F480515

General Info

Members Datasets Scaffolds Average Seq Length
780 366 1560 117

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10045041|Ga0105248_100450414
Length 141
Sequence LSIPDEVVRRSVASIRGFDLKENNMEYMILIYGDESAFGGLKEAQLKAMYAEYGTYTQELMKAGVMRSGSELKPASTATTVRLRSGKVLTTDGPFAETKEQLGGYYLIDVPNLDAAVKWAGKCPGAKTGSVEVRPLNSMGK

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
200 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
201 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
202 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
203 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
204 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
205 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
208 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
209 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
210 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
211 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
212 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
215 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
218 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
219 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
220 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
221 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
235 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
236 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
237 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
238 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
239 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
240 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
241 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
242 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
245 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
263 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
264 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
265 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
266 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
267 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
270 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
273 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
274 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
277 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
278 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
292 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
299 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
300 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
301 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
302 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
329 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
337 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
338 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
339 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
353 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
356 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
357 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
358 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
359 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
360 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
361 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
362 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
363 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
364 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
365 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
366 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.08
Nodule 0
Rhizoplane 4.87
Rhizosphere 86.92
Stem 0
Stem Tuber 0
Unclassified 4.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10045041 3300009177 Bacteria 4947
2 JGI24746J21847_1044255 3300001977 Bacteria 622
3 JGI24737J22298_10075858 3300001990 Bacteria 1002
4 JGI24743J22301_10004185 3300001991 Bacteria 2334
5 JGI24744J21845_10000631 3300002077 Bacteria 6425
6 JGI24742J22300_10084579 3300002244 Bacteria 602
7 Ga0058863_11661298 3300004799 Bacteria 554
8 Ga0058861_11552989 3300004800 Bacteria 556
9 Ga0058862_11146068 3300004803 Bacteria 567
10 Ga0058862_11897661 3300004803 Bacteria 538
11 Ga0065714_10147543 3300005288 Bacteria 1127
12 Ga0065712_10069206 3300005290 Bacteria 7733
13 Ga0065707_10515230 3300005295 Bacteria 715
14 Ga0070676_10352685 3300005328 Bacteria 1012
15 Ga0070676_10459540 3300005328 Bacteria 897
16 Ga0070676_11447634 3300005328 Bacteria 528
17 Ga0070683_100056136 3300005329 Bacteria 3657
18 Ga0070683_100581809 3300005329 Bacteria 1071
19 Ga0070683_101077724 3300005329 Bacteria 772
20 Ga0070683_101517579 3300005329 Bacteria 644
21 Ga0070690_100007074 3300005330 Bacteria 6405
22 Ga0070690_100021315 3300005330 Bacteria 3955
23 Ga0070670_101521389 3300005331 Bacteria 614
24 Ga0068869_100466488 3300005334 Bacteria 1049
25 Ga0068869_100691186 3300005334 Bacteria 869
26 Ga0068869_100792073 3300005334 Bacteria 814
27 Ga0068869_101622911 3300005334 Bacteria 576
28 Ga0070666_10522019 3300005335 Bacteria 862
29 Ga0070666_11395413 3300005335 Unclassified 523
30 Ga0070680_100037543 3300005336 Bacteria 3914
31 Ga0070680_100102234 3300005336 Bacteria 2380
32 Ga0070680_100834217 3300005336 Bacteria 795
33 Ga0070680_101631021 3300005336 Bacteria 559
34 Ga0070682_100033754 3300005337 Bacteria 3111
35 Ga0070682_101063546 3300005337 Bacteria 675
36 Ga0068868_100012289 3300005338 Bacteria 6256
37 Ga0068868_100043988 3300005338 Bacteria 3490
38 Ga0070660_100489420 3300005339 Bacteria 1023
39 Ga0070689_100011209 3300005340 Bacteria 6415
40 Ga0070689_100748221 3300005340 Unclassified 856
41 Ga0070689_100801023 3300005340 Bacteria 828
42 Ga0070689_102163021 3300005340 Bacteria 510
43 Ga0070691_10030038 3300005341 Bacteria 2545
44 Ga0070691_10269084 3300005341 Bacteria 920
45 Ga0070691_10794119 3300005341 Bacteria 576
46 Ga0070687_100002834 3300005343 Bacteria 6623
47 Ga0070692_10130481 3300005345 Bacteria 1412
48 Ga0070692_10185080 3300005345 Bacteria 1210
49 Ga0070692_10840710 3300005345 Bacteria 630
50 Ga0070669_100142073 3300005353 Bacteria 1852
51 Ga0070669_100642622 3300005353 Bacteria 892
52 Ga0070669_101308394 3300005353 Bacteria 628
53 Ga0070675_100055736 3300005354 Bacteria 3254
54 Ga0070675_100070120 3300005354 Bacteria 2905
55 Ga0070671_100010532 3300005355 Bacteria 7424
56 Ga0070671_100058567 3300005355 Bacteria 3206
57 Ga0070674_100061489 3300005356 Bacteria 2621
58 Ga0070674_102053203 3300005356 Unclassified 521
59 Ga0070673_100006456 3300005364 Bacteria 7623
60 Ga0070673_101382972 3300005364 Bacteria 662
61 Ga0070688_100010397 3300005365 Bacteria 5130
62 Ga0070659_100050250 3300005366 Bacteria 3278
63 Ga0070659_100522221 3300005366 Bacteria 1014
64 Ga0070667_100000979 3300005367 Bacteria 26248
65 Ga0070667_100025576 3300005367 Bacteria 4908
66 Ga0070667_100989087 3300005367 Bacteria 785
67 Ga0070709_10386102 3300005434 Bacteria 1042
68 Ga0070713_100020052 3300005436 Bacteria 5118
69 Ga0070710_10169970 3300005437 Bacteria 1358
70 Ga0070701_10001504 3300005438 Bacteria 8633
71 Ga0070701_10237961 3300005438 Bacteria 1094
72 Ga0070711_100102295 3300005439 Bacteria 2086
73 Ga0070711_101907098 3300005439 Bacteria 522
74 Ga0070705_100019324 3300005440 Bacteria 3586
75 Ga0070705_100251321 3300005440 Bacteria 1241
76 Ga0070705_100330573 3300005440 Bacteria 1104
77 Ga0070705_101055204 3300005440 Bacteria 662
78 Ga0070700_100010408 3300005441 Bacteria 5135
79 Ga0070700_100039114 3300005441 Bacteria 2895
80 Ga0070700_100311556 3300005441 Bacteria 1153
81 Ga0070700_100871485 3300005441 Bacteria 731
82 Ga0070700_101405853 3300005441 Bacteria 590
83 Ga0070694_100149132 3300005444 Bacteria 1706
84 Ga0070694_100604247 3300005444 Bacteria 884
85 Ga0070708_100054773 3300005445 Unclassified 3544
86 Ga0070708_100060923 3300005445 Bacteria 3370
87 Ga0070708_100189804 3300005445 Bacteria 1922
88 Ga0070708_100651766 3300005445 Bacteria 992
89 Ga0070663_100021630 3300005455 Bacteria 4282
90 Ga0070663_100452870 3300005455 Bacteria 1058
91 Ga0070678_100019828 3300005456 Bacteria 4396
92 Ga0070678_100801641 3300005456 Unclassified 855
93 Ga0070678_102174222 3300005456 Bacteria 526
94 Ga0070662_100057493 3300005457 Bacteria 2826
95 Ga0070662_101060814 3300005457 Bacteria 695
96 Ga0070681_10024348 3300005458 Bacteria 6094
97 Ga0070681_10275499 3300005458 Bacteria 1594
98 Ga0070681_10627184 3300005458 Bacteria 990
99 Ga0070681_10926066 3300005458 Bacteria 790
100 Ga0070681_11098807 3300005458 Bacteria 716
101 Ga0070681_11146708 3300005458 Bacteria 699
102 Ga0068867_100148479 3300005459 Bacteria 1839
103 Ga0068867_100807610 3300005459 Bacteria 837
104 Ga0068867_101778186 3300005459 Bacteria 579
105 Ga0070685_10007470 3300005466 Bacteria 5592
106 Ga0070706_100013322 3300005467 Bacteria 7604
107 Ga0070706_101431022 3300005467 Bacteria 632
108 Ga0070707_100015083 3300005468 Bacteria 7251
109 Ga0070707_100185717 3300005468 Bacteria 2027
110 Ga0070707_100200507 3300005468 Bacteria 1945
111 Ga0070699_100003196 3300005518 Bacteria 14491
112 Ga0070699_100279240 3300005518 Bacteria 1496
113 Ga0070679_100000530 3300005530 Bacteria 32442
114 Ga0070684_100115542 3300005535 Bacteria 2410
115 Ga0070697_101161453 3300005536 Bacteria 688
116 Ga0070697_101229744 3300005536 Bacteria 668
117 Ga0068853_100265287 3300005539 Bacteria 1580
118 Ga0070672_100004964 3300005543 Bacteria 8759
119 Ga0070686_100000611 3300005544 Bacteria 21012
120 Ga0070686_100573680 3300005544 Bacteria 885
121 Ga0070686_100631698 3300005544 Bacteria 847
122 Ga0070695_100677990 3300005545 Bacteria 816
123 Ga0070696_100049413 3300005546 Bacteria 2922
124 Ga0070696_100142741 3300005546 Bacteria 1752
125 Ga0070696_101290145 3300005546 Bacteria 620
126 Ga0070693_100048473 3300005547 Bacteria 2419
127 Ga0070693_100242124 3300005547 Bacteria 1192
128 Ga0070693_101120113 3300005547 Bacteria 601
129 Ga0070665_100008989 3300005548 Bacteria 10119
130 Ga0070665_100350547 3300005548 Bacteria 1481
131 Ga0070704_100043956 3300005549 Bacteria 3101
132 Ga0070704_100044223 3300005549 Bacteria 3093
133 Ga0070704_100112508 3300005549 Bacteria 2074
134 Ga0070704_100366380 3300005549 Unclassified 1220
135 Ga0070704_101900754 3300005549 Bacteria 552
136 Ga0068855_100040359 3300005563 Bacteria 5540
137 Ga0068855_102319005 3300005563 Bacteria 537
138 Ga0070664_100012516 3300005564 Bacteria 6900
139 Ga0070664_100114737 3300005564 Bacteria 2354
140 Ga0068857_100027960 3300005577 Bacteria 4973
141 Ga0068857_100311364 3300005577 Bacteria 1452
142 Ga0068854_100337533 3300005578 Bacteria 1230
143 Ga0068854_100629923 3300005578 Bacteria 919
144 Ga0068856_100070376 3300005614 Bacteria 3461
145 Ga0070702_100001563 3300005615 Bacteria 9434
146 Ga0070702_100010533 3300005615 Bacteria 4559
147 Ga0070702_100085477 3300005615 Bacteria 1900
148 Ga0070702_100342917 3300005615 Bacteria 1049
149 Ga0070702_101677106 3300005615 Unclassified 528
150 Ga0068852_100144006 3300005616 Bacteria 2208
151 Ga0068859_100016447 3300005617 Bacteria 7430
152 Ga0068859_100043426 3300005617 Bacteria 4517
153 Ga0068859_100401176 3300005617 Bacteria 1467
154 Ga0068859_100665631 3300005617 Unclassified 1133
155 Ga0068864_100006740 3300005618 Bacteria 9406
156 Ga0068864_100014058 3300005618 Bacteria 6639
157 Ga0068866_10017845 3300005718 Bacteria 3198
158 Ga0068866_10036563 3300005718 Bacteria 2406
159 Ga0068866_10098692 3300005718 Bacteria 1607
160 Ga0068866_10251690 3300005718 Bacteria 1081
161 Ga0068866_10348755 3300005718 Bacteria 940
162 Ga0068861_100002590 3300005719 Bacteria 11835
163 Ga0068861_100031862 3300005719 Bacteria 3877
164 Ga0068861_100082547 3300005719 Bacteria 2519
165 Ga0068861_100249540 3300005719 Bacteria 1513
166 Ga0068851_10560351 3300005834 Bacteria 691
167 Ga0068870_10005655 3300005840 Bacteria 5468
168 Ga0068870_10420999 3300005840 Bacteria 874
169 Ga0068870_10616973 3300005840 Bacteria 739
170 Ga0068863_100056878 3300005841 Bacteria 3702
171 Ga0068858_100005213 3300005842 Bacteria 12736
172 Ga0068858_100009173 3300005842 Bacteria 9457
173 Ga0068858_100066405 3300005842 Bacteria 3339
174 Ga0068858_100404017 3300005842 Bacteria 1313
175 Ga0068860_100065302 3300005843 Bacteria 3456
176 Ga0068860_100091398 3300005843 Bacteria 2900
177 Ga0068860_100132741 3300005843 Bacteria 2390
178 Ga0068860_100153452 3300005843 Bacteria 2219
179 Ga0068860_100322665 3300005843 Bacteria 1516
180 Ga0068860_101365286 3300005843 Bacteria 730
181 Ga0068860_101588237 3300005843 Bacteria 676
182 Ga0068862_100029728 3300005844 Bacteria 4604
183 Ga0068862_100033465 3300005844 Bacteria 4345
184 Ga0068862_100091972 3300005844 Bacteria 2643
185 Ga0068862_100228767 3300005844 Bacteria 1686
186 Ga0081538_10039083 3300005981 Bacteria 3049
187 Ga0081538_10320074 3300005981 Bacteria 565
188 Ga0070717_10006806 3300006028 Bacteria 8439
189 Ga0070717_10225848 3300006028 Bacteria 1647
190 Ga0075365_10046664 3300006038 Bacteria 2846
191 Ga0075368_10064120 3300006042 Bacteria 1475
192 Ga0075368_10586015 3300006042 Bacteria 504
193 Ga0070715_10104743 3300006163 Bacteria 1325
194 Ga0070712_100144862 3300006175 Bacteria 1817
195 Ga0070712_100291280 3300006175 Bacteria 1318
196 Ga0070712_101382338 3300006175 Bacteria 614
197 Ga0070712_101688152 3300006175 Bacteria 554
198 Ga0075362_10122739 3300006177 Bacteria 1231
199 Ga0075367_10009456 3300006178 Bacteria 5095
200 Ga0097621_100000225 3300006237 Bacteria 37800
201 Ga0097621_100007400 3300006237 Bacteria 7853
202 Ga0097621_100037204 3300006237 Bacteria 3897
203 Ga0097621_100808651 3300006237 Bacteria 869
204 Ga0097621_102186112 3300006237 Unclassified 529
205 Ga0075370_10207528 3300006353 Bacteria 1156
206 Ga0075370_10392827 3300006353 Bacteria 832
207 Ga0075370_10614769 3300006353 Bacteria 659
208 Ga0068871_100001634 3300006358 Bacteria 15100
209 Ga0068871_100172230 3300006358 Bacteria 1856
210 Ga0068871_100200992 3300006358 Bacteria 1720
211 Ga0068871_100583640 3300006358 Bacteria 1015
212 Ga0075428_100000136 3300006844 Bacteria 64933
213 Ga0075428_100005377 3300006844 Bacteria 14240
214 Ga0075428_100027908 3300006844 Bacteria 6246
215 Ga0075428_100742179 3300006844 Unclassified 1045
216 Ga0075428_102154234 3300006844 Bacteria 576
217 Ga0075430_100001894 3300006846 Bacteria 17146
218 Ga0075430_100051969 3300006846 Bacteria 3451
219 Ga0075430_100245702 3300006846 Bacteria 1483
220 Ga0075431_100018587 3300006847 Bacteria 7081
221 Ga0075431_100037720 3300006847 Bacteria 4976
222 Ga0075431_101414964 3300006847 Bacteria 655
223 Ga0075431_102044395 3300006847 Bacteria 528
224 Ga0075433_10002714 3300006852 Bacteria 13517
225 Ga0075433_10289416 3300006852 Bacteria 1451
226 Ga0075433_11058483 3300006852 Bacteria 706
227 Ga0075433_11366517 3300006852 Bacteria 613
228 Ga0075434_100012330 3300006871 Bacteria 8098
229 Ga0075434_100123704 3300006871 Bacteria 2603
230 Ga0075434_100128779 3300006871 Bacteria 2549
231 Ga0075429_100000739 3300006880 Bacteria 25629
232 Ga0075429_100102491 3300006880 Bacteria 2499
233 Ga0075429_100237966 3300006880 Bacteria 1595
234 Ga0075429_100460127 3300006880 Bacteria 1115
235 Ga0068865_100028121 3300006881 Bacteria 3721
236 Ga0068865_100046324 3300006881 Bacteria 2983
237 Ga0068865_100824937 3300006881 Bacteria 802
238 Ga0068865_101691804 3300006881 Bacteria 570
239 Ga0068865_101828504 3300006881 Unclassified 549
240 Ga0075436_100883275 3300006914 Bacteria 668
241 Ga0097620_100016447 3300006931 Bacteria 7430
242 Ga0097620_100043428 3300006931 Bacteria 4517
243 Ga0097620_100401189 3300006931 Bacteria 1467
244 Ga0097620_100665634 3300006931 Unclassified 1133
245 Ga0075435_100103986 3300007076 Bacteria 2356
246 Ga0075435_100178130 3300007076 Bacteria 1796
247 Ga0075435_100690309 3300007076 Bacteria 887
248 Ga0099794_10002204 3300007265 Bacteria 7118
249 Ga0099794_10348371 3300007265 Bacteria 770
250 Ga0099794_10393847 3300007265 Bacteria 723
251 Ga0105240_10011300 3300009093 Bacteria 12441
252 Ga0105240_10804478 3300009093 Unclassified 1018
253 Ga0105240_11847341 3300009093 Bacteria 629
254 Ga0111539_10006965 3300009094 Bacteria 14511
255 Ga0111539_10022933 3300009094 Bacteria 7664
256 Ga0111539_10038680 3300009094 Bacteria 5757
257 Ga0111539_10147678 3300009094 Bacteria 2753
258 Ga0111539_10457456 3300009094 Bacteria 1486
259 Ga0111539_10613985 3300009094 Bacteria 1266
260 Ga0111539_12610727 3300009094 Unclassified 586
261 Ga0105245_10001938 3300009098 Bacteria 18801
262 Ga0105245_10010659 3300009098 Bacteria 7996
263 Ga0105245_10025116 3300009098 Bacteria 5239
264 Ga0105245_10043998 3300009098 Bacteria 3984
265 Ga0105245_10069034 3300009098 Bacteria 3204
266 Ga0105245_10649060 3300009098 Bacteria 1085
267 Ga0105245_11799145 3300009098 Bacteria 665
268 Ga0105247_10008360 3300009101 Bacteria 6308
269 Ga0114129_10006715 3300009147 Bacteria 16338
270 Ga0114129_10043926 3300009147 Bacteria 6287
271 Ga0114129_10172173 3300009147 Bacteria 2950
272 Ga0114129_10521713 3300009147 Bacteria 1549
273 Ga0105243_10134960 3300009148 Bacteria 2098
274 Ga0105243_10258697 3300009148 Bacteria 1557
275 Ga0105243_10384743 3300009148 Bacteria 1299
276 Ga0105243_10871838 3300009148 Bacteria 893
277 Ga0105241_11025211 3300009174 Bacteria 773
278 Ga0105241_11085002 3300009174 Bacteria 753
279 Ga0105242_10044048 3300009176 Bacteria 3612
280 Ga0105242_10065341 3300009176 Bacteria 3001
281 Ga0105242_10541114 3300009176 Bacteria 1115
282 Ga0105242_12277240 3300009176 Bacteria 588
283 Ga0105248_10018049 3300009177 Bacteria 7788
284 Ga0105248_10105401 3300009177 Bacteria 3179
285 Ga0105248_10263112 3300009177 Bacteria 1942
286 Ga0105248_11354110 3300009177 Bacteria 805
287 Ga0105237_10516606 3300009545 Bacteria 1201
288 Ga0105237_11133889 3300009545 Bacteria 789
289 Ga0105238_10745003 3300009551 Bacteria 993
290 Ga0105249_10044394 3300009553 Bacteria 4042
291 Ga0105249_10230097 3300009553 Bacteria 1828
292 Ga0099796_10015895 3300010159 Bacteria 2211
293 Ga0105239_10177864 3300010375 Bacteria 2380
294 Ga0105239_10964766 3300010375 Bacteria 980
295 Ga0105246_10028252 3300011119 Bacteria 3683
296 Ga0105246_10101579 3300011119 Bacteria 2095
297 Ga0105246_11315786 3300011119 Bacteria 670
298 Ga0157373_11142058 3300013100 Bacteria 585
299 Ga0157374_10018246 3300013296 Bacteria 6190
300 Ga0157374_10343254 3300013296 Bacteria 1483
301 Ga0157374_10373312 3300013296 Bacteria 1420
302 Ga0157374_11093275 3300013296 Bacteria 818
303 Ga0157374_11251880 3300013296 Bacteria 764
304 Ga0157374_11969064 3300013296 Bacteria 610
305 Ga0157378_10000764 3300013297 Bacteria 29926
306 Ga0157378_10064170 3300013297 Bacteria 3284
307 Ga0157378_10580810 3300013297 Bacteria 1130
308 Ga0163162_10217620 3300013306 Bacteria 2040
309 Ga0163162_10344989 3300013306 Bacteria 1622
310 Ga0163162_10373947 3300013306 Bacteria 1558
311 Ga0163162_10596588 3300013306 Unclassified 1231
312 Ga0163162_11105075 3300013306 Bacteria 898
313 Ga0163162_11709121 3300013306 Bacteria 719
314 Ga0163162_12740330 3300013306 Bacteria 567
315 Ga0157375_10015353 3300013308 Bacteria 6853
316 Ga0157375_10105511 3300013308 Bacteria 2908
317 Ga0157375_10150896 3300013308 Bacteria 2459
318 Ga0157375_10476499 3300013308 Bacteria 1413
319 Ga0163163_10167214 3300014325 Bacteria 2246
320 Ga0163163_11180391 3300014325 Bacteria 828
321 Ga0163163_12842558 3300014325 Bacteria 540
322 Ga0157380_10119947 3300014326 Bacteria 2226
323 Ga0157380_10126294 3300014326 Bacteria 2174
324 Ga0157380_10149036 3300014326 Bacteria 2020
325 Ga0157380_10345875 3300014326 Bacteria 1389
326 Ga0157380_10753789 3300014326 Bacteria 985
327 Ga0157380_13478792 3300014326 Unclassified 504
328 Ga0182008_10004992 3300014497 Bacteria 7637
329 Ga0157377_10084690 3300014745 Bacteria 1860
330 Ga0157379_10006573 3300014968 Bacteria 10032
331 Ga0157379_10027695 3300014968 Bacteria 5045
332 Ga0157379_10243347 3300014968 Bacteria 1632
333 Ga0157379_10601284 3300014968 Bacteria 1027
334 Ga0157379_11327012 3300014968 Bacteria 695
335 Ga0157379_12184639 3300014968 Bacteria 550
336 Ga0157376_10037814 3300014969 Bacteria 3923
337 Ga0157376_10902678 3300014969 Unclassified 902
338 Ga0182006_1000033 3300015261 Bacteria 238180
339 Ga0182007_10001557 3300015262 Bacteria 12229
340 Ga0182005_1000024 3300015265 Bacteria 238256
341 Ga0163161_10305281 3300017792 Bacteria 1254
342 Ga0163161_11440562 3300017792 Bacteria 603
343 Ga0163161_11462808 3300017792 Bacteria 599
344 Ga0213874_10429727 3300021377 Bacteria 518
345 Ga0207692_10076846 3300025898 Bacteria 1775
346 Ga0207642_10171883 3300025899 Bacteria 1173
347 Ga0207710_10006187 3300025900 Bacteria 5122
348 Ga0207688_10000189 3300025901 Bacteria 27212
349 Ga0207680_10125560 3300025903 Bacteria 1684
350 Ga0207647_10013420 3300025904 Bacteria 5679
351 Ga0207699_10326596 3300025906 Bacteria 1078
352 Ga0207645_10014573 3300025907 Bacteria 5257
353 Ga0207645_10267949 3300025907 Bacteria 1132
354 Ga0207643_10000943 3300025908 Bacteria 17451
355 Ga0207643_10156086 3300025908 Bacteria 1371
356 Ga0207705_10419998 3300025909 Bacteria 1035
357 Ga0207684_10008471 3300025910 Bacteria 9151
358 Ga0207684_11513015 3300025910 Unclassified 546
359 Ga0207654_10960506 3300025911 Bacteria 621
360 Ga0207707_10043943 3300025912 Bacteria 3896
361 Ga0207707_10510880 3300025912 Bacteria 1024
362 Ga0207707_11251312 3300025912 Bacteria 598
363 Ga0207695_10011536 3300025913 Bacteria 10693
364 Ga0207695_11654498 3300025913 Unclassified 521
365 Ga0207693_10295318 3300025915 Bacteria 1269
366 Ga0207693_10453968 3300025915 Bacteria 1001
367 Ga0207693_10482522 3300025915 Bacteria 968
368 Ga0207663_10413001 3300025916 Bacteria 1034
369 Ga0207663_11570679 3300025916 Bacteria 530
370 Ga0207660_10138981 3300025917 Bacteria 1856
371 Ga0207660_10340035 3300025917 Bacteria 1201
372 Ga0207660_10665653 3300025917 Bacteria 849
373 Ga0207660_10685912 3300025917 Bacteria 836
374 Ga0207662_10022370 3300025918 Bacteria 3624
375 Ga0207657_11480557 3300025919 Bacteria 508
376 Ga0207652_10031441 3300025921 Bacteria 4458
377 Ga0207646_10007557 3300025922 Bacteria 11019
378 Ga0207681_10088830 3300025923 Bacteria 2202
379 Ga0207681_10350230 3300025923 Bacteria 1182
380 Ga0207681_10804620 3300025923 Bacteria 785
381 Ga0207694_11658069 3300025924 Unclassified 538
382 Ga0207650_10040532 3300025925 Bacteria 3408
383 Ga0207659_10015245 3300025926 Bacteria 4974
384 Ga0207659_10230121 3300025926 Bacteria 1495
385 Ga0207659_11761525 3300025926 Bacteria 527
386 Ga0207687_10081064 3300025927 Bacteria 2344
387 Ga0207687_10301955 3300025927 Bacteria 1290
388 Ga0207687_10437098 3300025927 Bacteria 1083
389 Ga0207687_10661200 3300025927 Bacteria 884
390 Ga0207700_10166060 3300025928 Bacteria 1837
391 Ga0207664_10331128 3300025929 Bacteria 1345
392 Ga0207644_10004741 3300025931 Bacteria 8837
393 Ga0207706_10048058 3300025933 Bacteria 3774
394 Ga0207706_10117930 3300025933 Bacteria 2334
395 Ga0207706_10545720 3300025933 Bacteria 998
396 Ga0207686_10029598 3300025934 Bacteria 3232
397 Ga0207686_10080873 3300025934 Unclassified 2119
398 Ga0207686_10950197 3300025934 Bacteria 696
399 Ga0207709_10017464 3300025935 Bacteria 4004
400 Ga0207709_10125744 3300025935 Bacteria 1739
401 Ga0207709_10201132 3300025935 Bacteria 1423
402 Ga0207709_10582695 3300025935 Bacteria 884
403 Ga0207670_10011632 3300025936 Bacteria 5117
404 Ga0207670_10347745 3300025936 Bacteria 1173
405 Ga0207669_10196387 3300025937 Bacteria 1460
406 Ga0207669_10839303 3300025937 Bacteria 764
407 Ga0207669_10892225 3300025937 Unclassified 742
408 Ga0207704_10085296 3300025938 Bacteria 2055
409 Ga0207704_10356213 3300025938 Bacteria 1141
410 Ga0207691_10003140 3300025940 Bacteria 16146
411 Ga0207711_10003793 3300025941 Bacteria 12996
412 Ga0207711_10340888 3300025941 Bacteria 1387
413 Ga0207711_11006203 3300025941 Bacteria 773
414 Ga0207689_10003575 3300025942 Bacteria 14204
415 Ga0207689_10060683 3300025942 Bacteria 3110
416 Ga0207689_10853406 3300025942 Bacteria 768
417 Ga0207679_10015318 3300025945 Bacteria 5063
418 Ga0207679_10124718 3300025945 Bacteria 2056
419 Ga0207667_10017536 3300025949 Bacteria 8053
420 Ga0207667_10433476 3300025949 Bacteria 1337
421 Ga0207667_10834508 3300025949 Bacteria 916
422 Ga0207651_10011001 3300025960 Bacteria 5042
423 Ga0207651_10348217 3300025960 Bacteria 1247
424 Ga0207651_10744930 3300025960 Unclassified 866
425 Ga0207651_11227129 3300025960 Bacteria 673
426 Ga0207712_10067495 3300025961 Bacteria 2560
427 Ga0207712_10108292 3300025961 Bacteria 2079
428 Ga0207712_11555680 3300025961 Bacteria 593
429 Ga0207668_10018182 3300025972 Bacteria 4417
430 Ga0207640_10085464 3300025981 Bacteria 2169
431 Ga0207640_10561423 3300025981 Bacteria 961
432 Ga0207658_10120590 3300025986 Bacteria 2090
433 Ga0207658_10158254 3300025986 Bacteria 1854
434 Ga0207658_10160048 3300025986 Bacteria 1844
435 Ga0207677_10003357 3300026023 Bacteria 8482
436 Ga0207677_11332470 3300026023 Bacteria 660
437 Ga0207703_10028209 3300026035 Bacteria 4423
438 Ga0207703_10212296 3300026035 Bacteria 1726
439 Ga0207703_10473525 3300026035 Bacteria 1173
440 Ga0207639_10614642 3300026041 Bacteria 1003
441 Ga0207639_11791865 3300026041 Bacteria 574
442 Ga0207678_10001194 3300026067 Bacteria 23817
443 Ga0207708_10000641 3300026075 Bacteria 26841
444 Ga0207708_10007958 3300026075 Bacteria 7855
445 Ga0207702_10081058 3300026078 Bacteria 2818
446 Ga0207702_11413686 3300026078 Bacteria 689
447 Ga0207641_10035292 3300026088 Bacteria 4165
448 Ga0207641_10041780 3300026088 Bacteria 3844
449 Ga0207641_10087593 3300026088 Bacteria 2717
450 Ga0207648_10001650 3300026089 Bacteria 24468
451 Ga0207648_10011327 3300026089 Bacteria 8404
452 Ga0207648_10206240 3300026089 Bacteria 1744
453 Ga0207648_10330890 3300026089 Bacteria 1370
454 Ga0207676_10010466 3300026095 Bacteria 6607
455 Ga0207676_10081730 3300026095 Bacteria 2625
456 Ga0207676_10436895 3300026095 Unclassified 1231
457 Ga0207674_10018156 3300026116 Bacteria 7654
458 Ga0207674_10238372 3300026116 Bacteria 1766
459 Ga0207674_10705154 3300026116 Bacteria 974
460 Ga0207675_100001440 3300026118 Bacteria 23862
461 Ga0207675_100003691 3300026118 Bacteria 14910
462 Ga0207675_100164251 3300026118 Bacteria 2120
463 Ga0207675_100177853 3300026118 Bacteria 2036
464 Ga0207675_100235090 3300026118 Bacteria 1769
465 Ga0207675_102570105 3300026118 Bacteria 519
466 Ga0207683_10016908 3300026121 Bacteria 6207
467 Ga0207683_10025422 3300026121 Bacteria 5109
468 Ga0207683_10937082 3300026121 Bacteria 804
469 Ga0207698_10022096 3300026142 Bacteria 4413
470 Ga0209588_1000572 3300027671 Bacteria 9433
471 Ga0207428_10054088 3300027907 Bacteria 3198
472 Ga0207428_10117264 3300027907 Bacteria 2044
473 Ga0207428_10135824 3300027907 Bacteria 1880
474 Ga0268266_10021047 3300028379 Bacteria 5557
475 Ga0268266_11720069 3300028379 Bacteria 602
476 Ga0268265_10038036 3300028380 Bacteria 3536
477 Ga0268265_10107136 3300028380 Bacteria 2272
478 Ga0268265_10639223 3300028380 Bacteria 1021
479 Ga0268265_10860720 3300028380 Bacteria 887
480 Ga0268264_10006714 3300028381 Bacteria 9670
481 Ga0268264_10064138 3300028381 Bacteria 3091
482 Ga0268264_10436450 3300028381 Bacteria 1266
483 Ga0268264_10586410 3300028381 Bacteria 1097
484 Ga0265336_10166399 3300028666 Bacteria 656
485 Ga0307517_10263155 3300028786 Bacteria 999
486 Ga0307517_10407986 3300028786 Bacteria 717
487 Ga0307515_10005432 3300028794 Bacteria 25831
488 Ga0307515_10122903 3300028794 Bacteria 2924
489 Ga0307515_10317577 3300028794 Bacteria 1227
490 Ga0307512_10016492 3300030522 Bacteria 6819
491 Ga0265328_10021726 3300031239 Bacteria 2447
492 Ga0265320_10253273 3300031240 Bacteria 781
493 Ga0265329_10149399 3300031242 Bacteria 757
494 Ga0265340_10037079 3300031247 Bacteria 2416
495 Ga0265340_10125444 3300031247 Bacteria 1180
496 Ga0265340_10128986 3300031247 Bacteria 1161
497 Ga0265340_10190483 3300031247 Bacteria 925
498 Ga0265340_10261171 3300031247 Bacteria 771
499 Ga0265339_10474758 3300031249 Bacteria 579
500 Ga0265331_10016546 3300031250 Bacteria 3868
501 Ga0265327_10000028 3300031251 Bacteria 361066
502 Ga0265316_10175940 3300031344 Bacteria 1595
503 Ga0265316_10428528 3300031344 Unclassified 950
504 Ga0307509_10000426 3300031507 Bacteria 70899
505 Ga0307509_10002105 3300031507 Bacteria 32806
506 Ga0307509_10199457 3300031507 Bacteria 1840
507 Ga0307509_10593231 3300031507 Unclassified 781
508 Ga0307509_10623049 3300031507 Bacteria 750
509 Ga0307508_10005192 3300031616 Bacteria 12460
510 Ga0307508_10659081 3300031616 Bacteria 652
511 Ga0307514_10036312 3300031649 Bacteria 3917
512 Ga0307514_10067458 3300031649 Bacteria 2700
513 Ga0265314_10054163 3300031711 Bacteria 2777
514 Ga0265314_10644981 3300031711 Unclassified 541
515 Ga0265342_10072611 3300031712 Bacteria 2003
516 Ga0307516_10001925 3300031730 Bacteria 28437
517 Ga0307516_10026648 3300031730 Bacteria 5868
518 Ga0307518_10219170 3300031838 Bacteria 1244
519 Ga0307407_11298788 3300031903 Bacteria 571
520 Ga0307411_11464243 3300032005 Bacteria 627
521 Ga0307507_10215993 3300033179 Bacteria 1298
522 Ga0307510_10000088 3300033180 Bacteria 69071
523 Ga0307510_10006861 3300033180 Bacteria 13585
524 Ga0307510_10077439 3300033180 Bacteria 3261
525 Ga0307510_10324161 3300033180 Bacteria 996
526 Ga0373952_0016257 3300035092 Bacteria 1511
527 Ga0373939_0394191 3300035114 Bacteria 572
528 Ga0373954_0403564 3300035118 Bacteria 676
529 Ga0373943_0221108 3300035170 Bacteria 1055
530 Ga0373946_0044979 3300035171 Bacteria 1825
531 Ga0373946_0654773 3300035171 Bacteria 547
532 Ga0373931_0032969 3300035691 Bacteria 2683
533 Ga0373931_0053416 3300035691 Bacteria 2156
534 Ga0373931_0478593 3300035691 Bacteria 800
535 Ga0373935_0045996 3300035692 Bacteria 2756
536 Ga0373935_0476571 3300035692 Bacteria 904
537 Ga0373935_1027024 3300035692 Bacteria 613
538 Ga0373927_0038468 3300035695 Bacteria 3106
539 Ga0373927_0069283 3300035695 Bacteria 2283
540 Ga0373933_0104982 3300035724 Bacteria 1757
541 Ga0373933_0361000 3300035724 Bacteria 944
542 Ga0373947_0356743 3300035725 Bacteria 982
543 Ga0373947_0976018 3300035725 Bacteria 578
544 Ga0373937_0744996 3300036401 Bacteria 927
545 Ga0373925_0027474 3300037068 Bacteria 4165
546 Ga0373925_0263780 3300037068 Bacteria 1384
547 Ga0373925_0879779 3300037068 Bacteria 738
548 Ga0395905_1121261 3300037471 Bacteria 690
549 Ga0436364_0046427 3300037853 Bacteria 755
550 Ga0436364_0527691 3300037853 Bacteria 1693
551 Ga0436364_1041936 3300037853 Bacteria 1351
552 Ga0436365_0607910 3300039437 Bacteria 3065
553 Ga0436365_0916972 3300039437 Bacteria 7131
554 Ga0436365_0973927 3300039437 Bacteria 664
555 Ga0436360_1341154 3300039438 Bacteria 1514
556 Ga0436361_1093055 3300039447 Bacteria 682
557 Ga0436363_0926213 3300039450 Bacteria 1125
558 Ga0436362_0553147 3300039453 Bacteria 712
559 Ga0436362_0570944 3300039453 Unclassified 742
560 Ga0451793_0034844 3300041452 Bacteria 979
561 Ga0451797_0406438 3300041453 Bacteria 587
562 Ga0451802_1460824 3300041460 Bacteria 953
563 Ga0451837_0342159 3300041494 Bacteria 613
564 Ga0451847_0109149 3300041503 Bacteria 507
565 Ga0451577_0006653 3300042876 Bacteria 11477
566 Ga0451577_1328308 3300042876 Bacteria 639
567 Ga0466969_0046078 3300044656 Bacteria 2163
568 Ga0453683_0532227 3300044673 Bacteria 764
569 Ga0466966_0100847 3300044684 Bacteria 1786
570 Ga0466966_0765072 3300044684 Unclassified 582
571 Ga0466964_0004223 3300044706 Bacteria 5293
572 Ga0466959_0022530 3300045049 Bacteria 4658
573 Ga0466959_0411115 3300045049 Unclassified 919
574 Ga0451576_0389673 3300045051 Bacteria 1460
575 Ga0451576_1149622 3300045051 Bacteria 811
576 Ga0451576_2420815 3300045051 Unclassified 537
577 Ga0466958_0248170 3300045836 Unclassified 1138
578 Ga0466958_0468764 3300045836 Bacteria 816
579 Ga0495617_027992 3300046452 Bacteria 1895
580 Ga0495617_068566 3300046452 Bacteria 1167
581 Ga0495617_078261 3300046452 Bacteria 1084
582 Ga0495617_137084 3300046452 Bacteria 783
583 Ga0495592_0000307 3300046454 Bacteria 41229
584 Ga0495592_0234988 3300046454 Bacteria 1219
585 Ga0495592_0632099 3300046454 Bacteria 650
586 Ga0495592_0893785 3300046454 Bacteria 522
587 Ga0495603_0755002 3300046455 Bacteria 555
588 Ga0495590_0036439 3300046457 Bacteria 1716
589 Ga0495590_0118572 3300046457 Bacteria 948
590 Ga0495590_0120842 3300046457 Bacteria 939
591 Ga0495629_0546438 3300046459 Bacteria 778
592 Ga0495638_0051852 3300046460 Bacteria 2558
593 Ga0495650_0048231 3300046471 Bacteria 1777
594 Ga0495580_0000365 3300046472 Bacteria 36943
595 Ga0495580_0008399 3300046472 Bacteria 8214
596 Ga0495605_0003898 3300046474 Bacteria 8840
597 Ga0495605_0321332 3300046474 Bacteria 652
598 Ga0495664_0303937 3300046477 Bacteria 963
599 Ga0495584_0003202 3300046491 Bacteria 9107
600 Ga0495584_0080927 3300046491 Bacteria 1635
601 Ga0495584_0164087 3300046491 Bacteria 1129
602 Ga0495584_0286886 3300046491 Bacteria 836
603 Ga0495585_0019262 3300046492 Bacteria 3936
604 Ga0495585_0067927 3300046492 Bacteria 1948
605 Ga0495585_0208463 3300046492 Bacteria 992
606 Ga0495585_0527324 3300046492 Bacteria 559
607 Ga0495596_0084134 3300046500 Bacteria 1235
608 Ga0495607_0042439 3300046501 Bacteria 2695
609 Ga0495607_0046049 3300046501 Bacteria 2563
610 Ga0495583_0000947 3300046506 Bacteria 33746
611 Ga0495610_0014897 3300046512 Bacteria 4546
612 Ga0495610_0032850 3300046512 Bacteria 2690
613 Ga0495610_0129480 3300046512 Bacteria 1097
614 Ga0495616_0045199 3300046513 Bacteria 2230
615 Ga0495618_0400021 3300046514 Bacteria 840
616 Ga0495628_0389865 3300046516 Bacteria 1019
617 Ga0495628_0752947 3300046516 Bacteria 684
618 Ga0495630_0194872 3300046517 Bacteria 1546
619 Ga0495630_0922259 3300046517 Bacteria 665
620 Ga0495630_1408656 3300046517 Bacteria 524
621 Ga0495632_0172519 3300046519 Bacteria 993
622 Ga0495632_0485256 3300046519 Bacteria 534
623 Ga0495644_0003375 3300046523 Bacteria 6310
624 Ga0495644_0017511 3300046523 Bacteria 2738
625 Ga0495648_0007325 3300046524 Bacteria 8844
626 Ga0495648_0186695 3300046524 Bacteria 1049
627 Ga0495648_0370165 3300046524 Bacteria 649
628 Ga0495663_0014679 3300046525 Bacteria 2198
629 Ga0495640_0110990 3300046533 Bacteria 1792
630 Ga0495587_0124416 3300046536 Bacteria 1476
631 Ga0495598_0087090 3300046537 Bacteria 1012
632 Ga0495609_0065992 3300046538 Bacteria 1594
633 Ga0495609_0300700 3300046538 Bacteria 653
634 Ga0495609_0417317 3300046538 Unclassified 536
635 Ga0495633_0096206 3300046558 Bacteria 1375
636 Ga0495633_0190725 3300046558 Bacteria 942
637 Ga0495668_0465931 3300046616 Bacteria 696
638 Ga0495668_0814641 3300046616 Bacteria 517
639 Ga0495611_0013168 3300046648 Bacteria 3518
640 Ga0495611_0017599 3300046648 Bacteria 3058
641 Ga0495611_0096580 3300046648 Bacteria 1368
642 Ga0495625_0010661 3300046660 Bacteria 7574
643 Ga0495625_0019277 3300046660 Bacteria 5296
644 Ga0495659_0011058 3300046664 Bacteria 2906
645 Ga0495659_0346988 3300046664 Bacteria 634
646 Ga0495661_0057480 3300046665 Bacteria 2322
647 Ga0495661_0080855 3300046665 Bacteria 1874
648 Ga0495661_0191057 3300046665 Bacteria 1078
649 Ga0495588_0067029 3300046674 Bacteria 1863
650 Ga0495647_0129728 3300046681 Bacteria 1067
651 Ga0495658_0049549 3300046683 Bacteria 2373
652 Ga0495669_0169857 3300046684 Bacteria 1037
653 Ga0495613_0246340 3300046689 Bacteria 1248
654 Ga0495670_0010129 3300046691 Bacteria 4638
655 Ga0495670_0089022 3300046691 Bacteria 1578
656 Ga0495671_0001961 3300046692 Bacteria 13207
657 Ga0495671_0257137 3300046692 Bacteria 843
658 Ga0495660_0195520 3300046810 Bacteria 969
659 Ga0495636_0001420 3300047318 Bacteria 9056
660 Ga0495674_0220751 3300047319 Bacteria 1567
661 Ga0495672_0040004 3300047320 Bacteria 2846
662 Ga0495672_0134852 3300047320 Bacteria 1295
663 Ga0495676_0077450 3300047321 Bacteria 2535
664 Ga0495680_0069370 3300047322 Bacteria 2690
665 Ga0495683_0003427 3300047323 Bacteria 9251
666 Ga0495687_000814 3300047443 Bacteria 33460
667 Ga0495677_0003654 3300047445 Bacteria 5954
668 Ga0495677_0023619 3300047445 Bacteria 2231
669 Ga0495685_000505 3300047447 Bacteria 12081
670 Ga0495673_0022072 3300047469 Bacteria 3126
671 Ga0495673_0304380 3300047469 Bacteria 571
672 Ga0495686_0037169 3300047472 Bacteria 3121
673 Ga0495686_0145898 3300047472 Bacteria 1393
674 Ga0495602_0109999 3300048088 Bacteria 2241
675 Ga0495602_0385667 3300048088 Bacteria 1003
676 Ga0495602_0545447 3300048088 Bacteria 804
677 Ga0496100_0000681 3300048903 Bacteria 16202
678 Ga0496100_0079479 3300048903 Bacteria 2210
679 Ga0496101_0032590 3300048904 Bacteria 3669
680 Ga0496101_0089061 3300048904 Bacteria 2293
681 Ga0496102_0003713 3300048905 Bacteria 12906
682 Ga0496102_0331767 3300048905 Bacteria 1433
683 Ga0496103_0000914 3300048906 Bacteria 21169
684 Ga0496104_0107555 3300048907 Bacteria 2672
685 Ga0496104_0496498 3300048907 Bacteria 1131
686 Ga0496105_0000989 3300048908 Bacteria 19602
687 Ga0496105_0138315 3300048908 Bacteria 2005
688 Ga0496106_0002132 3300048909 Bacteria 14780
689 Ga0496107_0006476 3300048910 Bacteria 8053
690 Ga0496107_0099982 3300048910 Bacteria 2126
691 Ga0496108_0003622 3300048911 Bacteria 12377
692 Ga0496108_0565056 3300048911 Bacteria 992
693 Ga0496109_0004932 3300048912 Bacteria 11140
694 Ga0496109_0016929 3300048912 Bacteria 6380
695 Ga0496110_0001665 3300048913 Bacteria 16288
696 Ga0496110_0018198 3300048913 Bacteria 5887
697 Ga0496110_0583135 3300048913 Bacteria 1015
698 Ga0496111_0001993 3300048914 Bacteria 12146
699 Ga0496111_0004768 3300048914 Bacteria 8602
700 Ga0496111_0038413 3300048914 Bacteria 3430
701 Ga0496111_0399533 3300048914 Bacteria 1016
702 Ga0496112_0019227 3300048915 Bacteria 6442
703 Ga0496112_0203364 3300048915 Bacteria 1939
704 Ga0496112_0219542 3300048915 Bacteria 1857
705 Ga0496112_1468355 3300048915 Bacteria 596
706 Ga0496113_0003029 3300048916 Bacteria 9948
707 Ga0496113_0009473 3300048916 Bacteria 6389
708 Ga0496114_0015952 3300048917 Bacteria 6045
709 Ga0496114_0139838 3300048917 Bacteria 2095
710 Ga0496114_0193172 3300048917 Bacteria 1781
711 Ga0496115_0004015 3300048918 Bacteria 10621
712 Ga0496116_0020110 3300048919 Bacteria 5082
713 Ga0496118_0000031 3300048921 Bacteria 339329
714 Ga0496121_0011729 3300048924 Bacteria 9671
715 Ga0496122_0011135 3300048925 Bacteria 9161
716 Ga0496123_0016214 3300048926 Bacteria 6064
717 Ga0496124_0072543 3300048927 Bacteria 2851
718 Ga0496126_0380736 3300048929 Bacteria 1149
719 Ga0495682_0072795 3300049460 Bacteria 1236
720 Ga0501036_1335526 3300049572 Bacteria 582
721 Ga0501039_0654852 3300049575 Bacteria 822
722 Ga0501042_0243714 3300049578 Bacteria 1297
723 Ga0501042_1289959 3300049578 Bacteria 532
724 Ga0501043_0000097 3300049579 Bacteria 79736
725 Ga0501046_0000047 3300049580 Bacteria 140344
726 Ga0501047_0000058 3300049581 Bacteria 139202
727 Ga0501048_0016898 3300049582 Bacteria 5379
728 Ga0501048_0584880 3300049582 Bacteria 801
729 Ga0501075_0533049 3300049591 Bacteria 896
730 Ga0501075_0599843 3300049591 Bacteria 840
731 Ga0501257_007088 3300049686 Bacteria 2499
732 Ga0501079_1148966 3300049741 Bacteria 612
733 Ga0501083_0004308 3300049744 Bacteria 10024
734 Ga0501045_0006865 3300049824 Bacteria 7887
735 nmdc:mga07m45_248652_c1 3300050496 Bacteria 1035
736 nmdc:mga05p37_32045_c1 3300050507 Bacteria 6427
737 nmdc:mga05p37_47793_c1 3300050507 Bacteria 5262
738 nmdc:mga05p37_8685_c1 3300050507 Bacteria 12004
739 nmdc:mga09592_1041_c1 3300050508 Bacteria 22008
740 nmdc:mga09592_109087_c1 3300050508 Bacteria 2374
741 nmdc:mga09592_378678_c1 3300050508 Bacteria 1224
742 nmdc:mga09592_58916_c1 3300050508 Bacteria 3247
743 nmdc:mga0qj67_104_c1 3300050509 Bacteria 56273
744 nmdc:mga0qj67_1167851_c1 3300050509 Bacteria 600
745 nmdc:mga0qj67_609_c1 3300050509 Bacteria 24498
746 nmdc:mga06r32_1453_c1 3300050510 Bacteria 21382
747 nmdc:mga06r32_206810_c1 3300050510 Bacteria 528
748 nmdc:mga08y16_21766_c1 3300050511 Bacteria 6765
749 nmdc:mga08y16_23058_c1 3300050511 Bacteria 6571
750 nmdc:mga08y16_289720_c1 3300050511 Bacteria 1688
751 nmdc:mga08y16_38457_c1 3300050511 Bacteria 5024
752 nmdc:mga08y16_732241_c1 3300050511 Bacteria 986
753 nmdc:mga0n895_247686_c1 3300050512 Bacteria 1808
754 nmdc:mga0n895_35385_c1 3300050512 Bacteria 4815
755 nmdc:mga0rr50_1487167_c1 3300050513 Bacteria 573
756 nmdc:mga0rr50_54433_c1 3300050513 Bacteria 2981
757 nmdc:mga08x19_58351_c1 3300050514 Bacteria 2496
758 nmdc:mga0a205_1116507_c1 3300050515 Bacteria 636
759 nmdc:mga0a205_70494_c1 3300050515 Bacteria 3375
760 nmdc:mga0a205_9425_c1 3300050515 Bacteria 8925
761 Ga0495601_0466164 3300053077 Bacteria 816
762 Ga0495601_0508680 3300053077 Bacteria 777
763 Ga0495612_0217266 3300053078 Bacteria 846
764 Ga0495655_0013602 3300053083 Bacteria 1687
765 Ga0495619_0198718 3300053085 Bacteria 1388
766 Ga0500644_0007642 3300053088 Bacteria 2823
767 Ga0500644_0102874 3300053088 Bacteria 1088
768 Ga0500651_0156662 3300053093 Bacteria 1364
769 Ga0500594_0017366 3300053118 Bacteria 1761
770 Ga0500595_019389 3300053119 Bacteria 2469
771 Ga0500595_022216 3300053119 Bacteria 2250
772 Ga0500655_007881 3300053133 Bacteria 1919
773 Ga0500658_0041033 3300053134 Bacteria 1855
774 Ga0500559_0001106 3300053136 Bacteria 16255
775 Ga0500588_0017922 3300053146 Bacteria 1857
776 Ga0500622_0009073 3300053156 Bacteria 5522
777 Ga0500627_0377390 3300053158 Bacteria 608
778 Ga0500636_0089115 3300053177 Bacteria 1769
779 Ga0500587_000465 3300053739 Bacteria 4826
780 Ga0500587_004949 3300053739 Bacteria 1813
781 Ga0105248_10045041
782 JGI24746J21847_1044255
783 JGI24737J22298_10075858
784 JGI24743J22301_10004185
785 JGI24744J21845_10000631
786 JGI24742J22300_10084579
787 Ga0058863_11661298
788 Ga0058861_11552989
789 Ga0058862_11146068
790 Ga0058862_11897661
791 Ga0065714_10147543
792 Ga0065712_10069206
793 Ga0065707_10515230
794 Ga0070676_10352685
795 Ga0070676_10459540
796 Ga0070676_11447634
797 Ga0070683_100056136
798 Ga0070683_100581809
799 Ga0070683_101077724
800 Ga0070683_101517579
801 Ga0070690_100007074
802 Ga0070690_100021315
803 Ga0070670_101521389
804 Ga0068869_100466488
805 Ga0068869_100691186
806 Ga0068869_100792073
807 Ga0068869_101622911
808 Ga0070666_10522019
809 Ga0070666_11395413
810 Ga0070680_100037543
811 Ga0070680_100102234
812 Ga0070680_100834217
813 Ga0070680_101631021
814 Ga0070682_100033754
815 Ga0070682_101063546
816 Ga0068868_100012289
817 Ga0068868_100043988
818 Ga0070660_100489420
819 Ga0070689_100011209
820 Ga0070689_100748221
821 Ga0070689_100801023
822 Ga0070689_102163021
823 Ga0070691_10030038
824 Ga0070691_10269084
825 Ga0070691_10794119
826 Ga0070687_100002834
827 Ga0070692_10130481
828 Ga0070692_10185080
829 Ga0070692_10840710
830 Ga0070669_100142073
831 Ga0070669_100642622
832 Ga0070669_101308394
833 Ga0070675_100055736
834 Ga0070675_100070120
835 Ga0070671_100010532
836 Ga0070671_100058567
837 Ga0070674_100061489
838 Ga0070674_102053203
839 Ga0070673_100006456
840 Ga0070673_101382972
841 Ga0070688_100010397
842 Ga0070659_100050250
843 Ga0070659_100522221
844 Ga0070667_100000979
845 Ga0070667_100025576
846 Ga0070667_100989087
847 Ga0070709_10386102
848 Ga0070713_100020052
849 Ga0070710_10169970
850 Ga0070701_10001504
851 Ga0070701_10237961
852 Ga0070711_100102295
853 Ga0070711_101907098
854 Ga0070705_100019324
855 Ga0070705_100251321
856 Ga0070705_100330573
857 Ga0070705_101055204
858 Ga0070700_100010408
859 Ga0070700_100039114
860 Ga0070700_100311556
861 Ga0070700_100871485
862 Ga0070700_101405853
863 Ga0070694_100149132
864 Ga0070694_100604247
865 Ga0070708_100054773
866 Ga0070708_100060923
867 Ga0070708_100189804
868 Ga0070708_100651766
869 Ga0070663_100021630
870 Ga0070663_100452870
871 Ga0070678_100019828
872 Ga0070678_100801641
873 Ga0070678_102174222
874 Ga0070662_100057493
875 Ga0070662_101060814
876 Ga0070681_10024348
877 Ga0070681_10275499
878 Ga0070681_10627184
879 Ga0070681_10926066
880 Ga0070681_11098807
881 Ga0070681_11146708
882 Ga0068867_100148479
883 Ga0068867_100807610
884 Ga0068867_101778186
885 Ga0070685_10007470
886 Ga0070706_100013322
887 Ga0070706_101431022
888 Ga0070707_100015083
889 Ga0070707_100185717
890 Ga0070707_100200507
891 Ga0070699_100003196
892 Ga0070699_100279240
893 Ga0070679_100000530
894 Ga0070684_100115542
895 Ga0070697_101161453
896 Ga0070697_101229744
897 Ga0068853_100265287
898 Ga0070672_100004964
899 Ga0070686_100000611
900 Ga0070686_100573680
901 Ga0070686_100631698
902 Ga0070695_100677990
903 Ga0070696_100049413
904 Ga0070696_100142741
905 Ga0070696_101290145
906 Ga0070693_100048473
907 Ga0070693_100242124
908 Ga0070693_101120113
909 Ga0070665_100008989
910 Ga0070665_100350547
911 Ga0070704_100043956
912 Ga0070704_100044223
913 Ga0070704_100112508
914 Ga0070704_100366380
915 Ga0070704_101900754
916 Ga0068855_100040359
917 Ga0068855_102319005
918 Ga0070664_100012516
919 Ga0070664_100114737
920 Ga0068857_100027960
921 Ga0068857_100311364
922 Ga0068854_100337533
923 Ga0068854_100629923
924 Ga0068856_100070376
925 Ga0070702_100001563
926 Ga0070702_100010533
927 Ga0070702_100085477
928 Ga0070702_100342917
929 Ga0070702_101677106
930 Ga0068852_100144006
931 Ga0068859_100016447
932 Ga0068859_100043426
933 Ga0068859_100401176
934 Ga0068859_100665631
935 Ga0068864_100006740
936 Ga0068864_100014058
937 Ga0068866_10017845
938 Ga0068866_10036563
939 Ga0068866_10098692
940 Ga0068866_10251690
941 Ga0068866_10348755
942 Ga0068861_100002590
943 Ga0068861_100031862
944 Ga0068861_100082547
945 Ga0068861_100249540
946 Ga0068851_10560351
947 Ga0068870_10005655
948 Ga0068870_10420999
949 Ga0068870_10616973
950 Ga0068863_100056878
951 Ga0068858_100005213
952 Ga0068858_100009173
953 Ga0068858_100066405
954 Ga0068858_100404017
955 Ga0068860_100065302
956 Ga0068860_100091398
957 Ga0068860_100132741
958 Ga0068860_100153452
959 Ga0068860_100322665
960 Ga0068860_101365286
961 Ga0068860_101588237
962 Ga0068862_100029728
963 Ga0068862_100033465
964 Ga0068862_100091972
965 Ga0068862_100228767
966 Ga0081538_10039083
967 Ga0081538_10320074
968 Ga0070717_10006806
969 Ga0070717_10225848
970 Ga0075365_10046664
971 Ga0075368_10064120
972 Ga0075368_10586015
973 Ga0070715_10104743
974 Ga0070712_100144862
975 Ga0070712_100291280
976 Ga0070712_101382338
977 Ga0070712_101688152
978 Ga0075362_10122739
979 Ga0075367_10009456
980 Ga0097621_100000225
981 Ga0097621_100007400
982 Ga0097621_100037204
983 Ga0097621_100808651
984 Ga0097621_102186112
985 Ga0075370_10207528
986 Ga0075370_10392827
987 Ga0075370_10614769
988 Ga0068871_100001634
989 Ga0068871_100172230
990 Ga0068871_100200992
991 Ga0068871_100583640
992 Ga0075428_100000136
993 Ga0075428_100005377
994 Ga0075428_100027908
995 Ga0075428_100742179
996 Ga0075428_102154234
997 Ga0075430_100001894
998 Ga0075430_100051969
999 Ga0075430_100245702
1000 Ga0075431_100018587
1001 Ga0075431_100037720
1002 Ga0075431_101414964
1003 Ga0075431_102044395
1004 Ga0075433_10002714
1005 Ga0075433_10289416
1006 Ga0075433_11058483
1007 Ga0075433_11366517
1008 Ga0075434_100012330
1009 Ga0075434_100123704
1010 Ga0075434_100128779
1011 Ga0075429_100000739
1012 Ga0075429_100102491
1013 Ga0075429_100237966
1014 Ga0075429_100460127
1015 Ga0068865_100028121
1016 Ga0068865_100046324
1017 Ga0068865_100824937
1018 Ga0068865_101691804
1019 Ga0068865_101828504
1020 Ga0075436_100883275
1021 Ga0097620_100016447
1022 Ga0097620_100043428
1023 Ga0097620_100401189
1024 Ga0097620_100665634
1025 Ga0075435_100103986
1026 Ga0075435_100178130
1027 Ga0075435_100690309
1028 Ga0099794_10002204
1029 Ga0099794_10348371
1030 Ga0099794_10393847
1031 Ga0105240_10011300
1032 Ga0105240_10804478
1033 Ga0105240_11847341
1034 Ga0111539_10006965
1035 Ga0111539_10022933
1036 Ga0111539_10038680
1037 Ga0111539_10147678
1038 Ga0111539_10457456
1039 Ga0111539_10613985
1040 Ga0111539_12610727
1041 Ga0105245_10001938
1042 Ga0105245_10010659
1043 Ga0105245_10025116
1044 Ga0105245_10043998
1045 Ga0105245_10069034
1046 Ga0105245_10649060
1047 Ga0105245_11799145
1048 Ga0105247_10008360
1049 Ga0114129_10006715
1050 Ga0114129_10043926
1051 Ga0114129_10172173
1052 Ga0114129_10521713
1053 Ga0105243_10134960
1054 Ga0105243_10258697
1055 Ga0105243_10384743
1056 Ga0105243_10871838
1057 Ga0105241_11025211
1058 Ga0105241_11085002
1059 Ga0105242_10044048
1060 Ga0105242_10065341
1061 Ga0105242_10541114
1062 Ga0105242_12277240
1063 Ga0105248_10018049
1064 Ga0105248_10105401
1065 Ga0105248_10263112
1066 Ga0105248_11354110
1067 Ga0105237_10516606
1068 Ga0105237_11133889
1069 Ga0105238_10745003
1070 Ga0105249_10044394
1071 Ga0105249_10230097
1072 Ga0099796_10015895
1073 Ga0105239_10177864
1074 Ga0105239_10964766
1075 Ga0105246_10028252
1076 Ga0105246_10101579
1077 Ga0105246_11315786
1078 Ga0157373_11142058
1079 Ga0157374_10018246
1080 Ga0157374_10343254
1081 Ga0157374_10373312
1082 Ga0157374_11093275
1083 Ga0157374_11251880
1084 Ga0157374_11969064
1085 Ga0157378_10000764
1086 Ga0157378_10064170
1087 Ga0157378_10580810
1088 Ga0163162_10217620
1089 Ga0163162_10344989
1090 Ga0163162_10373947
1091 Ga0163162_10596588
1092 Ga0163162_11105075
1093 Ga0163162_11709121
1094 Ga0163162_12740330
1095 Ga0157375_10015353
1096 Ga0157375_10105511
1097 Ga0157375_10150896
1098 Ga0157375_10476499
1099 Ga0163163_10167214
1100 Ga0163163_11180391
1101 Ga0163163_12842558
1102 Ga0157380_10119947
1103 Ga0157380_10126294
1104 Ga0157380_10149036
1105 Ga0157380_10345875
1106 Ga0157380_10753789
1107 Ga0157380_13478792
1108 Ga0182008_10004992
1109 Ga0157377_10084690
1110 Ga0157379_10006573
1111 Ga0157379_10027695
1112 Ga0157379_10243347
1113 Ga0157379_10601284
1114 Ga0157379_11327012
1115 Ga0157379_12184639
1116 Ga0157376_10037814
1117 Ga0157376_10902678
1118 Ga0182006_1000033
1119 Ga0182007_10001557
1120 Ga0182005_1000024
1121 Ga0163161_10305281
1122 Ga0163161_11440562
1123 Ga0163161_11462808
1124 Ga0213874_10429727
1125 Ga0207692_10076846
1126 Ga0207642_10171883
1127 Ga0207710_10006187
1128 Ga0207688_10000189
1129 Ga0207680_10125560
1130 Ga0207647_10013420
1131 Ga0207699_10326596
1132 Ga0207645_10014573
1133 Ga0207645_10267949
1134 Ga0207643_10000943
1135 Ga0207643_10156086
1136 Ga0207705_10419998
1137 Ga0207684_10008471
1138 Ga0207684_11513015
1139 Ga0207654_10960506
1140 Ga0207707_10043943
1141 Ga0207707_10510880
1142 Ga0207707_11251312
1143 Ga0207695_10011536
1144 Ga0207695_11654498
1145 Ga0207693_10295318
1146 Ga0207693_10453968
1147 Ga0207693_10482522
1148 Ga0207663_10413001
1149 Ga0207663_11570679
1150 Ga0207660_10138981
1151 Ga0207660_10340035
1152 Ga0207660_10665653
1153 Ga0207660_10685912
1154 Ga0207662_10022370
1155 Ga0207657_11480557
1156 Ga0207652_10031441
1157 Ga0207646_10007557
1158 Ga0207681_10088830
1159 Ga0207681_10350230
1160 Ga0207681_10804620
1161 Ga0207694_11658069
1162 Ga0207650_10040532
1163 Ga0207659_10015245
1164 Ga0207659_10230121
1165 Ga0207659_11761525
1166 Ga0207687_10081064
1167 Ga0207687_10301955
1168 Ga0207687_10437098
1169 Ga0207687_10661200
1170 Ga0207700_10166060
1171 Ga0207664_10331128
1172 Ga0207644_10004741
1173 Ga0207706_10048058
1174 Ga0207706_10117930
1175 Ga0207706_10545720
1176 Ga0207686_10029598
1177 Ga0207686_10080873
1178 Ga0207686_10950197
1179 Ga0207709_10017464
1180 Ga0207709_10125744
1181 Ga0207709_10201132
1182 Ga0207709_10582695
1183 Ga0207670_10011632
1184 Ga0207670_10347745
1185 Ga0207669_10196387
1186 Ga0207669_10839303
1187 Ga0207669_10892225
1188 Ga0207704_10085296
1189 Ga0207704_10356213
1190 Ga0207691_10003140
1191 Ga0207711_10003793
1192 Ga0207711_10340888
1193 Ga0207711_11006203
1194 Ga0207689_10003575
1195 Ga0207689_10060683
1196 Ga0207689_10853406
1197 Ga0207679_10015318
1198 Ga0207679_10124718
1199 Ga0207667_10017536
1200 Ga0207667_10433476
1201 Ga0207667_10834508
1202 Ga0207651_10011001
1203 Ga0207651_10348217
1204 Ga0207651_10744930
1205 Ga0207651_11227129
1206 Ga0207712_10067495
1207 Ga0207712_10108292
1208 Ga0207712_11555680
1209 Ga0207668_10018182
1210 Ga0207640_10085464
1211 Ga0207640_10561423
1212 Ga0207658_10120590
1213 Ga0207658_10158254
1214 Ga0207658_10160048
1215 Ga0207677_10003357
1216 Ga0207677_11332470
1217 Ga0207703_10028209
1218 Ga0207703_10212296
1219 Ga0207703_10473525
1220 Ga0207639_10614642
1221 Ga0207639_11791865
1222 Ga0207678_10001194
1223 Ga0207708_10000641
1224 Ga0207708_10007958
1225 Ga0207702_10081058
1226 Ga0207702_11413686
1227 Ga0207641_10035292
1228 Ga0207641_10041780
1229 Ga0207641_10087593
1230 Ga0207648_10001650
1231 Ga0207648_10011327
1232 Ga0207648_10206240
1233 Ga0207648_10330890
1234 Ga0207676_10010466
1235 Ga0207676_10081730
1236 Ga0207676_10436895
1237 Ga0207674_10018156
1238 Ga0207674_10238372
1239 Ga0207674_10705154
1240 Ga0207675_100001440
1241 Ga0207675_100003691
1242 Ga0207675_100164251
1243 Ga0207675_100177853
1244 Ga0207675_100235090
1245 Ga0207675_102570105
1246 Ga0207683_10016908
1247 Ga0207683_10025422
1248 Ga0207683_10937082
1249 Ga0207698_10022096
1250 Ga0209588_1000572
1251 Ga0207428_10054088
1252 Ga0207428_10117264
1253 Ga0207428_10135824
1254 Ga0268266_10021047
1255 Ga0268266_11720069
1256 Ga0268265_10038036
1257 Ga0268265_10107136
1258 Ga0268265_10639223
1259 Ga0268265_10860720
1260 Ga0268264_10006714
1261 Ga0268264_10064138
1262 Ga0268264_10436450
1263 Ga0268264_10586410
1264 Ga0265336_10166399
1265 Ga0307517_10263155
1266 Ga0307517_10407986
1267 Ga0307515_10005432
1268 Ga0307515_10122903
1269 Ga0307515_10317577
1270 Ga0307512_10016492
1271 Ga0265328_10021726
1272 Ga0265320_10253273
1273 Ga0265329_10149399
1274 Ga0265340_10037079
1275 Ga0265340_10125444
1276 Ga0265340_10128986
1277 Ga0265340_10190483
1278 Ga0265340_10261171
1279 Ga0265339_10474758
1280 Ga0265331_10016546
1281 Ga0265327_10000028
1282 Ga0265316_10175940
1283 Ga0265316_10428528
1284 Ga0307509_10000426
1285 Ga0307509_10002105
1286 Ga0307509_10199457
1287 Ga0307509_10593231
1288 Ga0307509_10623049
1289 Ga0307508_10005192
1290 Ga0307508_10659081
1291 Ga0307514_10036312
1292 Ga0307514_10067458
1293 Ga0265314_10054163
1294 Ga0265314_10644981
1295 Ga0265342_10072611
1296 Ga0307516_10001925
1297 Ga0307516_10026648
1298 Ga0307518_10219170
1299 Ga0307407_11298788
1300 Ga0307411_11464243
1301 Ga0307507_10215993
1302 Ga0307510_10000088
1303 Ga0307510_10006861
1304 Ga0307510_10077439
1305 Ga0307510_10324161
1306 Ga0373952_0016257
1307 Ga0373939_0394191
1308 Ga0373954_0403564
1309 Ga0373943_0221108
1310 Ga0373946_0044979
1311 Ga0373946_0654773
1312 Ga0373931_0032969
1313 Ga0373931_0053416
1314 Ga0373931_0478593
1315 Ga0373935_0045996
1316 Ga0373935_0476571
1317 Ga0373935_1027024
1318 Ga0373927_0038468
1319 Ga0373927_0069283
1320 Ga0373933_0104982
1321 Ga0373933_0361000
1322 Ga0373947_0356743
1323 Ga0373947_0976018
1324 Ga0373937_0744996
1325 Ga0373925_0027474
1326 Ga0373925_0263780
1327 Ga0373925_0879779
1328 Ga0395905_1121261
1329 Ga0436364_0046427
1330 Ga0436364_0527691
1331 Ga0436364_1041936
1332 Ga0436365_0607910
1333 Ga0436365_0916972
1334 Ga0436365_0973927
1335 Ga0436360_1341154
1336 Ga0436361_1093055
1337 Ga0436363_0926213
1338 Ga0436362_0553147
1339 Ga0436362_0570944
1340 Ga0451793_0034844
1341 Ga0451797_0406438
1342 Ga0451802_1460824
1343 Ga0451837_0342159
1344 Ga0451847_0109149
1345 Ga0451577_0006653
1346 Ga0451577_1328308
1347 Ga0466969_0046078
1348 Ga0453683_0532227
1349 Ga0466966_0100847
1350 Ga0466966_0765072
1351 Ga0466964_0004223
1352 Ga0466959_0022530
1353 Ga0466959_0411115
1354 Ga0451576_0389673
1355 Ga0451576_1149622
1356 Ga0451576_2420815
1357 Ga0466958_0248170
1358 Ga0466958_0468764
1359 Ga0495617_027992
1360 Ga0495617_068566
1361 Ga0495617_078261
1362 Ga0495617_137084
1363 Ga0495592_0000307
1364 Ga0495592_0234988
1365 Ga0495592_0632099
1366 Ga0495592_0893785
1367 Ga0495603_0755002
1368 Ga0495590_0036439
1369 Ga0495590_0118572
1370 Ga0495590_0120842
1371 Ga0495629_0546438
1372 Ga0495638_0051852
1373 Ga0495650_0048231
1374 Ga0495580_0000365
1375 Ga0495580_0008399
1376 Ga0495605_0003898
1377 Ga0495605_0321332
1378 Ga0495664_0303937
1379 Ga0495584_0003202
1380 Ga0495584_0080927
1381 Ga0495584_0164087
1382 Ga0495584_0286886
1383 Ga0495585_0019262
1384 Ga0495585_0067927
1385 Ga0495585_0208463
1386 Ga0495585_0527324
1387 Ga0495596_0084134
1388 Ga0495607_0042439
1389 Ga0495607_0046049
1390 Ga0495583_0000947
1391 Ga0495610_0014897
1392 Ga0495610_0032850
1393 Ga0495610_0129480
1394 Ga0495616_0045199
1395 Ga0495618_0400021
1396 Ga0495628_0389865
1397 Ga0495628_0752947
1398 Ga0495630_0194872
1399 Ga0495630_0922259
1400 Ga0495630_1408656
1401 Ga0495632_0172519
1402 Ga0495632_0485256
1403 Ga0495644_0003375
1404 Ga0495644_0017511
1405 Ga0495648_0007325
1406 Ga0495648_0186695
1407 Ga0495648_0370165
1408 Ga0495663_0014679
1409 Ga0495640_0110990
1410 Ga0495587_0124416
1411 Ga0495598_0087090
1412 Ga0495609_0065992
1413 Ga0495609_0300700
1414 Ga0495609_0417317
1415 Ga0495633_0096206
1416 Ga0495633_0190725
1417 Ga0495668_0465931
1418 Ga0495668_0814641
1419 Ga0495611_0013168
1420 Ga0495611_0017599
1421 Ga0495611_0096580
1422 Ga0495625_0010661
1423 Ga0495625_0019277
1424 Ga0495659_0011058
1425 Ga0495659_0346988
1426 Ga0495661_0057480
1427 Ga0495661_0080855
1428 Ga0495661_0191057
1429 Ga0495588_0067029
1430 Ga0495647_0129728
1431 Ga0495658_0049549
1432 Ga0495669_0169857
1433 Ga0495613_0246340
1434 Ga0495670_0010129
1435 Ga0495670_0089022
1436 Ga0495671_0001961
1437 Ga0495671_0257137
1438 Ga0495660_0195520
1439 Ga0495636_0001420
1440 Ga0495674_0220751
1441 Ga0495672_0040004
1442 Ga0495672_0134852
1443 Ga0495676_0077450
1444 Ga0495680_0069370
1445 Ga0495683_0003427
1446 Ga0495687_000814
1447 Ga0495677_0003654
1448 Ga0495677_0023619
1449 Ga0495685_000505
1450 Ga0495673_0022072
1451 Ga0495673_0304380
1452 Ga0495686_0037169
1453 Ga0495686_0145898
1454 Ga0495602_0109999
1455 Ga0495602_0385667
1456 Ga0495602_0545447
1457 Ga0496100_0000681
1458 Ga0496100_0079479
1459 Ga0496101_0032590
1460 Ga0496101_0089061
1461 Ga0496102_0003713
1462 Ga0496102_0331767
1463 Ga0496103_0000914
1464 Ga0496104_0107555
1465 Ga0496104_0496498
1466 Ga0496105_0000989
1467 Ga0496105_0138315
1468 Ga0496106_0002132
1469 Ga0496107_0006476
1470 Ga0496107_0099982
1471 Ga0496108_0003622
1472 Ga0496108_0565056
1473 Ga0496109_0004932
1474 Ga0496109_0016929
1475 Ga0496110_0001665
1476 Ga0496110_0018198
1477 Ga0496110_0583135
1478 Ga0496111_0001993
1479 Ga0496111_0004768
1480 Ga0496111_0038413
1481 Ga0496111_0399533
1482 Ga0496112_0019227
1483 Ga0496112_0203364
1484 Ga0496112_0219542
1485 Ga0496112_1468355
1486 Ga0496113_0003029
1487 Ga0496113_0009473
1488 Ga0496114_0015952
1489 Ga0496114_0139838
1490 Ga0496114_0193172
1491 Ga0496115_0004015
1492 Ga0496116_0020110
1493 Ga0496118_0000031
1494 Ga0496121_0011729
1495 Ga0496122_0011135
1496 Ga0496123_0016214
1497 Ga0496124_0072543
1498 Ga0496126_0380736
1499 Ga0495682_0072795
1500 Ga0501036_1335526
1501 Ga0501039_0654852
1502 Ga0501042_0243714
1503 Ga0501042_1289959
1504 Ga0501043_0000097
1505 Ga0501046_0000047
1506 Ga0501047_0000058
1507 Ga0501048_0016898
1508 Ga0501048_0584880
1509 Ga0501075_0533049
1510 Ga0501075_0599843
1511 Ga0501257_007088
1512 Ga0501079_1148966
1513 Ga0501083_0004308
1514 Ga0501045_0006865
1515 nmdc:mga07m45_248652_c1
1516 nmdc:mga05p37_32045_c1
1517 nmdc:mga05p37_47793_c1
1518 nmdc:mga05p37_8685_c1
1519 nmdc:mga09592_1041_c1
1520 nmdc:mga09592_109087_c1
1521 nmdc:mga09592_378678_c1
1522 nmdc:mga09592_58916_c1
1523 nmdc:mga0qj67_104_c1
1524 nmdc:mga0qj67_1167851_c1
1525 nmdc:mga0qj67_609_c1
1526 nmdc:mga06r32_1453_c1
1527 nmdc:mga06r32_206810_c1
1528 nmdc:mga08y16_21766_c1
1529 nmdc:mga08y16_23058_c1
1530 nmdc:mga08y16_289720_c1
1531 nmdc:mga08y16_38457_c1
1532 nmdc:mga08y16_732241_c1
1533 nmdc:mga0n895_247686_c1
1534 nmdc:mga0n895_35385_c1
1535 nmdc:mga0rr50_1487167_c1
1536 nmdc:mga0rr50_54433_c1
1537 nmdc:mga08x19_58351_c1
1538 nmdc:mga0a205_1116507_c1
1539 nmdc:mga0a205_70494_c1
1540 nmdc:mga0a205_9425_c1
1541 Ga0495601_0466164
1542 Ga0495601_0508680
1543 Ga0495612_0217266
1544 Ga0495655_0013602
1545 Ga0495619_0198718
1546 Ga0500644_0007642
1547 Ga0500644_0102874
1548 Ga0500651_0156662
1549 Ga0500594_0017366
1550 Ga0500595_019389
1551 Ga0500595_022216
1552 Ga0500655_007881
1553 Ga0500658_0041033
1554 Ga0500559_0001106
1555 Ga0500588_0017922
1556 Ga0500622_0009073
1557 Ga0500627_0377390
1558 Ga0500636_0089115
1559 Ga0500587_000465
1560 Ga0500587_004949

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

25

139

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8945 1 114
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8803 1 114
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7746 1 115
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7632 1 115
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.7572 1 115
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8945 1 114 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8803 1 114 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7377 1 115 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7321 1 115 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6977 1 114 3.30.70.1060
ID Description Score Start End GO Terms
AF-A6FZL8-F1-model_v4 YCII-related domain-containing protein 0.9537 1 115
AF-A0A4P8IWP2-F1-model_v4 YciI family protein 0.9521 1 114
AF-A0A6J4KSJ7-F1-model_v4 PhnB protein 0.9519 2 115
AF-A0A526RJW6-F1-model_v4 YciI family protein 0.951 1 108
AF-A0A7Y5BYR8-F1-model_v4 YciI family protein 0.949 1 115

Map