F480484

General Info

Members Datasets Scaffolds Average Seq Length
779 304 1558 299

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0000001|Ga0451577_0000001_1597888_1598940
Length 292
Sequence MEVVVAIVAVAVLGVLIRSIRIVGQAEVMVIERLGRFHRLARSGLNIVIPALERAKSIDVRYQEEDAGSGMKRLVSGSTTRIDLREQVLNFPKQPVITKDNVTIDIDAVLYYRVADPQKATYAIQNLPFALETLTRTALRNIVGEMELDQSLVSRDLINKRMRDVIEEAAIGWGVDVTRVELQSIEPPRDIQQSMELQMRAERERRASVTALPAEQVSTYLLGLKYMEALPTLAQGKGSTIFLPAEAAGVLGALGALRKVLDAGAGTGNETTASSTASPKPPALGSGFPPAK

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
208 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
209 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
210 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
279 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
280 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
281 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
282 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
283 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
288 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.05
Rhizosphere 97.69
Stem 0
Stem Tuber 0
Unclassified 3.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0000001 3300042876 Bacteria 2461803
2 Ga0065704_10221130 3300005289 Bacteria 1074
3 Ga0065707_10091418 3300005295 Bacteria 3950
4 Ga0065707_10106580 3300005295 Bacteria 2590
5 Ga0070658_10008683 3300005327 Bacteria 8164
6 Ga0070658_10023189 3300005327 Bacteria 4983
7 Ga0070658_10027759 3300005327 Bacteria 4542
8 Ga0070676_10000168 3300005328 Bacteria 26560
9 Ga0070676_10038723 3300005328 Bacteria 2754
10 Ga0070676_10112139 3300005328 Bacteria 1700
11 Ga0070683_100001524 3300005329 Bacteria 17903
12 Ga0070683_100002342 3300005329 Bacteria 15031
13 Ga0070683_100007250 3300005329 Bacteria 9355
14 Ga0070683_100009280 3300005329 Bacteria 8405
15 Ga0070683_100017935 3300005329 Bacteria 6258
16 Ga0070683_100043062 3300005329 Bacteria 4160
17 Ga0070683_100050590 3300005329 Bacteria 3847
18 Ga0070683_100080555 3300005329 Bacteria 3048
19 Ga0070683_100087487 3300005329 Bacteria 2922
20 Ga0070683_100088624 3300005329 Bacteria 2903
21 Ga0070683_100152364 3300005329 Bacteria 2192
22 Ga0070683_100224118 3300005329 Bacteria 1787
23 Ga0070690_100012805 3300005330 Bacteria 4941
24 Ga0070690_100042430 3300005330 Bacteria 2881
25 Ga0070690_100110625 3300005330 Bacteria 1833
26 Ga0070670_100000138 3300005331 Bacteria 68361
27 Ga0070670_100006336 3300005331 Bacteria 10014
28 Ga0068869_100003300 3300005334 Bacteria 9853
29 Ga0068869_100096231 3300005334 Bacteria 2234
30 Ga0068869_100400349 3300005334 Unclassified 1129
31 Ga0070666_10047345 3300005335 Bacteria 2886
32 Ga0070680_100005879 3300005336 Bacteria 9315
33 Ga0070680_100027130 3300005336 Bacteria 4586
34 Ga0070680_100104022 3300005336 Unclassified 2359
35 Ga0070680_100235124 3300005336 Bacteria 1548
36 Ga0070682_100125490 3300005337 Bacteria 1729
37 Ga0070682_100165709 3300005337 Bacteria 1531
38 Ga0068868_100015779 3300005338 Bacteria 5596
39 Ga0070660_100039324 3300005339 Bacteria 3595
40 Ga0070660_100045078 3300005339 Bacteria 3375
41 Ga0070660_100047018 3300005339 Bacteria 3309
42 Ga0070660_100095586 3300005339 Bacteria 2349
43 Ga0070689_100023857 3300005340 Bacteria 4585
44 Ga0070689_100135882 3300005340 Bacteria 1974
45 Ga0070689_100193676 3300005340 Bacteria 1656
46 Ga0070691_10061579 3300005341 Bacteria 1805
47 Ga0070691_10102484 3300005341 Unclassified 1423
48 Ga0070687_100075621 3300005343 Bacteria 1821
49 Ga0070661_100001898 3300005344 Bacteria 14473
50 Ga0070661_100014249 3300005344 Bacteria 5601
51 Ga0070661_100041515 3300005344 Bacteria 3357
52 Ga0070661_100301469 3300005344 Unclassified 1247
53 Ga0070692_10013649 3300005345 Bacteria 3792
54 Ga0070692_10122866 3300005345 Bacteria 1450
55 Ga0070668_100000678 3300005347 Bacteria 23171
56 Ga0070668_100021761 3300005347 Bacteria 4845
57 Ga0070668_100038005 3300005347 Bacteria 3677
58 Ga0070668_100055943 3300005347 Bacteria 3046
59 Ga0070669_100001286 3300005353 Bacteria 18141
60 Ga0070669_100004218 3300005353 Bacteria 10398
61 Ga0070669_100016678 3300005353 Bacteria 5243
62 Ga0070675_100003493 3300005354 Bacteria 11919
63 Ga0070675_100006770 3300005354 Bacteria 8805
64 Ga0070675_100020360 3300005354 Bacteria 5295
65 Ga0070675_100053605 3300005354 Bacteria 3317
66 Ga0070675_100188138 3300005354 Bacteria 1788
67 Ga0070671_100024672 3300005355 Bacteria 4926
68 Ga0070671_100031009 3300005355 Bacteria 4414
69 Ga0070671_100047458 3300005355 Bacteria 3571
70 Ga0070673_100006410 3300005364 Bacteria 7650
71 Ga0070673_100054637 3300005364 Bacteria 3142
72 Ga0070673_100162296 3300005364 Bacteria 1901
73 Ga0070688_100024267 3300005365 Bacteria 3575
74 Ga0070688_100174402 3300005365 Bacteria 1487
75 Ga0070659_100012624 3300005366 Bacteria 6265
76 Ga0070659_100017927 3300005366 Bacteria 5334
77 Ga0070659_100020742 3300005366 Bacteria 4996
78 Ga0070659_100207055 3300005366 Bacteria 1616
79 Ga0070667_100024910 3300005367 Bacteria 4970
80 Ga0070667_100141757 3300005367 Bacteria 2105
81 Ga0070667_100222936 3300005367 Bacteria 1679
82 Ga0070714_100004147 3300005435 Bacteria 10891
83 Ga0070714_100061322 3300005435 Bacteria 3230
84 Ga0070714_100084223 3300005435 Bacteria 2774
85 Ga0070714_100127061 3300005435 Bacteria 2274
86 Ga0070713_100000095 3300005436 Bacteria 56677
87 Ga0070713_100010296 3300005436 Bacteria 6750
88 Ga0070713_100067267 3300005436 Bacteria 3016
89 Ga0070713_100074982 3300005436 Bacteria 2868
90 Ga0070710_10146635 3300005437 Bacteria 1452
91 Ga0070701_10004434 3300005438 Bacteria 5687
92 Ga0070701_10013547 3300005438 Bacteria 3713
93 Ga0070711_100193724 3300005439 Bacteria 1564
94 Ga0070694_100015222 3300005444 Bacteria 4825
95 Ga0070694_100018972 3300005444 Bacteria 4370
96 Ga0070694_100048474 3300005444 Bacteria 2858
97 Ga0070708_100000004 3300005445 Bacteria 168041
98 Ga0070663_100062510 3300005455 Bacteria 2684
99 Ga0070663_100069310 3300005455 Unclassified 2562
100 Ga0070663_100129797 3300005455 Bacteria 1913
101 Ga0070678_100148235 3300005456 Bacteria 1887
102 Ga0070678_100157007 3300005456 Unclassified 1839
103 Ga0070662_100007887 3300005457 Bacteria 6919
104 Ga0070662_100019738 3300005457 Bacteria 4580
105 Ga0070662_100031444 3300005457 Bacteria 3725
106 Ga0070681_10005847 3300005458 Bacteria 11909
107 Ga0070681_10018250 3300005458 Bacteria 7011
108 Ga0070681_10021058 3300005458 Bacteria 6533
109 Ga0070681_10037232 3300005458 Bacteria 4883
110 Ga0070681_10045206 3300005458 Bacteria 4406
111 Ga0070681_10103475 3300005458 Bacteria 2791
112 Ga0068867_100002642 3300005459 Bacteria 12639
113 Ga0068867_100075169 3300005459 Bacteria 2534
114 Ga0068867_100134619 3300005459 Bacteria 1925
115 Ga0068867_100213929 3300005459 Bacteria 1550
116 Ga0070685_10021073 3300005466 Bacteria 3538
117 Ga0070706_100046133 3300005467 Bacteria 4023
118 Ga0070706_100060644 3300005467 Bacteria 3492
119 Ga0070707_100076965 3300005468 Bacteria 3219
120 Ga0070707_100425003 3300005468 Unclassified 1289
121 Ga0070698_100000313 3300005471 Bacteria 49238
122 Ga0070698_100001920 3300005471 Bacteria 23105
123 Ga0070698_100148454 3300005471 Bacteria 2293
124 Ga0070699_100002608 3300005518 Bacteria 16105
125 Ga0070699_100028940 3300005518 Bacteria 4777
126 Ga0070699_100032889 3300005518 Bacteria 4480
127 Ga0070699_100240078 3300005518 Bacteria 1617
128 Ga0070679_100001684 3300005530 Bacteria 19884
129 Ga0070679_100001856 3300005530 Bacteria 18992
130 Ga0070679_100003522 3300005530 Bacteria 14332
131 Ga0070679_100007101 3300005530 Bacteria 10450
132 Ga0070679_100030623 3300005530 Bacteria 5313
133 Ga0070679_100159359 3300005530 Bacteria 2231
134 Ga0070679_100391560 3300005530 Bacteria 1336
135 Ga0070684_100004605 3300005535 Bacteria 10516
136 Ga0070684_100006092 3300005535 Bacteria 9287
137 Ga0070684_100006251 3300005535 Bacteria 9194
138 Ga0070684_100006545 3300005535 Bacteria 9020
139 Ga0070684_100011134 3300005535 Bacteria 7159
140 Ga0070684_100021304 3300005535 Bacteria 5392
141 Ga0070684_100035444 3300005535 Bacteria 4270
142 Ga0070684_100036042 3300005535 Bacteria 4238
143 Ga0070684_100047867 3300005535 Bacteria 3707
144 Ga0070684_100075889 3300005535 Bacteria 2966
145 Ga0070684_100084632 3300005535 Bacteria 2812
146 Ga0070684_100107874 3300005535 Bacteria 2494
147 Ga0070684_100202023 3300005535 Bacteria 1810
148 Ga0070684_100204635 3300005535 Bacteria 1798
149 Ga0070697_100123316 3300005536 Unclassified 2169
150 Ga0068853_100003016 3300005539 Bacteria 12855
151 Ga0068853_100003657 3300005539 Bacteria 11792
152 Ga0068853_100086853 3300005539 Bacteria 2744
153 Ga0070672_100013512 3300005543 Bacteria 5771
154 Ga0070672_100024070 3300005543 Bacteria 4494
155 Ga0070672_100024656 3300005543 Bacteria 4449
156 Ga0070672_100269277 3300005543 Bacteria 1438
157 Ga0070686_100030840 3300005544 Bacteria 3273
158 Ga0070696_100000096 3300005546 Bacteria 44146
159 Ga0070696_100014917 3300005546 Bacteria 5218
160 Ga0070693_100012340 3300005547 Bacteria 4322
161 Ga0070693_100109190 3300005547 Bacteria 1699
162 Ga0070665_100001779 3300005548 Bacteria 24545
163 Ga0068855_100001603 3300005563 Bacteria 28390
164 Ga0068855_100027292 3300005563 Bacteria 6832
165 Ga0068855_100056876 3300005563 Bacteria 4586
166 Ga0068855_100149159 3300005563 Bacteria 2659
167 Ga0070664_100005766 3300005564 Bacteria 9988
168 Ga0070664_100011553 3300005564 Bacteria 7165
169 Ga0070664_100036265 3300005564 Bacteria 4142
170 Ga0070664_100081286 3300005564 Bacteria 2792
171 Ga0070664_100082103 3300005564 Bacteria 2779
172 Ga0070664_100089183 3300005564 Bacteria 2668
173 Ga0070664_100105085 3300005564 Bacteria 2459
174 Ga0070664_100190411 3300005564 Bacteria 1827
175 Ga0068857_100017536 3300005577 Bacteria 6277
176 Ga0068857_100027871 3300005577 Bacteria 4981
177 Ga0068857_100031817 3300005577 Bacteria 4661
178 Ga0068854_100046888 3300005578 Bacteria 3079
179 Ga0068854_100074175 3300005578 Bacteria 2495
180 Ga0068856_100032775 3300005614 Bacteria 5087
181 Ga0070702_100000879 3300005615 Bacteria 11673
182 Ga0070702_100103785 3300005615 Bacteria 1749
183 Ga0068852_100002775 3300005616 Bacteria 12130
184 Ga0068852_100004960 3300005616 Bacteria 9458
185 Ga0068852_100014900 3300005616 Bacteria 6008
186 Ga0068852_100078404 3300005616 Bacteria 2922
187 Ga0068852_100103590 3300005616 Bacteria 2574
188 Ga0068859_100133700 3300005617 Bacteria 2552
189 Ga0068859_100301591 3300005617 Bacteria 1695
190 Ga0068864_100107052 3300005618 Bacteria 2487
191 Ga0068864_100170512 3300005618 Unclassified 1984
192 Ga0068864_100222609 3300005618 Bacteria 1742
193 Ga0068861_100000050 3300005719 Bacteria 54921
194 Ga0068861_100007608 3300005719 Bacteria 7434
195 Ga0068861_100105127 3300005719 Bacteria 2254
196 Ga0068870_10000965 3300005840 Bacteria 11308
197 Ga0068863_100006717 3300005841 Bacteria 11279
198 Ga0068863_100008116 3300005841 Bacteria 10248
199 Ga0068863_100019388 3300005841 Bacteria 6506
200 Ga0068863_100214084 3300005841 Bacteria 1856
201 Ga0068858_100030673 3300005842 Bacteria 4993
202 Ga0068860_100225863 3300005843 Bacteria 1819
203 Ga0068860_100241967 3300005843 Bacteria 1755
204 Ga0068860_100588995 3300005843 Bacteria 1117
205 Ga0068862_100000846 3300005844 Bacteria 30132
206 Ga0068862_100029837 3300005844 Bacteria 4595
207 Ga0068862_100240515 3300005844 Bacteria 1646
208 Ga0081539_10000206 3300005985 Bacteria 137177
209 Ga0081539_10069783 3300005985 Bacteria 1889
210 Ga0070717_10000931 3300006028 Bacteria 19509
211 Ga0070712_100059077 3300006175 Bacteria 2699
212 Ga0070712_100257077 3300006175 Bacteria 1398
213 Ga0097621_100004437 3300006237 Bacteria 9769
214 Ga0075428_100051440 3300006844 Bacteria 4517
215 Ga0075428_100398728 3300006844 Bacteria 1475
216 Ga0075430_100005973 3300006846 Bacteria 10280
217 Ga0075430_100011848 3300006846 Bacteria 7420
218 Ga0075430_100043196 3300006846 Bacteria 3810
219 Ga0075430_100122783 3300006846 Bacteria 2165
220 Ga0075431_100004527 3300006847 Bacteria 13646
221 Ga0075431_100005045 3300006847 Bacteria 12989
222 Ga0075431_100043991 3300006847 Bacteria 4606
223 Ga0075431_100074079 3300006847 Bacteria 3514
224 Ga0075431_100112915 3300006847 Bacteria 2804
225 Ga0075431_100298555 3300006847 Bacteria 1628
226 Ga0075433_10014919 3300006852 Bacteria 6360
227 Ga0075434_100025468 3300006871 Bacteria 5788
228 Ga0075434_100072711 3300006871 Bacteria 3431
229 Ga0075429_100009189 3300006880 Bacteria 8581
230 Ga0075429_100060410 3300006880 Bacteria 3301
231 Ga0075429_100155307 3300006880 Bacteria 2004
232 Ga0075429_100165009 3300006880 Bacteria 1940
233 Ga0068865_100013630 3300006881 Bacteria 5145
234 Ga0068865_100021062 3300006881 Bacteria 4237
235 Ga0068865_100133685 3300006881 Bacteria 1861
236 Ga0075436_100005201 3300006914 Bacteria 8956
237 Ga0075436_100049497 3300006914 Bacteria 2900
238 Ga0097620_100133695 3300006931 Bacteria 2552
239 Ga0097620_100301574 3300006931 Bacteria 1695
240 Ga0105240_10007936 3300009093 Bacteria 15313
241 Ga0105240_10012482 3300009093 Bacteria 11724
242 Ga0105240_10018122 3300009093 Bacteria 9467
243 Ga0105240_10050152 3300009093 Bacteria 5264
244 Ga0105240_10074881 3300009093 Bacteria 4177
245 Ga0105240_10220496 3300009093 Unclassified 2210
246 Ga0111539_10007826 3300009094 Bacteria 13646
247 Ga0111539_10009490 3300009094 Bacteria 12279
248 Ga0111539_10045061 3300009094 Bacteria 5281
249 Ga0111539_10055977 3300009094 Bacteria 4689
250 Ga0105245_10008157 3300009098 Bacteria 9160
251 Ga0114129_10089811 3300009147 Bacteria 4259
252 Ga0114129_10264471 3300009147 Unclassified 2304
253 Ga0114129_10429118 3300009147 Bacteria 1737
254 Ga0105241_10141668 3300009174 Bacteria 1958
255 Ga0105242_10021834 3300009176 Bacteria 5030
256 Ga0105242_10066907 3300009176 Bacteria 2969
257 Ga0105248_10003178 3300009177 Bacteria 18208
258 Ga0105248_10004642 3300009177 Bacteria 15197
259 Ga0105248_10009199 3300009177 Bacteria 10871
260 Ga0105248_10339175 3300009177 Bacteria 1692
261 Ga0105248_10369443 3300009177 Bacteria 1615
262 Ga0105237_10160455 3300009545 Bacteria 2247
263 Ga0105249_10000009 3300009553 Bacteria 313866
264 Ga0105249_10000188 3300009553 Bacteria 71137
265 Ga0105249_10001451 3300009553 Bacteria 20761
266 Ga0105239_10003476 3300010375 Bacteria 19271
267 Ga0105239_10142196 3300010375 Bacteria 2675
268 Ga0105246_10000805 3300011119 Bacteria 17824
269 Ga0105246_10070771 3300011119 Bacteria 2454
270 Ga0105246_10206809 3300011119 Bacteria 1530
271 Ga0157373_10117744 3300013100 Unclassified 1867
272 Ga0157371_10008228 3300013102 Bacteria 8334
273 Ga0157371_10024918 3300013102 Bacteria 4365
274 Ga0157371_10035913 3300013102 Bacteria 3550
275 Ga0157370_10008914 3300013104 Bacteria 10778
276 Ga0157370_10010458 3300013104 Bacteria 9776
277 Ga0157370_10018635 3300013104 Bacteria 6978
278 Ga0157370_10062436 3300013104 Bacteria 3533
279 Ga0157370_10197544 3300013104 Bacteria 1867
280 Ga0157370_10201215 3300013104 Bacteria 1848
281 Ga0157370_10280630 3300013104 Bacteria 1539
282 Ga0157369_10014926 3300013105 Bacteria 8767
283 Ga0157369_10022444 3300013105 Bacteria 7041
284 Ga0157369_10056890 3300013105 Unclassified 4220
285 Ga0157369_10081255 3300013105 Bacteria 3469
286 Ga0157369_10237399 3300013105 Bacteria 1904
287 Ga0157374_10015450 3300013296 Bacteria 6696
288 Ga0157374_10261612 3300013296 Bacteria 1704
289 Ga0157374_10344392 3300013296 Bacteria 1480
290 Ga0157378_10073426 3300013297 Bacteria 3075
291 Ga0163162_10000292 3300013306 Bacteria 45993
292 Ga0163162_10013502 3300013306 Bacteria 7974
293 Ga0157372_10006010 3300013307 Bacteria 12893
294 Ga0157372_10006234 3300013307 Bacteria 12678
295 Ga0157372_10007429 3300013307 Bacteria 11655
296 Ga0157372_10010290 3300013307 Bacteria 9938
297 Ga0157372_10010516 3300013307 Bacteria 9850
298 Ga0157372_10013019 3300013307 Bacteria 8871
299 Ga0157372_10020136 3300013307 Bacteria 7194
300 Ga0157372_10021673 3300013307 Bacteria 6945
301 Ga0157372_10043658 3300013307 Bacteria 4964
302 Ga0157372_10091781 3300013307 Bacteria 3454
303 Ga0157372_10261652 3300013307 Bacteria 2009
304 Ga0157372_10302157 3300013307 Bacteria 1861
305 Ga0157372_10450734 3300013307 Bacteria 1499
306 Ga0157375_10012717 3300013308 Bacteria 7469
307 Ga0157375_10020414 3300013308 Bacteria 6052
308 Ga0157375_10030826 3300013308 Bacteria 5062
309 Ga0157375_10052403 3300013308 Bacteria 4011
310 Ga0157375_10078419 3300013308 Bacteria 3336
311 Ga0163163_10034381 3300014325 Bacteria 4908
312 Ga0163163_10109754 3300014325 Bacteria 2786
313 Ga0163163_10152369 3300014325 Bacteria 2355
314 Ga0157380_10028871 3300014326 Bacteria 4235
315 Ga0157380_10181480 3300014326 Bacteria 1850
316 Ga0157380_10363526 3300014326 Bacteria 1359
317 Ga0182008_10033157 3300014497 Bacteria 2592
318 Ga0157377_10000915 3300014745 Bacteria 12303
319 Ga0157379_10000694 3300014968 Bacteria 27295
320 Ga0157376_10009000 3300014969 Bacteria 7231
321 Ga0163161_10001779 3300017792 Bacteria 15708
322 Ga0213876_10000952 3300021384 Bacteria 19055
323 Ga0207697_10000960 3300025315 Bacteria 16212
324 Ga0207682_10010184 3300025893 Bacteria 3689
325 Ga0207682_10026239 3300025893 Bacteria 2315
326 Ga0207642_10091089 3300025899 Bacteria 1506
327 Ga0207688_10034044 3300025901 Bacteria 2820
328 Ga0207688_10071329 3300025901 Bacteria 1972
329 Ga0207680_10118750 3300025903 Bacteria 1726
330 Ga0207680_10175984 3300025903 Bacteria 1444
331 Ga0207699_10104331 3300025906 Bacteria 1805
332 Ga0207645_10003416 3300025907 Bacteria 12073
333 Ga0207645_10069804 3300025907 Bacteria 2247
334 Ga0207645_10084514 3300025907 Bacteria 2037
335 Ga0207643_10001096 3300025908 Bacteria 16042
336 Ga0207643_10004931 3300025908 Bacteria 7139
337 Ga0207705_10011689 3300025909 Bacteria 6342
338 Ga0207705_10014752 3300025909 Bacteria 5618
339 Ga0207705_10024933 3300025909 Bacteria 4269
340 Ga0207684_10015138 3300025910 Bacteria 6642
341 Ga0207707_10000628 3300025912 Bacteria 35029
342 Ga0207707_10001286 3300025912 Bacteria 23415
343 Ga0207707_10001727 3300025912 Bacteria 20071
344 Ga0207707_10001809 3300025912 Bacteria 19630
345 Ga0207707_10002479 3300025912 Bacteria 16620
346 Ga0207707_10008507 3300025912 Bacteria 8895
347 Ga0207707_10019698 3300025912 Bacteria 5889
348 Ga0207707_10023835 3300025912 Bacteria 5352
349 Ga0207707_10049256 3300025912 Bacteria 3670
350 Ga0207707_10058829 3300025912 Bacteria 3344
351 Ga0207695_10000861 3300025913 Bacteria 55493
352 Ga0207695_10001150 3300025913 Bacteria 45914
353 Ga0207695_10002089 3300025913 Bacteria 30401
354 Ga0207695_10010924 3300025913 Bacteria 11044
355 Ga0207695_10023910 3300025913 Bacteria 6894
356 Ga0207695_10042786 3300025913 Bacteria 4833
357 Ga0207695_10062741 3300025913 Bacteria 3835
358 Ga0207695_10165424 3300025913 Bacteria 2141
359 Ga0207693_10007196 3300025915 Bacteria 9167
360 Ga0207693_10033815 3300025915 Bacteria 4033
361 Ga0207693_10226298 3300025915 Bacteria 1469
362 Ga0207660_10000475 3300025917 Bacteria 26652
363 Ga0207660_10155459 3300025917 Bacteria 1760
364 Ga0207660_10203363 3300025917 Bacteria 1548
365 Ga0207660_10252738 3300025917 Bacteria 1391
366 Ga0207662_10005076 3300025918 Bacteria 6978
367 Ga0207662_10006434 3300025918 Bacteria 6339
368 Ga0207662_10044650 3300025918 Bacteria 2617
369 Ga0207657_10003025 3300025919 Bacteria 18006
370 Ga0207657_10038966 3300025919 Bacteria 4225
371 Ga0207657_10057256 3300025919 Bacteria 3360
372 Ga0207657_10086749 3300025919 Bacteria 2619
373 Ga0207657_10100950 3300025919 Bacteria 2395
374 Ga0207649_10005285 3300025920 Bacteria 6983
375 Ga0207649_10013012 3300025920 Bacteria 4638
376 Ga0207649_10015723 3300025920 Bacteria 4253
377 Ga0207649_10019787 3300025920 Bacteria 3852
378 Ga0207649_10024007 3300025920 Bacteria 3538
379 Ga0207649_10057250 3300025920 Bacteria 2437
380 Ga0207649_10064916 3300025920 Bacteria 2309
381 Ga0207649_10112648 3300025920 Bacteria 1820
382 Ga0207649_10294547 3300025920 Bacteria 1184
383 Ga0207652_10000840 3300025921 Bacteria 29292
384 Ga0207652_10013432 3300025921 Bacteria 6627
385 Ga0207652_10027125 3300025921 Bacteria 4773
386 Ga0207652_10031985 3300025921 Bacteria 4419
387 Ga0207652_10056181 3300025921 Bacteria 3389
388 Ga0207652_10202274 3300025921 Bacteria 1787
389 Ga0207652_10339413 3300025921 Bacteria 1356
390 Ga0207652_10400777 3300025921 Bacteria 1238
391 Ga0207646_10029467 3300025922 Bacteria 4988
392 Ga0207681_10004385 3300025923 Bacteria 8695
393 Ga0207681_10006731 3300025923 Bacteria 7052
394 Ga0207681_10026038 3300025923 Bacteria 3769
395 Ga0207694_10050473 3300025924 Bacteria 3222
396 Ga0207694_10265808 3300025924 Bacteria 1406
397 Ga0207650_10000572 3300025925 Bacteria 29723
398 Ga0207650_10012729 3300025925 Bacteria 5810
399 Ga0207650_10197585 3300025925 Bacteria 1609
400 Ga0207659_10002363 3300025926 Bacteria 11234
401 Ga0207659_10007811 3300025926 Bacteria 6608
402 Ga0207659_10026895 3300025926 Bacteria 3888
403 Ga0207659_10240571 3300025926 Bacteria 1464
404 Ga0207687_10006115 3300025927 Bacteria 7967
405 Ga0207700_10000413 3300025928 Bacteria 25020
406 Ga0207700_10044952 3300025928 Bacteria 3255
407 Ga0207700_10056505 3300025928 Bacteria 2955
408 Ga0207664_10033976 3300025929 Bacteria 3924
409 Ga0207664_10050846 3300025929 Bacteria 3270
410 Ga0207664_10051785 3300025929 Bacteria 3243
411 Ga0207664_10110955 3300025929 Bacteria 2281
412 Ga0207644_10079807 3300025931 Bacteria 2415
413 Ga0207644_10105670 3300025931 Bacteria 2121
414 Ga0207644_10153148 3300025931 Bacteria 1786
415 Ga0207644_10334309 3300025931 Bacteria 1227
416 Ga0207690_10006584 3300025932 Bacteria 6882
417 Ga0207690_10008915 3300025932 Bacteria 5955
418 Ga0207690_10051155 3300025932 Bacteria 2761
419 Ga0207690_10073895 3300025932 Bacteria 2360
420 Ga0207690_10084404 3300025932 Bacteria 2226
421 Ga0207690_10128303 3300025932 Bacteria 1852
422 Ga0207706_10000083 3300025933 Bacteria 98149
423 Ga0207706_10016729 3300025933 Bacteria 6620
424 Ga0207706_10046521 3300025933 Bacteria 3841
425 Ga0207706_10070218 3300025933 Bacteria 3081
426 Ga0207706_10243264 3300025933 Bacteria 1573
427 Ga0207686_10043318 3300025934 Bacteria 2757
428 Ga0207670_10008787 3300025936 Bacteria 5722
429 Ga0207669_10129711 3300025937 Bacteria 1730
430 Ga0207704_10008294 3300025938 Bacteria 4958
431 Ga0207691_10001010 3300025940 Bacteria 27914
432 Ga0207691_10001083 3300025940 Bacteria 27125
433 Ga0207691_10002009 3300025940 Bacteria 19909
434 Ga0207691_10043343 3300025940 Bacteria 4147
435 Ga0207711_10025070 3300025941 Bacteria 5003
436 Ga0207711_10224720 3300025941 Bacteria 1718
437 Ga0207711_10400325 3300025941 Bacteria 1275
438 Ga0207689_10005380 3300025942 Bacteria 11458
439 Ga0207689_10282640 3300025942 Bacteria 1374
440 Ga0207689_10411327 3300025942 Unclassified 1128
441 Ga0207661_10001070 3300025944 Bacteria 18226
442 Ga0207661_10003651 3300025944 Bacteria 10720
443 Ga0207661_10009978 3300025944 Bacteria 6823
444 Ga0207661_10010207 3300025944 Bacteria 6752
445 Ga0207661_10011222 3300025944 Bacteria 6482
446 Ga0207661_10039432 3300025944 Bacteria 3707
447 Ga0207661_10040184 3300025944 Unclassified 3675
448 Ga0207661_10040319 3300025944 Bacteria 3670
449 Ga0207661_10066497 3300025944 Bacteria 2928
450 Ga0207661_10071627 3300025944 Bacteria 2833
451 Ga0207679_10000933 3300025945 Bacteria 18674
452 Ga0207679_10002183 3300025945 Bacteria 12108
453 Ga0207679_10012266 3300025945 Bacteria 5583
454 Ga0207679_10017905 3300025945 Bacteria 4735
455 Ga0207679_10023631 3300025945 Bacteria 4206
456 Ga0207679_10033339 3300025945 Bacteria 3622
457 Ga0207679_10142828 3300025945 Bacteria 1937
458 Ga0207667_10037955 3300025949 Bacteria 5148
459 Ga0207667_10135300 3300025949 Bacteria 2538
460 Ga0207667_10137684 3300025949 Bacteria 2514
461 Ga0207667_10162465 3300025949 Bacteria 2297
462 Ga0207667_10178190 3300025949 Bacteria 2183
463 Ga0207667_10203029 3300025949 Unclassified 2033
464 Ga0207667_10232001 3300025949 Bacteria 1890
465 Ga0207712_10000077 3300025961 Bacteria 119803
466 Ga0207712_10001391 3300025961 Bacteria 16534
467 Ga0207712_10050468 3300025961 Bacteria 2905
468 Ga0207668_10003865 3300025972 Bacteria 8826
469 Ga0207668_10035092 3300025972 Bacteria 3336
470 Ga0207668_10042924 3300025972 Bacteria 3065
471 Ga0207668_10220554 3300025972 Bacteria 1522
472 Ga0207640_10000396 3300025981 Bacteria 27678
473 Ga0207658_10009249 3300025986 Bacteria 6683
474 Ga0207677_10008551 3300026023 Bacteria 5726
475 Ga0207677_10083805 3300026023 Bacteria 2296
476 Ga0207677_10327981 3300026023 Unclassified 1275
477 Ga0207703_10270419 3300026035 Bacteria 1539
478 Ga0207639_10027593 3300026041 Bacteria 4138
479 Ga0207639_10032262 3300026041 Bacteria 3855
480 Ga0207639_10129722 3300026041 Bacteria 2085
481 Ga0207678_10047039 3300026067 Bacteria 3731
482 Ga0207678_10092125 3300026067 Bacteria 2591
483 Ga0207708_10063560 3300026075 Bacteria 2820
484 Ga0207702_10119187 3300026078 Bacteria 2359
485 Ga0207641_10032912 3300026088 Bacteria 4306
486 Ga0207641_10271965 3300026088 Bacteria 1590
487 Ga0207648_10015741 3300026089 Bacteria 6938
488 Ga0207648_10138315 3300026089 Bacteria 2146
489 Ga0207648_10143333 3300026089 Bacteria 2107
490 Ga0207676_10024653 3300026095 Bacteria 4454
491 Ga0207676_10044616 3300026095 Bacteria 3421
492 Ga0207674_10006057 3300026116 Bacteria 14305
493 Ga0207674_10008034 3300026116 Bacteria 12230
494 Ga0207674_10017289 3300026116 Bacteria 7868
495 Ga0207674_10025607 3300026116 Bacteria 6285
496 Ga0207674_10094868 3300026116 Bacteria 2969
497 Ga0207675_100000132 3300026118 Bacteria 62776
498 Ga0207675_100014893 3300026118 Bacteria 7259
499 Ga0207683_10178985 3300026121 Unclassified 1922
500 Ga0207683_10196679 3300026121 Bacteria 1832
501 Ga0207698_10013391 3300026142 Bacteria 5409
502 Ga0207698_10014692 3300026142 Bacteria 5214
503 Ga0207698_10029204 3300026142 Bacteria 3945
504 Ga0209969_1004715 3300027360 Unclassified 1905
505 Ga0210000_1004081 3300027462 Bacteria 2109
506 Ga0209968_1000965 3300027526 Bacteria 4431
507 Ga0209999_1001622 3300027543 Bacteria 3879
508 Ga0209966_1000414 3300027695 Bacteria 12377
509 Ga0209998_10000026 3300027717 Bacteria 60645
510 Ga0209974_10003467 3300027876 Bacteria 5687
511 Ga0207428_10017074 3300027907 Bacteria 6235
512 Ga0207428_10068112 3300027907 Unclassified 2801
513 Ga0207428_10118027 3300027907 Bacteria 2036
514 Ga0207428_10288480 3300027907 Bacteria 1217
515 Ga0268266_10070113 3300028379 Bacteria 3038
516 Ga0268265_10001692 3300028380 Bacteria 17977
517 Ga0268265_10014891 3300028380 Bacteria 5308
518 Ga0268265_10199106 3300028380 Bacteria 1736
519 Ga0268265_10206915 3300028380 Bacteria 1707
520 Ga0268264_10011767 3300028381 Bacteria 7215
521 Ga0307408_100009908 3300031548 Bacteria 6277
522 Ga0307408_100028286 3300031548 Bacteria 3873
523 Ga0307405_10000446 3300031731 Bacteria 15439
524 Ga0307405_10001705 3300031731 Bacteria 9372
525 Ga0307405_10024015 3300031731 Bacteria 3476
526 Ga0307405_10029611 3300031731 Bacteria 3202
527 Ga0307405_10046800 3300031731 Bacteria 2660
528 Ga0307405_10047539 3300031731 Bacteria 2643
529 Ga0307405_10139750 3300031731 Unclassified 1687
530 Ga0307413_10029611 3300031824 Unclassified 3066
531 Ga0307413_10032799 3300031824 Bacteria 2948
532 Ga0307413_10036657 3300031824 Bacteria 2825
533 Ga0307413_10100236 3300031824 Bacteria 1912
534 Ga0307413_10163701 3300031824 Bacteria 1566
535 Ga0307410_10013893 3300031852 Bacteria 4715
536 Ga0307410_10063754 3300031852 Bacteria 2529
537 Ga0307410_10125352 3300031852 Unclassified 1879
538 Ga0307406_10000378 3300031901 Bacteria 25641
539 Ga0307406_10004801 3300031901 Bacteria 7364
540 Ga0307406_10068753 3300031901 Bacteria 2313
541 Ga0307406_10083128 3300031901 Bacteria 2134
542 Ga0307406_10269106 3300031901 Bacteria 1293
543 Ga0307407_10081892 3300031903 Bacteria 1954
544 Ga0307407_10159534 3300031903 Bacteria 1474
545 Ga0307412_10003834 3300031911 Bacteria 8359
546 Ga0307412_10005546 3300031911 Bacteria 7089
547 Ga0307412_10036345 3300031911 Bacteria 3154
548 Ga0307412_10116473 3300031911 Bacteria 1917
549 Ga0307412_10128439 3300031911 Bacteria 1837
550 Ga0307412_10204494 3300031911 Bacteria 1502
551 Ga0307409_100079538 3300031995 Bacteria 2642
552 Ga0307409_100100520 3300031995 Bacteria 2397
553 Ga0307409_100203936 3300031995 Bacteria 1771
554 Ga0307409_100354029 3300031995 Bacteria 1386
555 Ga0307416_100002050 3300032002 Bacteria 11348
556 Ga0307416_100021406 3300032002 Bacteria 4641
557 Ga0307416_100054049 3300032002 Bacteria 3226
558 Ga0307416_100056420 3300032002 Bacteria 3170
559 Ga0307416_100066471 3300032002 Bacteria 2968
560 Ga0307416_100069569 3300032002 Bacteria 2913
561 Ga0307416_100103138 3300032002 Bacteria 2489
562 Ga0307416_100134043 3300032002 Bacteria 2236
563 Ga0307414_10018674 3300032004 Bacteria 4277
564 Ga0307414_10199118 3300032004 Bacteria 1627
565 Ga0307411_10002281 3300032005 Bacteria 8395
566 Ga0307411_10136486 3300032005 Bacteria 1802
567 Ga0307415_100012339 3300032126 Bacteria 4937
568 Ga0307415_100050993 3300032126 Bacteria 2806
569 Ga0307415_100053386 3300032126 Bacteria 2753
570 Ga0307415_100070454 3300032126 Bacteria 2455
571 Ga0307415_100075738 3300032126 Bacteria 2382
572 Ga0373934_0014235 3300035086 Bacteria 3013
573 Ga0373952_0017283 3300035092 Unclassified 1478
574 Ga0373945_0002457 3300035116 Bacteria 5816
575 Ga0373954_0007855 3300035118 Bacteria 4672
576 Ga0373956_0002165 3300035119 Bacteria 8113
577 Ga0373956_0015481 3300035119 Bacteria 3194
578 Ga0373943_0000065 3300035170 Bacteria 37193
579 Ga0373943_0018505 3300035170 Bacteria 3202
580 Ga0373955_0011674 3300035172 Bacteria 4197
581 Ga0373955_0030375 3300035172 Bacteria 2820
582 Ga0373955_0094968 3300035172 Bacteria 1705
583 Ga0373924_0004295 3300035410 Bacteria 4970
584 Ga0373935_0000894 3300035692 Bacteria 16125
585 Ga0373935_0069983 3300035692 Bacteria 2261
586 Ga0373927_0000854 3300035695 Bacteria 23241
587 Ga0373927_0004549 3300035695 Bacteria 9691
588 Ga0373933_0000091 3300035724 Bacteria 56608
589 Ga0373933_0010025 3300035724 Bacteria 5186
590 Ga0373933_0034234 3300035724 Bacteria 2959
591 Ga0373947_0000861 3300035725 Bacteria 18324
592 Ga0373937_0000104 3300036401 Bacteria 80334
593 Ga0373937_0000632 3300036401 Bacteria 30801
594 Ga0373937_0005619 3300036401 Bacteria 10765
595 Ga0373937_0150808 3300036401 Bacteria 2177
596 Ga0373925_0005691 3300037068 Bacteria 9263
597 Ga0395899_0005499 3300037312 Bacteria 9818
598 Ga0395900_0005573 3300037418 Bacteria 13181
599 Ga0395905_0001459 3300037471 Bacteria 28357
600 Ga0395905_0218535 3300037471 Bacteria 1784
601 Ga0436365_1394990 3300039437 Bacteria 17910
602 Ga0439439_0007292 3300041406 Bacteria 2584
603 Ga0439461_0019312 3300041410 Bacteria 1341
604 Ga0439448_0011860 3300042005 Bacteria 2600
605 Ga0439434_0003779 3300042435 Bacteria 4426
606 Ga0451577_0000228 3300042876 Bacteria 114707
607 Ga0451577_0018319 3300042876 Bacteria 6452
608 Ga0453684_0057598 3300044712 Bacteria 5027
609 Ga0451576_0095544 3300045051 Bacteria 3091
610 Ga0466967_0149582 3300045976 Unclassified 2181
611 Ga0466967_0266093 3300045976 Bacteria 1641
612 Ga0495592_0000491 3300046454 Bacteria 28840
613 Ga0495592_0119261 3300046454 Bacteria 1858
614 Ga0495603_0000172 3300046455 Bacteria 32737
615 Ga0495603_0005363 3300046455 Bacteria 7646
616 Ga0495629_0014858 3300046459 Bacteria 5601
617 Ga0495629_0024515 3300046459 Bacteria 4296
618 Ga0495651_0018107 3300046462 Bacteria 5454
619 Ga0495653_0000064 3300046463 Bacteria 92950
620 Ga0495653_0009793 3300046463 Bacteria 7837
621 Ga0495580_0026113 3300046472 Bacteria 4261
622 Ga0495580_0044141 3300046472 Bacteria 3172
623 Ga0495582_0003555 3300046473 Bacteria 8787
624 Ga0495582_0014645 3300046473 Unclassified 4309
625 Ga0495639_0000571 3300046475 Bacteria 17187
626 Ga0495639_0007940 3300046475 Bacteria 4560
627 Ga0495639_0031832 3300046475 Bacteria 2350
628 Ga0495664_0081626 3300046477 Bacteria 1938
629 Ga0495594_0038762 3300046499 Bacteria 2603
630 Ga0495594_0056484 3300046499 Bacteria 2166
631 Ga0495594_0074532 3300046499 Bacteria 1891
632 Ga0495608_0000200 3300046511 Bacteria 42536
633 Ga0495608_0009567 3300046511 Bacteria 6769
634 Ga0495608_0042531 3300046511 Bacteria 3038
635 Ga0495618_0100369 3300046514 Bacteria 1852
636 Ga0495628_0019957 3300046516 Bacteria 5536
637 Ga0495628_0081513 3300046516 Bacteria 2513
638 Ga0495628_0166270 3300046516 Bacteria 1674
639 Ga0495630_0000434 3300046517 Bacteria 31953
640 Ga0495630_0034417 3300046517 Bacteria 3783
641 Ga0495630_0038766 3300046517 Bacteria 3565
642 Ga0495666_0052505 3300046526 Bacteria 1957
643 Ga0495666_0071108 3300046526 Bacteria 1654
644 Ga0495652_0014540 3300046529 Bacteria 7061
645 Ga0495652_0019942 3300046529 Bacteria 5962
646 Ga0495652_0048425 3300046529 Bacteria 3642
647 Ga0495665_0000479 3300046531 Bacteria 20123
648 Ga0495665_0010772 3300046531 Bacteria 4951
649 Ga0495665_0110563 3300046531 Bacteria 1441
650 Ga0495640_0027642 3300046533 Bacteria 4089
651 Ga0495586_0018554 3300046535 Bacteria 3704
652 Ga0495586_0027910 3300046535 Bacteria 3020
653 Ga0495586_0037512 3300046535 Bacteria 2602
654 Ga0495586_0089857 3300046535 Bacteria 1696
655 Ga0495587_0000557 3300046536 Bacteria 25724
656 Ga0495587_0007146 3300046536 Bacteria 7247
657 Ga0495587_0026846 3300046536 Bacteria 3507
658 Ga0495645_0003259 3300046543 Bacteria 11020
659 Ga0495645_0006736 3300046543 Bacteria 7983
660 Ga0495645_0013728 3300046543 Bacteria 5738
661 Ga0495645_0036263 3300046543 Bacteria 3594
662 Ga0495667_0000234 3300046559 Bacteria 36417
663 Ga0495667_0005301 3300046559 Bacteria 8714
664 Ga0495667_0015101 3300046559 Bacteria 5213
665 Ga0495667_0152716 3300046559 Bacteria 1486
666 Ga0495634_0009995 3300046642 Bacteria 6970
667 Ga0495634_0115134 3300046642 Bacteria 1726
668 Ga0495635_0000027 3300046663 Bacteria 123782
669 Ga0495635_0013330 3300046663 Bacteria 5753
670 Ga0495635_0092420 3300046663 Bacteria 2069
671 Ga0495588_0001301 3300046674 Bacteria 10686
672 Ga0495657_0000786 3300046675 Bacteria 28252
673 Ga0495657_0084559 3300046675 Bacteria 2046
674 Ga0495657_0119152 3300046675 Bacteria 1664
675 Ga0495599_0000121 3300046678 Bacteria 52373
676 Ga0495599_0003580 3300046678 Bacteria 9105
677 Ga0495599_0032040 3300046678 Bacteria 3299
678 Ga0495599_0052584 3300046678 Bacteria 2552
679 Ga0495623_0006212 3300046679 Bacteria 7767
680 Ga0495623_0015630 3300046679 Bacteria 4906
681 Ga0495646_0001695 3300046680 Bacteria 13200
682 Ga0495646_0107894 3300046680 Bacteria 1588
683 Ga0495647_0023149 3300046681 Bacteria 2251
684 Ga0495658_0000078 3300046683 Bacteria 48561
685 Ga0495658_0088105 3300046683 Bacteria 1834
686 Ga0495658_0113369 3300046683 Bacteria 1632
687 Ga0495613_0006241 3300046689 Bacteria 8916
688 Ga0495613_0025751 3300046689 Bacteria 4383
689 Ga0495613_0029042 3300046689 Bacteria 4111
690 Ga0495600_0000507 3300046809 Bacteria 20181
691 Ga0495600_0035246 3300046809 Bacteria 3249
692 Ga0495581_0000333 3300047315 Bacteria 23451
693 Ga0495604_0001528 3300047317 Bacteria 19052
694 Ga0495604_0005226 3300047317 Bacteria 10283
695 Ga0495674_0000649 3300047319 Bacteria 32671
696 Ga0495674_0013587 3300047319 Bacteria 7649
697 Ga0495674_0037263 3300047319 Bacteria 4369
698 Ga0495674_0314848 3300047319 Bacteria 1276
699 Ga0495680_0011086 3300047322 Bacteria 8001
700 Ga0495680_0025356 3300047322 Bacteria 4908
701 Ga0495675_0002291 3300047444 Bacteria 11424
702 Ga0495684_0000116 3300047471 Bacteria 57957
703 Ga0495684_0000527 3300047471 Bacteria 30992
704 Ga0495684_0008323 3300047471 Bacteria 8037
705 Ga0495684_0013643 3300047471 Bacteria 6257
706 Ga0495684_0016578 3300047471 Bacteria 5675
707 Ga0495684_0052197 3300047471 Bacteria 3120
708 Ga0495593_0001774 3300047673 Bacteria 12778
709 Ga0495602_0000377 3300048088 Bacteria 41583
710 Ga0495614_0000593 3300048089 Bacteria 15147
711 Ga0496100_0132203 3300048903 Bacteria 1759
712 Ga0496101_0127269 3300048904 Bacteria 1931
713 Ga0496102_0347927 3300048905 Bacteria 1396
714 Ga0496104_0280485 3300048907 Bacteria 1579
715 Ga0496104_0325747 3300048907 Bacteria 1449
716 Ga0496108_0128287 3300048911 Bacteria 2179
717 Ga0496108_0276866 3300048911 Bacteria 1461
718 Ga0496109_0080356 3300048912 Bacteria 3004
719 Ga0496111_0141584 3300048914 Bacteria 1782
720 Ga0496112_0015670 3300048915 Bacteria 7079
721 Ga0496112_0144830 3300048915 Bacteria 2344
722 Ga0496112_0282989 3300048915 Bacteria 1605
723 Ga0496113_0004584 3300048916 Bacteria 8520
724 Ga0496113_0038286 3300048916 Bacteria 3525
725 Ga0496114_0095590 3300048917 Bacteria 2529
726 Ga0496115_0044897 3300048918 Bacteria 3526
727 Ga0501292_000394 3300049515 Bacteria 5826
728 Ga0501032_0055011 3300049569 Bacteria 2678
729 Ga0501033_0028590 3300049570 Bacteria 4188
730 Ga0501034_0069465 3300049571 Bacteria 3534
731 Ga0501034_0119760 3300049571 Bacteria 2619
732 Ga0501036_0008548 3300049572 Bacteria 8396
733 Ga0501037_0075596 3300049573 Bacteria 2446
734 Ga0501042_0189993 3300049578 Bacteria 1481
735 Ga0501046_0091280 3300049580 Bacteria 2343
736 Ga0501048_0102640 3300049582 Bacteria 2018
737 Ga0501070_0345602 3300049586 Bacteria 1208
738 Ga0501074_0186274 3300049590 Bacteria 1480
739 Ga0501217_001705 3300049661 Bacteria 4191
740 Ga0501235_000510 3300049669 Bacteria 7766
741 Ga0501258_000052 3300049687 Bacteria 6101
742 Ga0501261_006862 3300049690 Bacteria 1455
743 Ga0501221_000412 3300049704 Bacteria 6604
744 Ga0501234_004859 3300049707 Bacteria 2110
745 Ga0501080_0147761 3300049742 Bacteria 2173
746 Ga0501081_0134944 3300049743 Bacteria 1766
747 Ga0501083_0038746 3300049744 Bacteria 3239
748 Ga0501266_000807 3300049763 Bacteria 4078
749 Ga0501268_000194 3300049765 Bacteria 5769
750 Ga0501035_0209579 3300049822 Bacteria 1668
751 Ga0501044_0015212 3300049823 Bacteria 8287
752 Ga0501045_0013520 3300049824 Bacteria 5766
753 nmdc:mga05p37_130510_c1 3300050507 Bacteria 3083
754 nmdc:mga09592_10883_c1 3300050508 Bacteria 7404
755 nmdc:mga09592_151908_c1 3300050508 Bacteria 1998
756 nmdc:mga09592_179756_c1 3300050508 Bacteria 1830
757 nmdc:mga0qj67_18266_c2 3300050509 Bacteria 2631
758 nmdc:mga0qj67_25506_c1 3300050509 Bacteria 4568
759 nmdc:mga06r32_221551_c1 3300050510 Bacteria 1880
760 nmdc:mga06r32_42752_c1 3300050510 Bacteria 4310
761 nmdc:mga06r32_4856_c1 3300050510 Bacteria 12108
762 nmdc:mga06r32_60208_c1 3300050510 Bacteria 3653
763 nmdc:mga06r32_63688_c1 3300050510 Bacteria 3555
764 nmdc:mga06r32_91159_c1 3300050510 Unclassified 2978
765 nmdc:mga08y16_14115_c1 3300050511 Bacteria 8410
766 nmdc:mga08y16_354466_c1 3300050511 Bacteria 1507
767 nmdc:mga08y16_93175_c1 3300050511 Bacteria 3139
768 nmdc:mga0n895_10198_c1 3300050512 Bacteria 8277
769 nmdc:mga0n895_34165_c1 3300050512 Bacteria 4893
770 nmdc:mga0n895_74746_c1 3300050512 Bacteria 3367
771 nmdc:mga08x19_160617_c1 3300050514 Bacteria 1526
772 nmdc:mga08x19_5867_c1 3300050514 Bacteria 7265
773 nmdc:mga08x19_9592_c1 3300050514 Bacteria 5795
774 nmdc:mga0a205_999_c1 3300050515 Bacteria 23420
775 Ga0495601_0001181 3300053077 Bacteria 14281
776 Ga0495595_0035146 3300053084 Bacteria 2270
777 Ga0495619_0000293 3300053085 Bacteria 35547
778 Ga0501082_0293232 3300060353 Bacteria 1416
779 Ga0530510_0259066 3300061734 Bacteria 1297
780 Ga0451577_0000001
781 Ga0065704_10221130
782 Ga0065707_10091418
783 Ga0065707_10106580
784 Ga0070658_10008683
785 Ga0070658_10023189
786 Ga0070658_10027759
787 Ga0070676_10000168
788 Ga0070676_10038723
789 Ga0070676_10112139
790 Ga0070683_100001524
791 Ga0070683_100002342
792 Ga0070683_100007250
793 Ga0070683_100009280
794 Ga0070683_100017935
795 Ga0070683_100043062
796 Ga0070683_100050590
797 Ga0070683_100080555
798 Ga0070683_100087487
799 Ga0070683_100088624
800 Ga0070683_100152364
801 Ga0070683_100224118
802 Ga0070690_100012805
803 Ga0070690_100042430
804 Ga0070690_100110625
805 Ga0070670_100000138
806 Ga0070670_100006336
807 Ga0068869_100003300
808 Ga0068869_100096231
809 Ga0068869_100400349
810 Ga0070666_10047345
811 Ga0070680_100005879
812 Ga0070680_100027130
813 Ga0070680_100104022
814 Ga0070680_100235124
815 Ga0070682_100125490
816 Ga0070682_100165709
817 Ga0068868_100015779
818 Ga0070660_100039324
819 Ga0070660_100045078
820 Ga0070660_100047018
821 Ga0070660_100095586
822 Ga0070689_100023857
823 Ga0070689_100135882
824 Ga0070689_100193676
825 Ga0070691_10061579
826 Ga0070691_10102484
827 Ga0070687_100075621
828 Ga0070661_100001898
829 Ga0070661_100014249
830 Ga0070661_100041515
831 Ga0070661_100301469
832 Ga0070692_10013649
833 Ga0070692_10122866
834 Ga0070668_100000678
835 Ga0070668_100021761
836 Ga0070668_100038005
837 Ga0070668_100055943
838 Ga0070669_100001286
839 Ga0070669_100004218
840 Ga0070669_100016678
841 Ga0070675_100003493
842 Ga0070675_100006770
843 Ga0070675_100020360
844 Ga0070675_100053605
845 Ga0070675_100188138
846 Ga0070671_100024672
847 Ga0070671_100031009
848 Ga0070671_100047458
849 Ga0070673_100006410
850 Ga0070673_100054637
851 Ga0070673_100162296
852 Ga0070688_100024267
853 Ga0070688_100174402
854 Ga0070659_100012624
855 Ga0070659_100017927
856 Ga0070659_100020742
857 Ga0070659_100207055
858 Ga0070667_100024910
859 Ga0070667_100141757
860 Ga0070667_100222936
861 Ga0070714_100004147
862 Ga0070714_100061322
863 Ga0070714_100084223
864 Ga0070714_100127061
865 Ga0070713_100000095
866 Ga0070713_100010296
867 Ga0070713_100067267
868 Ga0070713_100074982
869 Ga0070710_10146635
870 Ga0070701_10004434
871 Ga0070701_10013547
872 Ga0070711_100193724
873 Ga0070694_100015222
874 Ga0070694_100018972
875 Ga0070694_100048474
876 Ga0070708_100000004
877 Ga0070663_100062510
878 Ga0070663_100069310
879 Ga0070663_100129797
880 Ga0070678_100148235
881 Ga0070678_100157007
882 Ga0070662_100007887
883 Ga0070662_100019738
884 Ga0070662_100031444
885 Ga0070681_10005847
886 Ga0070681_10018250
887 Ga0070681_10021058
888 Ga0070681_10037232
889 Ga0070681_10045206
890 Ga0070681_10103475
891 Ga0068867_100002642
892 Ga0068867_100075169
893 Ga0068867_100134619
894 Ga0068867_100213929
895 Ga0070685_10021073
896 Ga0070706_100046133
897 Ga0070706_100060644
898 Ga0070707_100076965
899 Ga0070707_100425003
900 Ga0070698_100000313
901 Ga0070698_100001920
902 Ga0070698_100148454
903 Ga0070699_100002608
904 Ga0070699_100028940
905 Ga0070699_100032889
906 Ga0070699_100240078
907 Ga0070679_100001684
908 Ga0070679_100001856
909 Ga0070679_100003522
910 Ga0070679_100007101
911 Ga0070679_100030623
912 Ga0070679_100159359
913 Ga0070679_100391560
914 Ga0070684_100004605
915 Ga0070684_100006092
916 Ga0070684_100006251
917 Ga0070684_100006545
918 Ga0070684_100011134
919 Ga0070684_100021304
920 Ga0070684_100035444
921 Ga0070684_100036042
922 Ga0070684_100047867
923 Ga0070684_100075889
924 Ga0070684_100084632
925 Ga0070684_100107874
926 Ga0070684_100202023
927 Ga0070684_100204635
928 Ga0070697_100123316
929 Ga0068853_100003016
930 Ga0068853_100003657
931 Ga0068853_100086853
932 Ga0070672_100013512
933 Ga0070672_100024070
934 Ga0070672_100024656
935 Ga0070672_100269277
936 Ga0070686_100030840
937 Ga0070696_100000096
938 Ga0070696_100014917
939 Ga0070693_100012340
940 Ga0070693_100109190
941 Ga0070665_100001779
942 Ga0068855_100001603
943 Ga0068855_100027292
944 Ga0068855_100056876
945 Ga0068855_100149159
946 Ga0070664_100005766
947 Ga0070664_100011553
948 Ga0070664_100036265
949 Ga0070664_100081286
950 Ga0070664_100082103
951 Ga0070664_100089183
952 Ga0070664_100105085
953 Ga0070664_100190411
954 Ga0068857_100017536
955 Ga0068857_100027871
956 Ga0068857_100031817
957 Ga0068854_100046888
958 Ga0068854_100074175
959 Ga0068856_100032775
960 Ga0070702_100000879
961 Ga0070702_100103785
962 Ga0068852_100002775
963 Ga0068852_100004960
964 Ga0068852_100014900
965 Ga0068852_100078404
966 Ga0068852_100103590
967 Ga0068859_100133700
968 Ga0068859_100301591
969 Ga0068864_100107052
970 Ga0068864_100170512
971 Ga0068864_100222609
972 Ga0068861_100000050
973 Ga0068861_100007608
974 Ga0068861_100105127
975 Ga0068870_10000965
976 Ga0068863_100006717
977 Ga0068863_100008116
978 Ga0068863_100019388
979 Ga0068863_100214084
980 Ga0068858_100030673
981 Ga0068860_100225863
982 Ga0068860_100241967
983 Ga0068860_100588995
984 Ga0068862_100000846
985 Ga0068862_100029837
986 Ga0068862_100240515
987 Ga0081539_10000206
988 Ga0081539_10069783
989 Ga0070717_10000931
990 Ga0070712_100059077
991 Ga0070712_100257077
992 Ga0097621_100004437
993 Ga0075428_100051440
994 Ga0075428_100398728
995 Ga0075430_100005973
996 Ga0075430_100011848
997 Ga0075430_100043196
998 Ga0075430_100122783
999 Ga0075431_100004527
1000 Ga0075431_100005045
1001 Ga0075431_100043991
1002 Ga0075431_100074079
1003 Ga0075431_100112915
1004 Ga0075431_100298555
1005 Ga0075433_10014919
1006 Ga0075434_100025468
1007 Ga0075434_100072711
1008 Ga0075429_100009189
1009 Ga0075429_100060410
1010 Ga0075429_100155307
1011 Ga0075429_100165009
1012 Ga0068865_100013630
1013 Ga0068865_100021062
1014 Ga0068865_100133685
1015 Ga0075436_100005201
1016 Ga0075436_100049497
1017 Ga0097620_100133695
1018 Ga0097620_100301574
1019 Ga0105240_10007936
1020 Ga0105240_10012482
1021 Ga0105240_10018122
1022 Ga0105240_10050152
1023 Ga0105240_10074881
1024 Ga0105240_10220496
1025 Ga0111539_10007826
1026 Ga0111539_10009490
1027 Ga0111539_10045061
1028 Ga0111539_10055977
1029 Ga0105245_10008157
1030 Ga0114129_10089811
1031 Ga0114129_10264471
1032 Ga0114129_10429118
1033 Ga0105241_10141668
1034 Ga0105242_10021834
1035 Ga0105242_10066907
1036 Ga0105248_10003178
1037 Ga0105248_10004642
1038 Ga0105248_10009199
1039 Ga0105248_10339175
1040 Ga0105248_10369443
1041 Ga0105237_10160455
1042 Ga0105249_10000009
1043 Ga0105249_10000188
1044 Ga0105249_10001451
1045 Ga0105239_10003476
1046 Ga0105239_10142196
1047 Ga0105246_10000805
1048 Ga0105246_10070771
1049 Ga0105246_10206809
1050 Ga0157373_10117744
1051 Ga0157371_10008228
1052 Ga0157371_10024918
1053 Ga0157371_10035913
1054 Ga0157370_10008914
1055 Ga0157370_10010458
1056 Ga0157370_10018635
1057 Ga0157370_10062436
1058 Ga0157370_10197544
1059 Ga0157370_10201215
1060 Ga0157370_10280630
1061 Ga0157369_10014926
1062 Ga0157369_10022444
1063 Ga0157369_10056890
1064 Ga0157369_10081255
1065 Ga0157369_10237399
1066 Ga0157374_10015450
1067 Ga0157374_10261612
1068 Ga0157374_10344392
1069 Ga0157378_10073426
1070 Ga0163162_10000292
1071 Ga0163162_10013502
1072 Ga0157372_10006010
1073 Ga0157372_10006234
1074 Ga0157372_10007429
1075 Ga0157372_10010290
1076 Ga0157372_10010516
1077 Ga0157372_10013019
1078 Ga0157372_10020136
1079 Ga0157372_10021673
1080 Ga0157372_10043658
1081 Ga0157372_10091781
1082 Ga0157372_10261652
1083 Ga0157372_10302157
1084 Ga0157372_10450734
1085 Ga0157375_10012717
1086 Ga0157375_10020414
1087 Ga0157375_10030826
1088 Ga0157375_10052403
1089 Ga0157375_10078419
1090 Ga0163163_10034381
1091 Ga0163163_10109754
1092 Ga0163163_10152369
1093 Ga0157380_10028871
1094 Ga0157380_10181480
1095 Ga0157380_10363526
1096 Ga0182008_10033157
1097 Ga0157377_10000915
1098 Ga0157379_10000694
1099 Ga0157376_10009000
1100 Ga0163161_10001779
1101 Ga0213876_10000952
1102 Ga0207697_10000960
1103 Ga0207682_10010184
1104 Ga0207682_10026239
1105 Ga0207642_10091089
1106 Ga0207688_10034044
1107 Ga0207688_10071329
1108 Ga0207680_10118750
1109 Ga0207680_10175984
1110 Ga0207699_10104331
1111 Ga0207645_10003416
1112 Ga0207645_10069804
1113 Ga0207645_10084514
1114 Ga0207643_10001096
1115 Ga0207643_10004931
1116 Ga0207705_10011689
1117 Ga0207705_10014752
1118 Ga0207705_10024933
1119 Ga0207684_10015138
1120 Ga0207707_10000628
1121 Ga0207707_10001286
1122 Ga0207707_10001727
1123 Ga0207707_10001809
1124 Ga0207707_10002479
1125 Ga0207707_10008507
1126 Ga0207707_10019698
1127 Ga0207707_10023835
1128 Ga0207707_10049256
1129 Ga0207707_10058829
1130 Ga0207695_10000861
1131 Ga0207695_10001150
1132 Ga0207695_10002089
1133 Ga0207695_10010924
1134 Ga0207695_10023910
1135 Ga0207695_10042786
1136 Ga0207695_10062741
1137 Ga0207695_10165424
1138 Ga0207693_10007196
1139 Ga0207693_10033815
1140 Ga0207693_10226298
1141 Ga0207660_10000475
1142 Ga0207660_10155459
1143 Ga0207660_10203363
1144 Ga0207660_10252738
1145 Ga0207662_10005076
1146 Ga0207662_10006434
1147 Ga0207662_10044650
1148 Ga0207657_10003025
1149 Ga0207657_10038966
1150 Ga0207657_10057256
1151 Ga0207657_10086749
1152 Ga0207657_10100950
1153 Ga0207649_10005285
1154 Ga0207649_10013012
1155 Ga0207649_10015723
1156 Ga0207649_10019787
1157 Ga0207649_10024007
1158 Ga0207649_10057250
1159 Ga0207649_10064916
1160 Ga0207649_10112648
1161 Ga0207649_10294547
1162 Ga0207652_10000840
1163 Ga0207652_10013432
1164 Ga0207652_10027125
1165 Ga0207652_10031985
1166 Ga0207652_10056181
1167 Ga0207652_10202274
1168 Ga0207652_10339413
1169 Ga0207652_10400777
1170 Ga0207646_10029467
1171 Ga0207681_10004385
1172 Ga0207681_10006731
1173 Ga0207681_10026038
1174 Ga0207694_10050473
1175 Ga0207694_10265808
1176 Ga0207650_10000572
1177 Ga0207650_10012729
1178 Ga0207650_10197585
1179 Ga0207659_10002363
1180 Ga0207659_10007811
1181 Ga0207659_10026895
1182 Ga0207659_10240571
1183 Ga0207687_10006115
1184 Ga0207700_10000413
1185 Ga0207700_10044952
1186 Ga0207700_10056505
1187 Ga0207664_10033976
1188 Ga0207664_10050846
1189 Ga0207664_10051785
1190 Ga0207664_10110955
1191 Ga0207644_10079807
1192 Ga0207644_10105670
1193 Ga0207644_10153148
1194 Ga0207644_10334309
1195 Ga0207690_10006584
1196 Ga0207690_10008915
1197 Ga0207690_10051155
1198 Ga0207690_10073895
1199 Ga0207690_10084404
1200 Ga0207690_10128303
1201 Ga0207706_10000083
1202 Ga0207706_10016729
1203 Ga0207706_10046521
1204 Ga0207706_10070218
1205 Ga0207706_10243264
1206 Ga0207686_10043318
1207 Ga0207670_10008787
1208 Ga0207669_10129711
1209 Ga0207704_10008294
1210 Ga0207691_10001010
1211 Ga0207691_10001083
1212 Ga0207691_10002009
1213 Ga0207691_10043343
1214 Ga0207711_10025070
1215 Ga0207711_10224720
1216 Ga0207711_10400325
1217 Ga0207689_10005380
1218 Ga0207689_10282640
1219 Ga0207689_10411327
1220 Ga0207661_10001070
1221 Ga0207661_10003651
1222 Ga0207661_10009978
1223 Ga0207661_10010207
1224 Ga0207661_10011222
1225 Ga0207661_10039432
1226 Ga0207661_10040184
1227 Ga0207661_10040319
1228 Ga0207661_10066497
1229 Ga0207661_10071627
1230 Ga0207679_10000933
1231 Ga0207679_10002183
1232 Ga0207679_10012266
1233 Ga0207679_10017905
1234 Ga0207679_10023631
1235 Ga0207679_10033339
1236 Ga0207679_10142828
1237 Ga0207667_10037955
1238 Ga0207667_10135300
1239 Ga0207667_10137684
1240 Ga0207667_10162465
1241 Ga0207667_10178190
1242 Ga0207667_10203029
1243 Ga0207667_10232001
1244 Ga0207712_10000077
1245 Ga0207712_10001391
1246 Ga0207712_10050468
1247 Ga0207668_10003865
1248 Ga0207668_10035092
1249 Ga0207668_10042924
1250 Ga0207668_10220554
1251 Ga0207640_10000396
1252 Ga0207658_10009249
1253 Ga0207677_10008551
1254 Ga0207677_10083805
1255 Ga0207677_10327981
1256 Ga0207703_10270419
1257 Ga0207639_10027593
1258 Ga0207639_10032262
1259 Ga0207639_10129722
1260 Ga0207678_10047039
1261 Ga0207678_10092125
1262 Ga0207708_10063560
1263 Ga0207702_10119187
1264 Ga0207641_10032912
1265 Ga0207641_10271965
1266 Ga0207648_10015741
1267 Ga0207648_10138315
1268 Ga0207648_10143333
1269 Ga0207676_10024653
1270 Ga0207676_10044616
1271 Ga0207674_10006057
1272 Ga0207674_10008034
1273 Ga0207674_10017289
1274 Ga0207674_10025607
1275 Ga0207674_10094868
1276 Ga0207675_100000132
1277 Ga0207675_100014893
1278 Ga0207683_10178985
1279 Ga0207683_10196679
1280 Ga0207698_10013391
1281 Ga0207698_10014692
1282 Ga0207698_10029204
1283 Ga0209969_1004715
1284 Ga0210000_1004081
1285 Ga0209968_1000965
1286 Ga0209999_1001622
1287 Ga0209966_1000414
1288 Ga0209998_10000026
1289 Ga0209974_10003467
1290 Ga0207428_10017074
1291 Ga0207428_10068112
1292 Ga0207428_10118027
1293 Ga0207428_10288480
1294 Ga0268266_10070113
1295 Ga0268265_10001692
1296 Ga0268265_10014891
1297 Ga0268265_10199106
1298 Ga0268265_10206915
1299 Ga0268264_10011767
1300 Ga0307408_100009908
1301 Ga0307408_100028286
1302 Ga0307405_10000446
1303 Ga0307405_10001705
1304 Ga0307405_10024015
1305 Ga0307405_10029611
1306 Ga0307405_10046800
1307 Ga0307405_10047539
1308 Ga0307405_10139750
1309 Ga0307413_10029611
1310 Ga0307413_10032799
1311 Ga0307413_10036657
1312 Ga0307413_10100236
1313 Ga0307413_10163701
1314 Ga0307410_10013893
1315 Ga0307410_10063754
1316 Ga0307410_10125352
1317 Ga0307406_10000378
1318 Ga0307406_10004801
1319 Ga0307406_10068753
1320 Ga0307406_10083128
1321 Ga0307406_10269106
1322 Ga0307407_10081892
1323 Ga0307407_10159534
1324 Ga0307412_10003834
1325 Ga0307412_10005546
1326 Ga0307412_10036345
1327 Ga0307412_10116473
1328 Ga0307412_10128439
1329 Ga0307412_10204494
1330 Ga0307409_100079538
1331 Ga0307409_100100520
1332 Ga0307409_100203936
1333 Ga0307409_100354029
1334 Ga0307416_100002050
1335 Ga0307416_100021406
1336 Ga0307416_100054049
1337 Ga0307416_100056420
1338 Ga0307416_100066471
1339 Ga0307416_100069569
1340 Ga0307416_100103138
1341 Ga0307416_100134043
1342 Ga0307414_10018674
1343 Ga0307414_10199118
1344 Ga0307411_10002281
1345 Ga0307411_10136486
1346 Ga0307415_100012339
1347 Ga0307415_100050993
1348 Ga0307415_100053386
1349 Ga0307415_100070454
1350 Ga0307415_100075738
1351 Ga0373934_0014235
1352 Ga0373952_0017283
1353 Ga0373945_0002457
1354 Ga0373954_0007855
1355 Ga0373956_0002165
1356 Ga0373956_0015481
1357 Ga0373943_0000065
1358 Ga0373943_0018505
1359 Ga0373955_0011674
1360 Ga0373955_0030375
1361 Ga0373955_0094968
1362 Ga0373924_0004295
1363 Ga0373935_0000894
1364 Ga0373935_0069983
1365 Ga0373927_0000854
1366 Ga0373927_0004549
1367 Ga0373933_0000091
1368 Ga0373933_0010025
1369 Ga0373933_0034234
1370 Ga0373947_0000861
1371 Ga0373937_0000104
1372 Ga0373937_0000632
1373 Ga0373937_0005619
1374 Ga0373937_0150808
1375 Ga0373925_0005691
1376 Ga0395899_0005499
1377 Ga0395900_0005573
1378 Ga0395905_0001459
1379 Ga0395905_0218535
1380 Ga0436365_1394990
1381 Ga0439439_0007292
1382 Ga0439461_0019312
1383 Ga0439448_0011860
1384 Ga0439434_0003779
1385 Ga0451577_0000228
1386 Ga0451577_0018319
1387 Ga0453684_0057598
1388 Ga0451576_0095544
1389 Ga0466967_0149582
1390 Ga0466967_0266093
1391 Ga0495592_0000491
1392 Ga0495592_0119261
1393 Ga0495603_0000172
1394 Ga0495603_0005363
1395 Ga0495629_0014858
1396 Ga0495629_0024515
1397 Ga0495651_0018107
1398 Ga0495653_0000064
1399 Ga0495653_0009793
1400 Ga0495580_0026113
1401 Ga0495580_0044141
1402 Ga0495582_0003555
1403 Ga0495582_0014645
1404 Ga0495639_0000571
1405 Ga0495639_0007940
1406 Ga0495639_0031832
1407 Ga0495664_0081626
1408 Ga0495594_0038762
1409 Ga0495594_0056484
1410 Ga0495594_0074532
1411 Ga0495608_0000200
1412 Ga0495608_0009567
1413 Ga0495608_0042531
1414 Ga0495618_0100369
1415 Ga0495628_0019957
1416 Ga0495628_0081513
1417 Ga0495628_0166270
1418 Ga0495630_0000434
1419 Ga0495630_0034417
1420 Ga0495630_0038766
1421 Ga0495666_0052505
1422 Ga0495666_0071108
1423 Ga0495652_0014540
1424 Ga0495652_0019942
1425 Ga0495652_0048425
1426 Ga0495665_0000479
1427 Ga0495665_0010772
1428 Ga0495665_0110563
1429 Ga0495640_0027642
1430 Ga0495586_0018554
1431 Ga0495586_0027910
1432 Ga0495586_0037512
1433 Ga0495586_0089857
1434 Ga0495587_0000557
1435 Ga0495587_0007146
1436 Ga0495587_0026846
1437 Ga0495645_0003259
1438 Ga0495645_0006736
1439 Ga0495645_0013728
1440 Ga0495645_0036263
1441 Ga0495667_0000234
1442 Ga0495667_0005301
1443 Ga0495667_0015101
1444 Ga0495667_0152716
1445 Ga0495634_0009995
1446 Ga0495634_0115134
1447 Ga0495635_0000027
1448 Ga0495635_0013330
1449 Ga0495635_0092420
1450 Ga0495588_0001301
1451 Ga0495657_0000786
1452 Ga0495657_0084559
1453 Ga0495657_0119152
1454 Ga0495599_0000121
1455 Ga0495599_0003580
1456 Ga0495599_0032040
1457 Ga0495599_0052584
1458 Ga0495623_0006212
1459 Ga0495623_0015630
1460 Ga0495646_0001695
1461 Ga0495646_0107894
1462 Ga0495647_0023149
1463 Ga0495658_0000078
1464 Ga0495658_0088105
1465 Ga0495658_0113369
1466 Ga0495613_0006241
1467 Ga0495613_0025751
1468 Ga0495613_0029042
1469 Ga0495600_0000507
1470 Ga0495600_0035246
1471 Ga0495581_0000333
1472 Ga0495604_0001528
1473 Ga0495604_0005226
1474 Ga0495674_0000649
1475 Ga0495674_0013587
1476 Ga0495674_0037263
1477 Ga0495674_0314848
1478 Ga0495680_0011086
1479 Ga0495680_0025356
1480 Ga0495675_0002291
1481 Ga0495684_0000116
1482 Ga0495684_0000527
1483 Ga0495684_0008323
1484 Ga0495684_0013643
1485 Ga0495684_0016578
1486 Ga0495684_0052197
1487 Ga0495593_0001774
1488 Ga0495602_0000377
1489 Ga0495614_0000593
1490 Ga0496100_0132203
1491 Ga0496101_0127269
1492 Ga0496102_0347927
1493 Ga0496104_0280485
1494 Ga0496104_0325747
1495 Ga0496108_0128287
1496 Ga0496108_0276866
1497 Ga0496109_0080356
1498 Ga0496111_0141584
1499 Ga0496112_0015670
1500 Ga0496112_0144830
1501 Ga0496112_0282989
1502 Ga0496113_0004584
1503 Ga0496113_0038286
1504 Ga0496114_0095590
1505 Ga0496115_0044897
1506 Ga0501292_000394
1507 Ga0501032_0055011
1508 Ga0501033_0028590
1509 Ga0501034_0069465
1510 Ga0501034_0119760
1511 Ga0501036_0008548
1512 Ga0501037_0075596
1513 Ga0501042_0189993
1514 Ga0501046_0091280
1515 Ga0501048_0102640
1516 Ga0501070_0345602
1517 Ga0501074_0186274
1518 Ga0501217_001705
1519 Ga0501235_000510
1520 Ga0501258_000052
1521 Ga0501261_006862
1522 Ga0501221_000412
1523 Ga0501234_004859
1524 Ga0501080_0147761
1525 Ga0501081_0134944
1526 Ga0501083_0038746
1527 Ga0501266_000807
1528 Ga0501268_000194
1529 Ga0501035_0209579
1530 Ga0501044_0015212
1531 Ga0501045_0013520
1532 nmdc:mga05p37_130510_c1
1533 nmdc:mga09592_10883_c1
1534 nmdc:mga09592_151908_c1
1535 nmdc:mga09592_179756_c1
1536 nmdc:mga0qj67_18266_c2
1537 nmdc:mga0qj67_25506_c1
1538 nmdc:mga06r32_221551_c1
1539 nmdc:mga06r32_42752_c1
1540 nmdc:mga06r32_4856_c1
1541 nmdc:mga06r32_60208_c1
1542 nmdc:mga06r32_63688_c1
1543 nmdc:mga06r32_91159_c1
1544 nmdc:mga08y16_14115_c1
1545 nmdc:mga08y16_354466_c1
1546 nmdc:mga08y16_93175_c1
1547 nmdc:mga0n895_10198_c1
1548 nmdc:mga0n895_34165_c1
1549 nmdc:mga0n895_74746_c1
1550 nmdc:mga08x19_160617_c1
1551 nmdc:mga08x19_5867_c1
1552 nmdc:mga08x19_9592_c1
1553 nmdc:mga0a205_999_c1
1554 Ga0495601_0001181
1555 Ga0495595_0035146
1556 Ga0495619_0000293
1557 Ga0501082_0293232
1558 Ga0530510_0259066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01145

Band_7

SPFH domain / Band 7 family

21

216

0.95

Map