F480592

General Info

Members Datasets Scaffolds Average Seq Length
782 327 729 94

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000007|JGI25162J39368_100000771
Length 94
Sequence MTYKLNFFKSALKEWKALAPTIKEQFKKKLAERLENPHVVSARLCGPKNNRYKIKLKSLGYRLVYQVEDQEIIVTVVAVGKREGNEAYKLAEKR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231012 Pseudomonas sp. GM33 Isolate Nodule
6 2511231018 Pseudomonas sp. GM60 Isolate Nodule
7 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
8 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
9 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
10 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
11 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
12 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
13 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
14 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
15 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
16 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
17 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
18 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
19 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
20 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
21 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
22 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
23 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
24 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
25 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
26 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
27 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
28 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
29 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
30 2784132063 Pseudomonas sp. 424 Isolate Unclassified
31 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
32 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
33 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
34 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
35 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
36 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
37 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
38 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
39 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
40 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
41 2919150387 Rahnella aceris 1817 Isolate Unclassified
42 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
43 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
44 2927143783 Rahnella sp. 2050 Isolate Unclassified
45 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
46 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
47 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
48 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
49 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
50 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
51 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
52 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
53 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
54 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
55 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
56 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
57 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
58 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
59 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
60 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
61 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
62 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
63 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
64 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
65 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
66 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
68 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
69 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
70 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
71 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
98 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
99 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
100 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
120 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
146 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
152 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
167 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
168 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
169 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
170 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
171 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
172 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
173 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
174 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
175 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
176 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
177 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
178 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
179 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
180 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
181 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
182 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
183 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
184 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
185 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
186 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
187 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
190 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
195 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
203 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
206 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
225 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
226 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
232 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
244 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
253 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
254 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
255 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
262 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
265 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
266 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
267 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
270 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
271 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
280 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
283 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
286 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
291 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
292 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
293 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
300 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
301 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
302 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
303 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
304 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
305 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
306 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
307 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
308 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
309 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
310 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
311 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
312 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
313 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
314 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
315 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
316 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
317 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
318 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
321 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
322 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
323 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
324 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
325 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
326 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
327 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.09
Metatranscriptomes 0.13
Isolates 6.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.95
Nodule 1.79
Rhizoplane 2.94
Rhizosphere 70.59
Stem 0
Stem Tuber 0.13
Unclassified 15.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_878 2124908027 Bacteria 17504
2 SwRhRL2b_contig_942673 2162886007 Bacteria 2901
3 MRS1b_contig_1512768 2162886011 Bacteria 979
4 JGI24740J21852_10031135 3300001979 Bacteria 1725
5 JGI24737J22298_10033282 3300001990 Unclassified 1602
6 JGI24738J21930_10024949 3300002075 Bacteria 1229
7 JGI25162J39368_1000007 3300002737 Bacteria 403947
8 JGI25163J39215_1000040 3300002771 Bacteria 58616
9 JGI25164J39214_1000016 3300002772 Bacteria 202035
10 Ga0055538_1000006 3300003751 Bacteria 403947
11 Ga0055539_1000010 3300003752 Bacteria 403947
12 Ga0055533_1000013 3300003756 Bacteria 403947
13 Ga0055525_1000015 3300003759 Bacteria 403947
14 Ga0055536_1000145 3300003781 Bacteria 60430
15 Ga0055536_1000200 3300003781 Bacteria 48822
16 Ga0055534_1049140 3300003784 Bacteria 603
17 Ga0055530_10000128 3300003791 Bacteria 66096
18 Ga0055530_10000163 3300003791 Bacteria 60448
19 Ga0055540_1000156 3300003792 Bacteria 67320
20 Ga0055540_1001073 3300003792 Bacteria 17394
21 Ga0055540_1088347 3300003792 Bacteria 587
22 Ga0055531_10000425 3300003794 Bacteria 40017
23 Ga0055541_1000007 3300003841 Bacteria 403947
24 Ga0065714_10000431 3300005288 Bacteria 4997
25 Ga0065714_10005818 3300005288 Bacteria 3631
26 Ga0065714_10102197 3300005288 Bacteria 1627
27 Ga0065714_10120917 3300005288 Bacteria 1350
28 Ga0065714_10172880 3300005288 Bacteria 983
29 Ga0065714_10218135 3300005288 Bacteria 848
30 Ga0065714_10330062 3300005288 Bacteria 658
31 Ga0065704_10000271 3300005289 Bacteria 42831
32 Ga0065704_10156563 3300005289 Bacteria 1386
33 Ga0065704_10161970 3300005289 Bacteria 1348
34 Ga0065704_10291037 3300005289 Bacteria 903
35 Ga0065704_10315890 3300005289 Bacteria 861
36 Ga0065712_10182057 3300005290 Bacteria 1177
37 Ga0065712_10652761 3300005290 Bacteria 560
38 Ga0065715_10139364 3300005293 Bacteria 1875
39 Ga0065707_10127222 3300005295 Bacteria 1978
40 Ga0070680_102009700 3300005336 Bacteria 501
41 Ga0070659_100315936 3300005366 Bacteria 1305
42 Ga0070662_100027158 3300005457 Bacteria 3970
43 Ga0070662_100330068 3300005457 Bacteria 1246
44 Ga0068853_100053947 3300005539 Bacteria 3463
45 Ga0068855_100511680 3300005563 Bacteria 1303
46 Ga0068857_100029738 3300005577 Bacteria 4821
47 Ga0068857_100228009 3300005577 Bacteria 1703
48 Ga0068854_100049056 3300005578 Bacteria 3014
49 Ga0068852_101526137 3300005616 Unclassified 690
50 Ga0075363_100255511 3300006048 Bacteria 1010
51 Ga0075364_10095803 3300006051 Bacteria 1973
52 Ga0075364_10267326 3300006051 Bacteria 1163
53 Ga0075364_10715459 3300006051 Bacteria 683
54 Ga0075364_10741135 3300006051 Bacteria 670
55 Ga0075364_11019993 3300006051 Bacteria 562
56 Ga0075364_11070689 3300006051 Bacteria 548
57 Ga0075432_10097649 3300006058 Bacteria 1082
58 Ga0075432_10141775 3300006058 Bacteria 917
59 Ga0075432_10206485 3300006058 Bacteria 780
60 Ga0075432_10258756 3300006058 Bacteria 709
61 Ga0075432_10395522 3300006058 Bacteria 595
62 Ga0075432_10407184 3300006058 Bacteria 588
63 Ga0075432_10560242 3300006058 Bacteria 517
64 Ga0075362_10047340 3300006177 Bacteria 1915
65 Ga0075362_10243354 3300006177 Bacteria 884
66 Ga0075369_10126209 3300006186 Bacteria 1160
67 Ga0075370_10416480 3300006353 Bacteria 807
68 Ga0075436_100223473 3300006914 Bacteria 1336
69 Ga0075436_100455893 3300006914 Bacteria 931
70 Ga0075436_100474883 3300006914 Bacteria 913
71 Ga0079104_1000290 3300006946 Bacteria 63769
72 Ga0079104_1003915 3300006946 Bacteria 6652
73 Ga0079104_1009332 3300006946 Bacteria 3332
74 Ga0079104_1013375 3300006946 Bacteria 2530
75 Ga0105251_10008384 3300009011 Bacteria 6230
76 Ga0105251_10074727 3300009011 Bacteria 1574
77 Ga0105251_10148544 3300009011 Bacteria 1059
78 Ga0105251_10227935 3300009011 Bacteria 839
79 Ga0105251_10255529 3300009011 Bacteria 790
80 Ga0105244_10000026 3300009036 Bacteria 216056
81 Ga0105244_10019547 3300009036 Bacteria 3778
82 Ga0105244_10123703 3300009036 Bacteria 1251
83 Ga0105244_10143032 3300009036 Bacteria 1149
84 Ga0105244_10177061 3300009036 Bacteria 1013
85 Ga0105244_10192564 3300009036 Bacteria 964
86 Ga0105244_10205776 3300009036 Bacteria 927
87 Ga0105244_10220761 3300009036 Bacteria 889
88 Ga0105250_10001116 3300009092 Bacteria 15151
89 Ga0105250_10004167 3300009092 Bacteria 6704
90 Ga0105250_10099421 3300009092 Bacteria 1187
91 Ga0105250_10142365 3300009092 Bacteria 994
92 Ga0105250_10160908 3300009092 Bacteria 937
93 Ga0105240_12485856 3300009093 Bacteria 536
94 Ga0105243_10013201 3300009148 Bacteria 6245
95 Ga0105243_10124879 3300009148 Bacteria 2175
96 Ga0105243_11055168 3300009148 Bacteria 818
97 Ga0105241_10110315 3300009174 Bacteria 2201
98 Ga0105242_10015438 3300009176 Bacteria 5931
99 Ga0105242_11491208 3300009176 Bacteria 707
100 Ga0105248_10102693 3300009177 Bacteria 3222
101 Ga0105238_10311764 3300009551 Unclassified 1558
102 Ga0105238_10337113 3300009551 Bacteria 1495
103 Ga0105239_11041604 3300010375 Bacteria 941
104 Ga0157336_1001858 3300012477 Bacteria 1140
105 Ga0157345_1001192 3300012498 Bacteria 1858
106 Ga0157347_1011896 3300012502 Bacteria 931
107 Ga0157339_1013620 3300012505 Bacteria 780
108 Ga0157373_10016444 3300013100 Bacteria 5396
109 Ga0157373_10165428 3300013100 Bacteria 1557
110 Ga0157373_10479049 3300013100 Bacteria 898
111 Ga0157373_10498403 3300013100 Bacteria 880
112 Ga0157371_10000044 3300013102 Bacteria 194689
113 Ga0157371_10001383 3300013102 Bacteria 25425
114 Ga0157371_10010204 3300013102 Bacteria 7335
115 Ga0157371_10051292 3300013102 Bacteria 2932
116 Ga0157371_10067811 3300013102 Bacteria 2525
117 Ga0157371_10267965 3300013102 Bacteria 1232
118 Ga0157371_10432678 3300013102 Bacteria 966
119 Ga0157371_11318332 3300013102 Bacteria 559
120 Ga0157370_10021828 3300013104 Bacteria 6377
121 Ga0157370_10085874 3300013104 Bacteria 2956
122 Ga0157370_10210362 3300013104 Bacteria 1803
123 Ga0157370_10293730 3300013104 Bacteria 1501
124 Ga0157370_10636892 3300013104 Bacteria 975
125 Ga0157370_11737983 3300013104 Bacteria 560
126 Ga0157369_10007905 3300013105 Bacteria 12228
127 Ga0157369_10078453 3300013105 Bacteria 3538
128 Ga0157369_10397493 3300013105 Bacteria 1430
129 Ga0163162_10010387 3300013306 Bacteria 9049
130 Ga0163162_10582585 3300013306 Bacteria 1246
131 Ga0163162_11280742 3300013306 Bacteria 833
132 Ga0163162_11375294 3300013306 Bacteria 803
133 Ga0163162_11583479 3300013306 Bacteria 747
134 Ga0157372_10000453 3300013307 Bacteria 45046
135 Ga0157372_10025185 3300013307 Bacteria 6467
136 Ga0157375_10666823 3300013308 Bacteria 1195
137 Ga0157375_10810817 3300013308 Bacteria 1084
138 Ga0182008_10000238 3300014497 Bacteria 42638
139 Ga0182008_10016432 3300014497 Bacteria 3845
140 Ga0182008_10032643 3300014497 Bacteria 2614
141 Ga0182008_10130828 3300014497 Bacteria 1251
142 Ga0182008_10144922 3300014497 Bacteria 1189
143 Ga0182006_1013786 3300015261 Bacteria 3497
144 Ga0182006_1073962 3300015261 Bacteria 1257
145 Ga0182007_10072698 3300015262 Bacteria 1126
146 Ga0182007_10240575 3300015262 Bacteria 646
147 Ga0182005_1041845 3300015265 Bacteria 1246
148 Ga0182005_1070302 3300015265 Bacteria 961
149 Ga0182005_1086315 3300015265 Bacteria 870
150 Ga0163161_10175584 3300017792 Bacteria 1640
151 Ga0163161_10327370 3300017792 Bacteria 1213
152 Ga0163161_10489217 3300017792 Bacteria 1000
153 Ga0163161_10510030 3300017792 Bacteria 981
154 Ga0163161_10701669 3300017792 Bacteria 842
155 Ga0163161_10702948 3300017792 Bacteria 842
156 Ga0163161_11476642 3300017792 Bacteria 596
157 Ga0163161_11730898 3300017792 Bacteria 554
158 Ga0209760_100034 3300025207 Bacteria 135933
159 Ga0209784_100022 3300025224 Bacteria 403999
160 Ga0209566_100021 3300025225 Bacteria 403999
161 Ga0209674_100038 3300025226 Bacteria 403999
162 Ga0209563_100042 3300025230 Bacteria 403999
163 Ga0207427_100027 3300025231 Bacteria 403999
164 Ga0209437_100049 3300025233 Bacteria 403999
165 Ga0209677_100025 3300025253 Bacteria 403999
166 Ga0209233_1003281 3300025261 Bacteria 5737
167 Ga0209130_1031380 3300025284 Bacteria 1090
168 Ga0209675_1010416 3300025291 Bacteria 3177
169 Ga0209676_1000020 3300025292 Bacteria 617256
170 Ga0209676_1000032 3300025292 Bacteria 469558
171 Ga0209676_1000408 3300025292 Bacteria 77177
172 Ga0209676_1006111 3300025292 Bacteria 6045
173 Ga0209050_1000025 3300025298 Bacteria 528225
174 Ga0209050_1000099 3300025298 Bacteria 232176
175 Ga0209050_1001082 3300025298 Bacteria 33254
176 Ga0209051_1000026 3300025303 Bacteria 413311
177 Ga0209051_1000039 3300025303 Bacteria 319632
178 Ga0209051_1000047 3300025303 Bacteria 293227
179 Ga0209051_1024322 3300025303 Bacteria 2493
180 Ga0209257_1000034 3300025304 Bacteria 662719
181 Ga0209257_1111975 3300025304 Bacteria 650
182 Ga0207696_1000002 3300025711 Bacteria 1098043
183 Ga0207696_1000642 3300025711 Bacteria 25299
184 Ga0207696_1020208 3300025711 Bacteria 2153
185 Ga0207696_1053664 3300025711 Bacteria 1147
186 Ga0207655_1000057 3300025728 Bacteria 273598
187 Ga0207655_1000560 3300025728 Bacteria 46369
188 Ga0207655_1012867 3300025728 Bacteria 4847
189 Ga0207655_1018585 3300025728 Bacteria 3678
190 Ga0207655_1087344 3300025728 Bacteria 1107
191 Ga0207655_1088890 3300025728 Bacteria 1092
192 Ga0207655_1098508 3300025728 Bacteria 1012
193 Ga0207655_1117921 3300025728 Bacteria 885
194 Ga0207655_1122063 3300025728 Bacteria 862
195 Ga0207655_1200550 3300025728 Bacteria 596
196 Ga0207713_1000573 3300025735 Bacteria 36512
197 Ga0207713_1004368 3300025735 Bacteria 9184
198 Ga0207713_1006126 3300025735 Bacteria 7392
199 Ga0207713_1006127 3300025735 Bacteria 7392
200 Ga0207713_1008055 3300025735 Bacteria 6119
201 Ga0207713_1020172 3300025735 Bacteria 3238
202 Ga0207713_1031210 3300025735 Bacteria 2359
203 Ga0207713_1069000 3300025735 Bacteria 1311
204 Ga0207647_10175276 3300025904 Bacteria 1248
205 Ga0207654_10332309 3300025911 Bacteria 1042
206 Ga0207694_10104047 3300025924 Bacteria 2252
207 Ga0207650_10000185 3300025925 Bacteria 72385
208 Ga0207644_10548985 3300025931 Bacteria 956
209 Ga0207690_10261516 3300025932 Bacteria 1341
210 Ga0207706_10176427 3300025933 Bacteria 1877
211 Ga0207706_10399000 3300025933 Bacteria 1192
212 Ga0207686_10571208 3300025934 Bacteria 886
213 Ga0207709_10940985 3300025935 Bacteria 704
214 Ga0207709_11138580 3300025935 Bacteria 642
215 Ga0207668_10773876 3300025972 Bacteria 848
216 Ga0207640_10040953 3300025981 Bacteria 2943
217 Ga0207639_10017627 3300026041 Bacteria 5063
218 Ga0207674_10000029 3300026116 Bacteria 145730
219 Ga0207674_10025912 3300026116 Bacteria 6241
220 Ga0207674_10233715 3300026116 Bacteria 1786
221 Ga0207698_10178607 3300026142 Unclassified 1878
222 Ga0209281_1000026 3300027111 Bacteria 465877
223 Ga0209281_1000614 3300027111 Bacteria 40136
224 Ga0209281_1003496 3300027111 Bacteria 5164
225 Ga0209281_1005509 3300027111 Bacteria 3499
226 Ga0209371_1000014 3300027312 Bacteria 661118
227 Ga0209983_1026045 3300027665 Bacteria 1236
228 Ga0209974_10126046 3300027876 Bacteria 910
229 Ga0207428_10069990 3300027907 Bacteria 2759
230 Ga0207428_10407641 3300027907 Bacteria 995
231 Ga0207428_10454500 3300027907 Bacteria 933
232 Ga0207428_10505325 3300027907 Bacteria 878
233 Ga0207428_10815099 3300027907 Bacteria 663
234 Ga0268266_10106882 3300028379 Bacteria 2474
235 Ga0268266_10254151 3300028379 Bacteria 1626
236 Ga0268256_1000021 3300030500 Bacteria 542735
237 Ga0268256_1010279 3300030500 Bacteria 3043
238 Ga0316178_1142514 3300030735 Bacteria 13262
239 Ga0307408_100009196 3300031548 Bacteria 6515
240 Ga0307408_100273538 3300031548 Unclassified 1403
241 Ga0307408_100677396 3300031548 Bacteria 925
242 Ga0316579_10212966 3300031691 Bacteria 934
243 Ga0316579_10521807 3300031691 Unclassified 575
244 Ga0307405_10108814 3300031731 Bacteria 1873
245 Ga0307405_10182115 3300031731 Bacteria 1509
246 Ga0307405_10310489 3300031731 Bacteria 1200
247 Ga0307405_10331974 3300031731 Bacteria 1166
248 Ga0307405_10828258 3300031731 Unclassified 777
249 Ga0307410_10308877 3300031852 Bacteria 1250
250 Ga0307406_10267357 3300031901 Bacteria 1297
251 Ga0307412_10164900 3300031911 Bacteria 1651
252 Ga0307412_10213799 3300031911 Bacteria 1473
253 Ga0307412_10319033 3300031911 Bacteria 1235
254 Ga0307416_100281173 3300032002 Bacteria 1641
255 Ga0307416_102284124 3300032002 Bacteria 641
256 Ga0307411_10114545 3300032005 Bacteria 1937
257 Ga0307411_10347662 3300032005 Bacteria 1207
258 Ga0307415_101443879 3300032126 Bacteria 656
259 Ga0395899_0217634 3300037312 Bacteria 1324
260 Ga0395900_0002169 3300037418 Bacteria 21931
261 Ga0395900_0071831 3300037418 Bacteria 3558
262 Ga0395898_0072438 3300037466 Bacteria 3329
263 Ga0436361_1058773 3300039447 Bacteria 5025
264 Ga0439438_001153 3300041405 Bacteria 11736
265 Ga0439438_033200 3300041405 Bacteria 1364
266 Ga0439447_000379 3300041407 Bacteria 16202
267 Ga0439447_000776 3300041407 Bacteria 11711
268 Ga0439447_003341 3300041407 Bacteria 5707
269 Ga0439447_035093 3300041407 Bacteria 1244
270 Ga0439466_0000176 3300041411 Bacteria 25636
271 Ga0439466_0008485 3300041411 Bacteria 3872
272 Ga0439466_0020842 3300041411 Bacteria 2331
273 Ga0439466_0030233 3300041411 Bacteria 1859
274 Ga0439466_0064278 3300041411 Bacteria 1176
275 Ga0439466_0130211 3300041411 Bacteria 774
276 Ga0451807_0901309 3300041486 Bacteria 759
277 Ga0451807_0911490 3300041486 Bacteria 662
278 Ga0439432_002585 3300042006 Bacteria 6813
279 Ga0439432_023994 3300042006 Bacteria 2005
280 Ga0439432_058951 3300042006 Bacteria 1186
281 Ga0439432_093155 3300042006 Bacteria 905
282 Ga0439451_022878 3300042009 Bacteria 1259
283 Ga0439451_059161 3300042009 Bacteria 766
284 Ga0439452_000005 3300042010 Bacteria 646919
285 Ga0439452_000229 3300042010 Bacteria 39029
286 Ga0439452_048552 3300042010 Bacteria 978
287 Ga0439456_001064 3300042013 Bacteria 5468
288 Ga0439456_001435 3300042013 Bacteria 4789
289 Ga0439456_002068 3300042013 Bacteria 4040
290 Ga0439456_005338 3300042013 Bacteria 2604
291 Ga0439456_007928 3300042013 Bacteria 2188
292 Ga0439456_008553 3300042013 Bacteria 2114
293 Ga0439456_014786 3300042013 Bacteria 1627
294 Ga0439463_000558 3300042016 Bacteria 10418
295 Ga0439463_001147 3300042016 Bacteria 7098
296 Ga0439463_125649 3300042016 Bacteria 663
297 Ga0450911_000290 3300042115 Bacteria 18460
298 Ga0450911_000924 3300042115 Bacteria 7774
299 Ga0450911_006040 3300042115 Bacteria 1828
300 Ga0450919_004043 3300042121 Bacteria 1802
301 Ga0450920_002881 3300042122 Bacteria 2958
302 Ga0450922_000391 3300042124 Bacteria 4703
303 Ga0450923_011486 3300042125 Bacteria 1592
304 Ga0450900_016097 3300042136 Bacteria 1010
305 Ga0450902_001758 3300042137 Bacteria 2990
306 Ga0450902_032425 3300042137 Bacteria 881
307 Ga0450902_044893 3300042137 Bacteria 754
308 Ga0450903_000904 3300042138 Bacteria 5702
309 Ga0450903_025431 3300042138 Bacteria 905
310 Ga0450904_004135 3300042139 Bacteria 1521
311 Ga0450905_024695 3300042142 Bacteria 901
312 Ga0450906_001755 3300042145 Bacteria 4746
313 Ga0450906_003379 3300042145 Bacteria 3434
314 Ga0450907_000020 3300042146 Bacteria 75915
315 Ga0450907_000681 3300042146 Bacteria 8821
316 Ga0450910_005521 3300042147 Bacteria 1726
317 Ga0450910_022646 3300042147 Bacteria 957
318 Ga0439446_0064545 3300042156 Bacteria 1111
319 Ga0450908_087622 3300042184 Bacteria 562
320 Ga0450909_000635 3300042185 Bacteria 4635
321 Ga0450909_012929 3300042185 Bacteria 1225
322 Ga0439434_0000018 3300042435 Bacteria 42785
323 Ga0439464_0293630 3300042439 Bacteria 530
324 Ga0439460_0000545 3300042461 Bacteria 8252
325 Ga0439460_0002133 3300042461 Bacteria 4744
326 Ga0450918_021625 3300042531 Bacteria 1123
327 Ga0450893_0010920 3300042532 Bacteria 1496
328 Ga0451577_0000239 3300042876 Bacteria 108628
329 Ga0451577_0348022 3300042876 Unclassified 1344
330 Ga0439440_0000422 3300042993 Bacteria 7062
331 Ga0466969_0006571 3300044656 Bacteria 6180
332 Ga0453683_0640014 3300044673 Bacteria 695
333 Ga0453683_0952108 3300044673 Bacteria 569
334 Ga0453684_0001090 3300044712 Bacteria 85790
335 Ga0453684_0021005 3300044712 Bacteria 9789
336 Ga0453684_0190791 3300044712 Bacteria 2397
337 Ga0453684_0212099 3300044712 Bacteria 2250
338 Ga0451576_1319323 3300045051 Unclassified 752
339 Ga0451576_1654857 3300045051 Unclassified 663
340 Ga0495617_000608 3300046452 Bacteria 17996
341 Ga0495617_006994 3300046452 Bacteria 3933
342 Ga0495617_013490 3300046452 Bacteria 2781
343 Ga0495617_013625 3300046452 Bacteria 2766
344 Ga0495617_119463 3300046452 Bacteria 849
345 Ga0495627_001586 3300046453 Bacteria 12824
346 Ga0495627_011878 3300046453 Bacteria 3107
347 Ga0495627_015823 3300046453 Bacteria 2598
348 Ga0495627_088122 3300046453 Bacteria 894
349 Ga0495603_0001348 3300046455 Bacteria 14264
350 Ga0495603_0030679 3300046455 Bacteria 3237
351 Ga0495603_0693215 3300046455 Bacteria 582
352 Ga0495590_0000615 3300046457 Bacteria 16615
353 Ga0495590_0086300 3300046457 Bacteria 1108
354 Ga0495591_002305 3300046458 Bacteria 10797
355 Ga0495591_007492 3300046458 Bacteria 4633
356 Ga0495591_013020 3300046458 Bacteria 3065
357 Ga0495638_0002132 3300046460 Bacteria 16635
358 Ga0495638_0008667 3300046460 Bacteria 7195
359 Ga0495653_0570250 3300046463 Bacteria 698
360 Ga0495650_0000039 3300046471 Bacteria 375501
361 Ga0495650_0002587 3300046471 Bacteria 14248
362 Ga0495650_0106470 3300046471 Bacteria 1046
363 Ga0495605_0000530 3300046474 Bacteria 32164
364 Ga0495605_0000758 3300046474 Bacteria 23640
365 Ga0495605_0010780 3300046474 Bacteria 5108
366 Ga0495605_0226505 3300046474 Bacteria 806
367 Ga0495639_0039981 3300046475 Bacteria 2109
368 Ga0495639_0070435 3300046475 Bacteria 1615
369 Ga0495639_0090588 3300046475 Bacteria 1434
370 Ga0495639_0333060 3300046475 Bacteria 760
371 Ga0495584_0000787 3300046491 Bacteria 20916
372 Ga0495584_0002815 3300046491 Bacteria 9708
373 Ga0495584_0028177 3300046491 Bacteria 2845
374 Ga0495584_0115361 3300046491 Bacteria 1359
375 Ga0495584_0347430 3300046491 Bacteria 753
376 Ga0495585_0016673 3300046492 Bacteria 4255
377 Ga0495585_0117335 3300046492 Bacteria 1410
378 Ga0495585_0226186 3300046492 Bacteria 942
379 Ga0495585_0274479 3300046492 Bacteria 835
380 Ga0495594_0016477 3300046499 Bacteria 3893
381 Ga0495596_0022058 3300046500 Bacteria 2594
382 Ga0495607_0010999 3300046501 Bacteria 6048
383 Ga0495607_0040897 3300046501 Bacteria 2756
384 Ga0495607_0147481 3300046501 Bacteria 1207
385 Ga0495607_0193517 3300046501 Bacteria 1011
386 Ga0495607_0520267 3300046501 Bacteria 525
387 Ga0495583_0001511 3300046506 Bacteria 23143
388 Ga0495583_0040852 3300046506 Bacteria 2176
389 Ga0495583_0087514 3300046506 Bacteria 1345
390 Ga0495606_0006414 3300046507 Bacteria 10855
391 Ga0495606_0009270 3300046507 Bacteria 8352
392 Ga0495606_0091273 3300046507 Bacteria 1873
393 Ga0495606_0156493 3300046507 Bacteria 1333
394 Ga0495610_0003477 3300046512 Bacteria 12259
395 Ga0495610_0008115 3300046512 Bacteria 6862
396 Ga0495610_0009185 3300046512 Bacteria 6275
397 Ga0495610_0023023 3300046512 Bacteria 3393
398 Ga0495610_0035494 3300046512 Bacteria 2559
399 Ga0495610_0060740 3300046512 Bacteria 1798
400 Ga0495610_0101103 3300046512 Bacteria 1291
401 Ga0495616_0001725 3300046513 Bacteria 14898
402 Ga0495616_0006195 3300046513 Bacteria 7277
403 Ga0495616_0107817 3300046513 Bacteria 1297
404 Ga0495620_0002386 3300046515 Bacteria 10888
405 Ga0495620_0002590 3300046515 Bacteria 10459
406 Ga0495620_0257161 3300046515 Bacteria 665
407 Ga0495628_0211855 3300046516 Bacteria 1457
408 Ga0495630_0000091 3300046517 Bacteria 71198
409 Ga0495630_0680147 3300046517 Bacteria 787
410 Ga0495631_0001404 3300046518 Bacteria 14638
411 Ga0495631_0019053 3300046518 Bacteria 3223
412 Ga0495631_0398065 3300046518 Bacteria 586
413 Ga0495632_0000312 3300046519 Bacteria 47020
414 Ga0495632_0044876 3300046519 Bacteria 2204
415 Ga0495632_0069013 3300046519 Bacteria 1702
416 Ga0495632_0072070 3300046519 Bacteria 1658
417 Ga0495632_0198472 3300046519 Bacteria 914
418 Ga0495637_0001838 3300046520 Bacteria 12150
419 Ga0495637_0007664 3300046520 Bacteria 5340
420 Ga0495637_0009153 3300046520 Bacteria 4836
421 Ga0495637_0017794 3300046520 Bacteria 3303
422 Ga0495637_0024007 3300046520 Bacteria 2760
423 Ga0495643_0003399 3300046522 Bacteria 11696
424 Ga0495643_0084848 3300046522 Bacteria 1643
425 Ga0495644_0021319 3300046523 Bacteria 2472
426 Ga0495644_0441361 3300046523 Bacteria 517
427 Ga0495648_0002010 3300046524 Bacteria 19274
428 Ga0495648_0010271 3300046524 Bacteria 7148
429 Ga0495648_0025513 3300046524 Bacteria 3999
430 Ga0495648_0033204 3300046524 Bacteria 3374
431 Ga0495648_0086748 3300046524 Bacteria 1764
432 Ga0495648_0483567 3300046524 Bacteria 534
433 Ga0495666_0002069 3300046526 Bacteria 9937
434 Ga0495666_0004705 3300046526 Bacteria 6902
435 Ga0495666_0203230 3300046526 Bacteria 910
436 Ga0495666_0574002 3300046526 Bacteria 502
437 Ga0495642_0000231 3300046528 Bacteria 31949
438 Ga0495642_0007466 3300046528 Bacteria 4188
439 Ga0495654_0002895 3300046530 Bacteria 10758
440 Ga0495654_0004614 3300046530 Bacteria 8133
441 Ga0495654_0007837 3300046530 Bacteria 5938
442 Ga0495654_0011817 3300046530 Bacteria 4712
443 Ga0495654_0015690 3300046530 Bacteria 4020
444 Ga0495654_0017619 3300046530 Bacteria 3750
445 Ga0495654_0433818 3300046530 Bacteria 518
446 Ga0495665_0131052 3300046531 Bacteria 1312
447 Ga0495598_0044642 3300046537 Bacteria 1310
448 Ga0495609_0004699 3300046538 Bacteria 7392
449 Ga0495609_0007646 3300046538 Bacteria 5370
450 Ga0495609_0158782 3300046538 Bacteria 959
451 Ga0495609_0160730 3300046538 Bacteria 952
452 Ga0495609_0200777 3300046538 Bacteria 833
453 Ga0495609_0231846 3300046538 Bacteria 764
454 Ga0495597_0016354 3300046542 Bacteria 3502
455 Ga0495597_0050948 3300046542 Bacteria 1826
456 Ga0495597_0099047 3300046542 Bacteria 1231
457 Ga0495597_0187926 3300046542 Bacteria 832
458 Ga0495622_0010557 3300046557 Bacteria 4264
459 Ga0495622_0092064 3300046557 Bacteria 1392
460 Ga0495622_0120410 3300046557 Bacteria 1198
461 Ga0495622_0402770 3300046557 Bacteria 589
462 Ga0495633_0007110 3300046558 Bacteria 6504
463 Ga0495633_0077315 3300046558 Bacteria 1550
464 Ga0495633_0087462 3300046558 Bacteria 1449
465 Ga0495668_0010717 3300046616 Bacteria 5536
466 Ga0495634_0001289 3300046642 Bacteria 22945
467 Ga0495611_0015723 3300046648 Bacteria 3233
468 Ga0495625_0005424 3300046660 Bacteria 11641
469 Ga0495625_0009016 3300046660 Bacteria 8425
470 Ga0495625_0011860 3300046660 Bacteria 7078
471 Ga0495625_0041834 3300046660 Bacteria 3333
472 Ga0495659_0089481 3300046664 Bacteria 1180
473 Ga0495659_0123236 3300046664 Bacteria 1022
474 Ga0495661_0011981 3300046665 Bacteria 5868
475 Ga0495661_0044203 3300046665 Bacteria 2732
476 Ga0495661_0053604 3300046665 Bacteria 2424
477 Ga0495588_0009384 3300046674 Bacteria 4520
478 Ga0495588_0047982 3300046674 Bacteria 2193
479 Ga0495588_0112479 3300046674 Bacteria 1434
480 Ga0495623_0002460 3300046679 Bacteria 12290
481 Ga0495623_0007120 3300046679 Bacteria 7264
482 Ga0495646_0052317 3300046680 Bacteria 2467
483 Ga0495669_0083221 3300046684 Bacteria 1470
484 Ga0495669_0343256 3300046684 Bacteria 722
485 Ga0495613_0147858 3300046689 Bacteria 1676
486 Ga0495624_0135552 3300046690 Bacteria 1509
487 Ga0495670_0002161 3300046691 Bacteria 9721
488 Ga0495670_0009471 3300046691 Bacteria 4787
489 Ga0495670_0109700 3300046691 Bacteria 1427
490 Ga0495670_0124583 3300046691 Bacteria 1340
491 Ga0495670_0356741 3300046691 Bacteria 787
492 Ga0495670_0752563 3300046691 Bacteria 531
493 Ga0495670_0770526 3300046691 Unclassified 525
494 Ga0495671_0031930 3300046692 Bacteria 2690
495 Ga0495671_0077331 3300046692 Bacteria 1631
496 Ga0495671_0127779 3300046692 Bacteria 1239
497 Ga0495671_0166423 3300046692 Bacteria 1072
498 Ga0495649_0000095 3300046694 Bacteria 76587
499 Ga0495649_0024772 3300046694 Bacteria 3345
500 Ga0495649_0026855 3300046694 Bacteria 3197
501 Ga0495649_0038244 3300046694 Bacteria 2633
502 Ga0495649_0207266 3300046694 Bacteria 1016
503 Ga0495649_0236518 3300046694 Bacteria 941
504 Ga0495649_0551568 3300046694 Bacteria 570
505 Ga0495589_0000199 3300046794 Bacteria 52067
506 Ga0495589_0009466 3300046794 Bacteria 5067
507 Ga0495589_0011985 3300046794 Bacteria 4494
508 Ga0495589_0091139 3300046794 Bacteria 1480
509 Ga0495589_0144244 3300046794 Bacteria 1139
510 Ga0495660_0000023 3300046810 Bacteria 272605
511 Ga0495660_0012349 3300046810 Bacteria 4956
512 Ga0495660_0014970 3300046810 Bacteria 4484
513 Ga0495660_0016611 3300046810 Bacteria 4243
514 Ga0495660_0030975 3300046810 Bacteria 3010
515 Ga0495660_0065501 3300046810 Bacteria 1939
516 Ga0495660_0078488 3300046810 Bacteria 1735
517 Ga0495660_0124607 3300046810 Bacteria 1299
518 Ga0495660_0273895 3300046810 Bacteria 774
519 Ga0495660_0309822 3300046810 Bacteria 712
520 Ga0495604_0020713 3300047317 Bacteria 5250
521 Ga0495636_0087388 3300047318 Bacteria 1349
522 Ga0495674_0030209 3300047319 Bacteria 4929
523 Ga0495674_1434889 3300047319 Bacteria 513
524 Ga0495672_0001614 3300047320 Bacteria 22014
525 Ga0495672_0002964 3300047320 Bacteria 14946
526 Ga0495672_0003304 3300047320 Bacteria 13933
527 Ga0495672_0014441 3300047320 Bacteria 5407
528 Ga0495672_0124754 3300047320 Bacteria 1363
529 Ga0495672_0136669 3300047320 Bacteria 1284
530 Ga0495672_0477763 3300047320 Bacteria 557
531 Ga0495680_0014308 3300047322 Bacteria 6879
532 Ga0495680_0016640 3300047322 Bacteria 6310
533 Ga0495680_0159865 3300047322 Bacteria 1636
534 Ga0495683_0000604 3300047323 Bacteria 26955
535 Ga0495683_0033580 3300047323 Bacteria 2610
536 Ga0495683_0082720 3300047323 Bacteria 1564
537 Ga0495687_057410 3300047443 Bacteria 1619
538 Ga0495687_173789 3300047443 Bacteria 710
539 Ga0495675_0086816 3300047444 Bacteria 1966
540 Ga0495679_001784 3300047446 Bacteria 11765
541 Ga0495685_003052 3300047447 Bacteria 5307
542 Ga0495685_124053 3300047447 Bacteria 847
543 Ga0495673_0000957 3300047469 Bacteria 26116
544 Ga0495673_0003450 3300047469 Bacteria 10405
545 Ga0495673_0005239 3300047469 Bacteria 7877
546 Ga0495673_0027758 3300047469 Bacteria 2689
547 Ga0495673_0073814 3300047469 Bacteria 1428
548 Ga0495681_0001896 3300047470 Bacteria 15349
549 Ga0495681_0009188 3300047470 Bacteria 6113
550 Ga0495681_0016792 3300047470 Bacteria 4087
551 Ga0495681_0027486 3300047470 Bacteria 2941
552 Ga0495681_0350152 3300047470 Bacteria 562
553 Ga0495593_0000903 3300047673 Bacteria 17237
554 Ga0495593_0104978 3300047673 Bacteria 1446
555 Ga0495614_0077121 3300048089 Bacteria 1441
556 Ga0495615_0002720 3300048090 Bacteria 2868
557 Ga0495626_0000931 3300048091 Bacteria 25617
558 Ga0495626_0001133 3300048091 Bacteria 22281
559 Ga0495626_0002819 3300048091 Bacteria 11623
560 Ga0495626_0058837 3300048091 Bacteria 1754
561 Ga0495626_0126736 3300048091 Bacteria 1093
562 Ga0495626_0187227 3300048091 Bacteria 855
563 Ga0495626_0369595 3300048091 Bacteria 557
564 Ga0496102_0001223 3300048905 Bacteria 23305
565 Ga0496102_0073644 3300048905 Bacteria 3138
566 Ga0496103_0000823 3300048906 Bacteria 22758
567 Ga0496104_0000514 3300048907 Bacteria 33125
568 Ga0496108_1163972 3300048911 Bacteria 653
569 Ga0496110_0115942 3300048913 Bacteria 2411
570 Ga0496111_0821547 3300048914 Bacteria 672
571 Ga0496113_0814912 3300048916 Bacteria 741
572 Ga0496116_0000112 3300048919 Bacteria 181946
573 Ga0496116_0001003 3300048919 Bacteria 34466
574 Ga0496116_0006369 3300048919 Bacteria 10736
575 Ga0496116_0011788 3300048919 Bacteria 7196
576 Ga0496116_0013064 3300048919 Bacteria 6729
577 Ga0496116_0015601 3300048919 Bacteria 5997
578 Ga0496116_0051985 3300048919 Bacteria 2717
579 Ga0496116_0058673 3300048919 Bacteria 2507
580 Ga0496116_0192380 3300048919 Bacteria 1078
581 Ga0496116_0273013 3300048919 Bacteria 824
582 Ga0496116_0276053 3300048919 Bacteria 817
583 Ga0496117_0004007 3300048920 Bacteria 16614
584 Ga0496117_0013976 3300048920 Bacteria 6956
585 Ga0496117_0067627 3300048920 Bacteria 2416
586 Ga0496117_0068072 3300048920 Bacteria 2405
587 Ga0496117_0083412 3300048920 Bacteria 2089
588 Ga0496117_0152831 3300048920 Bacteria 1363
589 Ga0496117_0170557 3300048920 Bacteria 1263
590 Ga0496117_0179132 3300048920 Bacteria 1220
591 Ga0496117_0265985 3300048920 Bacteria 926
592 Ga0496117_0278240 3300048920 Bacteria 897
593 Ga0496117_0369737 3300048920 Bacteria 734
594 Ga0496117_0401421 3300048920 Bacteria 691
595 Ga0496118_0002977 3300048921 Bacteria 21906
596 Ga0496118_0011162 3300048921 Bacteria 8798
597 Ga0496118_0035604 3300048921 Bacteria 4038
598 Ga0496118_0125271 3300048921 Bacteria 1664
599 Ga0496118_0153834 3300048921 Bacteria 1434
600 Ga0496118_0160248 3300048921 Bacteria 1392
601 Ga0496118_0165701 3300048921 Bacteria 1358
602 Ga0496118_0175828 3300048921 Bacteria 1300
603 Ga0496118_0201686 3300048921 Bacteria 1177
604 Ga0496118_0291062 3300048921 Bacteria 902
605 Ga0496118_0311509 3300048921 Bacteria 858
606 Ga0496118_0570494 3300048921 Bacteria 547
607 Ga0496119_0000847 3300048922 Bacteria 40396
608 Ga0496119_0007444 3300048922 Bacteria 9856
609 Ga0496119_0014320 3300048922 Bacteria 6219
610 Ga0496119_0152341 3300048922 Bacteria 1237
611 Ga0496119_0269287 3300048922 Bacteria 851
612 Ga0496120_0004876 3300048923 Bacteria 10938
613 Ga0496120_0041389 3300048923 Bacteria 2699
614 Ga0496120_0061416 3300048923 Bacteria 2097
615 Ga0496120_0133159 3300048923 Bacteria 1270
616 Ga0496120_0154587 3300048923 Bacteria 1149
617 Ga0496121_0000097 3300048924 Bacteria 201224
618 Ga0496121_0013519 3300048924 Bacteria 8759
619 Ga0496121_0034157 3300048924 Bacteria 4582
620 Ga0496121_0037405 3300048924 Bacteria 4311
621 Ga0496121_0077588 3300048924 Bacteria 2644
622 Ga0496121_0264509 3300048924 Bacteria 1185
623 Ga0496122_0000067 3300048925 Bacteria 231365
624 Ga0496122_0003413 3300048925 Bacteria 20906
625 Ga0496122_0038151 3300048925 Bacteria 3854
626 Ga0496122_0075028 3300048925 Bacteria 2388
627 Ga0496122_0112971 3300048925 Bacteria 1776
628 Ga0496122_0167868 3300048925 Bacteria 1327
629 Ga0496122_0214848 3300048925 Bacteria 1110
630 Ga0496122_0269285 3300048925 Bacteria 939
631 Ga0496123_0000056 3300048926 Bacteria 231365
632 Ga0496123_0001391 3300048926 Bacteria 33892
633 Ga0496123_0007815 3300048926 Bacteria 9955
634 Ga0496123_0042687 3300048926 Bacteria 3125
635 Ga0496123_0073455 3300048926 Bacteria 2121
636 Ga0496123_0095355 3300048926 Bacteria 1750
637 Ga0496123_0208862 3300048926 Bacteria 994
638 Ga0496123_0232106 3300048926 Bacteria 922
639 Ga0496123_0366142 3300048926 Bacteria 666
640 Ga0496124_0000150 3300048927 Bacteria 142820
641 Ga0496124_0000247 3300048927 Bacteria 104657
642 Ga0496124_0006179 3300048927 Bacteria 13126
643 Ga0496124_0008088 3300048927 Bacteria 11053
644 Ga0496124_0038226 3300048927 Bacteria 4168
645 Ga0496124_0061033 3300048927 Bacteria 3161
646 Ga0496124_0083929 3300048927 Bacteria 2613
647 Ga0496124_0084502 3300048927 Bacteria 2602
648 Ga0496124_0110448 3300048927 Bacteria 2213
649 Ga0496124_0139680 3300048927 Bacteria 1913
650 Ga0496124_0142342 3300048927 Bacteria 1891
651 Ga0496124_0230626 3300048927 Bacteria 1384
652 Ga0496124_0233950 3300048927 Bacteria 1371
653 Ga0496124_0443479 3300048927 Bacteria 887
654 Ga0496124_0518559 3300048927 Bacteria 794
655 Ga0496124_0835257 3300048927 Bacteria 566
656 Ga0496124_0991124 3300048927 Bacteria 501
657 Ga0496125_0000048 3300048928 Bacteria 290651
658 Ga0496125_0001267 3300048928 Bacteria 37640
659 Ga0496125_0005813 3300048928 Bacteria 13548
660 Ga0496125_0011522 3300048928 Bacteria 8835
661 Ga0496125_0016521 3300048928 Bacteria 7082
662 Ga0496125_0021219 3300048928 Bacteria 6066
663 Ga0496125_0092376 3300048928 Bacteria 2263
664 Ga0496125_0153496 3300048928 Bacteria 1577
665 Ga0496125_0197397 3300048928 Bacteria 1321
666 Ga0496125_0275150 3300048928 Bacteria 1046
667 Ga0496125_0286304 3300048928 Bacteria 1017
668 Ga0496125_0328633 3300048928 Bacteria 923
669 Ga0496125_0624216 3300048928 Bacteria 584
670 Ga0496125_0683133 3300048928 Bacteria 547
671 Ga0496126_0050061 3300048929 Bacteria 3809
672 Ga0496126_0083434 3300048929 Bacteria 2820
673 Ga0496126_0145532 3300048929 Bacteria 2035
674 Ga0496126_0288064 3300048929 Bacteria 1359
675 Ga0496126_0462333 3300048929 Bacteria 1019
676 Ga0496126_0568155 3300048929 Bacteria 897
677 Ga0496126_0742629 3300048929 Bacteria 758
678 Ga0496126_1041310 3300048929 Bacteria 611
679 Ga0495678_016179 3300049459 Bacteria 3417
680 Ga0495678_029133 3300049459 Bacteria 2321
681 Ga0495678_029443 3300049459 Bacteria 2305
682 Ga0495678_042348 3300049459 Bacteria 1815
683 Ga0495682_0065915 3300049460 Bacteria 1305
684 Ga0495682_0074495 3300049460 Bacteria 1221
685 Ga0495682_0299221 3300049460 Bacteria 567
686 Ga0495682_0366744 3300049460 Bacteria 507
687 Ga0501290_031375 3300049513 Bacteria 763
688 Ga0501335_015018 3300049551 Bacteria 787
689 Ga0501034_0114939 3300049571 Bacteria 2680
690 Ga0501034_0244190 3300049571 Bacteria 1741
691 Ga0501034_0264477 3300049571 Bacteria 1662
692 Ga0501038_0140963 3300049574 Bacteria 1972
693 Ga0501043_0018210 3300049579 Bacteria 5507
694 Ga0501043_0381375 3300049579 Bacteria 1067
695 Ga0501046_0015320 3300049580 Bacteria 6446
696 Ga0501047_0672521 3300049581 Unclassified 854
697 Ga0501202_091395 3300049652 Bacteria 729
698 Ga0501206_022389 3300049653 Bacteria 906
699 Ga0501211_005242 3300049658 Bacteria 1301
700 Ga0501217_289699 3300049661 Unclassified 538
701 Ga0501235_001027 3300049669 Bacteria 5821
702 Ga0501236_023660 3300049670 Bacteria 926
703 Ga0501240_017619 3300049673 Bacteria 1041
704 Ga0501243_107875 3300049675 Bacteria 568
705 Ga0501225_0007311 3300049705 Bacteria 3201
706 Ga0501225_0291406 3300049705 Bacteria 550
707 Ga0501245_005492 3300049708 Bacteria 1757
708 Ga0501264_005581 3300049761 Bacteria 1147
709 Ga0501281_21911 3300049777 Bacteria 501
710 nmdc:mga03683_160815_c1 3300050489 Bacteria 1017
711 nmdc:mga03683_298171_c1 3300050489 Bacteria 755
712 nmdc:mga03683_408802_c1 3300050489 Bacteria 649
713 nmdc:mga03683_476106_c1 3300050489 Bacteria 603
714 nmdc:mga03683_84215_c1 3300050489 Bacteria 1378
715 nmdc:mga03n38_276812_c1 3300050490 Bacteria 894
716 nmdc:mga00v17_1066996_c1 3300050491 Bacteria 507
717 nmdc:mga00v17_199939_c1 3300050491 Bacteria 1292
718 nmdc:mga00v17_853315_c1 3300050491 Bacteria 578
719 nmdc:mga00v17_917402_c1 3300050491 Bacteria 554
720 nmdc:mga00v17_918451_c1 3300050491 Bacteria 554
721 nmdc:mga00v17_923703_c1 3300050491 Bacteria 552
722 nmdc:mga07m45_393668_c1 3300050496 Bacteria 804
723 nmdc:mga08x19_1027785_c1 3300050514 Bacteria 585
724 nmdc:mga08x19_80812_c1 3300050514 Bacteria 2134
725 Ga0500641_0011666 3300053096 Bacteria 3193
726 Ga0500621_048640 3300053126 Bacteria 1715
727 Ga0500577_0003180 3300053142 Bacteria 4252
728 Ga0500616_0191680 3300053153 Bacteria 912
729 Ga0500625_002649 3300053729 Bacteria 6780

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009174 Ga0105241_10110315 Ga0105241_101103151 86
2 3300013104 Ga0157370_10021828 Ga0157370_100218281 86
3 3300025911 Ga0207654_10332309 Ga0207654_103323093 86
4 iso_pu_bacteria 2511231004 2511254897 89
5 iso_pu_bacteria 2511231012 2511302425 89
6 iso_pu_bacteria 2511231018 2511341167 89
7 iso_pu_bacteria 2512047018 2512328733 89
8 iso_pu_bacteria 2582580891 2583789563 89
9 iso_pu_bacteria 2597489887 2597855363 89
10 iso_pu_bacteria 2599185303 2599950806 89
11 iso_pu_bacteria 2643221588 2643951331 89
12 iso_pu_bacteria 2643221589 2643956349 89
13 iso_pu_bacteria 2643221602 2644021402 89
14 iso_pu_bacteria 2667528173 2671109272 89
15 iso_pu_bacteria 2713897148 2715750581 89
16 iso_pu_bacteria 2713897149 2715760007 89
17 iso_pu_bacteria 2738543015 2739261243 89
18 iso_pu_bacteria 2738543025 2739314616 89
19 iso_pu_bacteria 2784132063 2784264222 89
20 iso_pu_bacteria 2838736955 2838737731 89
21 iso_pu_bacteria 2841840854 2841841900 89
22 iso_pu_bacteria 2842140634 2842141679 89
23 iso_pu_bacteria 2842843487 2842846756 89
24 iso_pu_bacteria 2844665904 2844667581 89
25 iso_pu_bacteria 2852657418 2852657693 89
26 iso_pu_bacteria 2855020534 2855022543 89
27 iso_pu_bacteria 2880230671 2880233699 89
28 iso_pu_bacteria 2904474040 2904477448 89
29 iso_pu_bacteria 2904550169 2904555006 89
30 iso_pu_bacteria 2919150387 2919153843 89
31 iso_pu_bacteria 2919487758 2919489270 89
32 iso_pu_bacteria 2919679072 2919681666 89
33 iso_pu_bacteria 2927143783 2927147141 89
34 iso_pu_bacteria 2939573065 2939575845 89
35 iso_pu_bacteria 2984286254 2984292347 89
36 iso_pu_bacteria 2998139840 2998142518 89
37 iso_pu_bacteria 3007614139 3007616166 89
38 iso_pu_bacteria 3007718800 3007721499 89
39 iso_pu_bacteria 8029995093 8029998176 89
40 iso_pu_bacteria 8055087960 8055088440 89
41 iso_pu_bacteria 8055092621 8055096929 89
42 iso_pu_bacteria 8055770955 8055771126 89
43 iso_pu_bacteria 8056125926 8056126211 89
44 iso_pu_bacteria 8056155041 8056158237 89
45 iso_pu_bacteria 8056166840 8056168566 89
46 3300009011 Ga0105251_10074727 Ga0105251_100747272 90
47 3300009092 Ga0105250_10160908 Ga0105250_101609083 90
48 3300025735 Ga0207713_1020172 Ga0207713_10201722 90
49 3300046542 Ga0495597_0187926 Ga0495597_0187926_212_514 90
50 3300046452 Ga0495617_119463 Ga0495617_119463_16_321 91
51 3300046692 Ga0495671_0077331 Ga0495671_0077331_713_991 92
52 3300048091 Ga0495626_0000931 Ga0495626_0000931_12624_12902 92
53 2124908027 MRS2a_Contig_878 MRS2a_00723610 93
54 2162886007 SwRhRL2b_contig_942673 SwRhRL2b_0039.00000990 93
55 2162886011 MRS1b_contig_1512768 MRS1b_0542.00000820 93
56 3300001979 JGI24740J21852_10031135 JGI24740J21852_100311352 93
57 3300001990 JGI24737J22298_10033282 JGI24737J22298_100332821 93
58 3300002075 JGI24738J21930_10024949 JGI24738J21930_100249492 93
59 3300002737 JGI25162J39368_1000007 JGI25162J39368_100000771 93
60 3300002771 JGI25163J39215_1000040 JGI25163J39215_100004043 93
61 3300002772 JGI25164J39214_1000016 JGI25164J39214_1000016119 93
62 3300003751 Ga0055538_1000006 Ga0055538_100000671 93
63 3300003752 Ga0055539_1000010 Ga0055539_100001071 93
64 3300003756 Ga0055533_1000013 Ga0055533_100001371 93
65 3300003759 Ga0055525_1000015 Ga0055525_100001571 93
66 3300003781 Ga0055536_1000145 Ga0055536_100014529 93
67 3300003781 Ga0055536_1000200 Ga0055536_100020026 93
68 3300003784 Ga0055534_1049140 Ga0055534_10491401 93
69 3300003791 Ga0055530_10000128 Ga0055530_1000012820 93
70 3300003791 Ga0055530_10000163 Ga0055530_1000016326 93
71 3300003792 Ga0055540_1000156 Ga0055540_100015636 93
72 3300003792 Ga0055540_1001073 Ga0055540_10010735 93
73 3300003792 Ga0055540_1088347 Ga0055540_10883472 93
74 3300003794 Ga0055531_10000425 Ga0055531_1000042522 93
75 3300003841 Ga0055541_1000007 Ga0055541_1000007304 93
76 3300005288 Ga0065714_10000431 Ga0065714_100004313 93
77 3300005288 Ga0065714_10005818 Ga0065714_100058184 93
78 3300005288 Ga0065714_10102197 Ga0065714_101021972 93
79 3300005288 Ga0065714_10120917 Ga0065714_101209173 93
80 3300005288 Ga0065714_10172880 Ga0065714_101728801 93
81 3300005288 Ga0065714_10218135 Ga0065714_102181351 93
82 3300005288 Ga0065714_10330062 Ga0065714_103300621 93
83 3300005289 Ga0065704_10000271 Ga0065704_1000027116 93
84 3300005289 Ga0065704_10156563 Ga0065704_101565633 93
85 3300005289 Ga0065704_10161970 Ga0065704_101619702 93
86 3300005289 Ga0065704_10291037 Ga0065704_102910371 93
87 3300005289 Ga0065704_10315890 Ga0065704_103158902 93
88 3300005290 Ga0065712_10182057 Ga0065712_101820573 93
89 3300005290 Ga0065712_10652761 Ga0065712_106527612 93
90 3300005293 Ga0065715_10139364 Ga0065715_101393641 93
91 3300005295 Ga0065707_10127222 Ga0065707_101272223 93
92 3300005336 Ga0070680_102009700 Ga0070680_1020097001 93
93 3300005366 Ga0070659_100315936 Ga0070659_1003159363 93
94 3300005457 Ga0070662_100027158 Ga0070662_1000271582 93
95 3300005457 Ga0070662_100330068 Ga0070662_1003300682 93
96 3300005539 Ga0068853_100053947 Ga0068853_1000539471 93
97 3300005563 Ga0068855_100511680 Ga0068855_1005116803 93
98 3300005577 Ga0068857_100029738 Ga0068857_1000297383 93
99 3300005577 Ga0068857_100228009 Ga0068857_1002280092 93
100 3300005578 Ga0068854_100049056 Ga0068854_1000490564 93
101 3300005616 Ga0068852_101526137 Ga0068852_1015261371 93
102 3300006048 Ga0075363_100255511 Ga0075363_1002555112 93
103 3300006051 Ga0075364_10095803 Ga0075364_100958033 93
104 3300006051 Ga0075364_10267326 Ga0075364_102673262 93
105 3300006051 Ga0075364_10715459 Ga0075364_107154592 93
106 3300006051 Ga0075364_10741135 Ga0075364_107411352 93
107 3300006051 Ga0075364_11019993 Ga0075364_110199931 93
108 3300006051 Ga0075364_11070689 Ga0075364_110706892 93
109 3300006058 Ga0075432_10097649 Ga0075432_100976492 93
110 3300006058 Ga0075432_10141775 Ga0075432_101417753 93
111 3300006058 Ga0075432_10206485 Ga0075432_102064853 93
112 3300006058 Ga0075432_10258756 Ga0075432_102587561 93
113 3300006058 Ga0075432_10395522 Ga0075432_103955222 93
114 3300006058 Ga0075432_10407184 Ga0075432_104071842 93
115 3300006058 Ga0075432_10560242 Ga0075432_105602422 93
116 3300006177 Ga0075362_10047340 Ga0075362_100473403 93
117 3300006177 Ga0075362_10243354 Ga0075362_102433543 93
118 3300006186 Ga0075369_10126209 Ga0075369_101262092 93
119 3300006353 Ga0075370_10416480 Ga0075370_104164801 93
120 3300006914 Ga0075436_100223473 Ga0075436_1002234734 93
121 3300006914 Ga0075436_100455893 Ga0075436_1004558933 93
122 3300006914 Ga0075436_100474883 Ga0075436_1004748832 93
123 3300006946 Ga0079104_1000290 Ga0079104_100029026 93
124 3300006946 Ga0079104_1003915 Ga0079104_10039153 93
125 3300006946 Ga0079104_1009332 Ga0079104_10093321 93
126 3300006946 Ga0079104_1013375 Ga0079104_10133753 93
127 3300009011 Ga0105251_10008384 Ga0105251_100083843 93
128 3300009011 Ga0105251_10148544 Ga0105251_101485443 93
129 3300009011 Ga0105251_10227935 Ga0105251_102279351 93
130 3300009011 Ga0105251_10255529 Ga0105251_102555292 93
131 3300009036 Ga0105244_10000026 Ga0105244_1000002626 93
132 3300009036 Ga0105244_10019547 Ga0105244_100195473 93
133 3300009036 Ga0105244_10123703 Ga0105244_101237032 93
134 3300009036 Ga0105244_10143032 Ga0105244_101430323 93
135 3300009036 Ga0105244_10177061 Ga0105244_101770613 93
136 3300009036 Ga0105244_10192564 Ga0105244_101925643 93
137 3300009036 Ga0105244_10205776 Ga0105244_102057762 93
138 3300009036 Ga0105244_10220761 Ga0105244_102207613 93
139 3300009092 Ga0105250_10001116 Ga0105250_100011167 93
140 3300009092 Ga0105250_10004167 Ga0105250_100041672 93
141 3300009092 Ga0105250_10099421 Ga0105250_100994213 93
142 3300009092 Ga0105250_10142365 Ga0105250_101423653 93
143 3300009093 Ga0105240_12485856 Ga0105240_124858562 93
144 3300009148 Ga0105243_10013201 Ga0105243_100132015 93
145 3300009148 Ga0105243_10124879 Ga0105243_101248793 93
146 3300009148 Ga0105243_11055168 Ga0105243_110551682 93
147 3300009176 Ga0105242_10015438 Ga0105242_1001543810 93
148 3300009176 Ga0105242_11491208 Ga0105242_114912081 93
149 3300009177 Ga0105248_10102693 Ga0105248_101026934 93
150 3300009551 Ga0105238_10311764 Ga0105238_103117643 93
151 3300009551 Ga0105238_10337113 Ga0105238_103371133 93
152 3300010375 Ga0105239_11041604 Ga0105239_110416042 93
153 3300012477 Ga0157336_1001858 Ga0157336_10018582 93
154 3300012498 Ga0157345_1001192 Ga0157345_10011922 93
155 3300012502 Ga0157347_1011896 Ga0157347_10118962 93
156 3300012505 Ga0157339_1013620 Ga0157339_10136202 93
157 3300013100 Ga0157373_10016444 Ga0157373_100164446 93
158 3300013100 Ga0157373_10165428 Ga0157373_101654282 93
159 3300013100 Ga0157373_10479049 Ga0157373_104790493 93
160 3300013100 Ga0157373_10498403 Ga0157373_104984032 93
161 3300013102 Ga0157371_10000044 Ga0157371_10000044138 93
162 3300013102 Ga0157371_10001383 Ga0157371_100013839 93
163 3300013102 Ga0157371_10010204 Ga0157371_100102043 93
164 3300013102 Ga0157371_10051292 Ga0157371_100512923 93
165 3300013102 Ga0157371_10067811 Ga0157371_100678113 93
166 3300013102 Ga0157371_10267965 Ga0157371_102679653 93
167 3300013102 Ga0157371_10432678 Ga0157371_104326783 93
168 3300013102 Ga0157371_11318332 Ga0157371_113183322 93
169 3300013104 Ga0157370_10085874 Ga0157370_100858743 93
170 3300013104 Ga0157370_10210362 Ga0157370_102103623 93
171 3300013104 Ga0157370_10293730 Ga0157370_102937303 93
172 3300013104 Ga0157370_10636892 Ga0157370_106368923 93
173 3300013104 Ga0157370_11737983 Ga0157370_117379831 93
174 3300013105 Ga0157369_10007905 Ga0157369_100079054 93
175 3300013105 Ga0157369_10078453 Ga0157369_100784534 93
176 3300013105 Ga0157369_10397493 Ga0157369_103974933 93
177 3300013306 Ga0163162_10010387 Ga0163162_100103871 93
178 3300013306 Ga0163162_10582585 Ga0163162_105825854 93
179 3300013306 Ga0163162_11280742 Ga0163162_112807423 93
180 3300013306 Ga0163162_11375294 Ga0163162_113752942 93
181 3300013306 Ga0163162_11583479 Ga0163162_115834792 93
182 3300013307 Ga0157372_10000453 Ga0157372_1000045332 93
183 3300013307 Ga0157372_10025185 Ga0157372_100251852 93
184 3300013308 Ga0157375_10666823 Ga0157375_106668233 93
185 3300013308 Ga0157375_10810817 Ga0157375_108108172 93
186 3300014497 Ga0182008_10000238 Ga0182008_1000023814 93
187 3300014497 Ga0182008_10016432 Ga0182008_100164324 93
188 3300014497 Ga0182008_10032643 Ga0182008_100326433 93
189 3300014497 Ga0182008_10130828 Ga0182008_101308281 93
190 3300014497 Ga0182008_10144922 Ga0182008_101449223 93
191 3300015261 Ga0182006_1013786 Ga0182006_10137862 93
192 3300015261 Ga0182006_1073962 Ga0182006_10739624 93
193 3300015262 Ga0182007_10072698 Ga0182007_100726983 93
194 3300015262 Ga0182007_10240575 Ga0182007_102405752 93
195 3300015265 Ga0182005_1041845 Ga0182005_10418453 93
196 3300015265 Ga0182005_1070302 Ga0182005_10703021 93
197 3300015265 Ga0182005_1086315 Ga0182005_10863151 93
198 3300017792 Ga0163161_10175584 Ga0163161_101755842 93
199 3300017792 Ga0163161_10327370 Ga0163161_103273703 93
200 3300017792 Ga0163161_10489217 Ga0163161_104892173 93
201 3300017792 Ga0163161_10510030 Ga0163161_105100301 93
202 3300017792 Ga0163161_10701669 Ga0163161_107016691 93
203 3300017792 Ga0163161_10702948 Ga0163161_107029481 93
204 3300017792 Ga0163161_11476642 Ga0163161_114766421 93
205 3300017792 Ga0163161_11730898 Ga0163161_117308982 93
206 3300025207 Ga0209760_100034 Ga0209760_10003461 93
207 3300025224 Ga0209784_100022 Ga0209784_100022300 93
208 3300025225 Ga0209566_100021 Ga0209566_100021300 93
209 3300025226 Ga0209674_100038 Ga0209674_100038300 93
210 3300025230 Ga0209563_100042 Ga0209563_100042300 93
211 3300025231 Ga0207427_100027 Ga0207427_100027300 93
212 3300025233 Ga0209437_100049 Ga0209437_100049300 93
213 3300025253 Ga0209677_100025 Ga0209677_100025300 93
214 3300025261 Ga0209233_1003281 Ga0209233_10032813 93
215 3300025284 Ga0209130_1031380 Ga0209130_10313803 93
216 3300025291 Ga0209675_1010416 Ga0209675_10104166 93
217 3300025292 Ga0209676_1000020 Ga0209676_1000020139 93
218 3300025292 Ga0209676_1000032 Ga0209676_100003249 93
219 3300025292 Ga0209676_1000408 Ga0209676_100040829 93
220 3300025292 Ga0209676_1006111 Ga0209676_10061117 93
221 3300025298 Ga0209050_1000025 Ga0209050_100002550 93
222 3300025298 Ga0209050_1000099 Ga0209050_1000099179 93
223 3300025298 Ga0209050_1001082 Ga0209050_100108219 93
224 3300025303 Ga0209051_1000026 Ga0209051_1000026328 93
225 3300025303 Ga0209051_1000039 Ga0209051_1000039227 93
226 3300025303 Ga0209051_1000047 Ga0209051_1000047227 93
227 3300025303 Ga0209051_1024322 Ga0209051_10243223 93
228 3300025304 Ga0209257_1000034 Ga0209257_1000034533 93
229 3300025304 Ga0209257_1111975 Ga0209257_11119752 93
230 3300025711 Ga0207696_1000002 Ga0207696_1000002534 93
231 3300025711 Ga0207696_1000642 Ga0207696_10006422 93
232 3300025711 Ga0207696_1020208 Ga0207696_10202084 93
233 3300025711 Ga0207696_1053664 Ga0207696_10536643 93
234 3300025728 Ga0207655_1000057 Ga0207655_100005755 93
235 3300025728 Ga0207655_1000560 Ga0207655_100056025 93
236 3300025728 Ga0207655_1012867 Ga0207655_10128675 93
237 3300025728 Ga0207655_1018585 Ga0207655_10185853 93
238 3300025728 Ga0207655_1087344 Ga0207655_10873443 93
239 3300025728 Ga0207655_1088890 Ga0207655_10888901 93
240 3300025728 Ga0207655_1098508 Ga0207655_10985083 93
241 3300025728 Ga0207655_1117921 Ga0207655_11179213 93
242 3300025728 Ga0207655_1122063 Ga0207655_11220632 93
243 3300025728 Ga0207655_1200550 Ga0207655_12005502 93
244 3300025735 Ga0207713_1000573 Ga0207713_100057320 93
245 3300025735 Ga0207713_1004368 Ga0207713_10043688 93
246 3300025735 Ga0207713_1006126 Ga0207713_10061265 93
247 3300025735 Ga0207713_1006127 Ga0207713_10061275 93
248 3300025735 Ga0207713_1008055 Ga0207713_10080559 93
249 3300025735 Ga0207713_1031210 Ga0207713_10312103 93
250 3300025735 Ga0207713_1069000 Ga0207713_10690003 93
251 3300025904 Ga0207647_10175276 Ga0207647_101752762 93
252 3300025924 Ga0207694_10104047 Ga0207694_101040472 93
253 3300025925 Ga0207650_10000185 Ga0207650_1000018522 93
254 3300025931 Ga0207644_10548985 Ga0207644_105489852 93
255 3300025932 Ga0207690_10261516 Ga0207690_102615163 93
256 3300025933 Ga0207706_10176427 Ga0207706_101764272 93
257 3300025933 Ga0207706_10399000 Ga0207706_103990003 93
258 3300025934 Ga0207686_10571208 Ga0207686_105712083 93
259 3300025935 Ga0207709_10940985 Ga0207709_109409852 93
260 3300025935 Ga0207709_11138580 Ga0207709_111385801 93
261 3300025972 Ga0207668_10773876 Ga0207668_107738761 93
262 3300025981 Ga0207640_10040953 Ga0207640_100409534 93
263 3300026041 Ga0207639_10017627 Ga0207639_100176272 93
264 3300026116 Ga0207674_10000029 Ga0207674_1000002965 93
265 3300026116 Ga0207674_10025912 Ga0207674_100259126 93
266 3300026116 Ga0207674_10233715 Ga0207674_102337153 93
267 3300026142 Ga0207698_10178607 Ga0207698_101786072 93
268 3300027111 Ga0209281_1000026 Ga0209281_100002629 93
269 3300027111 Ga0209281_1000614 Ga0209281_100061411 93
270 3300027111 Ga0209281_1003496 Ga0209281_10034963 93
271 3300027111 Ga0209281_1005509 Ga0209281_10055091 93
272 3300027312 Ga0209371_1000014 Ga0209371_1000014355 93
273 3300027665 Ga0209983_1026045 Ga0209983_10260452 93
274 3300027876 Ga0209974_10126046 Ga0209974_101260462 93
275 3300027907 Ga0207428_10069990 Ga0207428_100699903 93
276 3300027907 Ga0207428_10407641 Ga0207428_104076412 93
277 3300027907 Ga0207428_10454500 Ga0207428_104545003 93
278 3300027907 Ga0207428_10505325 Ga0207428_105053252 93
279 3300027907 Ga0207428_10815099 Ga0207428_108150992 93
280 3300028379 Ga0268266_10106882 Ga0268266_101068822 93
281 3300028379 Ga0268266_10254151 Ga0268266_102541511 93
282 3300030500 Ga0268256_1000021 Ga0268256_1000021349 93
283 3300030500 Ga0268256_1010279 Ga0268256_10102793 93
284 3300030735 Ga0316178_1142514 Ga0316178_114251411 93
285 3300031548 Ga0307408_100009196 Ga0307408_1000091964 93
286 3300031548 Ga0307408_100273538 Ga0307408_1002735383 93
287 3300031548 Ga0307408_100677396 Ga0307408_1006773962 93
288 3300031691 Ga0316579_10212966 Ga0316579_102129662 93
289 3300031691 Ga0316579_10521807 Ga0316579_105218071 93
290 3300031731 Ga0307405_10108814 Ga0307405_101088142 93
291 3300031731 Ga0307405_10182115 Ga0307405_101821153 93
292 3300031731 Ga0307405_10310489 Ga0307405_103104893 93
293 3300031731 Ga0307405_10331974 Ga0307405_103319742 93
294 3300031731 Ga0307405_10828258 Ga0307405_108282582 93
295 3300031852 Ga0307410_10308877 Ga0307410_103088772 93
296 3300031901 Ga0307406_10267357 Ga0307406_102673572 93
297 3300031911 Ga0307412_10164900 Ga0307412_101649001 93
298 3300031911 Ga0307412_10213799 Ga0307412_102137993 93
299 3300031911 Ga0307412_10319033 Ga0307412_103190332 93
300 3300032002 Ga0307416_100281173 Ga0307416_1002811733 93
301 3300032002 Ga0307416_102284124 Ga0307416_1022841241 93
302 3300032005 Ga0307411_10114545 Ga0307411_101145452 93
303 3300032005 Ga0307411_10347662 Ga0307411_103476623 93
304 3300032126 Ga0307415_101443879 Ga0307415_1014438791 93
305 3300037312 Ga0395899_0217634 Ga0395899_0217634_144_431 93
306 3300037418 Ga0395900_0002169 Ga0395900_0002169_20889_21176 93
307 3300037418 Ga0395900_0071831 Ga0395900_0071831_1419_1706 93
308 3300037466 Ga0395898_0072438 Ga0395898_0072438_892_1179 93
309 3300039447 Ga0436361_1058773 Ga0436361_1058773_309_596 93
310 3300041405 Ga0439438_001153 Ga0439438_001153_9952_10233 93
311 3300041405 Ga0439438_033200 Ga0439438_033200_724_1053 93
312 3300041407 Ga0439447_000379 Ga0439447_000379_2515_2796 93
313 3300041407 Ga0439447_000776 Ga0439447_000776_4060_4341 93
314 3300041407 Ga0439447_003341 Ga0439447_003341_4903_5232 93
315 3300041407 Ga0439447_035093 Ga0439447_035093_320_601 93
316 3300041411 Ga0439466_0000176 Ga0439466_0000176_6953_7234 93
317 3300041411 Ga0439466_0008485 Ga0439466_0008485_2408_2689 93
318 3300041411 Ga0439466_0020842 Ga0439466_0020842_1857_2138 93
319 3300041411 Ga0439466_0030233 Ga0439466_0030233_1377_1658 93
320 3300041411 Ga0439466_0064278 Ga0439466_0064278_334_615 93
321 3300041411 Ga0439466_0130211 Ga0439466_0130211_75_404 93
322 3300041486 Ga0451807_0901309 Ga0451807_0901309_172_459 93
323 3300041486 Ga0451807_0911490 Ga0451807_0911490_132_419 93
324 3300042006 Ga0439432_002585 Ga0439432_002585_3050_3331 93
325 3300042006 Ga0439432_023994 Ga0439432_023994_333_614 93
326 3300042006 Ga0439432_058951 Ga0439432_058951_789_1073 93
327 3300042006 Ga0439432_093155 Ga0439432_093155_306_587 93
328 3300042009 Ga0439451_022878 Ga0439451_022878_79_408 93
329 3300042009 Ga0439451_059161 Ga0439451_059161_430_711 93
330 3300042010 Ga0439452_000005 Ga0439452_000005_389747_390031 93
331 3300042010 Ga0439452_000229 Ga0439452_000229_1737_2018 93
332 3300042010 Ga0439452_048552 Ga0439452_048552_592_873 93
333 3300042013 Ga0439456_001064 Ga0439456_001064_1388_1669 93
334 3300042013 Ga0439456_001435 Ga0439456_001435_3769_4098 93
335 3300042013 Ga0439456_002068 Ga0439456_002068_3653_3934 93
336 3300042013 Ga0439456_005338 Ga0439456_005338_475_756 93
337 3300042013 Ga0439456_007928 Ga0439456_007928_508_789 93
338 3300042013 Ga0439456_008553 Ga0439456_008553_1783_2064 93
339 3300042013 Ga0439456_014786 Ga0439456_014786_239_520 93
340 3300042016 Ga0439463_000558 Ga0439463_000558_6882_7163 93
341 3300042016 Ga0439463_001147 Ga0439463_001147_4050_4331 93
342 3300042016 Ga0439463_125649 Ga0439463_125649_346_627 93
343 3300042115 Ga0450911_000290 Ga0450911_000290_16428_16709 93
344 3300042115 Ga0450911_000924 Ga0450911_000924_1552_1833 93
345 3300042115 Ga0450911_006040 Ga0450911_006040_265_546 93
346 3300042121 Ga0450919_004043 Ga0450919_004043_730_1011 93
347 3300042122 Ga0450920_002881 Ga0450920_002881_447_728 93
348 3300042124 Ga0450922_000391 Ga0450922_000391_3840_4121 93
349 3300042125 Ga0450923_011486 Ga0450923_011486_547_828 93
350 3300042136 Ga0450900_016097 Ga0450900_016097_253_534 93
351 3300042137 Ga0450902_001758 Ga0450902_001758_278_559 93
352 3300042137 Ga0450902_032425 Ga0450902_032425_240_521 93
353 3300042137 Ga0450902_044893 Ga0450902_044893_10_291 93
354 3300042138 Ga0450903_000904 Ga0450903_000904_2917_3198 93
355 3300042138 Ga0450903_025431 Ga0450903_025431_270_599 93
356 3300042139 Ga0450904_004135 Ga0450904_004135_1193_1474 93
357 3300042142 Ga0450905_024695 Ga0450905_024695_144_425 93
358 3300042145 Ga0450906_001755 Ga0450906_001755_3193_3474 93
359 3300042145 Ga0450906_003379 Ga0450906_003379_1605_1886 93
360 3300042146 Ga0450907_000020 Ga0450907_000020_65323_65652 93
361 3300042146 Ga0450907_000681 Ga0450907_000681_8289_8570 93
362 3300042147 Ga0450910_005521 Ga0450910_005521_1163_1444 93
363 3300042147 Ga0450910_022646 Ga0450910_022646_465_794 93
364 3300042156 Ga0439446_0064545 Ga0439446_0064545_421_750 93
365 3300042184 Ga0450908_087622 Ga0450908_087622_30_311 93
366 3300042185 Ga0450909_000635 Ga0450909_000635_1066_1395 93
367 3300042185 Ga0450909_012929 Ga0450909_012929_735_1016 93
368 3300042435 Ga0439434_0000018 Ga0439434_0000018_36461_36790 93
369 3300042439 Ga0439464_0293630 Ga0439464_0293630_154_435 93
370 3300042461 Ga0439460_0000545 Ga0439460_0000545_6748_7077 93
371 3300042461 Ga0439460_0002133 Ga0439460_0002133_2933_3214 93
372 3300042531 Ga0450918_021625 Ga0450918_021625_97_378 93
373 3300042532 Ga0450893_0010920 Ga0450893_0010920_350_631 93
374 3300042876 Ga0451577_0000239 Ga0451577_0000239_20951_21241 93
375 3300042876 Ga0451577_0348022 Ga0451577_0348022_1021_1311 93
376 3300042993 Ga0439440_0000422 Ga0439440_0000422_475_756 93
377 3300044656 Ga0466969_0006571 Ga0466969_0006571_4421_4711 93
378 3300044673 Ga0453683_0640014 Ga0453683_0640014_347_631 93
379 3300044673 Ga0453683_0952108 Ga0453683_0952108_11_301 93
380 3300044712 Ga0453684_0001090 Ga0453684_0001090_20951_21241 93
381 3300044712 Ga0453684_0021005 Ga0453684_0021005_6002_6292 93
382 3300044712 Ga0453684_0190791 Ga0453684_0190791_436_729 93
383 3300044712 Ga0453684_0212099 Ga0453684_0212099_1917_2207 93
384 3300045051 Ga0451576_1319323 Ga0451576_1319323_332_613 93
385 3300045051 Ga0451576_1654857 Ga0451576_1654857_29_319 93
386 3300046452 Ga0495617_000608 Ga0495617_000608_9882_10163 93
387 3300046452 Ga0495617_006994 Ga0495617_006994_2407_2688 93
388 3300046452 Ga0495617_013490 Ga0495617_013490_1045_1326 93
389 3300046452 Ga0495617_013625 Ga0495617_013625_1679_1960 93
390 3300046453 Ga0495627_001586 Ga0495627_001586_10270_10551 93
391 3300046453 Ga0495627_011878 Ga0495627_011878_314_595 93
392 3300046453 Ga0495627_015823 Ga0495627_015823_510_794 93
393 3300046453 Ga0495627_088122 Ga0495627_088122_478_759 93
394 3300046455 Ga0495603_0001348 Ga0495603_0001348_8428_8709 93
395 3300046455 Ga0495603_0030679 Ga0495603_0030679_784_1065 93
396 3300046455 Ga0495603_0693215 Ga0495603_0693215_239_520 93
397 3300046457 Ga0495590_0000615 Ga0495590_0000615_9794_10075 93
398 3300046457 Ga0495590_0086300 Ga0495590_0086300_424_705 93
399 3300046458 Ga0495591_002305 Ga0495591_002305_1414_1695 93
400 3300046458 Ga0495591_007492 Ga0495591_007492_1880_2161 93
401 3300046458 Ga0495591_013020 Ga0495591_013020_11_292 93
402 3300046460 Ga0495638_0002132 Ga0495638_0002132_6053_6334 93
403 3300046460 Ga0495638_0008667 Ga0495638_0008667_4097_4378 93
404 3300046463 Ga0495653_0570250 Ga0495653_0570250_226_507 93
405 3300046471 Ga0495650_0000039 Ga0495650_0000039_337423_337707 93
406 3300046471 Ga0495650_0002587 Ga0495650_0002587_13511_13792 93
407 3300046471 Ga0495650_0106470 Ga0495650_0106470_708_989 93
408 3300046474 Ga0495605_0000530 Ga0495605_0000530_19504_19785 93
409 3300046474 Ga0495605_0000758 Ga0495605_0000758_2748_3029 93
410 3300046474 Ga0495605_0010780 Ga0495605_0010780_2781_3062 93
411 3300046474 Ga0495605_0226505 Ga0495605_0226505_59_340 93
412 3300046475 Ga0495639_0039981 Ga0495639_0039981_1623_1904 93
413 3300046475 Ga0495639_0070435 Ga0495639_0070435_76_360 93
414 3300046475 Ga0495639_0090588 Ga0495639_0090588_435_716 93
415 3300046475 Ga0495639_0333060 Ga0495639_0333060_394_675 93
416 3300046491 Ga0495584_0000787 Ga0495584_0000787_10821_11102 93
417 3300046491 Ga0495584_0002815 Ga0495584_0002815_5748_6029 93
418 3300046491 Ga0495584_0028177 Ga0495584_0028177_1220_1501 93
419 3300046491 Ga0495584_0115361 Ga0495584_0115361_296_577 93
420 3300046491 Ga0495584_0347430 Ga0495584_0347430_302_583 93
421 3300046492 Ga0495585_0016673 Ga0495585_0016673_1199_1480 93
422 3300046492 Ga0495585_0117335 Ga0495585_0117335_534_815 93
423 3300046492 Ga0495585_0226186 Ga0495585_0226186_76_357 93
424 3300046492 Ga0495585_0274479 Ga0495585_0274479_283_570 93
425 3300046499 Ga0495594_0016477 Ga0495594_0016477_3115_3396 93
426 3300046500 Ga0495596_0022058 Ga0495596_0022058_1327_1608 93
427 3300046501 Ga0495607_0010999 Ga0495607_0010999_256_537 93
428 3300046501 Ga0495607_0040897 Ga0495607_0040897_2221_2502 93
429 3300046501 Ga0495607_0147481 Ga0495607_0147481_462_743 93
430 3300046501 Ga0495607_0193517 Ga0495607_0193517_493_774 93
431 3300046501 Ga0495607_0520267 Ga0495607_0520267_72_353 93
432 3300046506 Ga0495583_0001511 Ga0495583_0001511_10168_10449 93
433 3300046506 Ga0495583_0040852 Ga0495583_0040852_992_1273 93
434 3300046506 Ga0495583_0087514 Ga0495583_0087514_469_750 93
435 3300046507 Ga0495606_0006414 Ga0495606_0006414_12_293 93
436 3300046507 Ga0495606_0009270 Ga0495606_0009270_4089_4370 93
437 3300046507 Ga0495606_0091273 Ga0495606_0091273_1149_1508 93
438 3300046507 Ga0495606_0156493 Ga0495606_0156493_238_528 93
439 3300046512 Ga0495610_0003477 Ga0495610_0003477_10096_10377 93
440 3300046512 Ga0495610_0008115 Ga0495610_0008115_4358_4639 93
441 3300046512 Ga0495610_0009185 Ga0495610_0009185_1103_1384 93
442 3300046512 Ga0495610_0023023 Ga0495610_0023023_2229_2510 93
443 3300046512 Ga0495610_0035494 Ga0495610_0035494_2062_2343 93
444 3300046512 Ga0495610_0060740 Ga0495610_0060740_120_401 93
445 3300046512 Ga0495610_0101103 Ga0495610_0101103_288_575 93
446 3300046513 Ga0495616_0001725 Ga0495616_0001725_12463_12744 93
447 3300046513 Ga0495616_0006195 Ga0495616_0006195_4057_4338 93
448 3300046513 Ga0495616_0107817 Ga0495616_0107817_454_735 93
449 3300046515 Ga0495620_0002386 Ga0495620_0002386_10315_10596 93
450 3300046515 Ga0495620_0002590 Ga0495620_0002590_8752_9033 93
451 3300046515 Ga0495620_0257161 Ga0495620_0257161_163_444 93
452 3300046516 Ga0495628_0211855 Ga0495628_0211855_271_552 93
453 3300046517 Ga0495630_0000091 Ga0495630_0000091_2266_2550 93
454 3300046517 Ga0495630_0680147 Ga0495630_0680147_369_650 93
455 3300046518 Ga0495631_0001404 Ga0495631_0001404_13565_13846 93
456 3300046518 Ga0495631_0019053 Ga0495631_0019053_2496_2777 93
457 3300046518 Ga0495631_0398065 Ga0495631_0398065_150_431 93
458 3300046519 Ga0495632_0000312 Ga0495632_0000312_28690_28971 93
459 3300046519 Ga0495632_0044876 Ga0495632_0044876_991_1272 93
460 3300046519 Ga0495632_0069013 Ga0495632_0069013_1398_1679 93
461 3300046519 Ga0495632_0072070 Ga0495632_0072070_29_310 93
462 3300046519 Ga0495632_0198472 Ga0495632_0198472_186_467 93
463 3300046520 Ga0495637_0001838 Ga0495637_0001838_4937_5296 93
464 3300046520 Ga0495637_0007664 Ga0495637_0007664_399_680 93
465 3300046520 Ga0495637_0009153 Ga0495637_0009153_643_924 93
466 3300046520 Ga0495637_0017794 Ga0495637_0017794_1442_1723 93
467 3300046520 Ga0495637_0024007 Ga0495637_0024007_1058_1339 93
468 3300046522 Ga0495643_0003399 Ga0495643_0003399_4197_4478 93
469 3300046522 Ga0495643_0084848 Ga0495643_0084848_296_577 93
470 3300046523 Ga0495644_0021319 Ga0495644_0021319_225_506 93
471 3300046523 Ga0495644_0441361 Ga0495644_0441361_58_339 93
472 3300046524 Ga0495648_0002010 Ga0495648_0002010_7364_7645 93
473 3300046524 Ga0495648_0010271 Ga0495648_0010271_6575_6856 93
474 3300046524 Ga0495648_0025513 Ga0495648_0025513_134_415 93
475 3300046524 Ga0495648_0033204 Ga0495648_0033204_275_556 93
476 3300046524 Ga0495648_0086748 Ga0495648_0086748_773_1054 93
477 3300046524 Ga0495648_0483567 Ga0495648_0483567_56_337 93
478 3300046526 Ga0495666_0002069 Ga0495666_0002069_2837_3118 93
479 3300046526 Ga0495666_0004705 Ga0495666_0004705_226_507 93
480 3300046526 Ga0495666_0203230 Ga0495666_0203230_350_631 93
481 3300046526 Ga0495666_0574002 Ga0495666_0574002_99_380 93
482 3300046528 Ga0495642_0000231 Ga0495642_0000231_19479_19760 93
483 3300046528 Ga0495642_0007466 Ga0495642_0007466_2262_2543 93
484 3300046530 Ga0495654_0002895 Ga0495654_0002895_214_495 93
485 3300046530 Ga0495654_0004614 Ga0495654_0004614_7531_7812 93
486 3300046530 Ga0495654_0007837 Ga0495654_0007837_4850_5131 93
487 3300046530 Ga0495654_0011817 Ga0495654_0011817_2550_2831 93
488 3300046530 Ga0495654_0015690 Ga0495654_0015690_483_764 93
489 3300046530 Ga0495654_0017619 Ga0495654_0017619_142_423 93
490 3300046530 Ga0495654_0433818 Ga0495654_0433818_96_377 93
491 3300046531 Ga0495665_0131052 Ga0495665_0131052_599_883 93
492 3300046537 Ga0495598_0044642 Ga0495598_0044642_18_302 93
493 3300046538 Ga0495609_0004699 Ga0495609_0004699_2890_3171 93
494 3300046538 Ga0495609_0007646 Ga0495609_0007646_907_1188 93
495 3300046538 Ga0495609_0158782 Ga0495609_0158782_40_321 93
496 3300046538 Ga0495609_0160730 Ga0495609_0160730_631_912 93
497 3300046538 Ga0495609_0200777 Ga0495609_0200777_192_473 93
498 3300046538 Ga0495609_0231846 Ga0495609_0231846_207_488 93
499 3300046542 Ga0495597_0016354 Ga0495597_0016354_2887_3168 93
500 3300046542 Ga0495597_0050948 Ga0495597_0050948_934_1215 93
501 3300046542 Ga0495597_0099047 Ga0495597_0099047_75_356 93
502 3300046557 Ga0495622_0010557 Ga0495622_0010557_2180_2461 93
503 3300046557 Ga0495622_0092064 Ga0495622_0092064_431_712 93
504 3300046557 Ga0495622_0120410 Ga0495622_0120410_508_789 93
505 3300046557 Ga0495622_0402770 Ga0495622_0402770_228_509 93
506 3300046558 Ga0495633_0007110 Ga0495633_0007110_2573_2854 93
507 3300046558 Ga0495633_0077315 Ga0495633_0077315_728_1009 93
508 3300046558 Ga0495633_0087462 Ga0495633_0087462_740_1021 93
509 3300046616 Ga0495668_0010717 Ga0495668_0010717_4138_4419 93
510 3300046642 Ga0495634_0001289 Ga0495634_0001289_14488_14769 93
511 3300046648 Ga0495611_0015723 Ga0495611_0015723_1495_1776 93
512 3300046660 Ga0495625_0005424 Ga0495625_0005424_8385_8666 93
513 3300046660 Ga0495625_0009016 Ga0495625_0009016_7932_8213 93
514 3300046660 Ga0495625_0011860 Ga0495625_0011860_6431_6712 93
515 3300046660 Ga0495625_0041834 Ga0495625_0041834_660_941 93
516 3300046664 Ga0495659_0089481 Ga0495659_0089481_568_849 93
517 3300046664 Ga0495659_0123236 Ga0495659_0123236_216_497 93
518 3300046665 Ga0495661_0011981 Ga0495661_0011981_1422_1703 93
519 3300046665 Ga0495661_0044203 Ga0495661_0044203_526_807 93
520 3300046665 Ga0495661_0053604 Ga0495661_0053604_1260_1541 93
521 3300046674 Ga0495588_0009384 Ga0495588_0009384_1813_2094 93
522 3300046674 Ga0495588_0047982 Ga0495588_0047982_228_509 93
523 3300046674 Ga0495588_0112479 Ga0495588_0112479_1001_1282 93
524 3300046679 Ga0495623_0002460 Ga0495623_0002460_3155_3436 93
525 3300046679 Ga0495623_0007120 Ga0495623_0007120_3235_3516 93
526 3300046680 Ga0495646_0052317 Ga0495646_0052317_484_765 93
527 3300046684 Ga0495669_0083221 Ga0495669_0083221_509_790 93
528 3300046684 Ga0495669_0343256 Ga0495669_0343256_280_561 93
529 3300046689 Ga0495613_0147858 Ga0495613_0147858_442_723 93
530 3300046690 Ga0495624_0135552 Ga0495624_0135552_415_696 93
531 3300046691 Ga0495670_0002161 Ga0495670_0002161_461_742 93
532 3300046691 Ga0495670_0009471 Ga0495670_0009471_2902_3183 93
533 3300046691 Ga0495670_0109700 Ga0495670_0109700_522_803 93
534 3300046691 Ga0495670_0124583 Ga0495670_0124583_294_575 93
535 3300046691 Ga0495670_0356741 Ga0495670_0356741_202_483 93
536 3300046691 Ga0495670_0752563 Ga0495670_0752563_105_386 93
537 3300046691 Ga0495670_0770526 Ga0495670_0770526_104_391 93
538 3300046692 Ga0495671_0031930 Ga0495671_0031930_2166_2447 93
539 3300046692 Ga0495671_0127779 Ga0495671_0127779_576_857 93
540 3300046692 Ga0495671_0166423 Ga0495671_0166423_187_468 93
541 3300046694 Ga0495649_0000095 Ga0495649_0000095_23699_23980 93
542 3300046694 Ga0495649_0024772 Ga0495649_0024772_2772_3053 93
543 3300046694 Ga0495649_0026855 Ga0495649_0026855_2200_2481 93
544 3300046694 Ga0495649_0038244 Ga0495649_0038244_1129_1410 93
545 3300046694 Ga0495649_0207266 Ga0495649_0207266_332_613 93
546 3300046694 Ga0495649_0236518 Ga0495649_0236518_579_860 93
547 3300046694 Ga0495649_0551568 Ga0495649_0551568_252_533 93
548 3300046794 Ga0495589_0000199 Ga0495589_0000199_20824_21105 93
549 3300046794 Ga0495589_0009466 Ga0495589_0009466_1888_2169 93
550 3300046794 Ga0495589_0011985 Ga0495589_0011985_3052_3333 93
551 3300046794 Ga0495589_0091139 Ga0495589_0091139_645_926 93
552 3300046794 Ga0495589_0144244 Ga0495589_0144244_629_910 93
553 3300046810 Ga0495660_0000023 Ga0495660_0000023_197454_197738 93
554 3300046810 Ga0495660_0012349 Ga0495660_0012349_2172_2453 93
555 3300046810 Ga0495660_0014970 Ga0495660_0014970_1908_2189 93
556 3300046810 Ga0495660_0016611 Ga0495660_0016611_3293_3574 93
557 3300046810 Ga0495660_0030975 Ga0495660_0030975_712_993 93
558 3300046810 Ga0495660_0065501 Ga0495660_0065501_116_397 93
559 3300046810 Ga0495660_0078488 Ga0495660_0078488_99_380 93
560 3300046810 Ga0495660_0124607 Ga0495660_0124607_60_341 93
561 3300046810 Ga0495660_0273895 Ga0495660_0273895_360_641 93
562 3300046810 Ga0495660_0309822 Ga0495660_0309822_167_448 93
563 3300047317 Ga0495604_0020713 Ga0495604_0020713_11_292 93
564 3300047318 Ga0495636_0087388 Ga0495636_0087388_398_679 93
565 3300047319 Ga0495674_0030209 Ga0495674_0030209_4263_4544 93
566 3300047319 Ga0495674_1434889 Ga0495674_1434889_199_483 93
567 3300047320 Ga0495672_0001614 Ga0495672_0001614_2736_3017 93
568 3300047320 Ga0495672_0002964 Ga0495672_0002964_11891_12172 93
569 3300047320 Ga0495672_0003304 Ga0495672_0003304_1731_2012 93
570 3300047320 Ga0495672_0014441 Ga0495672_0014441_2361_2642 93
571 3300047320 Ga0495672_0124754 Ga0495672_0124754_487_768 93
572 3300047320 Ga0495672_0136669 Ga0495672_0136669_667_948 93
573 3300047320 Ga0495672_0477763 Ga0495672_0477763_186_467 93
574 3300047322 Ga0495680_0014308 Ga0495680_0014308_4959_5240 93
575 3300047322 Ga0495680_0016640 Ga0495680_0016640_84_365 93
576 3300047322 Ga0495680_0159865 Ga0495680_0159865_1124_1405 93
577 3300047323 Ga0495683_0000604 Ga0495683_0000604_13089_13370 93
578 3300047323 Ga0495683_0033580 Ga0495683_0033580_1016_1297 93
579 3300047323 Ga0495683_0082720 Ga0495683_0082720_271_552 93
580 3300047443 Ga0495687_057410 Ga0495687_057410_494_775 93
581 3300047443 Ga0495687_173789 Ga0495687_173789_322_603 93
582 3300047444 Ga0495675_0086816 Ga0495675_0086816_1078_1359 93
583 3300047446 Ga0495679_001784 Ga0495679_001784_10426_10707 93
584 3300047447 Ga0495685_003052 Ga0495685_003052_4587_4868 93
585 3300047447 Ga0495685_124053 Ga0495685_124053_207_488 93
586 3300047469 Ga0495673_0000957 Ga0495673_0000957_2058_2339 93
587 3300047469 Ga0495673_0003450 Ga0495673_0003450_2855_3136 93
588 3300047469 Ga0495673_0005239 Ga0495673_0005239_2261_2542 93
589 3300047469 Ga0495673_0027758 Ga0495673_0027758_2304_2585 93
590 3300047469 Ga0495673_0073814 Ga0495673_0073814_680_961 93
591 3300047470 Ga0495681_0001896 Ga0495681_0001896_10549_10830 93
592 3300047470 Ga0495681_0009188 Ga0495681_0009188_3907_4188 93
593 3300047470 Ga0495681_0016792 Ga0495681_0016792_1517_1798 93
594 3300047470 Ga0495681_0027486 Ga0495681_0027486_1210_1491 93
595 3300047470 Ga0495681_0350152 Ga0495681_0350152_254_535 93
596 3300047673 Ga0495593_0000903 Ga0495593_0000903_11159_11440 93
597 3300047673 Ga0495593_0104978 Ga0495593_0104978_485_766 93
598 3300048089 Ga0495614_0077121 Ga0495614_0077121_721_1002 93
599 3300048090 Ga0495615_0002720 Ga0495615_0002720_518_802 93
600 3300048091 Ga0495626_0001133 Ga0495626_0001133_10670_10951 93
601 3300048091 Ga0495626_0002819 Ga0495626_0002819_2674_2955 93
602 3300048091 Ga0495626_0058837 Ga0495626_0058837_114_395 93
603 3300048091 Ga0495626_0126736 Ga0495626_0126736_439_720 93
604 3300048091 Ga0495626_0187227 Ga0495626_0187227_477_758 93
605 3300048091 Ga0495626_0369595 Ga0495626_0369595_91_372 93
606 3300048905 Ga0496102_0001223 Ga0496102_0001223_9354_9635 93
607 3300048905 Ga0496102_0073644 Ga0496102_0073644_2276_2563 93
608 3300048906 Ga0496103_0000823 Ga0496103_0000823_8669_8950 93
609 3300048907 Ga0496104_0000514 Ga0496104_0000514_20452_20736 93
610 3300048911 Ga0496108_1163972 Ga0496108_1163972_224_508 93
611 3300048913 Ga0496110_0115942 Ga0496110_0115942_1319_1603 93
612 3300048914 Ga0496111_0821547 Ga0496111_0821547_120_401 93
613 3300048916 Ga0496113_0814912 Ga0496113_0814912_304_585 93
614 3300048919 Ga0496116_0000112 Ga0496116_0000112_55963_56247 93
615 3300048919 Ga0496116_0001003 Ga0496116_0001003_26713_26997 93
616 3300048919 Ga0496116_0006369 Ga0496116_0006369_9753_10034 93
617 3300048919 Ga0496116_0011788 Ga0496116_0011788_4630_4911 93
618 3300048919 Ga0496116_0013064 Ga0496116_0013064_314_598 93
619 3300048919 Ga0496116_0015601 Ga0496116_0015601_183_464 93
620 3300048919 Ga0496116_0051985 Ga0496116_0051985_1630_1914 93
621 3300048919 Ga0496116_0058673 Ga0496116_0058673_1473_1757 93
622 3300048919 Ga0496116_0192380 Ga0496116_0192380_77_361 93
623 3300048919 Ga0496116_0273013 Ga0496116_0273013_334_618 93
624 3300048919 Ga0496116_0276053 Ga0496116_0276053_165_446 93
625 3300048920 Ga0496117_0004007 Ga0496117_0004007_10123_10404 93
626 3300048920 Ga0496117_0013976 Ga0496117_0013976_4979_5260 93
627 3300048920 Ga0496117_0067627 Ga0496117_0067627_163_444 93
628 3300048920 Ga0496117_0068072 Ga0496117_0068072_682_966 93
629 3300048920 Ga0496117_0083412 Ga0496117_0083412_279_563 93
630 3300048920 Ga0496117_0152831 Ga0496117_0152831_927_1208 93
631 3300048920 Ga0496117_0170557 Ga0496117_0170557_730_1014 93
632 3300048920 Ga0496117_0179132 Ga0496117_0179132_135_419 93
633 3300048920 Ga0496117_0265985 Ga0496117_0265985_164_445 93
634 3300048920 Ga0496117_0278240 Ga0496117_0278240_170_454 93
635 3300048920 Ga0496117_0369737 Ga0496117_0369737_261_548 93
636 3300048920 Ga0496117_0401421 Ga0496117_0401421_158_442 93
637 3300048921 Ga0496118_0002977 Ga0496118_0002977_13675_13956 93
638 3300048921 Ga0496118_0011162 Ga0496118_0011162_8332_8613 93
639 3300048921 Ga0496118_0035604 Ga0496118_0035604_866_1147 93
640 3300048921 Ga0496118_0125271 Ga0496118_0125271_880_1164 93
641 3300048921 Ga0496118_0153834 Ga0496118_0153834_901_1185 93
642 3300048921 Ga0496118_0160248 Ga0496118_0160248_159_440 93
643 3300048921 Ga0496118_0165701 Ga0496118_0165701_825_1109 93
644 3300048921 Ga0496118_0175828 Ga0496118_0175828_444_728 93
645 3300048921 Ga0496118_0201686 Ga0496118_0201686_739_1020 93
646 3300048921 Ga0496118_0291062 Ga0496118_0291062_476_757 93
647 3300048921 Ga0496118_0311509 Ga0496118_0311509_140_424 93
648 3300048921 Ga0496118_0570494 Ga0496118_0570494_49_333 93
649 3300048922 Ga0496119_0000847 Ga0496119_0000847_13402_13686 93
650 3300048922 Ga0496119_0007444 Ga0496119_0007444_7867_8151 93
651 3300048922 Ga0496119_0014320 Ga0496119_0014320_5396_5680 93
652 3300048922 Ga0496119_0152341 Ga0496119_0152341_516_797 93
653 3300048922 Ga0496119_0269287 Ga0496119_0269287_452_733 93
654 3300048923 Ga0496120_0004876 Ga0496120_0004876_3223_3507 93
655 3300048923 Ga0496120_0041389 Ga0496120_0041389_1536_1820 93
656 3300048923 Ga0496120_0061416 Ga0496120_0061416_1401_1685 93
657 3300048923 Ga0496120_0133159 Ga0496120_0133159_973_1257 93
658 3300048923 Ga0496120_0154587 Ga0496120_0154587_213_500 93
659 3300048924 Ga0496121_0000097 Ga0496121_0000097_50807_51088 93
660 3300048924 Ga0496121_0013519 Ga0496121_0013519_2463_2747 93
661 3300048924 Ga0496121_0034157 Ga0496121_0034157_2283_2567 93
662 3300048924 Ga0496121_0037405 Ga0496121_0037405_1888_2169 93
663 3300048924 Ga0496121_0077588 Ga0496121_0077588_1182_1466 93
664 3300048924 Ga0496121_0264509 Ga0496121_0264509_203_487 93
665 3300048925 Ga0496122_0000067 Ga0496122_0000067_156323_156607 93
666 3300048925 Ga0496122_0003413 Ga0496122_0003413_13045_13326 93
667 3300048925 Ga0496122_0038151 Ga0496122_0038151_2526_2810 93
668 3300048925 Ga0496122_0075028 Ga0496122_0075028_1692_1976 93
669 3300048925 Ga0496122_0112971 Ga0496122_0112971_993_1277 93
670 3300048925 Ga0496122_0167868 Ga0496122_0167868_609_896 93
671 3300048925 Ga0496122_0214848 Ga0496122_0214848_533_814 93
672 3300048925 Ga0496122_0269285 Ga0496122_0269285_152_433 93
673 3300048926 Ga0496123_0000056 Ga0496123_0000056_74759_75043 93
674 3300048926 Ga0496123_0001391 Ga0496123_0001391_20734_21015 93
675 3300048926 Ga0496123_0007815 Ga0496123_0007815_4193_4477 93
676 3300048926 Ga0496123_0042687 Ga0496123_0042687_826_1110 93
677 3300048926 Ga0496123_0073455 Ga0496123_0073455_845_1129 93
678 3300048926 Ga0496123_0095355 Ga0496123_0095355_750_1037 93
679 3300048926 Ga0496123_0208862 Ga0496123_0208862_83_367 93
680 3300048926 Ga0496123_0232106 Ga0496123_0232106_139_420 93
681 3300048926 Ga0496123_0366142 Ga0496123_0366142_91_372 93
682 3300048927 Ga0496124_0000150 Ga0496124_0000150_28941_29225 93
683 3300048927 Ga0496124_0000247 Ga0496124_0000247_29621_29905 93
684 3300048927 Ga0496124_0006179 Ga0496124_0006179_2256_2540 93
685 3300048927 Ga0496124_0008088 Ga0496124_0008088_9219_9503 93
686 3300048927 Ga0496124_0038226 Ga0496124_0038226_348_632 93
687 3300048927 Ga0496124_0061033 Ga0496124_0061033_476_757 93
688 3300048927 Ga0496124_0083929 Ga0496124_0083929_276_557 93
689 3300048927 Ga0496124_0084502 Ga0496124_0084502_129_410 93
690 3300048927 Ga0496124_0110448 Ga0496124_0110448_1052_1333 93
691 3300048927 Ga0496124_0139680 Ga0496124_0139680_1487_1768 93
692 3300048927 Ga0496124_0142342 Ga0496124_0142342_589_870 93
693 3300048927 Ga0496124_0230626 Ga0496124_0230626_324_608 93
694 3300048927 Ga0496124_0233950 Ga0496124_0233950_971_1255 93
695 3300048927 Ga0496124_0443479 Ga0496124_0443479_487_771 93
696 3300048927 Ga0496124_0518559 Ga0496124_0518559_246_533 93
697 3300048927 Ga0496124_0835257 Ga0496124_0835257_178_459 93
698 3300048927 Ga0496124_0991124 Ga0496124_0991124_133_417 93
699 3300048928 Ga0496125_0000048 Ga0496125_0000048_215215_215505 93
700 3300048928 Ga0496125_0001267 Ga0496125_0001267_4052_4336 93
701 3300048928 Ga0496125_0005813 Ga0496125_0005813_2768_3049 93
702 3300048928 Ga0496125_0011522 Ga0496125_0011522_5310_5594 93
703 3300048928 Ga0496125_0016521 Ga0496125_0016521_6427_6711 93
704 3300048928 Ga0496125_0021219 Ga0496125_0021219_5155_5439 93
705 3300048928 Ga0496125_0092376 Ga0496125_0092376_405_686 93
706 3300048928 Ga0496125_0153496 Ga0496125_0153496_542_823 93
707 3300048928 Ga0496125_0197397 Ga0496125_0197397_12_296 93
708 3300048928 Ga0496125_0275150 Ga0496125_0275150_564_851 93
709 3300048928 Ga0496125_0286304 Ga0496125_0286304_546_830 93
710 3300048928 Ga0496125_0328633 Ga0496125_0328633_605_886 93
711 3300048928 Ga0496125_0624216 Ga0496125_0624216_137_424 93
712 3300048928 Ga0496125_0683133 Ga0496125_0683133_105_389 93
713 3300048929 Ga0496126_0050061 Ga0496126_0050061_612_893 93
714 3300048929 Ga0496126_0083434 Ga0496126_0083434_221_505 93
715 3300048929 Ga0496126_0145532 Ga0496126_0145532_264_548 93
716 3300048929 Ga0496126_0288064 Ga0496126_0288064_432_713 93
717 3300048929 Ga0496126_0462333 Ga0496126_0462333_510_797 93
718 3300048929 Ga0496126_0568155 Ga0496126_0568155_170_454 93
719 3300048929 Ga0496126_0742629 Ga0496126_0742629_368_652 93
720 3300048929 Ga0496126_1041310 Ga0496126_1041310_78_365 93
721 3300049459 Ga0495678_016179 Ga0495678_016179_136_417 93
722 3300049459 Ga0495678_029133 Ga0495678_029133_1568_1849 93
723 3300049459 Ga0495678_029443 Ga0495678_029443_476_757 93
724 3300049459 Ga0495678_042348 Ga0495678_042348_47_337 93
725 3300049460 Ga0495682_0065915 Ga0495682_0065915_561_842 93
726 3300049460 Ga0495682_0074495 Ga0495682_0074495_143_424 93
727 3300049460 Ga0495682_0299221 Ga0495682_0299221_136_417 93
728 3300049460 Ga0495682_0366744 Ga0495682_0366744_110_391 93
729 3300049513 Ga0501290_031375 Ga0501290_031375_17_349 93
730 3300049551 Ga0501335_015018 Ga0501335_015018_132_464 93
731 3300049571 Ga0501034_0114939 Ga0501034_0114939_250_534 93
732 3300049571 Ga0501034_0244190 Ga0501034_0244190_180_470 93
733 3300049571 Ga0501034_0264477 Ga0501034_0264477_1338_1619 93
734 3300049574 Ga0501038_0140963 Ga0501038_0140963_425_709 93
735 3300049579 Ga0501043_0018210 Ga0501043_0018210_4402_4692 93
736 3300049579 Ga0501043_0381375 Ga0501043_0381375_608_892 93
737 3300049580 Ga0501046_0015320 Ga0501046_0015320_4936_5220 93
738 3300049581 Ga0501047_0672521 Ga0501047_0672521_172_456 93
739 3300049652 Ga0501202_091395 Ga0501202_091395_423_710 93
740 3300049653 Ga0501206_022389 Ga0501206_022389_73_405 93
741 3300049658 Ga0501211_005242 Ga0501211_005242_837_1169 93
742 3300049661 Ga0501217_289699 Ga0501217_289699_18_305 93
743 3300049669 Ga0501235_001027 Ga0501235_001027_1399_1731 93
744 3300049670 Ga0501236_023660 Ga0501236_023660_265_597 93
745 3300049673 Ga0501240_017619 Ga0501240_017619_58_339 93
746 3300049675 Ga0501243_107875 Ga0501243_107875_163_495 93
747 3300049705 Ga0501225_0007311 Ga0501225_0007311_2404_2736 93
748 3300049705 Ga0501225_0291406 Ga0501225_0291406_56_343 93
749 3300049708 Ga0501245_005492 Ga0501245_005492_275_607 93
750 3300049761 Ga0501264_005581 Ga0501264_005581_379_711 93
751 3300049777 Ga0501281_21911 Ga0501281_21911_138_470 93
752 3300050489 nmdc:mga03683_160815_c1 nmdc:mga03683_160815_c1_491_772 93
753 3300050489 nmdc:mga03683_298171_c1 nmdc:mga03683_298171_c1_74_355 93
754 3300050489 nmdc:mga03683_408802_c1 nmdc:mga03683_408802_c1_349_630 93
755 3300050489 nmdc:mga03683_476106_c1 nmdc:mga03683_476106_c1_289_570 93
756 3300050489 nmdc:mga03683_84215_c1 nmdc:mga03683_84215_c1_926_1207 93
757 3300050490 nmdc:mga03n38_276812_c1 nmdc:mga03n38_276812_c1_149_430 93
758 3300050491 nmdc:mga00v17_1066996_c1 nmdc:mga00v17_1066996_c1_122_403 93
759 3300050491 nmdc:mga00v17_199939_c1 nmdc:mga00v17_199939_c1_649_930 93
760 3300050491 nmdc:mga00v17_853315_c1 nmdc:mga00v17_853315_c1_194_475 93
761 3300050491 nmdc:mga00v17_917402_c1 nmdc:mga00v17_917402_c1_78_359 93
762 3300050491 nmdc:mga00v17_918451_c1 nmdc:mga00v17_918451_c1_11_292 93
763 3300050491 nmdc:mga00v17_923703_c1 nmdc:mga00v17_923703_c1_28_315 93
764 3300050496 nmdc:mga07m45_393668_c1 nmdc:mga07m45_393668_c1_91_372 93
765 3300050514 nmdc:mga08x19_1027785_c1 nmdc:mga08x19_1027785_c1_160_441 93
766 3300050514 nmdc:mga08x19_80812_c1 nmdc:mga08x19_80812_c1_828_1109 93
767 3300053096 Ga0500641_0011666 Ga0500641_0011666_924_1208 93
768 3300053126 Ga0500621_048640 Ga0500621_048640_1416_1697 93
769 3300053142 Ga0500577_0003180 Ga0500577_0003180_2999_3289 93
770 3300053153 Ga0500616_0191680 Ga0500616_0191680_303_584 93
771 3300053729 Ga0500625_002649 Ga0500625_002649_2345_2626 93
772 iso_pu_bacteria 2599185161 2599364774 93
773 iso_pu_bacteria 2599185162 2599371105 93
774 iso_pu_bacteria 2599185163 2599377467 93
775 iso_pu_bacteria 2599185164 2599381422 93
776 iso_pu_bacteria 2599185165 2599388434 93
777 iso_pu_bacteria 2599185166 2599396329 93
778 iso_pu_bacteria 2599185168 2599408516 93
779 iso_pu_bacteria 2599185181 2599463150 93
780 iso_pu_bacteria 2599185186 2599492167 93
781 iso_pu_bacteria 2599185356 2600215778 93
782 iso_pu_bacteria 2600255313 2601775945 93

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

5

86

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxe-assembly1.cif.gz_D-2 crystal structure of the intact e. coli relbe toxin-antitoxin complex 0.9765 3 80
4fxe-assembly1.cif.gz_E crystal structure of the intact e. coli relbe toxin-antitoxin complex 0.9666 3 83
4fxe-assembly1.cif.gz_D-2 crystal structure of the intact e. coli relbe toxin-antitoxin complex 0.9633 3 80
4v7j-assembly2.cif.gz_By structure of rele nuclease bound to the 70s ribosome (precleavage state) 0.9622 3 93
4v7k-assembly2.cif.gz_By structure of rele nuclease bound to the 70s ribosome (postcleavage state) 0.9593 3 93
ID Description Score Start End Superfamily
4fxeF00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.981 3 80 3.30.2310.20
4fxeD00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9765 3 80 3.30.2310.20
4fxeD00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9633 3 80 3.30.2310.20
4fxeF00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9569 3 80 3.30.2310.20
af_Q8VWG2_13_142_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.9011 50 80 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A3S4J7T8-F1-model_v4 RelE toxin (EC 3.1.-.-) 1.008 1 65 GO:0016787
AF-A0A2H0HT33-F1-model_v4 Type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family 1.007 1 68
AF-A0A1P8EU37-F1-model_v4 deleted 1.004 1 93
AF-A0A3P1WM56-F1-model_v4 Type II toxin-antitoxin system mRNA interferase RelE 1.004 1 68
AF-A0A1V3K7R2-F1-model_v4 deleted 1.003 1 93

Feature Viewer

pLDDT pTM Quality
92.32 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map