_11799710 | 3300025926 | Unclassified | 520 |
| 337 | Ga0207687_10202991 | 3300025927 | Unclassified | 1551 |
| 338 | Ga0207687_10756021 | 3300025927 | Bacteria | 827 |
| 339 | Ga0207700_10043298 | 3300025928 | Bacteria | 3306 |
| 340 | Ga0207700_10394285 | 3300025928 | Unclassified | 1212 |
| 341 | Ga0207700_10523181 | 3300025928 | Bacteria | 1051 |
| 342 | Ga0207700_10905393 | 3300025928 | Unclassified | 789 |
| 343 | Ga0207664_10037085 | 3300025929 | Bacteria | 3771 |
| 344 | Ga0207664_10164628 | 3300025929 | Bacteria | 1894 |
| 345 | Ga0207664_10378141 | 3300025929 | Bacteria | 1257 |
| 346 | Ga0207664_11726670 | 3300025929 | Bacteria | 548 |
| 347 | Ga0207644_10170959 | 3300025931 | Bacteria | 1696 |
| 348 | Ga0207644_11743057 | 3300025931 | Unclassified | 521 |
| 349 | Ga0207690_10175888 | 3300025932 | Bacteria | 1607 |
| 350 | Ga0207690_10848051 | 3300025932 | Bacteria | 756 |
| 351 | Ga0207706_10008946 | 3300025933 | Bacteria | 9216 |
| 352 | Ga0207706_10020855 | 3300025933 | Bacteria | 5884 |
| 353 | Ga0207686_10062296 | 3300025934 | Bacteria | 2368 |
| 354 | Ga0207686_10151008 | 3300025934 | Bacteria | 1617 |
| 355 | Ga0207686_10253963 | 3300025934 | Bacteria | 1286 |
| 356 | Ga0207709_10010291 | 3300025935 | Bacteria | 5153 |
| 357 | Ga0207709_10158940 | 3300025935 | Bacteria | 1574 |
| 358 | Ga0207670_10137060 | 3300025936 | Bacteria | 1800 |
| 359 | Ga0207670_10952538 | 3300025936 | Unclassified | 721 |
| 360 | Ga0207670_11642542 | 3300025936 | Bacteria | 546 |
| 361 | Ga0207669_10006625 | 3300025937 | Bacteria | 5308 |
| 362 | Ga0207669_10025976 | 3300025937 | Bacteria | 3177 |
| 363 | Ga0207704_10048207 | 3300025938 | Bacteria | 2552 |
| 364 | Ga0207665_10011325 | 3300025939 | Bacteria | 5855 |
| 365 | Ga0207665_10133273 | 3300025939 | Bacteria | 1766 |
| 366 | Ga0207691_10003107 | 3300025940 | Bacteria | 16211 |
| 367 | Ga0207691_10189968 | 3300025940 | Bacteria | 1791 |
| 368 | Ga0207711_10007877 | 3300025941 | Bacteria | 8913 |
| 369 | Ga0207689_10004621 | 3300025942 | Bacteria | 12454 |
| 370 | Ga0207689_10059297 | 3300025942 | Bacteria | 3148 |
| 371 | Ga0207661_10414447 | 3300025944 | Unclassified | 1223 |
| 372 | Ga0207661_11385635 | 3300025944 | Bacteria | 645 |
| 373 | Ga0207679_10239235 | 3300025945 | Bacteria | 1537 |
| 374 | Ga0207679_10264365 | 3300025945 | Unclassified | 1469 |
| 375 | Ga0207651_10105487 | 3300025960 | Unclassified | 2102 |
| 376 | Ga0207651_11283697 | 3300025960 | Unclassified | 658 |
| 377 | Ga0207712_10142590 | 3300025961 | Unclassified | 1841 |
| 378 | Ga0207668_10474191 | 3300025972 | Bacteria | 1072 |
| 379 | Ga0207640_10089119 | 3300025981 | Unclassified | 2132 |
| 380 | Ga0207640_11220785 | 3300025981 | Unclassified | 669 |
| 381 | Ga0207658_10039475 | 3300025986 | Bacteria | 3406 |
| 382 | Ga0207658_10057159 | 3300025986 | Bacteria | 2898 |
| 383 | Ga0207677_10009466 | 3300026023 | Bacteria | 5483 |
| 384 | Ga0207703_10835833 | 3300026035 | Unclassified | 880 |
| 385 | Ga0207703_11267735 | 3300026035 | Bacteria | 709 |
| 386 | Ga0207703_12099668 | 3300026035 | Unclassified | 541 |
| 387 | Ga0207639_10775620 | 3300026041 | Unclassified | 892 |
| 388 | Ga0207639_10781391 | 3300026041 | Unclassified | 889 |
| 389 | Ga0207678_10012522 | 3300026067 | Bacteria | 7449 |
| 390 | Ga0207678_10016271 | 3300026067 | Bacteria | 6528 |
| 391 | Ga0207708_10000903 | 3300026075 | Bacteria | 22295 |
| 392 | Ga0207708_10805366 | 3300026075 | Unclassified | 809 |
| 393 | Ga0207702_10486634 | 3300026078 | Bacteria | 1201 |
| 394 | Ga0207702_10660748 | 3300026078 | Bacteria | 1028 |
| 395 | Ga0207702_12031197 | 3300026078 | Unclassified | 565 |
| 396 | Ga0207641_10314400 | 3300026088 | Unclassified | 1483 |
| 397 | Ga0207641_10378261 | 3300026088 | Bacteria | 1355 |
| 398 | Ga0207648_10007242 | 3300026089 | Bacteria | 10939 |
| 399 | Ga0207648_10030022 | 3300026089 | Bacteria | 4820 |
| 400 | Ga0207676_10028505 | 3300026095 | Bacteria | 4171 |
| 401 | Ga0207676_10304487 | 3300026095 | Bacteria | 1456 |
| 402 | Ga0207674_10433291 | 3300026116 | Bacteria | 1271 |
| 403 | Ga0207675_100005933 | 3300026118 | Bacteria | 11656 |
| 404 | Ga0207675_100454498 | 3300026118 | Unclassified | 1270 |
| 405 | Ga0207683_10012534 | 3300026121 | Bacteria | 7233 |
| 406 | Ga0207683_10087529 | 3300026121 | Plasmid | 2770 |
| 407 | Ga0207698_10013610 | 3300026142 | Bacteria | 5376 |
| 408 | Ga0209588_1056808 | 3300027671 | Bacteria | 1265 |
| 409 | Ga0207428_10177736 | 3300027907 | Bacteria | 1609 |
| 410 | Ga0268266_10344945 | 3300028379 | Unclassified | 1398 |
| 411 | Ga0268266_12006058 | 3300028379 | Unclassified | 552 |
| 412 | Ga0268265_10034930 | 3300028380 | Bacteria | 3669 |
| 413 | Ga0268265_10564007 | 3300028380 | Unclassified | 1083 |
| 414 | Ga0268264_10034737 | 3300028381 | Bacteria | 4149 |
| 415 | Ga0268264_10350919 | 3300028381 | Bacteria | 1404 |
| 416 | Ga0265328_10068548 | 3300031239 | Bacteria | 1303 |
| 417 | Ga0265340_10011490 | 3300031247 | Bacteria | 4704 |
| 418 | Ga0265339_10046597 | 3300031249 | Bacteria | 2382 |
| 419 | Ga0265316_10784265 | 3300031344 | Bacteria | 669 |
| 420 | Ga0307408_101513324 | 3300031548 | Bacteria | 635 |
| 421 | Ga0307409_101944000 | 3300031995 | Bacteria | 618 |
| 422 | Ga0373930_0016442 | 3300034816 | Unclassified | 1399 |
| 423 | Ga0373948_0079309 | 3300034817 | Unclassified | 747 |
| 424 | Ga0373948_0131780 | 3300034817 | Bacteria | 612 |
| 425 | Ga0373950_0005845 | 3300034818 | Bacteria | 1852 |
| 426 | Ga0373958_0072470 | 3300034819 | Bacteria | 767 |
| 427 | Ga0373959_0007110 | 3300034820 | Bacteria | 1876 |
| 428 | Ga0373938_0000774 | 3300034957 | Bacteria | 5192 |
| 429 | Ga0373926_0037707 | 3300035083 | Unclassified | 1719 |
| 430 | Ga0373926_0058377 | 3300035083 | Bacteria | 1403 |
| 431 | Ga0373928_0009457 | 3300035084 | Bacteria | 1904 |
| 432 | Ga0373929_0015217 | 3300035085 | Bacteria | 1493 |
| 433 | Ga0373940_0043240 | 3300035088 | Bacteria | 1244 |
| 434 | Ga0373944_0039143 | 3300035089 | Bacteria | 1459 |
| 435 | Ga0373949_0011150 | 3300035090 | Bacteria | 1977 |
| 436 | Ga0373951_0008469 | 3300035091 | Unclassified | 2321 |
| 437 | Ga0373952_0002665 | 3300035092 | Bacteria | 3219 |
| 438 | Ga0373952_0110744 | 3300035092 | Unclassified | 735 |
| 439 | Ga0373923_0133786 | 3300035111 | Unclassified | 1116 |
| 440 | Ga0373932_0044982 | 3300035112 | Unclassified | 1289 |
| 441 | Ga0373936_0024357 | 3300035113 | Unclassified | 2362 |
| 442 | Ga0373939_0029961 | 3300035114 | Bacteria | 1561 |
| 443 | Ga0373939_0040233 | 3300035114 | Bacteria | 1403 |
| 444 | Ga0373941_0025144 | 3300035115 | Bacteria | 1717 |
| 445 | Ga0373945_0034012 | 3300035116 | Unclassified | 1814 |
| 446 | Ga0373945_0039439 | 3300035116 | Bacteria | 1702 |
| 447 | Ga0373953_0334172 | 3300035117 | Unclassified | 663 |
| 448 | Ga0373954_0026708 | 3300035118 | Unclassified | 2648 |
| 449 | Ga0373957_0026288 | 3300035120 | Bacteria | 2104 |
| 450 | Ga0373960_0028872 | 3300035121 | Unclassified | 1533 |
| 451 | Ga0373943_0007085 | 3300035170 | Bacteria | 5030 |
| 452 | Ga0373943_0014234 | 3300035170 | Unclassified | 3598 |
| 453 | Ga0373943_0025570 | 3300035170 | Bacteria | 2760 |
| 454 | Ga0373943_0056792 | 3300035170 | Bacteria | 1943 |
| 455 | Ga0373943_0418506 | 3300035170 | Bacteria | 775 |
| 456 | Ga0373943_0733771 | 3300035170 | Bacteria | 586 |
| 457 | Ga0373946_0001998 | 3300035171 | Bacteria | 7140 |
| 458 | Ga0373946_0020211 | 3300035171 | Bacteria | 2572 |
| 459 | Ga0373946_0074603 | 3300035171 | Unclassified | 1472 |
| 460 | Ga0373946_0114781 | 3300035171 | Bacteria | 1223 |
| 461 | Ga0373955_0120795 | 3300035172 | Unclassified | 1523 |
| 462 | Ga0373942_0020135 | 3300035207 | Unclassified | 1672 |
| 463 | Ga0373961_0007527 | 3300035241 | Bacteria | 2636 |
| 464 | Ga0373962_0001749 | 3300035242 | Bacteria | 5167 |
| 465 | Ga0373924_0199106 | 3300035410 | Unclassified | 883 |
| 466 | Ga0373931_0031652 | 3300035691 | Bacteria | 2731 |
| 467 | Ga0373931_0798215 | 3300035691 | Bacteria | 629 |
| 468 | Ga0373935_0039066 | 3300035692 | Bacteria | 2974 |
| 469 | Ga0373935_0039930 | 3300035692 | Bacteria | 2943 |
| 470 | Ga0373935_0127801 | 3300035692 | Unclassified | 1704 |
| 471 | Ga0373927_0004359 | 3300035695 | Bacteria | 9920 |
| 472 | Ga0373927_0066162 | 3300035695 | Bacteria | 2338 |
| 473 | Ga0373927_0185508 | 3300035695 | Unclassified | 1364 |
| 474 | Ga0373927_0288087 | 3300035695 | Bacteria | 1081 |
| 475 | Ga0373933_0332262 | 3300035724 | Bacteria | 986 |
| 476 | Ga0373933_0370572 | 3300035724 | Unclassified | 932 |
| 477 | Ga0373933_0444198 | 3300035724 | Bacteria | 848 |
| 478 | Ga0373947_0001284 | 3300035725 | Bacteria | 15473 |
| 479 | Ga0373947_0010881 | 3300035725 | Bacteria | 5222 |
| 480 | Ga0373947_0031943 | 3300035725 | Bacteria | 3101 |
| 481 | Ga0373947_0060773 | 3300035725 | Bacteria | 2295 |
| 482 | Ga0373947_0169076 | 3300035725 | Unclassified | 1417 |
| 483 | Ga0373937_0040093 | 3300036401 | Bacteria | 4269 |
| 484 | Ga0373937_0301605 | 3300036401 | Unclassified | 1514 |
| 485 | Ga0373925_0005253 | 3300037068 | Bacteria | 9670 |
| 486 | Ga0373925_0007671 | 3300037068 | Bacteria | 7860 |
| 487 | Ga0373925_0071711 | 3300037068 | Bacteria | 2621 |
| 488 | Ga0395900_1283846 | 3300037418 | Bacteria | 646 |
| 489 | Ga0436364_0108650 | 3300037853 | Unclassified | 787 |
| 490 | Ga0436364_0212863 | 3300037853 | Bacteria | 2758 |
| 491 | Ga0436364_0629386 | 3300037853 | Bacteria | 1012 |
| 492 | Ga0436364_1057555 | 3300037853 | Bacteria | 51632 |
| 493 | Ga0436364_1148727 | 3300037853 | Bacteria | 1619 |
| 494 | Ga0436364_1168836 | 3300037853 | Bacteria | 611 |
| 495 | Ga0436364_1496074 | 3300037853 | Bacteria | 707 |
| 496 | Ga0436364_1544542 | 3300037853 | Bacteria | 3449 |
| 497 | Ga0395901_0361500 | 3300038443 | Bacteria | 1497 |
| 498 | Ga0395901_0694544 | 3300038443 | Bacteria | 1016 |
| 499 | Ga0242420_004389 | 3300038996 | Bacteria | 2130 |
| 500 | Ga0436365_0050135 | 3300039437 | Bacteria | 3409 |
| 501 | Ga0436365_1463846 | 3300039437 | Bacteria | 3332 |
| 502 | Ga0436360_0739662 | 3300039438 | Bacteria | 4390 |
| 503 | Ga0436361_0480030 | 3300039447 | Unclassified | 503 |
| 504 | Ga0436361_0550427 | 3300039447 | Bacteria | 1193 |
| 505 | Ga0436361_0605963 | 3300039447 | Bacteria | 3794 |
| 506 | Ga0436363_0075951 | 3300039450 | Bacteria | 9272 |
| 507 | Ga0436363_0135958 | 3300039450 | Bacteria | 1707 |
| 508 | Ga0436363_0666566 | 3300039450 | Bacteria | 2068 |
| 509 | Ga0436362_0102214 | 3300039453 | Bacteria | 3071 |
| 510 | Ga0436362_0394223 | 3300039453 | Bacteria | 863 |
| 511 | Ga0451789_0108192 | 3300041443 | Bacteria | 942 |
| 512 | Ga0451795_0340630 | 3300041456 | Bacteria | 928 |
| 513 | Ga0451798_0682408 | 3300041458 | Unclassified | 996 |
| 514 | Ga0451833_0160897 | 3300041491 | Unclassified | 554 |
| 515 | Ga0451853_1842165 | 3300041512 | Bacteria | 832 |
| 516 | Ga0466967_0743405 | 3300045976 | Bacteria | 973 |
| 517 | Ga0495592_0010790 | 3300046454 | Bacteria | 6890 |
| 518 | Ga0495592_0120955 | 3300046454 | Bacteria | 1842 |
| 519 | Ga0495603_0000416 | 3300046455 | Bacteria | 23560 |
| 520 | Ga0495603_0030167 | 3300046455 | Bacteria | 3267 |
| 521 | Ga0495603_0535938 | 3300046455 | Unclassified | 670 |
| 522 | Ga0495629_0002468 | 3300046459 | Bacteria | 14194 |
| 523 | Ga0495629_0021071 | 3300046459 | Bacteria | 4651 |
| 524 | Ga0495629_0103580 | 3300046459 | Bacteria | 1985 |
| 525 | Ga0495629_0213138 | 3300046459 | Bacteria | 1333 |
| 526 | Ga0495638_0560425 | 3300046460 | Unclassified | 567 |
| 527 | Ga0495641_0014527 | 3300046461 | Bacteria | 4255 |
| 528 | Ga0495641_0087079 | 3300046461 | Unclassified | 1397 |
| 529 | Ga0495651_0021958 | 3300046462 | Bacteria | 4964 |
| 530 | Ga0495653_0069117 | 3300046463 | Bacteria | 2647 |
| 531 | Ga0495580_0028144 | 3300046472 | Unclassified | 4087 |
| 532 | Ga0495580_0130499 | 3300046472 | Unclassified | 1743 |
| 533 | Ga0495580_0233318 | 3300046472 | Bacteria | 1263 |
| 534 | Ga0495582_0003410 | 3300046473 | Bacteria | 8948 |
| 535 | Ga0495582_0005148 | 3300046473 | Bacteria | 7321 |
| 536 | Ga0495582_0045970 | 3300046473 | Unclassified | 2404 |
| 537 | Ga0495582_0081710 | 3300046473 | Unclassified | 1795 |
| 538 | Ga0495605_0111650 | 3300046474 | Bacteria | 1247 |
| 539 | Ga0495605_0216137 | 3300046474 | Unclassified | 830 |
| 540 | Ga0495605_0222747 | 3300046474 | Unclassified | 815 |
| 541 | Ga0495639_0002783 | 3300046475 | Bacteria | 7604 |
| 542 | Ga0495639_0017252 | 3300046475 | Bacteria | 3135 |
| 543 | Ga0495639_0038487 | 3300046475 | Bacteria | 2148 |
| 544 | Ga0495639_0098920 | 3300046475 | Bacteria | 1375 |
| 545 | Ga0495662_0010361 | 3300046476 | Unclassified | 4567 |
| 546 | Ga0495662_0023790 | 3300046476 | Plasmid | 2958 |
| 547 | Ga0495662_0176584 | 3300046476 | Bacteria | 1053 |
| 548 | Ga0495664_0020825 | 3300046477 | Bacteria | 3786 |
| 549 | Ga0495664_0027417 | 3300046477 | Unclassified | 3321 |
| 550 | Ga0495664_0506829 | 3300046477 | Unclassified | 721 |
| 551 | Ga0495584_0035794 | 3300046491 | Bacteria | 2509 |
| 552 | Ga0495584_0072730 | 3300046491 | Unclassified | 1728 |
| 553 | Ga0495585_0003446 | 3300046492 | Bacteria | 10686 |
| 554 | Ga0495585_0370598 | 3300046492 | Unclassified | 693 |
| 555 | Ga0495594_0012273 | 3300046499 | Bacteria | 4462 |
| 556 | Ga0495594_0066444 | 3300046499 | Unclassified | 2000 |
| 557 | Ga0495594_0371359 | 3300046499 | Unclassified | 814 |
| 558 | Ga0495594_0630048 | 3300046499 | Unclassified | 607 |
| 559 | Ga0495607_0027729 | 3300046501 | Bacteria | 3499 |
| 560 | Ga0495608_0004974 | 3300046511 | Bacteria | 9511 |
| 561 | Ga0495608_0106726 | 3300046511 | Unclassified | 1802 |
| 562 | Ga0495618_0001026 | 3300046514 | Bacteria | 19150 |
| 563 | Ga0495618_0071015 | 3300046514 | Bacteria | 2215 |
| 564 | Ga0495618_0101727 | 3300046514 | Bacteria | 1839 |
| 565 | Ga0495618_0170806 | 3300046514 | Bacteria | 1384 |
| 566 | Ga0495618_0185269 | 3300046514 | Bacteria | 1322 |
| 567 | Ga0495620_0231178 | 3300046515 | Bacteria | 707 |
| 568 | Ga0495620_0351571 | 3300046515 | Unclassified | 559 |
| 569 | Ga0495630_0029501 | 3300046517 | Unclassified | 4078 |
| 570 | Ga0495630_0041199 | 3300046517 | Bacteria | 3449 |
| 571 | Ga0495630_0067767 | 3300046517 | Bacteria | 2683 |
| 572 | Ga0495630_0199060 | 3300046517 | Unclassified | 1528 |
| 573 | Ga0495630_0506300 | 3300046517 | Bacteria | 926 |
| 574 | Ga0495631_0395082 | 3300046518 | Unclassified | 589 |
| 575 | Ga0495637_0030422 | 3300046520 | Bacteria | 2396 |
| 576 | Ga0495644_0084703 | 3300046523 | Unclassified | 1195 |
| 577 | Ga0495644_0152495 | 3300046523 | Bacteria | 885 |
| 578 | Ga0495663_0009368 | 3300046525 | Bacteria | 2715 |
| 579 | Ga0495666_0081508 | 3300046526 | Unclassified | 1530 |
| 580 | Ga0495642_0205138 | 3300046528 | Bacteria | 860 |
| 581 | Ga0495652_0003570 | 3300046529 | Bacteria | 15274 |
| 582 | Ga0495652_0075832 | 3300046529 | Bacteria | 2791 |
| 583 | Ga0495665_0059852 | 3300046531 | Unclassified | 2010 |
| 584 | Ga0495665_0195837 | 3300046531 | Unclassified | 1048 |
| 585 | Ga0495665_0314036 | 3300046531 | Bacteria | 801 |
| 586 | Ga0495665_0333093 | 3300046531 | Unclassified | 774 |
| 587 | Ga0495640_0001631 | 3300046533 | Bacteria | 17720 |
| 588 | Ga0495640_0017672 | 3300046533 | Bacteria | 5307 |
| 589 | Ga0495587_0096070 | 3300046536 | Unclassified | 1709 |
| 590 | Ga0495587_0114149 | 3300046536 | Bacteria | 1550 |
| 591 | Ga0495587_0117953 | 3300046536 | Bacteria | 1521 |
| 592 | Ga0495587_0795041 | 3300046536 | Bacteria | 517 |
| 593 | Ga0495598_0016272 | 3300046537 | Unclassified | 1895 |
| 594 | Ga0495609_0209774 | 3300046538 | Bacteria | 812 |
| 595 | Ga0495621_0020825 | 3300046539 | Bacteria | 2156 |
| 596 | Ga0495622_0049319 | 3300046557 | Unclassified | 1954 |
| 597 | Ga0495633_0024190 | 3300046558 | Bacteria | 3003 |
| 598 | Ga0495667_0051000 | 3300046559 | Bacteria | 2730 |
| 599 | Ga0495667_0111401 | 3300046559 | Bacteria | 1768 |
| 600 | Ga0495667_0193396 | 3300046559 | Bacteria | 1303 |
| 601 | Ga0495656_0004050 | 3300046615 | Bacteria | 4984 |
| 602 | Ga0495656_0143011 | 3300046615 | Bacteria | 1149 |
| 603 | Ga0495656_0718129 | 3300046615 | Unclassified | 538 |
| 604 | Ga0495668_0454585 | 3300046616 | Unclassified | 705 |
| 605 | Ga0495634_0009355 | 3300046642 | Bacteria | 7228 |
| 606 | Ga0495634_0065700 | 3300046642 | Bacteria | 2403 |
| 607 | Ga0495634_0074977 | 3300046642 | Bacteria | 2222 |
| 608 | Ga0495634_0755317 | 3300046642 | Unclassified | 557 |
| 609 | Ga0495611_0258414 | 3300046648 | Bacteria | 807 |
| 610 | Ga0495635_0031396 | 3300046663 | Bacteria | 3688 |
| 611 | Ga0495635_0111609 | 3300046663 | Bacteria | 1867 |
| 612 | Ga0495635_0314511 | 3300046663 | Bacteria | 1049 |
| 613 | Ga0495659_0087294 | 3300046664 | Unclassified | 1193 |
| 614 | Ga0495661_0124373 | 3300046665 | Bacteria | 1421 |
| 615 | Ga0495588_0055074 | 3300046674 | Unclassified | 2052 |
| 616 | Ga0495588_0089457 | 3300046674 | Bacteria | 1612 |
| 617 | Ga0495588_0245545 | 3300046674 | Bacteria | 944 |
| 618 | Ga0495599_0746671 | 3300046678 | Bacteria | 562 |
| 619 | Ga0495623_0669578 | 3300046679 | Bacteria | 534 |
| 620 | Ga0495646_0010226 | 3300046680 | Bacteria | 5968 |
| 621 | Ga0495646_0120913 | 3300046680 | Unclassified | 1482 |
| 622 | Ga0495647_0029831 | 3300046681 | Bacteria | 2019 |
| 623 | Ga0495647_0031656 | 3300046681 | Bacteria | 1968 |
| 624 | Ga0495647_0095482 | 3300046681 | Unclassified | 1224 |
| 625 | Ga0495658_0016929 | 3300046683 | Bacteria | 3757 |
| 626 | Ga0495658_0230011 | 3300046683 | Unclassified | 1162 |
| 627 | Ga0495669_0108597 | 3300046684 | Unclassified | 1294 |
| 628 | Ga0495669_0336361 | 3300046684 | Unclassified | 729 |
| 629 | Ga0495613_0010882 | 3300046689 | Bacteria | 6752 |
| 630 | Ga0495613_0069839 | 3300046689 | Bacteria | 2561 |
| 631 | Ga0495613_0117029 | 3300046689 | Bacteria | 1916 |
| 632 | Ga0495613_0426108 | 3300046689 | Bacteria | 902 |
| 633 | Ga0495624_0012119 | 3300046690 | Bacteria | 5904 |
| 634 | Ga0495624_0022379 | 3300046690 | Unclassified | 4178 |
| 635 | Ga0495624_0093163 | 3300046690 | Bacteria | 1857 |
| 636 | Ga0495624_0275781 | 3300046690 | Unclassified | 1016 |
| 637 | Ga0495624_0462873 | 3300046690 | Bacteria | 759 |
| 638 | Ga0495670_0016334 | 3300046691 | Bacteria | 3648 |
| 639 | Ga0495670_0437634 | 3300046691 | Bacteria | 708 |
| 640 | Ga0495649_0236726 | 3300046694 | Unclassified | 941 |
| 641 | Ga0495589_0134550 | 3300046794 | Bacteria | 1186 |
| 642 | Ga0495600_0021873 | 3300046809 | Bacteria | 4100 |
| 643 | Ga0495581_0042417 | 3300047315 | Bacteria | 2633 |
| 644 | Ga0495581_0060611 | 3300047315 | Bacteria | 2187 |
| 645 | Ga0495581_0153898 | 3300047315 | Bacteria | 1343 |
| 646 | Ga0495604_0117101 | 3300047317 | Unclassified | 1933 |
| 647 | Ga0495604_0119198 | 3300047317 | Bacteria | 1912 |
| 648 | Ga0495674_0032294 | 3300047319 | Bacteria | 4749 |
| 649 | Ga0495674_0037259 | 3300047319 | Bacteria | 4369 |
| 650 | Ga0495674_0046677 | 3300047319 | Unclassified | 3844 |
| 651 | Ga0495674_0080871 | 3300047319 | Bacteria | 2788 |
| 652 | Ga0495676_0010139 | 3300047321 | Bacteria | 8555 |
| 653 | Ga0495676_0049167 | 3300047321 | Bacteria | 3393 |
| 654 | Ga0495676_0052869 | 3300047321 | Bacteria | 3240 |
| 655 | Ga0495680_0012109 | 3300047322 | Bacteria | 7610 |
| 656 | Ga0495680_0039741 | 3300047322 | Unclassified | 3751 |
| 657 | Ga0495680_0801548 | 3300047322 | Unclassified | 615 |
| 658 | Ga0495683_0212119 | 3300047323 | Unclassified | 868 |
| 659 | Ga0495675_0514928 | 3300047444 | Unclassified | 686 |
| 660 | Ga0495684_0036616 | 3300047471 | Bacteria | 3761 |
| 661 | Ga0495684_0121283 | 3300047471 | Bacteria | 1969 |
| 662 | Ga0495593_0051036 | 3300047673 | Bacteria | 2190 |
| 663 | Ga0495593_0069421 | 3300047673 | Unclassified | 1832 |
| 664 | Ga0495593_0165757 | 3300047673 | Bacteria | 1115 |
| 665 | Ga0495602_0192817 | 3300048088 | Bacteria | 1561 |
| 666 | Ga0495614_0128836 | 3300048089 | Unclassified | 1119 |
| 667 | Ga0495614_0191648 | 3300048089 | Unclassified | 922 |
| 668 | Ga0495614_0633934 | 3300048089 | Bacteria | 515 |
| 669 | Ga0496100_0017306 | 3300048903 | Bacteria | 4252 |
| 670 | Ga0496100_0055212 | 3300048903 | Bacteria | 2594 |
| 671 | Ga0496100_0095940 | 3300048903 | Bacteria | 2034 |
| 672 | Ga0496100_0239388 | 3300048903 | Bacteria | 1338 |
| 673 | Ga0496100_0260629 | 3300048903 | Bacteria | 1285 |
| 674 | Ga0496100_0473269 | 3300048903 | Bacteria | 963 |
| 675 | Ga0496101_0008621 | 3300048904 | Bacteria | 6666 |
| 676 | Ga0496101_0127792 | 3300048904 | Bacteria | 1927 |
| 677 | Ga0496101_0272667 | 3300048904 | Bacteria | 1321 |
| 678 | Ga0496101_0622203 | 3300048904 | Unclassified | 853 |
| 679 | Ga0496102_0001884 | 3300048905 | Bacteria | 18078 |
| 680 | Ga0496102_0103362 | 3300048905 | Bacteria | 2649 |
| 681 | Ga0496102_0120622 | 3300048905 | Bacteria | 2449 |
| 682 | Ga0496102_0155393 | 3300048905 | Bacteria | 2150 |
| 683 | Ga0496102_1155484 | 3300048905 | Unclassified | 694 |
| 684 | Ga0496102_1879471 | 3300048905 | Unclassified | 515 |
| 685 | Ga0496103_0025215 | 3300048906 | Bacteria | 3592 |
| 686 | Ga0496103_0029796 | 3300048906 | Bacteria | 3318 |
| 687 | Ga0496104_0001262 | 3300048907 | Bacteria | 21783 |
| 688 | Ga0496104_0003395 | 3300048907 | Bacteria | 13749 |
| 689 | Ga0496104_0122057 | 3300048907 | Unclassified | 2501 |
| 690 | Ga0496104_0259494 | 3300048907 | Bacteria | 1651 |
| 691 | Ga0496105_0000320 | 3300048908 | Bacteria | 31520 |
| 692 | Ga0496105_0004927 | 3300048908 | Bacteria | 10093 |
| 693 | Ga0496105_0052339 | 3300048908 | Bacteria | 3372 |
| 694 | Ga0496105_0067833 | 3300048908 | Plasmid | 2945 |
| 695 | Ga0496105_0662838 | 3300048908 | Bacteria | 804 |
| 696 | Ga0496106_0005802 | 3300048909 | Bacteria | 9127 |
| 697 | Ga0496106_0091446 | 3300048909 | Bacteria | 2349 |
| 698 | Ga0496107_0096843 | 3300048910 | Unclassified | 2159 |
| 699 | Ga0496107_0288907 | 3300048910 | Unclassified | 1220 |
| 700 | Ga0496107_0876915 | 3300048910 | Bacteria | 655 |
| 701 | Ga0496108_0000724 | 3300048911 | Bacteria | 25671 |
| 702 | Ga0496108_0033404 | 3300048911 | Bacteria | 4274 |
| 703 | Ga0496108_0041605 | 3300048911 | Bacteria | 3836 |
| 704 | Ga0496108_0056254 | 3300048911 | Bacteria | 3304 |
| 705 | Ga0496108_0232554 | 3300048911 | Bacteria | 1603 |
| 706 | Ga0496108_0665171 | 3300048911 | Bacteria | 905 |
| 707 | Ga0496109_0000865 | 3300048912 | Bacteria | 25247 |
| 708 | Ga0496109_0006844 | 3300048912 | Bacteria | 9615 |
| 709 | Ga0496109_0057195 | 3300048912 | Bacteria | 3559 |
| 710 | Ga0496109_0181006 | 3300048912 | Bacteria | 1979 |
| 711 | Ga0496109_0668771 | 3300048912 | Unclassified | 976 |
| 712 | Ga0496110_0014219 | 3300048913 | Bacteria | 6604 |
| 713 | Ga0496110_0034457 | 3300048913 | Bacteria | 4385 |
| 714 | Ga0496110_0089973 | 3300048913 | Bacteria | 2744 |
| 715 | Ga0496110_0251451 | 3300048913 | Bacteria | 1608 |
| 716 | Ga0496111_0004794 | 3300048914 | Bacteria | 8577 |
| 717 | Ga0496111_0015932 | 3300048914 | Bacteria | 5170 |
| 718 | Ga0496111_0063214 | 3300048914 | Unclassified | 2684 |
| 719 | Ga0496112_0003413 | 3300048915 | Bacteria | 13123 |
| 720 | Ga0496112_0003786 | 3300048915 | Bacteria | 12636 |
| 721 | Ga0496112_0036546 | 3300048915 | Bacteria | 4791 |
| 722 | Ga0496112_0064550 | 3300048915 | Bacteria | 3613 |
| 723 | Ga0496113_0000157 | 3300048916 | Bacteria | 30003 |
| 724 | Ga0496113_0011446 | 3300048916 | Bacteria | 5919 |
| 725 | Ga0496113_0024047 | 3300048916 | Bacteria | 4325 |
| 726 | Ga0496113_0087015 | 3300048916 | Bacteria | 2402 |
| 727 | Ga0496114_0292976 | 3300048917 | Bacteria | 1436 |
| 728 | Ga0496114_1004945 | 3300048917 | Unclassified | 717 |
| 729 | Ga0496115_0005569 | 3300048918 | Bacteria | 9162 |
| 730 | Ga0496115_0067824 | 3300048918 | Bacteria | 2886 |
| 731 | Ga0496115_0090874 | 3300048918 | Unclassified | 2494 |
| 732 | Ga0496115_0138810 | 3300048918 | Bacteria | 2005 |
| 733 | nmdc:mga03n38_377889_c1 | 3300050490 | Bacteria | 776 |
| 734 | nmdc:mga00v17_217202_c1 | 3300050491 | Bacteria | 1237 |
| 735 | nmdc:mga00v17_54756_c1 | 3300050491 | Bacteria | 2434 |
| 736 | nmdc:mga0yw44_336373_c1 | 3300050492 | Bacteria | 1015 |
| 737 | nmdc:mga0yw44_358317_c1 | 3300050492 | Bacteria | 983 |
| 738 | nmdc:mga0yw44_4409_c1 | 3300050492 | Bacteria | 6448 |
| 739 | nmdc:mga0yw44_44507_c1 | 3300050492 | Bacteria | 2655 |
| 740 | nmdc:mga0yw44_761233_c1 | 3300050492 | Bacteria | 658 |
| 741 | nmdc:mga0yw44_8275_c1 | 3300050492 | Bacteria | 5169 |
| 742 | nmdc:mga0yw44_9898_c1 | 3300050492 | Bacteria | 4844 |
| 743 | nmdc:mga07m45_905688_c1 | 3300050496 | Unclassified | 504 |
| 744 | nmdc:mga05p37_159654_c1 | 3300050507 | Plasmid | 2754 |
| 745 | nmdc:mga05p37_1697979_c1 | 3300050507 | Unclassified | 616 |
| 746 | nmdc:mga05p37_190319_c1 | 3300050507 | Bacteria | 2492 |
| 747 | nmdc:mga05p37_26994_c1 | 3300050507 | Bacteria | 6987 |
| 748 | nmdc:mga05p37_448955_c1 | 3300050507 | Bacteria | 1493 |
| 749 | nmdc:mga09592_252617_c1 | 3300050508 | Bacteria | 1528 |
| 750 | nmdc:mga09592_884989_c1 | 3300050508 | Bacteria | 751 |
| 751 | nmdc:mga06r32_102963_c1 | 3300050510 | Bacteria | 2803 |
| 752 | nmdc:mga06r32_139192_c1 | 3300050510 | Unclassified | 2403 |
| 753 | nmdc:mga06r32_290632_c1 | 3300050510 | Bacteria | 1621 |
| 754 | nmdc:mga08y16_269020_c1 | 3300050511 | Bacteria | 1759 |
| 755 | nmdc:mga08y16_793539_c1 | 3300050511 | Bacteria | 940 |
| 756 | nmdc:mga0n895_1218528_c1 | 3300050512 | Unclassified | 726 |
| 757 | nmdc:mga0n895_127820_c1 | 3300050512 | Bacteria | 2565 |
| 758 | nmdc:mga0n895_147343_c1 | 3300050512 | Bacteria | 2384 |
| 759 | nmdc:mga0n895_1553479_c1 | 3300050512 | Bacteria | 627 |
| 760 | nmdc:mga0rr50_406303_c1 | 3300050513 | Bacteria | 1151 |
| 761 | nmdc:mga0rr50_931973_c1 | 3300050513 | Bacteria | 740 |
| 762 | nmdc:mga08x19_139961_c1 | 3300050514 | Unclassified | 1634 |
| 763 | nmdc:mga08x19_563424_c1 | 3300050514 | Bacteria | 806 |
| 764 | nmdc:mga08x19_890382_c1 | 3300050514 | Unclassified | 632 |
| 765 | nmdc:mga0a205_114482_c1 | 3300050515 | Bacteria | 2595 |
| 766 | nmdc:mga0a205_277894_c1 | 3300050515 | Bacteria | 1550 |
| 767 | nmdc:mga0a205_897050_c1 | 3300050515 | Bacteria | 733 |
| 768 | nmdc:mga0sz30_487732_c1 | 3300050516 | Unclassified | 554 |
| 769 | Ga0495601_0002214 | 3300053077 | Bacteria | 10944 |
| 770 | Ga0495601_0026816 | 3300053077 | Bacteria | 3559 |
| 771 | Ga0495601_0200374 | 3300053077 | Bacteria | 1304 |
| 772 | Ga0495601_0924935 | 3300053077 | Unclassified | 550 |
| 773 | Ga0495612_0004473 | 3300053078 | Bacteria | 5801 |
| 774 | Ga0495612_0161368 | 3300053078 | Bacteria | 979 |
| 775 | Ga0495612_0590938 | 3300053078 | Unclassified | 513 |
| 776 | Ga0495595_0005062 | 3300053084 | Bacteria | 5324 |
| 777 | Ga0495595_0006212 | 3300053084 | Bacteria | 4861 |
| 778 | Ga0495619_0005727 | 3300053085 | Bacteria | 7878 |
| 779 | Ga0495619_0015921 | 3300053085 | Bacteria | 4762 |
| 780 | Ga0495619_0017258 | 3300053085 | Bacteria | 4571 |
| 781 | Ga0500593_001564 | 3300053117 | Bacteria | 8237 |
| 782 | Ga0500614_168819 | 3300053123 | Unclassified | 666 |
| 783 | Ga0105242_10995329 | |||
| 784 | 2214817448 | |||
| 785 | ARcpr5oldR_c024750 | |||
| 786 | ARcpr5yngRDRAFT_c012710 | |||
| 787 | JGI24740J21852_10107259 | |||
| 788 | JGI24743J22301_10001539 | |||
| 789 | JGI25404J52841_10009138 | |||
| 790 | JGI25405J52794_10015261 | |||
| 791 | JGI25405J52794_10073986 | |||
| 792 | Ga0065717_1006076 | |||
| 793 | Ga0070658_10480903 | |||
| 794 | Ga0070683_100553412 | |||
| 795 | Ga0070683_100831334 | |||
| 796 | Ga0070690_100153880 | |||
| 797 | Ga0070690_100236831 | |||
| 798 | Ga0070670_100039820 | |||
| 799 | Ga0070670_100123660 | |||
| 800 | Ga0070670_100200782 | |||
| 801 | Ga0068869_100388027 | |||
| 802 | Ga0070682_100012793 | |||
| 803 | Ga0070682_100757437 | |||
| 804 | Ga0068868_100004763 | |||
| 805 | Ga0068868_100168960 | |||
| 806 | Ga0070660_100035139 | |||
| 807 | Ga0070660_100562557 | |||
| 808 | Ga0070689_100004926 | |||
| 809 | Ga0070689_100228178 | |||
| 810 | Ga0070689_100230558 | |||
| 811 | Ga0070691_10413216 | |||
| 812 | Ga0070691_10417859 | |||
| 813 | Ga0070687_100050547 | |||
| 814 | Ga0070687_100556972 | |||
| 815 | Ga0070687_100643851 | |||
| 816 | Ga0070687_101464255 | |||
| 817 | Ga0070661_100679429 | |||
| 818 | Ga0070661_100800369 | |||
| 819 | Ga0070668_100051305 | |||
| 820 | Ga0070668_100054312 | |||
| 821 | Ga0070668_100277331 | |||
| 822 | Ga0070671_100022886 | |||
| 823 | Ga0070674_100075774 | |||
| 824 | Ga0070674_100401904 | |||
| 825 | Ga0070674_100635367 | |||
| 826 | Ga0070673_100294291 | |||
| 827 | Ga0070688_100085753 | |||
| 828 | Ga0070659_100559597 | |||
| 829 | Ga0070659_100636547 | |||
| 830 | Ga0070659_101328138 | |||
| 831 | Ga0070667_100079544 | |||
| 832 | Ga0070667_100172967 | |||
| 833 | Ga0070709_10231250 | |||
| 834 | Ga0070709_10710629 | |||
| 835 | Ga0070714_100172158 | |||
| 836 | Ga0070713_100273175 | |||
| 837 | Ga0070713_100313755 | |||
| 838 | Ga0070713_101577413 | |||
| 839 | Ga0070710_10373076 | |||
| 840 | Ga0070701_10005855 | |||
| 841 | Ga0070701_10641654 | |||
| 842 | Ga0070711_100400100 | |||
| 843 | Ga0070711_100402795 | |||
| 844 | Ga0070711_100916460 | |||
| 845 | Ga0070700_100327876 | |||
| 846 | Ga0070700_100617636 | |||
| 847 | Ga0070694_100065469 | |||
| 848 | Ga0070694_100068350 | |||
| 849 | Ga0070708_100458922 | |||
| 850 | Ga0070663_100025385 | |||
| 851 | Ga0070663_100296703 | |||
| 852 | Ga0070678_100073097 | |||
| 853 | Ga0070678_100509957 | |||
| 854 | Ga0070662_100020789 | |||
| 855 | Ga0070662_101422191 | |||
| 856 | Ga0070681_10003489 | |||
| 857 | Ga0068867_101733150 | |||
| 858 | Ga0070685_10581623 | |||
| 859 | Ga0070706_100219097 | |||
| 860 | Ga0070706_100469611 | |||
| 861 | Ga0070706_100713907 | |||
| 862 | Ga0070706_101048006 | |||
| 863 | Ga0070707_100359470 | |||
| 864 | Ga0070707_100439301 | |||
| 865 | Ga0070707_100530225 | |||
| 866 | Ga0070707_100956643 | |||
| 867 | Ga0070698_100237277 | |||
| 868 | Ga0070698_100735291 | |||
| 869 | Ga0070698_100795628 | |||
| 870 | Ga0070699_100182343 | |||
| 871 | Ga0070699_100656129 | |||
| 872 | Ga0070699_100768337 | |||
| 873 | Ga0070699_100793717 | |||
| 874 | Ga0070679_100007580 | |||
| 875 | Ga0070684_100486397 | |||
| 876 | Ga0070697_100235832 | |||
| 877 | Ga0070697_100289602 | |||
| 878 | Ga0070697_100562892 | |||
| 879 | Ga0070697_101020677 | |||
| 880 | Ga0070697_101336763 | |||
| 881 | Ga0070697_101495322 | |||
| 882 | Ga0070697_101784064 | |||
| 883 | Ga0068853_100026879 | |||
| 884 | Ga0070672_100001330 | |||
| 885 | Ga0070672_100541790 | |||
| 886 | Ga0070686_100056117 | |||
| 887 | Ga0070686_100105067 | |||
| 888 | Ga0070686_100412596 | |||
| 889 | Ga0070695_100193200 | |||
| 890 | Ga0070695_101072265 | |||
| 891 | Ga0070696_100057041 | |||
| 892 | Ga0070696_100371338 | |||
| 893 | Ga0070696_100530881 | |||
| 894 | Ga0070693_100179691 | |||
| 895 | Ga0070693_101242477 | |||
| 896 | Ga0070665_100042174 | |||
| 897 | Ga0070665_100215818 | |||
| 898 | Ga0070704_100297778 | |||
| 899 | Ga0068855_100616508 | |||
| 900 | Ga0070664_100200809 | |||
| 901 | Ga0070664_100583625 | |||
| 902 | Ga0068857_100130556 | |||
| 903 | Ga0068854_100265351 | |||
| 904 | Ga0068856_101506058 | |||
| 905 | Ga0070702_100004417 | |||
| 906 | Ga0070702_100212463 | |||
| 907 | Ga0070702_100547822 | |||
| 908 | Ga0070702_101098954 | |||
| 909 | Ga0068852_100008788 | |||
| 910 | Ga0068852_101167429 | |||
| 911 | Ga0068859_100076930 | |||
| 912 | Ga0068864_100146892 | |||
| 913 | Ga0068864_100353953 | |||
| 914 | Ga0068866_10008330 | |||
| 915 | Ga0068866_10049261 | |||
| 916 | Ga0068866_11418713 | |||
| 917 | Ga0068861_100012963 | |||
| 918 | Ga0068870_10009661 | |||
| 919 | Ga0068863_100034411 | |||
| 920 | Ga0068863_100120575 | |||
| 921 | Ga0068858_100086985 | |||
| 922 | Ga0068858_100554664 | |||
| 923 | Ga0068860_100151101 | |||
| 924 | Ga0068860_101794141 | |||
| 925 | Ga0068862_100384022 | |||
| 926 | Ga0068862_101236631 | |||
| 927 | Ga0081455_10003946 | |||
| 928 | Ga0081455_10008930 | |||
| 929 | Ga0081455_10030119 | |||
| 930 | Ga0081455_10055314 | |||
| 931 | Ga0081455_10081547 | |||
| 932 | Ga0081455_10491206 | |||
| 933 | Ga0081455_10650787 | |||
| 934 | Ga0081538_10051086 | |||
| 935 | Ga0081540_1000081 | |||
| 936 | Ga0081540_1005331 | |||
| 937 | Ga0081540_1023133 | |||
| 938 | Ga0070717_10097025 | |||
| 939 | Ga0070717_10330636 | |||
| 940 | Ga0070717_10348028 | |||
| 941 | Ga0070717_10618310 | |||
| 942 | Ga0070717_10639912 | |||
| 943 | Ga0070717_11020399 | |||
| 944 | Ga0075365_10005560 | |||
| 945 | Ga0075365_10040381 | |||
| 946 | Ga0075365_10137635 | |||
| 947 | Ga0075365_10142223 | |||
| 948 | Ga0075365_10143752 | |||
| 949 | Ga0075365_10162658 | |||
| 950 | Ga0075365_10500092 | |||
| 951 | Ga0075363_100132288 | |||
| 952 | Ga0075364_10624798 | |||
| 953 | Ga0075432_10274635 | |||
| 954 | Ga0070715_10004618 | |||
| 955 | Ga0070715_10056490 | |||
| 956 | Ga0070715_10238861 | |||
| 957 | Ga0070715_10424128 | |||
| 958 | Ga0070716_100020156 | |||
| 959 | Ga0070716_100045533 | |||
| 960 | Ga0070716_100141109 | |||
| 961 | Ga0070716_100942793 | |||
| 962 | Ga0070712_100314995 | |||
| 963 | Ga0070712_101268814 | |||
| 964 | Ga0075369_10643499 | |||
| 965 | Ga0097621_100319730 | |||
| 966 | Ga0097621_100392207 | |||
| 967 | Ga0068871_100199055 | |||
| 968 | Ga0068871_100241821 | |||
| 969 | Ga0075428_100044859 | |||
| 970 | Ga0075428_100057884 | |||
| 971 | Ga0075428_100141905 | |||
| 972 | Ga0075428_100321922 | |||
| 973 | Ga0075428_100643347 | |||
| 974 | Ga0075428_100680493 | |||
| 975 | Ga0075428_100698707 | |||
| 976 | Ga0075430_100069563 | |||
| 977 | Ga0075431_100071503 | |||
| 978 | Ga0075431_100149930 | |||
| 979 | Ga0075433_10331475 | |||
| 980 | Ga0075433_10337406 | |||
| 981 | Ga0075434_100111077 | |||
| 982 | Ga0075434_100214118 | |||
| 983 | Ga0075434_100323557 | |||
| 984 | Ga0075434_100401552 | |||
| 985 | Ga0075434_101701569 | |||
| 986 | Ga0075429_100391043 | |||
| 987 | Ga0075429_101435382 | |||
| 988 | Ga0068865_100935657 | |||
| 989 | Ga0075436_100243561 | |||
| 990 | Ga0075436_100265979 | |||
| 991 | Ga0075436_100413504 | |||
| 992 | Ga0075436_100688718 | |||
| 993 | Ga0097620_100076936 | |||
| 994 | Ga0075435_100005977 | |||
| 995 | Ga0075435_100062514 | |||
| 996 | Ga0075435_100178798 | |||
| 997 | Ga0075435_100491102 | |||
| 998 | Ga0075435_100584830 | |||
| 999 | Ga0099794_10032010 | |||
| 1000 | Ga0105251_10424117 | |||
| 1001 | Ga0105250_10132538 | |||
| 1002 | Ga0111539_10114513 | |||
| 1003 | Ga0111539_10344533 | |||
| 1004 | Ga0111539_10387212 | |||
| 1005 | Ga0111539_10981579 | |||
| 1006 | Ga0111539_11101473 | |||
| 1007 | Ga0105245_10037180 | |||
| 1008 | Ga0105245_10092205 | |||
| 1009 | Ga0105245_11093570 | |||
| 1010 | Ga0105245_12861612 | |||
| 1011 | Ga0105247_10004123 | |||
| 1012 | Ga0105247_10095790 | |||
| 1013 | Ga0105247_10117226 | |||
| 1014 | Ga0105247_10554603 | |||
| 1015 | Ga0105247_11748455 | |||
| 1016 | Ga0114129_10224269 | |||
| 1017 | Ga0114129_10344044 | |||
| 1018 | Ga0114129_10468026 | |||
| 1019 | Ga0105243_10024687 | |||
| 1020 | Ga0105243_10091236 | |||
| 1021 | Ga0105242_10066660 | |||
| 1022 | Ga0105242_10522338 | |||
| 1023 | Ga0105248_10154592 | |||
| 1024 | Ga0105248_10644321 | |||
| 1025 | Ga0105237_10331319 | |||
| 1026 | Ga0105237_11056995 | |||
| 1027 | Ga0105238_10098673 | |||
| 1028 | Ga0105238_11473494 | |||
| 1029 | Ga0105249_10034925 | |||
| 1030 | Ga0105249_10070280 | |||
| 1031 | Ga0099796_10276922 | |||
| 1032 | Ga0105239_10079166 | |||
| 1033 | Ga0105239_10263013 | |||
| 1034 | Ga0105239_10346909 | |||
| 1035 | Ga0105239_12690833 | |||
| 1036 | Ga0105239_13401546 | |||
| 1037 | Ga0105246_10035470 | |||
| 1038 | Ga0105246_10047375 | |||
| 1039 | Ga0105246_10109292 | |||
| 1040 | Ga0105246_10862295 | |||
| 1041 | Ga0157344_1004741 | |||
| 1042 | Ga0157336_1011267 | |||
| 1043 | Ga0157328_1002162 | |||
| 1044 | Ga0157320_1001735 | |||
| 1045 | Ga0157339_1018644 | |||
| 1046 | Ga0157342_1000251 | |||
| 1047 | Ga0157315_1008187 | |||
| 1048 | Ga0157373_10281398 | |||
| 1049 | Ga0157374_10033949 | |||
| 1050 | Ga0157374_10342625 | |||
| 1051 | Ga0157378_10182190 | |||
| 1052 | Ga0157378_10601040 | |||
| 1053 | Ga0163162_10284756 | |||
| 1054 | Ga0163162_10654472 | |||
| 1055 | Ga0163162_10698048 | |||
| 1056 | Ga0163162_10914960 | |||
| 1057 | Ga0163162_10920680 | |||
| 1058 | Ga0157375_10266819 | |||
| 1059 | Ga0157375_10415343 | |||
| 1060 | Ga0157375_11661220 | |||
| 1061 | Ga0157375_13403898 | |||
| 1062 | Ga0163163_10012664 | |||
| 1063 | Ga0163163_10154621 | |||
| 1064 | Ga0163163_10197636 | |||
| 1065 | Ga0157380_10150668 | |||
| 1066 | Ga0157380_12022999 | |||
| 1067 | Ga0157377_10002072 | |||
| 1068 | Ga0157379_10222152 | |||
| 1069 | Ga0157379_10731267 | |||
| 1070 | Ga0157379_10743494 | |||
| 1071 | Ga0157376_10090497 | |||
| 1072 | Ga0157376_10301067 | |||
| 1073 | Ga0163161_10478255 | |||
| 1074 | Ga0163161_10752310 | |||
| 1075 | Ga0213873_10036599 | |||
| 1076 | Ga0213874_10116118 | |||
| 1077 | Ga0213876_10031780 | |||
| 1078 | Ga0213876_10338404 | |||
| 1079 | Ga0207697_10032971 | |||
| 1080 | Ga0207696_1117830 | |||
| 1081 | Ga0207692_10694846 | |||
| 1082 | Ga0207692_10709524 | |||
| 1083 | Ga0207692_10918568 | |||
| 1084 | Ga0207642_10290325 | |||
| 1085 | Ga0207642_10905734 | |||
| 1086 | Ga0207710_10003493 | |||
| 1087 | Ga0207710_10061808 | |||
| 1088 | Ga0207688_10003162 | |||
| 1089 | Ga0207688_10226461 | |||
| 1090 | Ga0207680_10323799 | |||
| 1091 | Ga0207685_10012558 | |||
| 1092 | Ga0207685_10018081 | |||
| 1093 | Ga0207685_10034787 | |||
| 1094 | Ga0207699_11059582 | |||
| 1095 | Ga0207645_10027456 | |||
| 1096 | Ga0207643_10023614 | |||
| 1097 | Ga0207684_10229354 | |||
| 1098 | Ga0207684_10774315 | |||
| 1099 | Ga0207684_11419998 | |||
| 1100 | Ga0207654_10070256 | |||
| 1101 | Ga0207707_10079085 | |||
| 1102 | Ga0207693_10237155 | |||
| 1103 | Ga0207693_10273832 | |||
| 1104 | Ga0207663_10050434 | |||
| 1105 | Ga0207662_10001805 | |||
| 1106 | Ga0207662_10327496 | |||
| 1107 | Ga0207657_10084361 | |||
| 1108 | Ga0207657_10132376 | |||
| 1109 | Ga0207649_10227820 | |||
| 1110 | Ga0207649_10977682 | |||
| 1111 | Ga0207652_10018578 | |||
| 1112 | Ga0207646_10691370 | |||
| 1113 | Ga0207646_11150162 | |||
| 1114 | Ga0207681_10374436 | |||
| 1115 | Ga0207650_10048297 | |||
| 1116 | Ga0207650_10222614 | |||
| 1117 | Ga0207659_10272352 | |||
| 1118 | Ga0207659_11799710 | |||
| 1119 | Ga0207687_10202991 | |||
| 1120 | Ga0207687_10756021 | |||
| 1121 | Ga0207700_10043298 | |||
| 1122 | Ga0207700_10394285 | |||
| 1123 | Ga0207700_10523181 | |||
| 1124 | Ga0207700_10905393 | |||
| 1125 | Ga0207664_10037085 | |||
| 1126 | Ga0207664_10164628 | |||
| 1127 | Ga0207664_10378141 | |||
| 1128 | Ga0207664_11726670 | |||
| 1129 | Ga0207644_10170959 | |||
| 1130 | Ga0207644_11743057 | |||
| 1131 | Ga0207690_10175888 | |||
| 1132 | Ga0207690_10848051 | |||
| 1133 | Ga0207706_10008946 | |||
| 1134 | Ga0207706_10020855 | |||
| 1135 | Ga0207686_10062296 | |||
| 1136 | Ga0207686_10151008 | |||
| 1137 | Ga0207686_10253963 | |||
| 1138 | Ga0207709_10010291 | |||
| 1139 | Ga0207709_10158940 | |||
| 1140 | Ga0207670_10137060 | |||
| 1141 | Ga0207670_10952538 | |||
| 1142 | Ga0207670_11642542 | |||
| 1143 | Ga0207669_10006625 | |||
| 1144 | Ga0207669_10025976 | |||
| 1145 | Ga0207704_10048207 | |||
| 1146 | Ga0207665_10011325 | |||
| 1147 | Ga0207665_10133273 | |||
| 1148 | Ga0207691_10003107 | |||
| 1149 | Ga0207691_10189968 | |||
| 1150 | Ga0207711_10007877 | |||
| 1151 | Ga0207689_10004621 | |||
| 1152 | Ga0207689_10059297 | |||
| 1153 | Ga0207661_10414447 | |||
| 1154 | Ga0207661_11385635 | |||
| 1155 | Ga0207679_10239235 | |||
| 1156 | Ga0207679_10264365 | |||
| 1157 | Ga0207651_10105487 | |||
| 1158 | Ga0207651_11283697 | |||
| 1159 | Ga0207712_10142590 | |||
| 1160 | Ga0207668_10474191 | |||
| 1161 | Ga0207640_10089119 | |||
| 1162 | Ga0207640_11220785 | |||
| 1163 | Ga0207658_10039475 | |||
| 1164 | Ga0207658_10057159 | |||
| 1165 | Ga0207677_10009466 | |||
| 1166 | Ga0207703_10835833 | |||
| 1167 | Ga0207703_11267735 | |||
| 1168 | Ga0207703_12099668 | |||
| 1169 | Ga0207639_10775620 | |||
| 1170 | Ga0207639_10781391 | |||
| 1171 | Ga0207678_10012522 | |||
| 1172 | Ga0207678_10016271 | |||
| 1173 | Ga0207708_10000903 | |||
| 1174 | Ga0207708_10805366 | |||
| 1175 | Ga0207702_10486634 | |||
| 1176 | Ga0207702_10660748 | |||
| 1177 | Ga0207702_12031197 | |||
| 1178 | Ga0207641_10314400 | |||
| 1179 | Ga0207641_10378261 | |||
| 1180 | Ga0207648_10007242 | |||
| 1181 | Ga0207648_10030022 | |||
| 1182 | Ga0207676_10028505 | |||
| 1183 | Ga0207676_10304487 | |||
| 1184 | Ga0207674_10433291 | |||
| 1185 | Ga0207675_100005933 | |||
| 1186 | Ga0207675_100454498 | |||
| 1187 | Ga0207683_10012534 | |||
| 1188 | Ga0207683_10087529 | |||
| 1189 | Ga0207698_10013610 | |||
| 1190 | Ga0209588_1056808 | |||
| 1191 | Ga0207428_10177736 | |||
| 1192 | Ga0268266_10344945 | |||
| 1193 | Ga0268266_12006058 | |||
| 1194 | Ga0268265_10034930 | |||
| 1195 | Ga0268265_10564007 | |||
| 1196 | Ga0268264_10034737 | |||
| 1197 | Ga0268264_10350919 | |||
| 1198 | Ga0265328_10068548 | |||
| 1199 | Ga0265340_10011490 | |||
| 1200 | Ga0265339_10046597 | |||
| 1201 | Ga0265316_10784265 | |||
| 1202 | Ga0307408_101513324 | |||
| 1203 | Ga0307409_101944000 | |||
| 1204 | Ga0373930_0016442 | |||
| 1205 | Ga0373948_0079309 | |||
| 1206 | Ga0373948_0131780 | |||
| 1207 | Ga0373950_0005845 | |||
| 1208 | Ga0373958_0072470 | |||
| 1209 | Ga0373959_0007110 | |||
| 1210 | Ga0373938_0000774 | |||
| 1211 | Ga0373926_0037707 | |||
| 1212 | Ga0373926_0058377 | |||
| 1213 | Ga0373928_0009457 | |||
| 1214 | Ga0373929_0015217 | |||
| 1215 | Ga0373940_0043240 | |||
| 1216 | Ga0373944_0039143 | |||
| 1217 | Ga0373949_0011150 | |||
| 1218 | Ga0373951_0008469 | |||
| 1219 | Ga0373952_0002665 | |||
| 1220 | Ga0373952_0110744 | |||
| 1221 | Ga0373923_0133786 | |||
| 1222 | Ga0373932_0044982 | |||
| 1223 | Ga0373936_0024357 | |||
| 1224 | Ga0373939_0029961 | |||
| 1225 | Ga0373939_0040233 | |||
| 1226 | Ga0373941_0025144 | |||
| 1227 | Ga0373945_0034012 | |||
| 1228 | Ga0373945_0039439 | |||
| 1229 | Ga0373953_0334172 | |||
| 1230 | Ga0373954_0026708 | |||
| 1231 | Ga0373957_0026288 | |||
| 1232 | Ga0373960_0028872 | |||
| 1233 | Ga0373943_0007085 | |||
| 1234 | Ga0373943_0014234 | |||
| 1235 | Ga0373943_0025570 | |||
| 1236 | Ga0373943_0056792 | |||
| 1237 | Ga0373943_0418506 | |||
| 1238 | Ga0373943_0733771 | |||
| 1239 | Ga0373946_0001998 | |||
| 1240 | Ga0373946_0020211 | |||
| 1241 | Ga0373946_0074603 | |||
| 1242 | Ga0373946_0114781 | |||
| 1243 | Ga0373955_0120795 | |||
| 1244 | Ga0373942_0020135 | |||
| 1245 | Ga0373961_0007527 | |||
| 1246 | Ga0373962_0001749 | |||
| 1247 | Ga0373924_0199106 | |||
| 1248 | Ga0373931_0031652 | |||
| 1249 | Ga0373931_0798215 | |||
| 1250 | Ga0373935_0039066 | |||
| 1251 | Ga0373935_0039930 | |||
| 1252 | Ga0373935_0127801 | |||
| 1253 | Ga0373927_0004359 | |||
| 1254 | Ga0373927_0066162 | |||
| 1255 | Ga0373927_0185508 | |||
| 1256 | Ga0373927_0288087 | |||
| 1257 | Ga0373933_0332262 | |||
| 1258 | Ga0373933_0370572 | |||
| 1259 | Ga0373933_0444198 | |||
| 1260 | Ga0373947_0001284 | |||
| 1261 | Ga0373947_0010881 | |||
| 1262 | Ga0373947_0031943 | |||
| 1263 | Ga0373947_0060773 | |||
| 1264 | Ga0373947_0169076 | |||
| 1265 | Ga0373937_0040093 | |||
| 1266 | Ga0373937_0301605 | |||
| 1267 | Ga0373925_0005253 | |||
| 1268 | Ga0373925_0007671 | |||
| 1269 | Ga0373925_0071711 | |||
| 1270 | Ga0395900_1283846 | |||
| 1271 | Ga0436364_0108650 | |||
| 1272 | Ga0436364_0212863 | |||
| 1273 | Ga0436364_0629386 | |||
| 1274 | Ga0436364_1057555 | |||
| 1275 | Ga0436364_1148727 | |||
| 1276 | Ga0436364_1168836 | |||
| 1277 | Ga0436364_1496074 | |||
| 1278 | Ga0436364_1544542 | |||
| 1279 | Ga0395901_0361500 | |||
| 1280 | Ga0395901_0694544 | |||
| 1281 | Ga0242420_004389 | |||
| 1282 | Ga0436365_0050135 | |||
| 1283 | Ga0436365_1463846 | |||
| 1284 | Ga0436360_0739662 | |||
| 1285 | Ga0436361_0480030 | |||
| 1286 | Ga0436361_0550427 | |||
| 1287 | Ga0436361_0605963 | |||
| 1288 | Ga0436363_0075951 | |||
| 1289 | Ga0436363_0135958 | |||
| 1290 | Ga0436363_0666566 | |||
| 1291 | Ga0436362_0102214 | |||
| 1292 | Ga0436362_0394223 | |||
| 1293 | Ga0451789_0108192 | |||
| 1294 | Ga0451795_0340630 | |||
| 1295 | Ga0451798_0682408 | |||
| 1296 | Ga0451833_0160897 | |||
| 1297 | Ga0451853_1842165 | |||
| 1298 | Ga0466967_0743405 | |||
| 1299 | Ga0495592_0010790 | |||
| 1300 | Ga0495592_0120955 | |||
| 1301 | Ga0495603_0000416 | |||
| 1302 | Ga0495603_0030167 | |||
| 1303 | Ga0495603_0535938 | |||
| 1304 | Ga0495629_0002468 | |||
| 1305 | Ga0495629_0021071 | |||
| 1306 | Ga0495629_0103580 | |||
| 1307 | Ga0495629_0213138 | |||
| 1308 | Ga0495638_0560425 | |||
| 1309 | Ga0495641_0014527 | |||
| 1310 | Ga0495641_0087079 | |||
| 1311 | Ga0495651_0021958 | |||
| 1312 | Ga0495653_0069117 | |||
| 1313 | Ga0495580_0028144 | |||
| 1314 | Ga0495580_0130499 | |||
| 1315 | Ga0495580_0233318 | |||
| 1316 | Ga0495582_0003410 | |||
| 1317 | Ga0495582_0005148 | |||
| 1318 | Ga0495582_0045970 | |||
| 1319 | Ga0495582_0081710 | |||
| 1320 | Ga0495605_0111650 | |||
| 1321 | Ga0495605_0216137 | |||
| 1322 | Ga0495605_0222747 | |||
| 1323 | Ga0495639_0002783 | |||
| 1324 | Ga0495639_0017252 | |||
| 1325 | Ga0495639_0038487 | |||
| 1326 | Ga0495639_0098920 | |||
| 1327 | Ga0495662_0010361 | |||
| 1328 | Ga0495662_0023790 | |||
| 1329 | Ga0495662_0176584 | |||
| 1330 | Ga0495664_0020825 | |||
| 1331 | Ga0495664_0027417 | |||
| 1332 | Ga0495664_0506829 | |||
| 1333 | Ga0495584_0035794 | |||
| 1334 | Ga0495584_0072730 | |||
| 1335 | Ga0495585_0003446 | |||
| 1336 | Ga0495585_0370598 | |||
| 1337 | Ga0495594_0012273 | |||
| 1338 | Ga0495594_0066444 | |||
| 1339 | Ga0495594_0371359 | |||
| 1340 | Ga0495594_0630048 | |||
| 1341 | Ga0495607_0027729 | |||
| 1342 | Ga0495608_0004974 | |||
| 1343 | Ga0495608_0106726 | |||
| 1344 | Ga0495618_0001026 | |||
| 1345 | Ga0495618_0071015 | |||
| 1346 | Ga0495618_0101727 | |||
| 1347 | Ga0495618_0170806 | |||
| 1348 | Ga0495618_0185269 | |||
| 1349 | Ga0495620_0231178 | |||
| 1350 | Ga0495620_0351571 | |||
| 1351 | Ga0495630_0029501 | |||
| 1352 | Ga0495630_0041199 | |||
| 1353 | Ga0495630_0067767 | |||
| 1354 | Ga0495630_0199060 | |||
| 1355 | Ga0495630_0506300 | |||
| 1356 | Ga0495631_0395082 | |||
| 1357 | Ga0495637_0030422 | |||
| 1358 | Ga0495644_0084703 | |||
| 1359 | Ga0495644_0152495 | |||
| 1360 | Ga0495663_0009368 | |||
| 1361 | Ga0495666_0081508 | |||
| 1362 | Ga0495642_0205138 | |||
| 1363 | Ga0495652_0003570 | |||
| 1364 | Ga0495652_0075832 | |||
| 1365 | Ga0495665_0059852 | |||
| 1366 | Ga0495665_0195837 | |||
| 1367 | Ga0495665_0314036 | |||
| 1368 | Ga0495665_0333093 | |||
| 1369 | Ga0495640_0001631 | |||
| 1370 | Ga0495640_0017672 | |||
| 1371 | Ga0495587_0096070 | |||
| 1372 | Ga0495587_0114149 | |||
| 1373 | Ga0495587_0117953 | |||
| 1374 | Ga0495587_0795041 | |||
| 1375 | Ga0495598_0016272 | |||
| 1376 | Ga0495609_0209774 | |||
| 1377 | Ga0495621_0020825 | |||
| 1378 | Ga0495622_0049319 | |||
| 1379 | Ga0495633_0024190 | |||
| 1380 | Ga0495667_0051000 | |||
| 1381 | Ga0495667_0111401 | |||
| 1382 | Ga0495667_0193396 | |||
| 1383 | Ga0495656_0004050 | |||
| 1384 | Ga0495656_0143011 | |||
| 1385 | Ga0495656_0718129 | |||
| 1386 | Ga0495668_0454585 | |||
| 1387 | Ga0495634_0009355 | |||
| 1388 | Ga0495634_0065700 | |||
| 1389 | Ga0495634_0074977 | |||
| 1390 | Ga0495634_0755317 | |||
| 1391 | Ga0495611_0258414 | |||
| 1392 | Ga0495635_0031396 | |||
| 1393 | Ga0495635_0111609 | |||
| 1394 | Ga0495635_0314511 | |||
| 1395 | Ga0495659_0087294 | |||
| 1396 | Ga0495661_0124373 | |||
| 1397 | Ga0495588_0055074 | |||
| 1398 | Ga0495588_0089457 | |||
| 1399 | Ga0495588_0245545 | |||
| 1400 | Ga0495599_0746671 | |||
| 1401 | Ga0495623_0669578 | |||
| 1402 | Ga0495646_0010226 | |||
| 1403 | Ga0495646_0120913 | |||
| 1404 | Ga0495647_0029831 | |||
| 1405 | Ga0495647_0031656 | |||
| 1406 | Ga0495647_0095482 | |||
| 1407 | Ga0495658_0016929 | |||
| 1408 | Ga0495658_0230011 | |||
| 1409 | Ga0495669_0108597 | |||
| 1410 | Ga0495669_0336361 | |||
| 1411 | Ga0495613_0010882 | |||
| 1412 | Ga0495613_0069839 | |||
| 1413 | Ga0495613_0117029 | |||
| 1414 | Ga0495613_0426108 | |||
| 1415 | Ga0495624_0012119 | |||
| 1416 | Ga0495624_0022379 | |||
| 1417 | Ga0495624_0093163 | |||
| 1418 | Ga0495624_0275781 | |||
| 1419 | Ga0495624_0462873 | |||
| 1420 | Ga0495670_0016334 | |||
| 1421 | Ga0495670_0437634 | |||
| 1422 | Ga0495649_0236726 | |||
| 1423 | Ga0495589_0134550 | |||
| 1424 | Ga0495600_0021873 | |||
| 1425 | Ga0495581_0042417 | |||
| 1426 | Ga0495581_0060611 | |||
| 1427 | Ga0495581_0153898 | |||
| 1428 | Ga0495604_0117101 | |||
| 1429 | Ga0495604_0119198 | |||
| 1430 | Ga0495674_0032294 | |||
| 1431 | Ga0495674_0037259 | |||
| 1432 | Ga0495674_0046677 | |||
| 1433 | Ga0495674_0080871 | |||
| 1434 | Ga0495676_0010139 | |||
| 1435 | Ga0495676_0049167 | |||
| 1436 | Ga0495676_0052869 | |||
| 1437 | Ga0495680_0012109 | |||
| 1438 | Ga0495680_0039741 | |||
| 1439 | Ga0495680_0801548 | |||
| 1440 | Ga0495683_0212119 | |||
| 1441 | Ga0495675_0514928 | |||
| 1442 | Ga0495684_0036616 | |||
| 1443 | Ga0495684_0121283 | |||
| 1444 | Ga0495593_0051036 | |||
| 1445 | Ga0495593_0069421 | |||
| 1446 | Ga0495593_0165757 | |||
| 1447 | Ga0495602_0192817 | |||
| 1448 | Ga0495614_0128836 | |||
| 1449 | Ga0495614_0191648 | |||
| 1450 | Ga0495614_0633934 | |||
| 1451 | Ga0496100_0017306 | |||
| 1452 | Ga0496100_0055212 | |||
| 1453 | Ga0496100_0095940 | |||
| 1454 | Ga0496100_0239388 | |||
| 1455 | Ga0496100_0260629 | |||
| 1456 | Ga0496100_0473269 | |||
| 1457 | Ga0496101_0008621 | |||
| 1458 | Ga0496101_0127792 | |||
| 1459 | Ga0496101_0272667 | |||
| 1460 | Ga0496101_0622203 | |||
| 1461 | Ga0496102_0001884 | |||
| 1462 | Ga0496102_0103362 | |||
| 1463 | Ga0496102_0120622 | |||
| 1464 | Ga0496102_0155393 | |||
| 1465 | Ga0496102_1155484 | |||
| 1466 | Ga0496102_1879471 | |||
| 1467 | Ga0496103_0025215 | |||
| 1468 | Ga0496103_0029796 | |||
| 1469 | Ga0496104_0001262 | |||
| 1470 | Ga0496104_0003395 | |||
| 1471 | Ga0496104_0122057 | |||
| 1472 | Ga0496104_0259494 | |||
| 1473 | Ga0496105_0000320 | |||
| 1474 | Ga0496105_0004927 | |||
| 1475 | Ga0496105_0052339 | |||
| 1476 | Ga0496105_0067833 | |||
| 1477 | Ga0496105_0662838 | |||
| 1478 | Ga0496106_0005802 | |||
| 1479 | Ga0496106_0091446 | |||
| 1480 | Ga0496107_0096843 | |||
| 1481 | Ga0496107_0288907 | |||
| 1482 | Ga0496107_0876915 | |||
| 1483 | Ga0496108_0000724 | |||
| 1484 | Ga0496108_0033404 | |||
| 1485 | Ga0496108_0041605 | |||
| 1486 | Ga0496108_0056254 | |||
| 1487 | Ga0496108_0232554 | |||
| 1488 | Ga0496108_0665171 | |||
| 1489 | Ga0496109_0000865 | |||
| 1490 | Ga0496109_0006844 | |||
| 1491 | Ga0496109_0057195 | |||
| 1492 | Ga0496109_0181006 | |||
| 1493 | Ga0496109_0668771 | |||
| 1494 | Ga0496110_0014219 | |||
| 1495 | Ga0496110_0034457 | |||
| 1496 | Ga0496110_0089973 | |||
| 1497 | Ga0496110_0251451 | |||
| 1498 | Ga0496111_0004794 | |||
| 1499 | Ga0496111_0015932 | |||
| 1500 | Ga0496111_0063214 | |||
| 1501 | Ga0496112_0003413 | |||
| 1502 | Ga0496112_0003786 | |||
| 1503 | Ga0496112_0036546 | |||
| 1504 | Ga0496112_0064550 | |||
| 1505 | Ga0496113_0000157 | |||
| 1506 | Ga0496113_0011446 | |||
| 1507 | Ga0496113_0024047 | |||
| 1508 | Ga0496113_0087015 | |||
| 1509 | Ga0496114_0292976 | |||
| 1510 | Ga0496114_1004945 | |||
| 1511 | Ga0496115_0005569 | |||
| 1512 | Ga0496115_0067824 | |||
| 1513 | Ga0496115_0090874 | |||
| 1514 | Ga0496115_0138810 | |||
| 1515 | nmdc:mga03n38_377889_c1 | |||
| 1516 | nmdc:mga00v17_217202_c1 | |||
| 1517 | nmdc:mga00v17_54756_c1 | |||
| 1518 | nmdc:mga0yw44_336373_c1 | |||
| 1519 | nmdc:mga0yw44_358317_c1 | |||
| 1520 | nmdc:mga0yw44_4409_c1 | |||
| 1521 | nmdc:mga0yw44_44507_c1 | |||
| 1522 | nmdc:mga0yw44_761233_c1 | |||
| 1523 | nmdc:mga0yw44_8275_c1 | |||
| 1524 | nmdc:mga0yw44_9898_c1 | |||
| 1525 | nmdc:mga07m45_905688_c1 | |||
| 1526 | nmdc:mga05p37_159654_c1 | |||
| 1527 | nmdc:mga05p37_1697979_c1 | |||
| 1528 | nmdc:mga05p37_190319_c1 | |||
| 1529 | nmdc:mga05p37_26994_c1 | |||
| 1530 | nmdc:mga05p37_448955_c1 | |||
| 1531 | nmdc:mga09592_252617_c1 | |||
| 1532 | nmdc:mga09592_884989_c1 | |||
| 1533 | nmdc:mga06r32_102963_c1 | |||
| 1534 | nmdc:mga06r32_139192_c1 | |||
| 1535 | nmdc:mga06r32_290632_c1 | |||
| 1536 | nmdc:mga08y16_269020_c1 | |||
| 1537 | nmdc:mga08y16_793539_c1 | |||
| 1538 | nmdc:mga0n895_1218528_c1 | |||
| 1539 | nmdc:mga0n895_127820_c1 | |||
| 1540 | nmdc:mga0n895_147343_c1 | |||
| 1541 | nmdc:mga0n895_1553479_c1 | |||
| 1542 | nmdc:mga0rr50_406303_c1 | |||
| 1543 | nmdc:mga0rr50_931973_c1 | |||
| 1544 | nmdc:mga08x19_139961_c1 | |||
| 1545 | nmdc:mga08x19_563424_c1 | |||
| 1546 | nmdc:mga08x19_890382_c1 | |||
| 1547 | nmdc:mga0a205_114482_c1 | |||
| 1548 | nmdc:mga0a205_277894_c1 | |||
| 1549 | nmdc:mga0a205_897050_c1 | |||
| 1550 | nmdc:mga0sz30_487732_c1 | |||
| 1551 | Ga0495601_0002214 | |||
| 1552 | Ga0495601_0026816 | |||
| 1553 | Ga0495601_0200374 | |||
| 1554 | Ga0495601_0924935 | |||
| 1555 | Ga0495612_0004473 | |||
| 1556 | Ga0495612_0161368 | |||
| 1557 | Ga0495612_0590938 | |||
| 1558 | Ga0495595_0005062 | |||
| 1559 | Ga0495595_0006212 | |||
| 1560 | Ga0495619_0005727 | |||
| 1561 | Ga0495619_0015921 | |||
| 1562 | Ga0495619_0017258 | |||
| 1563 | Ga0500593_001564 | |||
| 1564 | Ga0500614_168819 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gir-assembly1.cif.gz_D-2 | crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, ethylene glycol and sulfate bound (ordered loops, space group p41212) | 0.6526 | 39 | 98 |
| 4gir-assembly1.cif.gz_B | crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, ethylene glycol and sulfate bound (ordered loops, space group p41212) | 0.648 | 39 | 98 |
| 7wvr-assembly1.cif.gz_A | crystal structure of talaromyces leycettanus jcm12802 expansin | 0.6461 | 41 | 101 |
| 7eby-assembly6.cif.gz_F | crystal structure of d-succinylase (dsa) from cupriavidus sp. p4-10-c | 0.645 | 79 | 98 |
| 7ea4-assembly1.cif.gz_A | crystal structure of l182e d-succinylase (dsa) from cupriavidus sp. p4-10-c | 0.6437 | 79 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_H2KZ40_3_184_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7435 | 82 | 99 | 2.130.10.10 |
| af_F1QF68_152_307_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.708 | 84 | 119 | 2.130.10.10 |
| af_Q9LDJ3_156_251_2.60.40.760 | Mainly Beta;Sandwich;Immunoglobulin-like;Expansin, cellulose-binding-like domain | 0.6829 | 41 | 98 | 2.60.40.760 |
| af_A1ZAE2_137_527_2.130.10.30 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II | 0.6688 | 39 | 98 | 2.130.10.30 |
| af_O60136_179_495_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.6644 | 41 | 98 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A525IZQ4-F1-model_v4 | Uncharacterized protein | 0.956 | 23 | 120 |
|
| AF-A0A537STM4-F1-model_v4 | ABC transporter permease | 0.9461 | 21 | 120 |
|
| AF-A0A537STM4-F1-model_v4 | ABC transporter permease | 0.9193 | 21 | 120 |
|
| AF-A0A1M6SZR1-F1-model_v4 | Uncharacterized protein | 0.9123 | 10 | 120 |
|
| AF-A0A525IZQ4-F1-model_v4 | Uncharacterized protein | 0.9024 | 23 | 120 |
|