F480610

General Info

Members Datasets Scaffolds Average Seq Length
782 360 1564 117

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10995329|Ga0105242_109953292
Length 135
Sequence MIRRLGRTGTFNGRFREVSPMRSLWLAVALLALAXSXATAQDRRGMRFWNLTLYTITSLQMSPAGQDTWGPDQCQNDRDGTVDHDERLRITGVEPGRYDVKLADRIGRICIVRDVEVKAAAVFTIEEKQLTDCRK

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
115 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
116 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
117 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
118 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
119 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
120 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
133 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
206 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
207 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
208 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
209 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
210 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
211 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
212 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
213 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
214 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
215 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
216 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
217 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
218 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
221 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
223 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
224 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
225 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
226 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
227 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
228 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
233 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
234 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
252 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
253 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
254 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
255 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
256 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
263 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
264 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
265 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
268 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
269 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
272 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
278 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
279 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
280 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
281 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
282 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
283 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
284 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
290 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
291 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
292 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
293 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
298 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
301 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
304 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
305 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
306 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
307 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
308 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
312 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
313 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
314 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
318 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
319 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
320 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
321 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
343 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
344 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
351 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
352 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
353 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
356 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
357 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
358 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
359 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
360 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.07
Nodule 0
Rhizoplane 8.57
Rhizosphere 86.06
Stem 0
Stem Tuber 0
Unclassified 27.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10995329 3300009176 Unclassified 846
2 2214817448 2209111006 Unclassified 672
3 ARcpr5oldR_c024750 3300000041 Unclassified 548
4 ARcpr5yngRDRAFT_c012710 3300000043 Unclassified 709
5 JGI24740J21852_10107259 3300001979 Unclassified 707
6 JGI24743J22301_10001539 3300001991 Bacteria 3226
7 JGI25404J52841_10009138 3300003659 Bacteria 2118
8 JGI25405J52794_10015261 3300003911 Bacteria 1508
9 JGI25405J52794_10073986 3300003911 Unclassified 745
10 Ga0065717_1006076 3300005276 Unclassified 827
11 Ga0070658_10480903 3300005327 Unclassified 1072
12 Ga0070683_100553412 3300005329 Bacteria 1100
13 Ga0070683_100831334 3300005329 Unclassified 886
14 Ga0070690_100153880 3300005330 Unclassified 1571
15 Ga0070690_100236831 3300005330 Bacteria 1286
16 Ga0070670_100039820 3300005331 Bacteria 4041
17 Ga0070670_100123660 3300005331 Unclassified 2232
18 Ga0070670_100200782 3300005331 Bacteria 1732
19 Ga0068869_100388027 3300005334 Bacteria 1146
20 Ga0070682_100012793 3300005337 Bacteria 4818
21 Ga0070682_100757437 3300005337 Unclassified 785
22 Ga0068868_100004763 3300005338 Bacteria 9528
23 Ga0068868_100168960 3300005338 Unclassified 1810
24 Ga0070660_100035139 3300005339 Bacteria 3793
25 Ga0070660_100562557 3300005339 Bacteria 952
26 Ga0070689_100004926 3300005340 Bacteria 9061
27 Ga0070689_100228178 3300005340 Unclassified 1530
28 Ga0070689_100230558 3300005340 Unclassified 1522
29 Ga0070691_10413216 3300005341 Unclassified 763
30 Ga0070691_10417859 3300005341 Unclassified 759
31 Ga0070687_100050547 3300005343 Bacteria 2147
32 Ga0070687_100556972 3300005343 Unclassified 781
33 Ga0070687_100643851 3300005343 Unclassified 734
34 Ga0070687_101464255 3300005343 Bacteria 512
35 Ga0070661_100679429 3300005344 Unclassified 838
36 Ga0070661_100800369 3300005344 Unclassified 773
37 Ga0070668_100051305 3300005347 Bacteria 3178
38 Ga0070668_100054312 3300005347 Bacteria 3090
39 Ga0070668_100277331 3300005347 Bacteria 1399
40 Ga0070671_100022886 3300005355 Bacteria 5107
41 Ga0070674_100075774 3300005356 Bacteria 2390
42 Ga0070674_100401904 3300005356 Unclassified 1119
43 Ga0070674_100635367 3300005356 Bacteria 906
44 Ga0070673_100294291 3300005364 Bacteria 1427
45 Ga0070688_100085753 3300005365 Bacteria 2047
46 Ga0070659_100559597 3300005366 Bacteria 979
47 Ga0070659_100636547 3300005366 Unclassified 919
48 Ga0070659_101328138 3300005366 Bacteria 638
49 Ga0070667_100079544 3300005367 Bacteria 2803
50 Ga0070667_100172967 3300005367 Bacteria 1907
51 Ga0070709_10231250 3300005434 Bacteria 1323
52 Ga0070709_10710629 3300005434 Unclassified 783
53 Ga0070714_100172158 3300005435 Bacteria 1965
54 Ga0070713_100273175 3300005436 Bacteria 1548
55 Ga0070713_100313755 3300005436 Unclassified 1447
56 Ga0070713_101577413 3300005436 Unclassified 637
57 Ga0070710_10373076 3300005437 Bacteria 950
58 Ga0070701_10005855 3300005438 Bacteria 5125
59 Ga0070701_10641654 3300005438 Bacteria 708
60 Ga0070711_100400100 3300005439 Unclassified 1114
61 Ga0070711_100402795 3300005439 Bacteria 1111
62 Ga0070711_100916460 3300005439 Unclassified 748
63 Ga0070700_100327876 3300005441 Bacteria 1127
64 Ga0070700_100617636 3300005441 Unclassified 851
65 Ga0070694_100065469 3300005444 Unclassified 2490
66 Ga0070694_100068350 3300005444 Bacteria 2441
67 Ga0070708_100458922 3300005445 Bacteria 1202
68 Ga0070663_100025385 3300005455 Bacteria 4000
69 Ga0070663_100296703 3300005455 Bacteria 1292
70 Ga0070678_100073097 3300005456 Plasmid 2572
71 Ga0070678_100509957 3300005456 Unclassified 1062
72 Ga0070662_100020789 3300005457 Bacteria 4475
73 Ga0070662_101422191 3300005457 Unclassified 598
74 Ga0070681_10003489 3300005458 Bacteria 14719
75 Ga0068867_101733150 3300005459 Unclassified 586
76 Ga0070685_10581623 3300005466 Bacteria 803
77 Ga0070706_100219097 3300005467 Bacteria 1776
78 Ga0070706_100469611 3300005467 Bacteria 1170
79 Ga0070706_100713907 3300005467 Bacteria 929
80 Ga0070706_101048006 3300005467 Bacteria 751
81 Ga0070707_100359470 3300005468 Bacteria 1414
82 Ga0070707_100439301 3300005468 Bacteria 1265
83 Ga0070707_100530225 3300005468 Bacteria 1139
84 Ga0070707_100956643 3300005468 Bacteria 821
85 Ga0070698_100237277 3300005471 Bacteria 1756
86 Ga0070698_100735291 3300005471 Bacteria 929
87 Ga0070698_100795628 3300005471 Bacteria 889
88 Ga0070699_100182343 3300005518 Bacteria 1863
89 Ga0070699_100656129 3300005518 Bacteria 958
90 Ga0070699_100768337 3300005518 Bacteria 881
91 Ga0070699_100793717 3300005518 Bacteria 866
92 Ga0070679_100007580 3300005530 Bacteria 10152
93 Ga0070684_100486397 3300005535 Bacteria 1143
94 Ga0070697_100235832 3300005536 Bacteria 1561
95 Ga0070697_100289602 3300005536 Bacteria 1406
96 Ga0070697_100562892 3300005536 Bacteria 1000
97 Ga0070697_101020677 3300005536 Bacteria 735
98 Ga0070697_101336763 3300005536 Bacteria 639
99 Ga0070697_101495322 3300005536 Bacteria 603
100 Ga0070697_101784064 3300005536 Unclassified 550
101 Ga0068853_100026879 3300005539 Bacteria 4834
102 Ga0070672_100001330 3300005543 Bacteria 15234
103 Ga0070672_100541790 3300005543 Unclassified 1010
104 Ga0070686_100056117 3300005544 Plasmid 2525
105 Ga0070686_100105067 3300005544 Bacteria 1914
106 Ga0070686_100412596 3300005544 Unclassified 1030
107 Ga0070695_100193200 3300005545 Unclassified 1450
108 Ga0070695_101072265 3300005545 Bacteria 658
109 Ga0070696_100057041 3300005546 Bacteria 2725
110 Ga0070696_100371338 3300005546 Bacteria 1112
111 Ga0070696_100530881 3300005546 Unclassified 940
112 Ga0070693_100179691 3300005547 Bacteria 1361
113 Ga0070693_101242477 3300005547 Unclassified 574
114 Ga0070665_100042174 3300005548 Bacteria 4586
115 Ga0070665_100215818 3300005548 Bacteria 1919
116 Ga0070704_100297778 3300005549 Unclassified 1343
117 Ga0068855_100616508 3300005563 Unclassified 1169
118 Ga0070664_100200809 3300005564 Bacteria 1779
119 Ga0070664_100583625 3300005564 Unclassified 1036
120 Ga0068857_100130556 3300005577 Bacteria 2266
121 Ga0068854_100265351 3300005578 Bacteria 1376
122 Ga0068856_101506058 3300005614 Unclassified 687
123 Ga0070702_100004417 3300005615 Bacteria 6419
124 Ga0070702_100212463 3300005615 Unclassified 1288
125 Ga0070702_100547822 3300005615 Bacteria 858
126 Ga0070702_101098954 3300005615 Unclassified 635
127 Ga0068852_100008788 3300005616 Bacteria 7474
128 Ga0068852_101167429 3300005616 Bacteria 791
129 Ga0068859_100076930 3300005617 Bacteria 3377
130 Ga0068864_100146892 3300005618 Bacteria 2132
131 Ga0068864_100353953 3300005618 Bacteria 1386
132 Ga0068866_10008330 3300005718 Bacteria 4362
133 Ga0068866_10049261 3300005718 Unclassified 2134
134 Ga0068866_11418713 3300005718 Unclassified 508
135 Ga0068861_100012963 3300005719 Bacteria 5822
136 Ga0068870_10009661 3300005840 Bacteria 4396
137 Ga0068863_100034411 3300005841 Bacteria 4826
138 Ga0068863_100120575 3300005841 Unclassified 2500
139 Ga0068858_100086985 3300005842 Bacteria 2907
140 Ga0068858_100554664 3300005842 Unclassified 1112
141 Ga0068860_100151101 3300005843 Unclassified 2236
142 Ga0068860_101794141 3300005843 Unclassified 635
143 Ga0068862_100384022 3300005844 Unclassified 1310
144 Ga0068862_101236631 3300005844 Unclassified 746
145 Ga0081455_10003946 3300005937 Bacteria 16854
146 Ga0081455_10008930 3300005937 Bacteria 10359
147 Ga0081455_10030119 3300005937 Bacteria 4937
148 Ga0081455_10055314 3300005937 Bacteria 3376
149 Ga0081455_10081547 3300005937 Bacteria 2649
150 Ga0081455_10491206 3300005937 Bacteria 827
151 Ga0081455_10650787 3300005937 Bacteria 679
152 Ga0081538_10051086 3300005981 Bacteria 2487
153 Ga0081540_1000081 3300005983 Bacteria 102423
154 Ga0081540_1005331 3300005983 Bacteria 9623
155 Ga0081540_1023133 3300005983 Bacteria 3646
156 Ga0070717_10097025 3300006028 Bacteria 2497
157 Ga0070717_10330636 3300006028 Bacteria 1359
158 Ga0070717_10348028 3300006028 Bacteria 1324
159 Ga0070717_10618310 3300006028 Bacteria 983
160 Ga0070717_10639912 3300006028 Bacteria 965
161 Ga0070717_11020399 3300006028 Bacteria 753
162 Ga0075365_10005560 3300006038 Bacteria 6812
163 Ga0075365_10040381 3300006038 Bacteria 3043
164 Ga0075365_10137635 3300006038 Bacteria 1693
165 Ga0075365_10142223 3300006038 Bacteria 1666
166 Ga0075365_10143752 3300006038 Bacteria 1657
167 Ga0075365_10162658 3300006038 Bacteria 1556
168 Ga0075365_10500092 3300006038 Bacteria 859
169 Ga0075363_100132288 3300006048 Bacteria 1400
170 Ga0075364_10624798 3300006051 Bacteria 736
171 Ga0075432_10274635 3300006058 Bacteria 691
172 Ga0070715_10004618 3300006163 Bacteria 4539
173 Ga0070715_10056490 3300006163 Bacteria 1708
174 Ga0070715_10238861 3300006163 Unclassified 944
175 Ga0070715_10424128 3300006163 Bacteria 745
176 Ga0070716_100020156 3300006173 Bacteria 3497
177 Ga0070716_100045533 3300006173 Bacteria 2463
178 Ga0070716_100141109 3300006173 Bacteria 1536
179 Ga0070716_100942793 3300006173 Bacteria 679
180 Ga0070712_100314995 3300006175 Bacteria 1271
181 Ga0070712_101268814 3300006175 Unclassified 642
182 Ga0075369_10643499 3300006186 Unclassified 509
183 Ga0097621_100319730 3300006237 Unclassified 1374
184 Ga0097621_100392207 3300006237 Bacteria 1242
185 Ga0068871_100199055 3300006358 Bacteria 1729
186 Ga0068871_100241821 3300006358 Bacteria 1569
187 Ga0075428_100044859 3300006844 Bacteria 4858
188 Ga0075428_100057884 3300006844 Bacteria 4243
189 Ga0075428_100141905 3300006844 Bacteria 2611
190 Ga0075428_100321922 3300006844 Bacteria 1661
191 Ga0075428_100643347 3300006844 Bacteria 1131
192 Ga0075428_100680493 3300006844 Bacteria 1096
193 Ga0075428_100698707 3300006844 Unclassified 1080
194 Ga0075430_100069563 3300006846 Bacteria 2953
195 Ga0075431_100071503 3300006847 Bacteria 3579
196 Ga0075431_100149930 3300006847 Unclassified 2402
197 Ga0075433_10331475 3300006852 Bacteria 1346
198 Ga0075433_10337406 3300006852 Bacteria 1332
199 Ga0075434_100111077 3300006871 Bacteria 2752
200 Ga0075434_100214118 3300006871 Bacteria 1946
201 Ga0075434_100323557 3300006871 Bacteria 1562
202 Ga0075434_100401552 3300006871 Bacteria 1392
203 Ga0075434_101701569 3300006871 Unclassified 638
204 Ga0075429_100391043 3300006880 Unclassified 1218
205 Ga0075429_101435382 3300006880 Unclassified 601
206 Ga0068865_100935657 3300006881 Unclassified 755
207 Ga0075436_100243561 3300006914 Bacteria 1279
208 Ga0075436_100265979 3300006914 Unclassified 1223
209 Ga0075436_100413504 3300006914 Bacteria 979
210 Ga0075436_100688718 3300006914 Unclassified 757
211 Ga0097620_100076936 3300006931 Bacteria 3377
212 Ga0075435_100005977 3300007076 Bacteria 8565
213 Ga0075435_100062514 3300007076 Bacteria 3022
214 Ga0075435_100178798 3300007076 Bacteria 1793
215 Ga0075435_100491102 3300007076 Bacteria 1061
216 Ga0075435_100584830 3300007076 Bacteria 968
217 Ga0099794_10032010 3300007265 Bacteria 2466
218 Ga0105251_10424117 3300009011 Bacteria 614
219 Ga0105250_10132538 3300009092 Unclassified 1029
220 Ga0111539_10114513 3300009094 Bacteria 3163
221 Ga0111539_10344533 3300009094 Bacteria 1734
222 Ga0111539_10387212 3300009094 Bacteria 1628
223 Ga0111539_10981579 3300009094 Unclassified 982
224 Ga0111539_11101473 3300009094 Bacteria 923
225 Ga0105245_10037180 3300009098 Bacteria 4328
226 Ga0105245_10092205 3300009098 Bacteria 2789
227 Ga0105245_11093570 3300009098 Unclassified 843
228 Ga0105245_12861612 3300009098 Unclassified 535
229 Ga0105247_10004123 3300009101 Bacteria 9326
230 Ga0105247_10095790 3300009101 Bacteria 1890
231 Ga0105247_10117226 3300009101 Unclassified 1721
232 Ga0105247_10554603 3300009101 Bacteria 845
233 Ga0105247_11748455 3300009101 Unclassified 516
234 Ga0114129_10224269 3300009147 Plasmid 2534
235 Ga0114129_10344044 3300009147 Bacteria 1977
236 Ga0114129_10468026 3300009147 Bacteria 1651
237 Ga0105243_10024687 3300009148 Bacteria 4587
238 Ga0105243_10091236 3300009148 Bacteria 2509
239 Ga0105242_10066660 3300009176 Bacteria 2974
240 Ga0105242_10522338 3300009176 Bacteria 1133
241 Ga0105248_10154592 3300009177 Bacteria 2589
242 Ga0105248_10644321 3300009177 Bacteria 1195
243 Ga0105237_10331319 3300009545 Unclassified 1526
244 Ga0105237_11056995 3300009545 Bacteria 819
245 Ga0105238_10098673 3300009551 Bacteria 2905
246 Ga0105238_11473494 3300009551 Bacteria 709
247 Ga0105249_10034925 3300009553 Bacteria 4558
248 Ga0105249_10070280 3300009553 Bacteria 3231
249 Ga0099796_10276922 3300010159 Unclassified 704
250 Ga0105239_10079166 3300010375 Bacteria 3616
251 Ga0105239_10263013 3300010375 Unclassified 1939
252 Ga0105239_10346909 3300010375 Bacteria 1676
253 Ga0105239_12690833 3300010375 Bacteria 580
254 Ga0105239_13401546 3300010375 Bacteria 517
255 Ga0105246_10035470 3300011119 Bacteria 3334
256 Ga0105246_10047375 3300011119 Bacteria 2935
257 Ga0105246_10109292 3300011119 Bacteria 2028
258 Ga0105246_10862295 3300011119 Bacteria 809
259 Ga0157344_1004741 3300012476 Unclassified 820
260 Ga0157336_1011267 3300012477 Unclassified 693
261 Ga0157328_1002162 3300012478 Unclassified 919
262 Ga0157320_1001735 3300012481 Unclassified 1147
263 Ga0157339_1018644 3300012505 Unclassified 716
264 Ga0157342_1000251 3300012507 Bacteria 2973
265 Ga0157315_1008187 3300012508 Unclassified 868
266 Ga0157373_10281398 3300013100 Bacteria 1179
267 Ga0157374_10033949 3300013296 Bacteria 4657
268 Ga0157374_10342625 3300013296 Bacteria 1484
269 Ga0157378_10182190 3300013297 Bacteria 1976
270 Ga0157378_10601040 3300013297 Bacteria 1111
271 Ga0163162_10284756 3300013306 Unclassified 1784
272 Ga0163162_10654472 3300013306 Bacteria 1174
273 Ga0163162_10698048 3300013306 Bacteria 1136
274 Ga0163162_10914960 3300013306 Bacteria 990
275 Ga0163162_10920680 3300013306 Bacteria 986
276 Ga0157375_10266819 3300013308 Bacteria 1873
277 Ga0157375_10415343 3300013308 Bacteria 1512
278 Ga0157375_11661220 3300013308 Bacteria 756
279 Ga0157375_13403898 3300013308 Unclassified 530
280 Ga0163163_10012664 3300014325 Bacteria 7691
281 Ga0163163_10154621 3300014325 Bacteria 2338
282 Ga0163163_10197636 3300014325 Bacteria 2059
283 Ga0157380_10150668 3300014326 Bacteria 2010
284 Ga0157380_12022999 3300014326 Bacteria 638
285 Ga0157377_10002072 3300014745 Bacteria 8802
286 Ga0157379_10222152 3300014968 Bacteria 1712
287 Ga0157379_10731267 3300014968 Unclassified 930
288 Ga0157379_10743494 3300014968 Bacteria 923
289 Ga0157376_10090497 3300014969 Bacteria 2648
290 Ga0157376_10301067 3300014969 Bacteria 1518
291 Ga0163161_10478255 3300017792 Unclassified 1011
292 Ga0163161_10752310 3300017792 Unclassified 815
293 Ga0213873_10036599 3300021358 Bacteria 1247
294 Ga0213874_10116118 3300021377 Bacteria 905
295 Ga0213876_10031780 3300021384 Bacteria 2785
296 Ga0213876_10338404 3300021384 Bacteria 800
297 Ga0207697_10032971 3300025315 Bacteria 2120
298 Ga0207696_1117830 3300025711 Unclassified 717
299 Ga0207692_10694846 3300025898 Bacteria 660
300 Ga0207692_10709524 3300025898 Bacteria 653
301 Ga0207692_10918568 3300025898 Unclassified 576
302 Ga0207642_10290325 3300025899 Bacteria 944
303 Ga0207642_10905734 3300025899 Unclassified 565
304 Ga0207710_10003493 3300025900 Bacteria 6996
305 Ga0207710_10061808 3300025900 Bacteria 1701
306 Ga0207688_10003162 3300025901 Bacteria 8980
307 Ga0207688_10226461 3300025901 Bacteria 1128
308 Ga0207680_10323799 3300025903 Unclassified 1078
309 Ga0207685_10012558 3300025905 Bacteria 2589
310 Ga0207685_10018081 3300025905 Bacteria 2294
311 Ga0207685_10034787 3300025905 Bacteria 1833
312 Ga0207699_11059582 3300025906 Bacteria 600
313 Ga0207645_10027456 3300025907 Bacteria 3675
314 Ga0207643_10023614 3300025908 Bacteria 3391
315 Ga0207684_10229354 3300025910 Bacteria 1602
316 Ga0207684_10774315 3300025910 Bacteria 812
317 Ga0207684_11419998 3300025910 Bacteria 567
318 Ga0207654_10070256 3300025911 Bacteria 2078
319 Ga0207707_10079085 3300025912 Bacteria 2871
320 Ga0207693_10237155 3300025915 Bacteria 1432
321 Ga0207693_10273832 3300025915 Bacteria 1323
322 Ga0207663_10050434 3300025916 Bacteria 2586
323 Ga0207662_10001805 3300025918 Bacteria 10509
324 Ga0207662_10327496 3300025918 Bacteria 1024
325 Ga0207657_10084361 3300025919 Bacteria 2663
326 Ga0207657_10132376 3300025919 Bacteria 2043
327 Ga0207649_10227820 3300025920 Unclassified 1331
328 Ga0207649_10977682 3300025920 Unclassified 665
329 Ga0207652_10018578 3300025921 Bacteria 5704
330 Ga0207646_10691370 3300025922 Bacteria 912
331 Ga0207646_11150162 3300025922 Bacteria 682
332 Ga0207681_10374436 3300025923 Unclassified 1145
333 Ga0207650_10048297 3300025925 Bacteria 3139
334 Ga0207650_10222614 3300025925 Bacteria 1519
335 Ga0207659_10272352 3300025926 Unclassified 1381
336 Ga0207659_11799710 3300025926 Unclassified 520
337 Ga0207687_10202991 3300025927 Unclassified 1551
338 Ga0207687_10756021 3300025927 Bacteria 827
339 Ga0207700_10043298 3300025928 Bacteria 3306
340 Ga0207700_10394285 3300025928 Unclassified 1212
341 Ga0207700_10523181 3300025928 Bacteria 1051
342 Ga0207700_10905393 3300025928 Unclassified 789
343 Ga0207664_10037085 3300025929 Bacteria 3771
344 Ga0207664_10164628 3300025929 Bacteria 1894
345 Ga0207664_10378141 3300025929 Bacteria 1257
346 Ga0207664_11726670 3300025929 Bacteria 548
347 Ga0207644_10170959 3300025931 Bacteria 1696
348 Ga0207644_11743057 3300025931 Unclassified 521
349 Ga0207690_10175888 3300025932 Bacteria 1607
350 Ga0207690_10848051 3300025932 Bacteria 756
351 Ga0207706_10008946 3300025933 Bacteria 9216
352 Ga0207706_10020855 3300025933 Bacteria 5884
353 Ga0207686_10062296 3300025934 Bacteria 2368
354 Ga0207686_10151008 3300025934 Bacteria 1617
355 Ga0207686_10253963 3300025934 Bacteria 1286
356 Ga0207709_10010291 3300025935 Bacteria 5153
357 Ga0207709_10158940 3300025935 Bacteria 1574
358 Ga0207670_10137060 3300025936 Bacteria 1800
359 Ga0207670_10952538 3300025936 Unclassified 721
360 Ga0207670_11642542 3300025936 Bacteria 546
361 Ga0207669_10006625 3300025937 Bacteria 5308
362 Ga0207669_10025976 3300025937 Bacteria 3177
363 Ga0207704_10048207 3300025938 Bacteria 2552
364 Ga0207665_10011325 3300025939 Bacteria 5855
365 Ga0207665_10133273 3300025939 Bacteria 1766
366 Ga0207691_10003107 3300025940 Bacteria 16211
367 Ga0207691_10189968 3300025940 Bacteria 1791
368 Ga0207711_10007877 3300025941 Bacteria 8913
369 Ga0207689_10004621 3300025942 Bacteria 12454
370 Ga0207689_10059297 3300025942 Bacteria 3148
371 Ga0207661_10414447 3300025944 Unclassified 1223
372 Ga0207661_11385635 3300025944 Bacteria 645
373 Ga0207679_10239235 3300025945 Bacteria 1537
374 Ga0207679_10264365 3300025945 Unclassified 1469
375 Ga0207651_10105487 3300025960 Unclassified 2102
376 Ga0207651_11283697 3300025960 Unclassified 658
377 Ga0207712_10142590 3300025961 Unclassified 1841
378 Ga0207668_10474191 3300025972 Bacteria 1072
379 Ga0207640_10089119 3300025981 Unclassified 2132
380 Ga0207640_11220785 3300025981 Unclassified 669
381 Ga0207658_10039475 3300025986 Bacteria 3406
382 Ga0207658_10057159 3300025986 Bacteria 2898
383 Ga0207677_10009466 3300026023 Bacteria 5483
384 Ga0207703_10835833 3300026035 Unclassified 880
385 Ga0207703_11267735 3300026035 Bacteria 709
386 Ga0207703_12099668 3300026035 Unclassified 541
387 Ga0207639_10775620 3300026041 Unclassified 892
388 Ga0207639_10781391 3300026041 Unclassified 889
389 Ga0207678_10012522 3300026067 Bacteria 7449
390 Ga0207678_10016271 3300026067 Bacteria 6528
391 Ga0207708_10000903 3300026075 Bacteria 22295
392 Ga0207708_10805366 3300026075 Unclassified 809
393 Ga0207702_10486634 3300026078 Bacteria 1201
394 Ga0207702_10660748 3300026078 Bacteria 1028
395 Ga0207702_12031197 3300026078 Unclassified 565
396 Ga0207641_10314400 3300026088 Unclassified 1483
397 Ga0207641_10378261 3300026088 Bacteria 1355
398 Ga0207648_10007242 3300026089 Bacteria 10939
399 Ga0207648_10030022 3300026089 Bacteria 4820
400 Ga0207676_10028505 3300026095 Bacteria 4171
401 Ga0207676_10304487 3300026095 Bacteria 1456
402 Ga0207674_10433291 3300026116 Bacteria 1271
403 Ga0207675_100005933 3300026118 Bacteria 11656
404 Ga0207675_100454498 3300026118 Unclassified 1270
405 Ga0207683_10012534 3300026121 Bacteria 7233
406 Ga0207683_10087529 3300026121 Plasmid 2770
407 Ga0207698_10013610 3300026142 Bacteria 5376
408 Ga0209588_1056808 3300027671 Bacteria 1265
409 Ga0207428_10177736 3300027907 Bacteria 1609
410 Ga0268266_10344945 3300028379 Unclassified 1398
411 Ga0268266_12006058 3300028379 Unclassified 552
412 Ga0268265_10034930 3300028380 Bacteria 3669
413 Ga0268265_10564007 3300028380 Unclassified 1083
414 Ga0268264_10034737 3300028381 Bacteria 4149
415 Ga0268264_10350919 3300028381 Bacteria 1404
416 Ga0265328_10068548 3300031239 Bacteria 1303
417 Ga0265340_10011490 3300031247 Bacteria 4704
418 Ga0265339_10046597 3300031249 Bacteria 2382
419 Ga0265316_10784265 3300031344 Bacteria 669
420 Ga0307408_101513324 3300031548 Bacteria 635
421 Ga0307409_101944000 3300031995 Bacteria 618
422 Ga0373930_0016442 3300034816 Unclassified 1399
423 Ga0373948_0079309 3300034817 Unclassified 747
424 Ga0373948_0131780 3300034817 Bacteria 612
425 Ga0373950_0005845 3300034818 Bacteria 1852
426 Ga0373958_0072470 3300034819 Bacteria 767
427 Ga0373959_0007110 3300034820 Bacteria 1876
428 Ga0373938_0000774 3300034957 Bacteria 5192
429 Ga0373926_0037707 3300035083 Unclassified 1719
430 Ga0373926_0058377 3300035083 Bacteria 1403
431 Ga0373928_0009457 3300035084 Bacteria 1904
432 Ga0373929_0015217 3300035085 Bacteria 1493
433 Ga0373940_0043240 3300035088 Bacteria 1244
434 Ga0373944_0039143 3300035089 Bacteria 1459
435 Ga0373949_0011150 3300035090 Bacteria 1977
436 Ga0373951_0008469 3300035091 Unclassified 2321
437 Ga0373952_0002665 3300035092 Bacteria 3219
438 Ga0373952_0110744 3300035092 Unclassified 735
439 Ga0373923_0133786 3300035111 Unclassified 1116
440 Ga0373932_0044982 3300035112 Unclassified 1289
441 Ga0373936_0024357 3300035113 Unclassified 2362
442 Ga0373939_0029961 3300035114 Bacteria 1561
443 Ga0373939_0040233 3300035114 Bacteria 1403
444 Ga0373941_0025144 3300035115 Bacteria 1717
445 Ga0373945_0034012 3300035116 Unclassified 1814
446 Ga0373945_0039439 3300035116 Bacteria 1702
447 Ga0373953_0334172 3300035117 Unclassified 663
448 Ga0373954_0026708 3300035118 Unclassified 2648
449 Ga0373957_0026288 3300035120 Bacteria 2104
450 Ga0373960_0028872 3300035121 Unclassified 1533
451 Ga0373943_0007085 3300035170 Bacteria 5030
452 Ga0373943_0014234 3300035170 Unclassified 3598
453 Ga0373943_0025570 3300035170 Bacteria 2760
454 Ga0373943_0056792 3300035170 Bacteria 1943
455 Ga0373943_0418506 3300035170 Bacteria 775
456 Ga0373943_0733771 3300035170 Bacteria 586
457 Ga0373946_0001998 3300035171 Bacteria 7140
458 Ga0373946_0020211 3300035171 Bacteria 2572
459 Ga0373946_0074603 3300035171 Unclassified 1472
460 Ga0373946_0114781 3300035171 Bacteria 1223
461 Ga0373955_0120795 3300035172 Unclassified 1523
462 Ga0373942_0020135 3300035207 Unclassified 1672
463 Ga0373961_0007527 3300035241 Bacteria 2636
464 Ga0373962_0001749 3300035242 Bacteria 5167
465 Ga0373924_0199106 3300035410 Unclassified 883
466 Ga0373931_0031652 3300035691 Bacteria 2731
467 Ga0373931_0798215 3300035691 Bacteria 629
468 Ga0373935_0039066 3300035692 Bacteria 2974
469 Ga0373935_0039930 3300035692 Bacteria 2943
470 Ga0373935_0127801 3300035692 Unclassified 1704
471 Ga0373927_0004359 3300035695 Bacteria 9920
472 Ga0373927_0066162 3300035695 Bacteria 2338
473 Ga0373927_0185508 3300035695 Unclassified 1364
474 Ga0373927_0288087 3300035695 Bacteria 1081
475 Ga0373933_0332262 3300035724 Bacteria 986
476 Ga0373933_0370572 3300035724 Unclassified 932
477 Ga0373933_0444198 3300035724 Bacteria 848
478 Ga0373947_0001284 3300035725 Bacteria 15473
479 Ga0373947_0010881 3300035725 Bacteria 5222
480 Ga0373947_0031943 3300035725 Bacteria 3101
481 Ga0373947_0060773 3300035725 Bacteria 2295
482 Ga0373947_0169076 3300035725 Unclassified 1417
483 Ga0373937_0040093 3300036401 Bacteria 4269
484 Ga0373937_0301605 3300036401 Unclassified 1514
485 Ga0373925_0005253 3300037068 Bacteria 9670
486 Ga0373925_0007671 3300037068 Bacteria 7860
487 Ga0373925_0071711 3300037068 Bacteria 2621
488 Ga0395900_1283846 3300037418 Bacteria 646
489 Ga0436364_0108650 3300037853 Unclassified 787
490 Ga0436364_0212863 3300037853 Bacteria 2758
491 Ga0436364_0629386 3300037853 Bacteria 1012
492 Ga0436364_1057555 3300037853 Bacteria 51632
493 Ga0436364_1148727 3300037853 Bacteria 1619
494 Ga0436364_1168836 3300037853 Bacteria 611
495 Ga0436364_1496074 3300037853 Bacteria 707
496 Ga0436364_1544542 3300037853 Bacteria 3449
497 Ga0395901_0361500 3300038443 Bacteria 1497
498 Ga0395901_0694544 3300038443 Bacteria 1016
499 Ga0242420_004389 3300038996 Bacteria 2130
500 Ga0436365_0050135 3300039437 Bacteria 3409
501 Ga0436365_1463846 3300039437 Bacteria 3332
502 Ga0436360_0739662 3300039438 Bacteria 4390
503 Ga0436361_0480030 3300039447 Unclassified 503
504 Ga0436361_0550427 3300039447 Bacteria 1193
505 Ga0436361_0605963 3300039447 Bacteria 3794
506 Ga0436363_0075951 3300039450 Bacteria 9272
507 Ga0436363_0135958 3300039450 Bacteria 1707
508 Ga0436363_0666566 3300039450 Bacteria 2068
509 Ga0436362_0102214 3300039453 Bacteria 3071
510 Ga0436362_0394223 3300039453 Bacteria 863
511 Ga0451789_0108192 3300041443 Bacteria 942
512 Ga0451795_0340630 3300041456 Bacteria 928
513 Ga0451798_0682408 3300041458 Unclassified 996
514 Ga0451833_0160897 3300041491 Unclassified 554
515 Ga0451853_1842165 3300041512 Bacteria 832
516 Ga0466967_0743405 3300045976 Bacteria 973
517 Ga0495592_0010790 3300046454 Bacteria 6890
518 Ga0495592_0120955 3300046454 Bacteria 1842
519 Ga0495603_0000416 3300046455 Bacteria 23560
520 Ga0495603_0030167 3300046455 Bacteria 3267
521 Ga0495603_0535938 3300046455 Unclassified 670
522 Ga0495629_0002468 3300046459 Bacteria 14194
523 Ga0495629_0021071 3300046459 Bacteria 4651
524 Ga0495629_0103580 3300046459 Bacteria 1985
525 Ga0495629_0213138 3300046459 Bacteria 1333
526 Ga0495638_0560425 3300046460 Unclassified 567
527 Ga0495641_0014527 3300046461 Bacteria 4255
528 Ga0495641_0087079 3300046461 Unclassified 1397
529 Ga0495651_0021958 3300046462 Bacteria 4964
530 Ga0495653_0069117 3300046463 Bacteria 2647
531 Ga0495580_0028144 3300046472 Unclassified 4087
532 Ga0495580_0130499 3300046472 Unclassified 1743
533 Ga0495580_0233318 3300046472 Bacteria 1263
534 Ga0495582_0003410 3300046473 Bacteria 8948
535 Ga0495582_0005148 3300046473 Bacteria 7321
536 Ga0495582_0045970 3300046473 Unclassified 2404
537 Ga0495582_0081710 3300046473 Unclassified 1795
538 Ga0495605_0111650 3300046474 Bacteria 1247
539 Ga0495605_0216137 3300046474 Unclassified 830
540 Ga0495605_0222747 3300046474 Unclassified 815
541 Ga0495639_0002783 3300046475 Bacteria 7604
542 Ga0495639_0017252 3300046475 Bacteria 3135
543 Ga0495639_0038487 3300046475 Bacteria 2148
544 Ga0495639_0098920 3300046475 Bacteria 1375
545 Ga0495662_0010361 3300046476 Unclassified 4567
546 Ga0495662_0023790 3300046476 Plasmid 2958
547 Ga0495662_0176584 3300046476 Bacteria 1053
548 Ga0495664_0020825 3300046477 Bacteria 3786
549 Ga0495664_0027417 3300046477 Unclassified 3321
550 Ga0495664_0506829 3300046477 Unclassified 721
551 Ga0495584_0035794 3300046491 Bacteria 2509
552 Ga0495584_0072730 3300046491 Unclassified 1728
553 Ga0495585_0003446 3300046492 Bacteria 10686
554 Ga0495585_0370598 3300046492 Unclassified 693
555 Ga0495594_0012273 3300046499 Bacteria 4462
556 Ga0495594_0066444 3300046499 Unclassified 2000
557 Ga0495594_0371359 3300046499 Unclassified 814
558 Ga0495594_0630048 3300046499 Unclassified 607
559 Ga0495607_0027729 3300046501 Bacteria 3499
560 Ga0495608_0004974 3300046511 Bacteria 9511
561 Ga0495608_0106726 3300046511 Unclassified 1802
562 Ga0495618_0001026 3300046514 Bacteria 19150
563 Ga0495618_0071015 3300046514 Bacteria 2215
564 Ga0495618_0101727 3300046514 Bacteria 1839
565 Ga0495618_0170806 3300046514 Bacteria 1384
566 Ga0495618_0185269 3300046514 Bacteria 1322
567 Ga0495620_0231178 3300046515 Bacteria 707
568 Ga0495620_0351571 3300046515 Unclassified 559
569 Ga0495630_0029501 3300046517 Unclassified 4078
570 Ga0495630_0041199 3300046517 Bacteria 3449
571 Ga0495630_0067767 3300046517 Bacteria 2683
572 Ga0495630_0199060 3300046517 Unclassified 1528
573 Ga0495630_0506300 3300046517 Bacteria 926
574 Ga0495631_0395082 3300046518 Unclassified 589
575 Ga0495637_0030422 3300046520 Bacteria 2396
576 Ga0495644_0084703 3300046523 Unclassified 1195
577 Ga0495644_0152495 3300046523 Bacteria 885
578 Ga0495663_0009368 3300046525 Bacteria 2715
579 Ga0495666_0081508 3300046526 Unclassified 1530
580 Ga0495642_0205138 3300046528 Bacteria 860
581 Ga0495652_0003570 3300046529 Bacteria 15274
582 Ga0495652_0075832 3300046529 Bacteria 2791
583 Ga0495665_0059852 3300046531 Unclassified 2010
584 Ga0495665_0195837 3300046531 Unclassified 1048
585 Ga0495665_0314036 3300046531 Bacteria 801
586 Ga0495665_0333093 3300046531 Unclassified 774
587 Ga0495640_0001631 3300046533 Bacteria 17720
588 Ga0495640_0017672 3300046533 Bacteria 5307
589 Ga0495587_0096070 3300046536 Unclassified 1709
590 Ga0495587_0114149 3300046536 Bacteria 1550
591 Ga0495587_0117953 3300046536 Bacteria 1521
592 Ga0495587_0795041 3300046536 Bacteria 517
593 Ga0495598_0016272 3300046537 Unclassified 1895
594 Ga0495609_0209774 3300046538 Bacteria 812
595 Ga0495621_0020825 3300046539 Bacteria 2156
596 Ga0495622_0049319 3300046557 Unclassified 1954
597 Ga0495633_0024190 3300046558 Bacteria 3003
598 Ga0495667_0051000 3300046559 Bacteria 2730
599 Ga0495667_0111401 3300046559 Bacteria 1768
600 Ga0495667_0193396 3300046559 Bacteria 1303
601 Ga0495656_0004050 3300046615 Bacteria 4984
602 Ga0495656_0143011 3300046615 Bacteria 1149
603 Ga0495656_0718129 3300046615 Unclassified 538
604 Ga0495668_0454585 3300046616 Unclassified 705
605 Ga0495634_0009355 3300046642 Bacteria 7228
606 Ga0495634_0065700 3300046642 Bacteria 2403
607 Ga0495634_0074977 3300046642 Bacteria 2222
608 Ga0495634_0755317 3300046642 Unclassified 557
609 Ga0495611_0258414 3300046648 Bacteria 807
610 Ga0495635_0031396 3300046663 Bacteria 3688
611 Ga0495635_0111609 3300046663 Bacteria 1867
612 Ga0495635_0314511 3300046663 Bacteria 1049
613 Ga0495659_0087294 3300046664 Unclassified 1193
614 Ga0495661_0124373 3300046665 Bacteria 1421
615 Ga0495588_0055074 3300046674 Unclassified 2052
616 Ga0495588_0089457 3300046674 Bacteria 1612
617 Ga0495588_0245545 3300046674 Bacteria 944
618 Ga0495599_0746671 3300046678 Bacteria 562
619 Ga0495623_0669578 3300046679 Bacteria 534
620 Ga0495646_0010226 3300046680 Bacteria 5968
621 Ga0495646_0120913 3300046680 Unclassified 1482
622 Ga0495647_0029831 3300046681 Bacteria 2019
623 Ga0495647_0031656 3300046681 Bacteria 1968
624 Ga0495647_0095482 3300046681 Unclassified 1224
625 Ga0495658_0016929 3300046683 Bacteria 3757
626 Ga0495658_0230011 3300046683 Unclassified 1162
627 Ga0495669_0108597 3300046684 Unclassified 1294
628 Ga0495669_0336361 3300046684 Unclassified 729
629 Ga0495613_0010882 3300046689 Bacteria 6752
630 Ga0495613_0069839 3300046689 Bacteria 2561
631 Ga0495613_0117029 3300046689 Bacteria 1916
632 Ga0495613_0426108 3300046689 Bacteria 902
633 Ga0495624_0012119 3300046690 Bacteria 5904
634 Ga0495624_0022379 3300046690 Unclassified 4178
635 Ga0495624_0093163 3300046690 Bacteria 1857
636 Ga0495624_0275781 3300046690 Unclassified 1016
637 Ga0495624_0462873 3300046690 Bacteria 759
638 Ga0495670_0016334 3300046691 Bacteria 3648
639 Ga0495670_0437634 3300046691 Bacteria 708
640 Ga0495649_0236726 3300046694 Unclassified 941
641 Ga0495589_0134550 3300046794 Bacteria 1186
642 Ga0495600_0021873 3300046809 Bacteria 4100
643 Ga0495581_0042417 3300047315 Bacteria 2633
644 Ga0495581_0060611 3300047315 Bacteria 2187
645 Ga0495581_0153898 3300047315 Bacteria 1343
646 Ga0495604_0117101 3300047317 Unclassified 1933
647 Ga0495604_0119198 3300047317 Bacteria 1912
648 Ga0495674_0032294 3300047319 Bacteria 4749
649 Ga0495674_0037259 3300047319 Bacteria 4369
650 Ga0495674_0046677 3300047319 Unclassified 3844
651 Ga0495674_0080871 3300047319 Bacteria 2788
652 Ga0495676_0010139 3300047321 Bacteria 8555
653 Ga0495676_0049167 3300047321 Bacteria 3393
654 Ga0495676_0052869 3300047321 Bacteria 3240
655 Ga0495680_0012109 3300047322 Bacteria 7610
656 Ga0495680_0039741 3300047322 Unclassified 3751
657 Ga0495680_0801548 3300047322 Unclassified 615
658 Ga0495683_0212119 3300047323 Unclassified 868
659 Ga0495675_0514928 3300047444 Unclassified 686
660 Ga0495684_0036616 3300047471 Bacteria 3761
661 Ga0495684_0121283 3300047471 Bacteria 1969
662 Ga0495593_0051036 3300047673 Bacteria 2190
663 Ga0495593_0069421 3300047673 Unclassified 1832
664 Ga0495593_0165757 3300047673 Bacteria 1115
665 Ga0495602_0192817 3300048088 Bacteria 1561
666 Ga0495614_0128836 3300048089 Unclassified 1119
667 Ga0495614_0191648 3300048089 Unclassified 922
668 Ga0495614_0633934 3300048089 Bacteria 515
669 Ga0496100_0017306 3300048903 Bacteria 4252
670 Ga0496100_0055212 3300048903 Bacteria 2594
671 Ga0496100_0095940 3300048903 Bacteria 2034
672 Ga0496100_0239388 3300048903 Bacteria 1338
673 Ga0496100_0260629 3300048903 Bacteria 1285
674 Ga0496100_0473269 3300048903 Bacteria 963
675 Ga0496101_0008621 3300048904 Bacteria 6666
676 Ga0496101_0127792 3300048904 Bacteria 1927
677 Ga0496101_0272667 3300048904 Bacteria 1321
678 Ga0496101_0622203 3300048904 Unclassified 853
679 Ga0496102_0001884 3300048905 Bacteria 18078
680 Ga0496102_0103362 3300048905 Bacteria 2649
681 Ga0496102_0120622 3300048905 Bacteria 2449
682 Ga0496102_0155393 3300048905 Bacteria 2150
683 Ga0496102_1155484 3300048905 Unclassified 694
684 Ga0496102_1879471 3300048905 Unclassified 515
685 Ga0496103_0025215 3300048906 Bacteria 3592
686 Ga0496103_0029796 3300048906 Bacteria 3318
687 Ga0496104_0001262 3300048907 Bacteria 21783
688 Ga0496104_0003395 3300048907 Bacteria 13749
689 Ga0496104_0122057 3300048907 Unclassified 2501
690 Ga0496104_0259494 3300048907 Bacteria 1651
691 Ga0496105_0000320 3300048908 Bacteria 31520
692 Ga0496105_0004927 3300048908 Bacteria 10093
693 Ga0496105_0052339 3300048908 Bacteria 3372
694 Ga0496105_0067833 3300048908 Plasmid 2945
695 Ga0496105_0662838 3300048908 Bacteria 804
696 Ga0496106_0005802 3300048909 Bacteria 9127
697 Ga0496106_0091446 3300048909 Bacteria 2349
698 Ga0496107_0096843 3300048910 Unclassified 2159
699 Ga0496107_0288907 3300048910 Unclassified 1220
700 Ga0496107_0876915 3300048910 Bacteria 655
701 Ga0496108_0000724 3300048911 Bacteria 25671
702 Ga0496108_0033404 3300048911 Bacteria 4274
703 Ga0496108_0041605 3300048911 Bacteria 3836
704 Ga0496108_0056254 3300048911 Bacteria 3304
705 Ga0496108_0232554 3300048911 Bacteria 1603
706 Ga0496108_0665171 3300048911 Bacteria 905
707 Ga0496109_0000865 3300048912 Bacteria 25247
708 Ga0496109_0006844 3300048912 Bacteria 9615
709 Ga0496109_0057195 3300048912 Bacteria 3559
710 Ga0496109_0181006 3300048912 Bacteria 1979
711 Ga0496109_0668771 3300048912 Unclassified 976
712 Ga0496110_0014219 3300048913 Bacteria 6604
713 Ga0496110_0034457 3300048913 Bacteria 4385
714 Ga0496110_0089973 3300048913 Bacteria 2744
715 Ga0496110_0251451 3300048913 Bacteria 1608
716 Ga0496111_0004794 3300048914 Bacteria 8577
717 Ga0496111_0015932 3300048914 Bacteria 5170
718 Ga0496111_0063214 3300048914 Unclassified 2684
719 Ga0496112_0003413 3300048915 Bacteria 13123
720 Ga0496112_0003786 3300048915 Bacteria 12636
721 Ga0496112_0036546 3300048915 Bacteria 4791
722 Ga0496112_0064550 3300048915 Bacteria 3613
723 Ga0496113_0000157 3300048916 Bacteria 30003
724 Ga0496113_0011446 3300048916 Bacteria 5919
725 Ga0496113_0024047 3300048916 Bacteria 4325
726 Ga0496113_0087015 3300048916 Bacteria 2402
727 Ga0496114_0292976 3300048917 Bacteria 1436
728 Ga0496114_1004945 3300048917 Unclassified 717
729 Ga0496115_0005569 3300048918 Bacteria 9162
730 Ga0496115_0067824 3300048918 Bacteria 2886
731 Ga0496115_0090874 3300048918 Unclassified 2494
732 Ga0496115_0138810 3300048918 Bacteria 2005
733 nmdc:mga03n38_377889_c1 3300050490 Bacteria 776
734 nmdc:mga00v17_217202_c1 3300050491 Bacteria 1237
735 nmdc:mga00v17_54756_c1 3300050491 Bacteria 2434
736 nmdc:mga0yw44_336373_c1 3300050492 Bacteria 1015
737 nmdc:mga0yw44_358317_c1 3300050492 Bacteria 983
738 nmdc:mga0yw44_4409_c1 3300050492 Bacteria 6448
739 nmdc:mga0yw44_44507_c1 3300050492 Bacteria 2655
740 nmdc:mga0yw44_761233_c1 3300050492 Bacteria 658
741 nmdc:mga0yw44_8275_c1 3300050492 Bacteria 5169
742 nmdc:mga0yw44_9898_c1 3300050492 Bacteria 4844
743 nmdc:mga07m45_905688_c1 3300050496 Unclassified 504
744 nmdc:mga05p37_159654_c1 3300050507 Plasmid 2754
745 nmdc:mga05p37_1697979_c1 3300050507 Unclassified 616
746 nmdc:mga05p37_190319_c1 3300050507 Bacteria 2492
747 nmdc:mga05p37_26994_c1 3300050507 Bacteria 6987
748 nmdc:mga05p37_448955_c1 3300050507 Bacteria 1493
749 nmdc:mga09592_252617_c1 3300050508 Bacteria 1528
750 nmdc:mga09592_884989_c1 3300050508 Bacteria 751
751 nmdc:mga06r32_102963_c1 3300050510 Bacteria 2803
752 nmdc:mga06r32_139192_c1 3300050510 Unclassified 2403
753 nmdc:mga06r32_290632_c1 3300050510 Bacteria 1621
754 nmdc:mga08y16_269020_c1 3300050511 Bacteria 1759
755 nmdc:mga08y16_793539_c1 3300050511 Bacteria 940
756 nmdc:mga0n895_1218528_c1 3300050512 Unclassified 726
757 nmdc:mga0n895_127820_c1 3300050512 Bacteria 2565
758 nmdc:mga0n895_147343_c1 3300050512 Bacteria 2384
759 nmdc:mga0n895_1553479_c1 3300050512 Bacteria 627
760 nmdc:mga0rr50_406303_c1 3300050513 Bacteria 1151
761 nmdc:mga0rr50_931973_c1 3300050513 Bacteria 740
762 nmdc:mga08x19_139961_c1 3300050514 Unclassified 1634
763 nmdc:mga08x19_563424_c1 3300050514 Bacteria 806
764 nmdc:mga08x19_890382_c1 3300050514 Unclassified 632
765 nmdc:mga0a205_114482_c1 3300050515 Bacteria 2595
766 nmdc:mga0a205_277894_c1 3300050515 Bacteria 1550
767 nmdc:mga0a205_897050_c1 3300050515 Bacteria 733
768 nmdc:mga0sz30_487732_c1 3300050516 Unclassified 554
769 Ga0495601_0002214 3300053077 Bacteria 10944
770 Ga0495601_0026816 3300053077 Bacteria 3559
771 Ga0495601_0200374 3300053077 Bacteria 1304
772 Ga0495601_0924935 3300053077 Unclassified 550
773 Ga0495612_0004473 3300053078 Bacteria 5801
774 Ga0495612_0161368 3300053078 Bacteria 979
775 Ga0495612_0590938 3300053078 Unclassified 513
776 Ga0495595_0005062 3300053084 Bacteria 5324
777 Ga0495595_0006212 3300053084 Bacteria 4861
778 Ga0495619_0005727 3300053085 Bacteria 7878
779 Ga0495619_0015921 3300053085 Bacteria 4762
780 Ga0495619_0017258 3300053085 Bacteria 4571
781 Ga0500593_001564 3300053117 Bacteria 8237
782 Ga0500614_168819 3300053123 Unclassified 666
783 Ga0105242_10995329
784 2214817448
785 ARcpr5oldR_c024750
786 ARcpr5yngRDRAFT_c012710
787 JGI24740J21852_10107259
788 JGI24743J22301_10001539
789 JGI25404J52841_10009138
790 JGI25405J52794_10015261
791 JGI25405J52794_10073986
792 Ga0065717_1006076
793 Ga0070658_10480903
794 Ga0070683_100553412
795 Ga0070683_100831334
796 Ga0070690_100153880
797 Ga0070690_100236831
798 Ga0070670_100039820
799 Ga0070670_100123660
800 Ga0070670_100200782
801 Ga0068869_100388027
802 Ga0070682_100012793
803 Ga0070682_100757437
804 Ga0068868_100004763
805 Ga0068868_100168960
806 Ga0070660_100035139
807 Ga0070660_100562557
808 Ga0070689_100004926
809 Ga0070689_100228178
810 Ga0070689_100230558
811 Ga0070691_10413216
812 Ga0070691_10417859
813 Ga0070687_100050547
814 Ga0070687_100556972
815 Ga0070687_100643851
816 Ga0070687_101464255
817 Ga0070661_100679429
818 Ga0070661_100800369
819 Ga0070668_100051305
820 Ga0070668_100054312
821 Ga0070668_100277331
822 Ga0070671_100022886
823 Ga0070674_100075774
824 Ga0070674_100401904
825 Ga0070674_100635367
826 Ga0070673_100294291
827 Ga0070688_100085753
828 Ga0070659_100559597
829 Ga0070659_100636547
830 Ga0070659_101328138
831 Ga0070667_100079544
832 Ga0070667_100172967
833 Ga0070709_10231250
834 Ga0070709_10710629
835 Ga0070714_100172158
836 Ga0070713_100273175
837 Ga0070713_100313755
838 Ga0070713_101577413
839 Ga0070710_10373076
840 Ga0070701_10005855
841 Ga0070701_10641654
842 Ga0070711_100400100
843 Ga0070711_100402795
844 Ga0070711_100916460
845 Ga0070700_100327876
846 Ga0070700_100617636
847 Ga0070694_100065469
848 Ga0070694_100068350
849 Ga0070708_100458922
850 Ga0070663_100025385
851 Ga0070663_100296703
852 Ga0070678_100073097
853 Ga0070678_100509957
854 Ga0070662_100020789
855 Ga0070662_101422191
856 Ga0070681_10003489
857 Ga0068867_101733150
858 Ga0070685_10581623
859 Ga0070706_100219097
860 Ga0070706_100469611
861 Ga0070706_100713907
862 Ga0070706_101048006
863 Ga0070707_100359470
864 Ga0070707_100439301
865 Ga0070707_100530225
866 Ga0070707_100956643
867 Ga0070698_100237277
868 Ga0070698_100735291
869 Ga0070698_100795628
870 Ga0070699_100182343
871 Ga0070699_100656129
872 Ga0070699_100768337
873 Ga0070699_100793717
874 Ga0070679_100007580
875 Ga0070684_100486397
876 Ga0070697_100235832
877 Ga0070697_100289602
878 Ga0070697_100562892
879 Ga0070697_101020677
880 Ga0070697_101336763
881 Ga0070697_101495322
882 Ga0070697_101784064
883 Ga0068853_100026879
884 Ga0070672_100001330
885 Ga0070672_100541790
886 Ga0070686_100056117
887 Ga0070686_100105067
888 Ga0070686_100412596
889 Ga0070695_100193200
890 Ga0070695_101072265
891 Ga0070696_100057041
892 Ga0070696_100371338
893 Ga0070696_100530881
894 Ga0070693_100179691
895 Ga0070693_101242477
896 Ga0070665_100042174
897 Ga0070665_100215818
898 Ga0070704_100297778
899 Ga0068855_100616508
900 Ga0070664_100200809
901 Ga0070664_100583625
902 Ga0068857_100130556
903 Ga0068854_100265351
904 Ga0068856_101506058
905 Ga0070702_100004417
906 Ga0070702_100212463
907 Ga0070702_100547822
908 Ga0070702_101098954
909 Ga0068852_100008788
910 Ga0068852_101167429
911 Ga0068859_100076930
912 Ga0068864_100146892
913 Ga0068864_100353953
914 Ga0068866_10008330
915 Ga0068866_10049261
916 Ga0068866_11418713
917 Ga0068861_100012963
918 Ga0068870_10009661
919 Ga0068863_100034411
920 Ga0068863_100120575
921 Ga0068858_100086985
922 Ga0068858_100554664
923 Ga0068860_100151101
924 Ga0068860_101794141
925 Ga0068862_100384022
926 Ga0068862_101236631
927 Ga0081455_10003946
928 Ga0081455_10008930
929 Ga0081455_10030119
930 Ga0081455_10055314
931 Ga0081455_10081547
932 Ga0081455_10491206
933 Ga0081455_10650787
934 Ga0081538_10051086
935 Ga0081540_1000081
936 Ga0081540_1005331
937 Ga0081540_1023133
938 Ga0070717_10097025
939 Ga0070717_10330636
940 Ga0070717_10348028
941 Ga0070717_10618310
942 Ga0070717_10639912
943 Ga0070717_11020399
944 Ga0075365_10005560
945 Ga0075365_10040381
946 Ga0075365_10137635
947 Ga0075365_10142223
948 Ga0075365_10143752
949 Ga0075365_10162658
950 Ga0075365_10500092
951 Ga0075363_100132288
952 Ga0075364_10624798
953 Ga0075432_10274635
954 Ga0070715_10004618
955 Ga0070715_10056490
956 Ga0070715_10238861
957 Ga0070715_10424128
958 Ga0070716_100020156
959 Ga0070716_100045533
960 Ga0070716_100141109
961 Ga0070716_100942793
962 Ga0070712_100314995
963 Ga0070712_101268814
964 Ga0075369_10643499
965 Ga0097621_100319730
966 Ga0097621_100392207
967 Ga0068871_100199055
968 Ga0068871_100241821
969 Ga0075428_100044859
970 Ga0075428_100057884
971 Ga0075428_100141905
972 Ga0075428_100321922
973 Ga0075428_100643347
974 Ga0075428_100680493
975 Ga0075428_100698707
976 Ga0075430_100069563
977 Ga0075431_100071503
978 Ga0075431_100149930
979 Ga0075433_10331475
980 Ga0075433_10337406
981 Ga0075434_100111077
982 Ga0075434_100214118
983 Ga0075434_100323557
984 Ga0075434_100401552
985 Ga0075434_101701569
986 Ga0075429_100391043
987 Ga0075429_101435382
988 Ga0068865_100935657
989 Ga0075436_100243561
990 Ga0075436_100265979
991 Ga0075436_100413504
992 Ga0075436_100688718
993 Ga0097620_100076936
994 Ga0075435_100005977
995 Ga0075435_100062514
996 Ga0075435_100178798
997 Ga0075435_100491102
998 Ga0075435_100584830
999 Ga0099794_10032010
1000 Ga0105251_10424117
1001 Ga0105250_10132538
1002 Ga0111539_10114513
1003 Ga0111539_10344533
1004 Ga0111539_10387212
1005 Ga0111539_10981579
1006 Ga0111539_11101473
1007 Ga0105245_10037180
1008 Ga0105245_10092205
1009 Ga0105245_11093570
1010 Ga0105245_12861612
1011 Ga0105247_10004123
1012 Ga0105247_10095790
1013 Ga0105247_10117226
1014 Ga0105247_10554603
1015 Ga0105247_11748455
1016 Ga0114129_10224269
1017 Ga0114129_10344044
1018 Ga0114129_10468026
1019 Ga0105243_10024687
1020 Ga0105243_10091236
1021 Ga0105242_10066660
1022 Ga0105242_10522338
1023 Ga0105248_10154592
1024 Ga0105248_10644321
1025 Ga0105237_10331319
1026 Ga0105237_11056995
1027 Ga0105238_10098673
1028 Ga0105238_11473494
1029 Ga0105249_10034925
1030 Ga0105249_10070280
1031 Ga0099796_10276922
1032 Ga0105239_10079166
1033 Ga0105239_10263013
1034 Ga0105239_10346909
1035 Ga0105239_12690833
1036 Ga0105239_13401546
1037 Ga0105246_10035470
1038 Ga0105246_10047375
1039 Ga0105246_10109292
1040 Ga0105246_10862295
1041 Ga0157344_1004741
1042 Ga0157336_1011267
1043 Ga0157328_1002162
1044 Ga0157320_1001735
1045 Ga0157339_1018644
1046 Ga0157342_1000251
1047 Ga0157315_1008187
1048 Ga0157373_10281398
1049 Ga0157374_10033949
1050 Ga0157374_10342625
1051 Ga0157378_10182190
1052 Ga0157378_10601040
1053 Ga0163162_10284756
1054 Ga0163162_10654472
1055 Ga0163162_10698048
1056 Ga0163162_10914960
1057 Ga0163162_10920680
1058 Ga0157375_10266819
1059 Ga0157375_10415343
1060 Ga0157375_11661220
1061 Ga0157375_13403898
1062 Ga0163163_10012664
1063 Ga0163163_10154621
1064 Ga0163163_10197636
1065 Ga0157380_10150668
1066 Ga0157380_12022999
1067 Ga0157377_10002072
1068 Ga0157379_10222152
1069 Ga0157379_10731267
1070 Ga0157379_10743494
1071 Ga0157376_10090497
1072 Ga0157376_10301067
1073 Ga0163161_10478255
1074 Ga0163161_10752310
1075 Ga0213873_10036599
1076 Ga0213874_10116118
1077 Ga0213876_10031780
1078 Ga0213876_10338404
1079 Ga0207697_10032971
1080 Ga0207696_1117830
1081 Ga0207692_10694846
1082 Ga0207692_10709524
1083 Ga0207692_10918568
1084 Ga0207642_10290325
1085 Ga0207642_10905734
1086 Ga0207710_10003493
1087 Ga0207710_10061808
1088 Ga0207688_10003162
1089 Ga0207688_10226461
1090 Ga0207680_10323799
1091 Ga0207685_10012558
1092 Ga0207685_10018081
1093 Ga0207685_10034787
1094 Ga0207699_11059582
1095 Ga0207645_10027456
1096 Ga0207643_10023614
1097 Ga0207684_10229354
1098 Ga0207684_10774315
1099 Ga0207684_11419998
1100 Ga0207654_10070256
1101 Ga0207707_10079085
1102 Ga0207693_10237155
1103 Ga0207693_10273832
1104 Ga0207663_10050434
1105 Ga0207662_10001805
1106 Ga0207662_10327496
1107 Ga0207657_10084361
1108 Ga0207657_10132376
1109 Ga0207649_10227820
1110 Ga0207649_10977682
1111 Ga0207652_10018578
1112 Ga0207646_10691370
1113 Ga0207646_11150162
1114 Ga0207681_10374436
1115 Ga0207650_10048297
1116 Ga0207650_10222614
1117 Ga0207659_10272352
1118 Ga0207659_11799710
1119 Ga0207687_10202991
1120 Ga0207687_10756021
1121 Ga0207700_10043298
1122 Ga0207700_10394285
1123 Ga0207700_10523181
1124 Ga0207700_10905393
1125 Ga0207664_10037085
1126 Ga0207664_10164628
1127 Ga0207664_10378141
1128 Ga0207664_11726670
1129 Ga0207644_10170959
1130 Ga0207644_11743057
1131 Ga0207690_10175888
1132 Ga0207690_10848051
1133 Ga0207706_10008946
1134 Ga0207706_10020855
1135 Ga0207686_10062296
1136 Ga0207686_10151008
1137 Ga0207686_10253963
1138 Ga0207709_10010291
1139 Ga0207709_10158940
1140 Ga0207670_10137060
1141 Ga0207670_10952538
1142 Ga0207670_11642542
1143 Ga0207669_10006625
1144 Ga0207669_10025976
1145 Ga0207704_10048207
1146 Ga0207665_10011325
1147 Ga0207665_10133273
1148 Ga0207691_10003107
1149 Ga0207691_10189968
1150 Ga0207711_10007877
1151 Ga0207689_10004621
1152 Ga0207689_10059297
1153 Ga0207661_10414447
1154 Ga0207661_11385635
1155 Ga0207679_10239235
1156 Ga0207679_10264365
1157 Ga0207651_10105487
1158 Ga0207651_11283697
1159 Ga0207712_10142590
1160 Ga0207668_10474191
1161 Ga0207640_10089119
1162 Ga0207640_11220785
1163 Ga0207658_10039475
1164 Ga0207658_10057159
1165 Ga0207677_10009466
1166 Ga0207703_10835833
1167 Ga0207703_11267735
1168 Ga0207703_12099668
1169 Ga0207639_10775620
1170 Ga0207639_10781391
1171 Ga0207678_10012522
1172 Ga0207678_10016271
1173 Ga0207708_10000903
1174 Ga0207708_10805366
1175 Ga0207702_10486634
1176 Ga0207702_10660748
1177 Ga0207702_12031197
1178 Ga0207641_10314400
1179 Ga0207641_10378261
1180 Ga0207648_10007242
1181 Ga0207648_10030022
1182 Ga0207676_10028505
1183 Ga0207676_10304487
1184 Ga0207674_10433291
1185 Ga0207675_100005933
1186 Ga0207675_100454498
1187 Ga0207683_10012534
1188 Ga0207683_10087529
1189 Ga0207698_10013610
1190 Ga0209588_1056808
1191 Ga0207428_10177736
1192 Ga0268266_10344945
1193 Ga0268266_12006058
1194 Ga0268265_10034930
1195 Ga0268265_10564007
1196 Ga0268264_10034737
1197 Ga0268264_10350919
1198 Ga0265328_10068548
1199 Ga0265340_10011490
1200 Ga0265339_10046597
1201 Ga0265316_10784265
1202 Ga0307408_101513324
1203 Ga0307409_101944000
1204 Ga0373930_0016442
1205 Ga0373948_0079309
1206 Ga0373948_0131780
1207 Ga0373950_0005845
1208 Ga0373958_0072470
1209 Ga0373959_0007110
1210 Ga0373938_0000774
1211 Ga0373926_0037707
1212 Ga0373926_0058377
1213 Ga0373928_0009457
1214 Ga0373929_0015217
1215 Ga0373940_0043240
1216 Ga0373944_0039143
1217 Ga0373949_0011150
1218 Ga0373951_0008469
1219 Ga0373952_0002665
1220 Ga0373952_0110744
1221 Ga0373923_0133786
1222 Ga0373932_0044982
1223 Ga0373936_0024357
1224 Ga0373939_0029961
1225 Ga0373939_0040233
1226 Ga0373941_0025144
1227 Ga0373945_0034012
1228 Ga0373945_0039439
1229 Ga0373953_0334172
1230 Ga0373954_0026708
1231 Ga0373957_0026288
1232 Ga0373960_0028872
1233 Ga0373943_0007085
1234 Ga0373943_0014234
1235 Ga0373943_0025570
1236 Ga0373943_0056792
1237 Ga0373943_0418506
1238 Ga0373943_0733771
1239 Ga0373946_0001998
1240 Ga0373946_0020211
1241 Ga0373946_0074603
1242 Ga0373946_0114781
1243 Ga0373955_0120795
1244 Ga0373942_0020135
1245 Ga0373961_0007527
1246 Ga0373962_0001749
1247 Ga0373924_0199106
1248 Ga0373931_0031652
1249 Ga0373931_0798215
1250 Ga0373935_0039066
1251 Ga0373935_0039930
1252 Ga0373935_0127801
1253 Ga0373927_0004359
1254 Ga0373927_0066162
1255 Ga0373927_0185508
1256 Ga0373927_0288087
1257 Ga0373933_0332262
1258 Ga0373933_0370572
1259 Ga0373933_0444198
1260 Ga0373947_0001284
1261 Ga0373947_0010881
1262 Ga0373947_0031943
1263 Ga0373947_0060773
1264 Ga0373947_0169076
1265 Ga0373937_0040093
1266 Ga0373937_0301605
1267 Ga0373925_0005253
1268 Ga0373925_0007671
1269 Ga0373925_0071711
1270 Ga0395900_1283846
1271 Ga0436364_0108650
1272 Ga0436364_0212863
1273 Ga0436364_0629386
1274 Ga0436364_1057555
1275 Ga0436364_1148727
1276 Ga0436364_1168836
1277 Ga0436364_1496074
1278 Ga0436364_1544542
1279 Ga0395901_0361500
1280 Ga0395901_0694544
1281 Ga0242420_004389
1282 Ga0436365_0050135
1283 Ga0436365_1463846
1284 Ga0436360_0739662
1285 Ga0436361_0480030
1286 Ga0436361_0550427
1287 Ga0436361_0605963
1288 Ga0436363_0075951
1289 Ga0436363_0135958
1290 Ga0436363_0666566
1291 Ga0436362_0102214
1292 Ga0436362_0394223
1293 Ga0451789_0108192
1294 Ga0451795_0340630
1295 Ga0451798_0682408
1296 Ga0451833_0160897
1297 Ga0451853_1842165
1298 Ga0466967_0743405
1299 Ga0495592_0010790
1300 Ga0495592_0120955
1301 Ga0495603_0000416
1302 Ga0495603_0030167
1303 Ga0495603_0535938
1304 Ga0495629_0002468
1305 Ga0495629_0021071
1306 Ga0495629_0103580
1307 Ga0495629_0213138
1308 Ga0495638_0560425
1309 Ga0495641_0014527
1310 Ga0495641_0087079
1311 Ga0495651_0021958
1312 Ga0495653_0069117
1313 Ga0495580_0028144
1314 Ga0495580_0130499
1315 Ga0495580_0233318
1316 Ga0495582_0003410
1317 Ga0495582_0005148
1318 Ga0495582_0045970
1319 Ga0495582_0081710
1320 Ga0495605_0111650
1321 Ga0495605_0216137
1322 Ga0495605_0222747
1323 Ga0495639_0002783
1324 Ga0495639_0017252
1325 Ga0495639_0038487
1326 Ga0495639_0098920
1327 Ga0495662_0010361
1328 Ga0495662_0023790
1329 Ga0495662_0176584
1330 Ga0495664_0020825
1331 Ga0495664_0027417
1332 Ga0495664_0506829
1333 Ga0495584_0035794
1334 Ga0495584_0072730
1335 Ga0495585_0003446
1336 Ga0495585_0370598
1337 Ga0495594_0012273
1338 Ga0495594_0066444
1339 Ga0495594_0371359
1340 Ga0495594_0630048
1341 Ga0495607_0027729
1342 Ga0495608_0004974
1343 Ga0495608_0106726
1344 Ga0495618_0001026
1345 Ga0495618_0071015
1346 Ga0495618_0101727
1347 Ga0495618_0170806
1348 Ga0495618_0185269
1349 Ga0495620_0231178
1350 Ga0495620_0351571
1351 Ga0495630_0029501
1352 Ga0495630_0041199
1353 Ga0495630_0067767
1354 Ga0495630_0199060
1355 Ga0495630_0506300
1356 Ga0495631_0395082
1357 Ga0495637_0030422
1358 Ga0495644_0084703
1359 Ga0495644_0152495
1360 Ga0495663_0009368
1361 Ga0495666_0081508
1362 Ga0495642_0205138
1363 Ga0495652_0003570
1364 Ga0495652_0075832
1365 Ga0495665_0059852
1366 Ga0495665_0195837
1367 Ga0495665_0314036
1368 Ga0495665_0333093
1369 Ga0495640_0001631
1370 Ga0495640_0017672
1371 Ga0495587_0096070
1372 Ga0495587_0114149
1373 Ga0495587_0117953
1374 Ga0495587_0795041
1375 Ga0495598_0016272
1376 Ga0495609_0209774
1377 Ga0495621_0020825
1378 Ga0495622_0049319
1379 Ga0495633_0024190
1380 Ga0495667_0051000
1381 Ga0495667_0111401
1382 Ga0495667_0193396
1383 Ga0495656_0004050
1384 Ga0495656_0143011
1385 Ga0495656_0718129
1386 Ga0495668_0454585
1387 Ga0495634_0009355
1388 Ga0495634_0065700
1389 Ga0495634_0074977
1390 Ga0495634_0755317
1391 Ga0495611_0258414
1392 Ga0495635_0031396
1393 Ga0495635_0111609
1394 Ga0495635_0314511
1395 Ga0495659_0087294
1396 Ga0495661_0124373
1397 Ga0495588_0055074
1398 Ga0495588_0089457
1399 Ga0495588_0245545
1400 Ga0495599_0746671
1401 Ga0495623_0669578
1402 Ga0495646_0010226
1403 Ga0495646_0120913
1404 Ga0495647_0029831
1405 Ga0495647_0031656
1406 Ga0495647_0095482
1407 Ga0495658_0016929
1408 Ga0495658_0230011
1409 Ga0495669_0108597
1410 Ga0495669_0336361
1411 Ga0495613_0010882
1412 Ga0495613_0069839
1413 Ga0495613_0117029
1414 Ga0495613_0426108
1415 Ga0495624_0012119
1416 Ga0495624_0022379
1417 Ga0495624_0093163
1418 Ga0495624_0275781
1419 Ga0495624_0462873
1420 Ga0495670_0016334
1421 Ga0495670_0437634
1422 Ga0495649_0236726
1423 Ga0495589_0134550
1424 Ga0495600_0021873
1425 Ga0495581_0042417
1426 Ga0495581_0060611
1427 Ga0495581_0153898
1428 Ga0495604_0117101
1429 Ga0495604_0119198
1430 Ga0495674_0032294
1431 Ga0495674_0037259
1432 Ga0495674_0046677
1433 Ga0495674_0080871
1434 Ga0495676_0010139
1435 Ga0495676_0049167
1436 Ga0495676_0052869
1437 Ga0495680_0012109
1438 Ga0495680_0039741
1439 Ga0495680_0801548
1440 Ga0495683_0212119
1441 Ga0495675_0514928
1442 Ga0495684_0036616
1443 Ga0495684_0121283
1444 Ga0495593_0051036
1445 Ga0495593_0069421
1446 Ga0495593_0165757
1447 Ga0495602_0192817
1448 Ga0495614_0128836
1449 Ga0495614_0191648
1450 Ga0495614_0633934
1451 Ga0496100_0017306
1452 Ga0496100_0055212
1453 Ga0496100_0095940
1454 Ga0496100_0239388
1455 Ga0496100_0260629
1456 Ga0496100_0473269
1457 Ga0496101_0008621
1458 Ga0496101_0127792
1459 Ga0496101_0272667
1460 Ga0496101_0622203
1461 Ga0496102_0001884
1462 Ga0496102_0103362
1463 Ga0496102_0120622
1464 Ga0496102_0155393
1465 Ga0496102_1155484
1466 Ga0496102_1879471
1467 Ga0496103_0025215
1468 Ga0496103_0029796
1469 Ga0496104_0001262
1470 Ga0496104_0003395
1471 Ga0496104_0122057
1472 Ga0496104_0259494
1473 Ga0496105_0000320
1474 Ga0496105_0004927
1475 Ga0496105_0052339
1476 Ga0496105_0067833
1477 Ga0496105_0662838
1478 Ga0496106_0005802
1479 Ga0496106_0091446
1480 Ga0496107_0096843
1481 Ga0496107_0288907
1482 Ga0496107_0876915
1483 Ga0496108_0000724
1484 Ga0496108_0033404
1485 Ga0496108_0041605
1486 Ga0496108_0056254
1487 Ga0496108_0232554
1488 Ga0496108_0665171
1489 Ga0496109_0000865
1490 Ga0496109_0006844
1491 Ga0496109_0057195
1492 Ga0496109_0181006
1493 Ga0496109_0668771
1494 Ga0496110_0014219
1495 Ga0496110_0034457
1496 Ga0496110_0089973
1497 Ga0496110_0251451
1498 Ga0496111_0004794
1499 Ga0496111_0015932
1500 Ga0496111_0063214
1501 Ga0496112_0003413
1502 Ga0496112_0003786
1503 Ga0496112_0036546
1504 Ga0496112_0064550
1505 Ga0496113_0000157
1506 Ga0496113_0011446
1507 Ga0496113_0024047
1508 Ga0496113_0087015
1509 Ga0496114_0292976
1510 Ga0496114_1004945
1511 Ga0496115_0005569
1512 Ga0496115_0067824
1513 Ga0496115_0090874
1514 Ga0496115_0138810
1515 nmdc:mga03n38_377889_c1
1516 nmdc:mga00v17_217202_c1
1517 nmdc:mga00v17_54756_c1
1518 nmdc:mga0yw44_336373_c1
1519 nmdc:mga0yw44_358317_c1
1520 nmdc:mga0yw44_4409_c1
1521 nmdc:mga0yw44_44507_c1
1522 nmdc:mga0yw44_761233_c1
1523 nmdc:mga0yw44_8275_c1
1524 nmdc:mga0yw44_9898_c1
1525 nmdc:mga07m45_905688_c1
1526 nmdc:mga05p37_159654_c1
1527 nmdc:mga05p37_1697979_c1
1528 nmdc:mga05p37_190319_c1
1529 nmdc:mga05p37_26994_c1
1530 nmdc:mga05p37_448955_c1
1531 nmdc:mga09592_252617_c1
1532 nmdc:mga09592_884989_c1
1533 nmdc:mga06r32_102963_c1
1534 nmdc:mga06r32_139192_c1
1535 nmdc:mga06r32_290632_c1
1536 nmdc:mga08y16_269020_c1
1537 nmdc:mga08y16_793539_c1
1538 nmdc:mga0n895_1218528_c1
1539 nmdc:mga0n895_127820_c1
1540 nmdc:mga0n895_147343_c1
1541 nmdc:mga0n895_1553479_c1
1542 nmdc:mga0rr50_406303_c1
1543 nmdc:mga0rr50_931973_c1
1544 nmdc:mga08x19_139961_c1
1545 nmdc:mga08x19_563424_c1
1546 nmdc:mga08x19_890382_c1
1547 nmdc:mga0a205_114482_c1
1548 nmdc:mga0a205_277894_c1
1549 nmdc:mga0a205_897050_c1
1550 nmdc:mga0sz30_487732_c1
1551 Ga0495601_0002214
1552 Ga0495601_0026816
1553 Ga0495601_0200374
1554 Ga0495601_0924935
1555 Ga0495612_0004473
1556 Ga0495612_0161368
1557 Ga0495612_0590938
1558 Ga0495595_0005062
1559 Ga0495595_0006212
1560 Ga0495619_0005727
1561 Ga0495619_0015921
1562 Ga0495619_0017258
1563 Ga0500593_001564
1564 Ga0500614_168819

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gir-assembly1.cif.gz_D-2 crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, ethylene glycol and sulfate bound (ordered loops, space group p41212) 0.6526 39 98
4gir-assembly1.cif.gz_B crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, ethylene glycol and sulfate bound (ordered loops, space group p41212) 0.648 39 98
7wvr-assembly1.cif.gz_A crystal structure of talaromyces leycettanus jcm12802 expansin 0.6461 41 101
7eby-assembly6.cif.gz_F crystal structure of d-succinylase (dsa) from cupriavidus sp. p4-10-c 0.645 79 98
7ea4-assembly1.cif.gz_A crystal structure of l182e d-succinylase (dsa) from cupriavidus sp. p4-10-c 0.6437 79 98
ID Description Score Start End Superfamily
af_H2KZ40_3_184_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7435 82 99 2.130.10.10
af_F1QF68_152_307_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.708 84 119 2.130.10.10
af_Q9LDJ3_156_251_2.60.40.760 Mainly Beta;Sandwich;Immunoglobulin-like;Expansin, cellulose-binding-like domain 0.6829 41 98 2.60.40.760
af_A1ZAE2_137_527_2.130.10.30 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 0.6688 39 98 2.130.10.30
af_O60136_179_495_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6644 41 98 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A525IZQ4-F1-model_v4 Uncharacterized protein 0.956 23 120
AF-A0A537STM4-F1-model_v4 ABC transporter permease 0.9461 21 120
AF-A0A537STM4-F1-model_v4 ABC transporter permease 0.9193 21 120
AF-A0A1M6SZR1-F1-model_v4 Uncharacterized protein 0.9123 10 120
AF-A0A525IZQ4-F1-model_v4 Uncharacterized protein 0.9024 23 120

Map