F480432

General Info

Members Datasets Scaffolds Average Seq Length
778 450 655 187

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0000048|Ga0496125_0000048_66435_66995
Length 186
Sequence MSSNSKEAILAAAKRTAQAHGYGGLNFRDLAAEVGIKAASIYHHFPSKADLGAAVARRYWQDTAVTLETLAESQDPVGALRQYPDTFRRALANDNRMCLGSFMAAEYDDLPDAVKKEIQTFADVNVAWLGKVLSAAAIVSPHESERRARAIFAAIAGAQLIARSRSEISLYDAIIDSYRAAGLLPA

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
7 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
8 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
9 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
10 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
11 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
12 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
13 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
14 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
15 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
16 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
17 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
18 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
19 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
20 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
21 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
22 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
23 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
24 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
25 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
26 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
27 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
28 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
29 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
30 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
31 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
32 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
33 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
34 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
35 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
36 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
37 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
38 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
39 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
40 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
41 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
42 2842747753 Variovorax sp. R-72060 Isolate Unclassified
43 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
44 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
45 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
46 2855730933 Achromobacter sp. HZ28 Isolate Nodule
47 2855767633 Achromobacter sp. HZ34 Isolate Nodule
48 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
49 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
50 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
51 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
52 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
53 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
54 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
55 2906610324
56 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
57 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
58 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
59 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
60 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
61 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
62 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
63 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
64 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
65 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
66 2922368715
67 2922425934
68 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
69 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
70 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
71 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
72 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
73 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
74 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
75 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
76 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
77 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
78 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
79 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
80 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
81 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
82 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
83 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
84 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
85 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
86 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
87 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
88 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
89 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
90 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
91 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
92 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
93 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
94 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
95 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
96 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
97 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
98 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
99 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
100 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
101 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
102 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
103 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
104 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
105 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
106 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
107 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
108 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
109 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
110 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
111 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
112 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
113 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
114 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
115 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
116 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
117 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
118 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
119 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
120 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
121 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
122 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
123 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
124 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
125 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
126 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
127 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
128 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
129 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
130 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
131 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
132 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
133 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
134 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
135 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
136 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
137 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
138 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
139 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
140 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
141 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
142 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
143 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
144 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
145 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
146 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
147 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
148 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
149 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
150 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
151 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
152 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
153 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
154 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
155 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
156 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
157 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
158 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
159 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
160 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
161 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
162 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
163 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
164 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
165 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
166 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
167 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
168 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
169 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
170 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
171 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
172 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
173 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
174 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
175 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
176 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
177 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
178 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
179 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
180 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
181 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
182 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
183 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
184 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
185 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
186 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
187 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
188 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
189 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
190 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
191 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
192 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
193 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
194 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
195 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
196 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
197 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
198 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
199 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
200 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
201 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
202 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
203 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
204 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
205 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
206 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
207 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
208 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
209 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
210 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
211 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
212 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
214 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
215 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
216 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
251 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
258 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
259 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
260 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
261 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
262 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
265 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
268 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
269 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
270 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
271 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
277 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
278 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
279 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
280 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
281 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
282 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
283 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
284 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
285 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
286 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
287 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
288 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
289 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
290 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
291 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
292 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
293 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
294 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
295 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
296 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
297 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
300 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
301 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
302 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
303 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
304 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
305 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
306 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
307 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
308 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
309 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
310 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
311 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
312 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
313 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
314 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
315 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
316 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
317 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
318 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
319 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
320 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
321 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
322 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
323 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
324 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
329 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
330 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
331 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
332 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
333 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
334 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
335 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
336 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
337 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
338 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
339 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
340 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
341 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
344 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
345 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
346 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
347 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
348 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
349 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
350 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
351 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
352 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
353 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
354 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
355 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
356 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
357 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
358 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
359 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
360 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
361 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
362 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
363 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
364 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
365 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
366 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
367 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
368 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
369 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
370 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
371 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
372 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
373 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
374 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
375 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
376 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
377 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
379 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
380 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
381 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
382 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
383 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
384 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
385 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
386 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
387 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
388 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
389 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
390 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
391 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
392 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
393 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
394 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
395 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
396 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
397 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
398 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
399 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
400 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
401 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
402 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
403 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
404 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
405 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
406 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
407 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
408 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
409 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
410 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
411 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
412 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
413 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
414 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
415 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
416 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
417 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
418 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
419 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
420 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
421 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
422 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
423 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
424 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
425 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
426 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
427 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
428 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
429 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
430 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
431 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
432 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
433 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
434 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
435 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
436 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
437 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
438 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
439 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
440 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
441 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
442 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
443 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
444 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
445 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
446 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
447 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
448 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
449 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
450 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.39
Metatranscriptomes 0
Isolates 15.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.15
Nodule 9
Rhizoplane 3.98
Rhizosphere 52.57
Stem 0
Stem Tuber 0
Unclassified 15.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1002612 3300000532 Bacteria 1261
2 JGI24740J21852_10000185 3300001979 Bacteria 25442
3 JGI24750J21931_1019772 3300002070 Bacteria 935
4 JGI24738J21930_10081733 3300002075 Bacteria 677
5 JGI25162J39368_1001010 3300002737 Bacteria 17537
6 JGI25151J46595_10002485 3300003187 Bacteria 11035
7 JGI25165J46597_1000859 3300003214 Bacteria 21876
8 JGI25153J46596_10005600 3300003215 Bacteria 6563
9 rootH1_10010685 3300003316 Bacteria 13982
10 rootH2_10045382 3300003320 Bacteria 2157
11 rootH2_10070521 3300003320 Bacteria 4126
12 rootL2_10261710 3300003322 Bacteria 2313
13 rootH1_10194063 3300003316 Bacteria 1401
14 rootH1_10194063 3300003323 Bacteria 3669
15 JGI25404J52841_10013938 3300003659 Bacteria 1744
16 JGI25404J52841_10051800 3300003659 Bacteria 862
17 Ga0055543_1004255 3300004625 Bacteria 3945
18 Ga0065165_1000348 3300005262 Bacteria 75762
19 Ga0065704_10046873 3300005289 Bacteria 941
20 Ga0070658_10504027 3300005327 Bacteria 1046
21 Ga0070676_10210399 3300005328 Bacteria 1279
22 Ga0070676_10469437 3300005328 Bacteria 888
23 Ga0068869_100026570 3300005334 Bacteria 4031
24 Ga0068869_100296448 3300005334 Bacteria 1304
25 Ga0070682_100215532 3300005337 Bacteria 1363
26 Ga0068868_100256349 3300005338 Bacteria 1474
27 Ga0068868_100542414 3300005338 Bacteria 1024
28 Ga0070668_100000040 3300005347 Bacteria 78926
29 Ga0070668_100025164 3300005347 Bacteria 4512
30 Ga0070668_100228753 3300005347 Bacteria 1536
31 Ga0070668_100265228 3300005347 Bacteria 1429
32 Ga0070668_100983418 3300005347 Bacteria 758
33 Ga0070669_100051671 3300005353 Bacteria 3005
34 Ga0070667_100169048 3300005367 Bacteria 1929
35 Ga0070703_10068774 3300005406 Bacteria 1178
36 Ga0070713_100462710 3300005436 Bacteria 1193
37 Ga0070710_10080555 3300005437 Bacteria 1900
38 Ga0070710_10257581 3300005437 Bacteria 1124
39 Ga0070700_100450168 3300005441 Bacteria 979
40 Ga0070694_100065348 3300005444 Bacteria 2492
41 Ga0070708_100180727 3300005445 Bacteria 1971
42 Ga0070708_100551004 3300005445 Bacteria 1088
43 Ga0070663_100009159 3300005455 Bacteria 6121
44 Ga0070663_100332693 3300005455 Bacteria 1225
45 Ga0070663_100405593 3300005455 Bacteria 1115
46 Ga0070663_100833585 3300005455 Bacteria 793
47 Ga0070678_100400191 3300005456 Bacteria 1193
48 Ga0070662_100017219 3300005457 Bacteria 4866
49 Ga0070706_100827244 3300005467 Bacteria 857
50 Ga0070698_100044970 3300005471 Bacteria 4519
51 Ga0070698_100388034 3300005471 Bacteria 1329
52 Ga0070699_100102003 3300005518 Bacteria 2515
53 Ga0070699_101412914 3300005518 Bacteria 638
54 Ga0070697_100337469 3300005536 Bacteria 1300
55 Ga0068853_100156110 3300005539 Bacteria 2056
56 Ga0070695_100154990 3300005545 Bacteria 1602
57 Ga0070665_100017575 3300005548 Bacteria 7183
58 Ga0070665_100104728 3300005548 Bacteria 2831
59 Ga0070665_100182965 3300005548 Bacteria 2096
60 Ga0070665_100375960 3300005548 Bacteria 1428
61 Ga0070665_100615955 3300005548 Bacteria 1099
62 Ga0070665_100684528 3300005548 Bacteria 1038
63 Ga0070704_100847356 3300005549 Bacteria 819
64 Ga0068855_100857911 3300005563 Bacteria 962
65 Ga0068854_100007247 3300005578 Bacteria 7081
66 Ga0070702_100633512 3300005615 Bacteria 806
67 Ga0068859_100581242 3300005617 Bacteria 1214
68 Ga0068864_100277428 3300005618 Bacteria 1563
69 Ga0068861_100002291 3300005719 Bacteria 12423
70 Ga0068861_100310887 3300005719 Bacteria 1369
71 Ga0068851_10089596 3300005834 Bacteria 1618
72 Ga0068863_100489143 3300005841 Bacteria 1211
73 Ga0068863_100722852 3300005841 Bacteria 990
74 Ga0068858_100190057 3300005842 Bacteria 1940
75 Ga0068858_100291897 3300005842 Bacteria 1554
76 Ga0068858_100672370 3300005842 Bacteria 1007
77 Ga0068858_100934296 3300005842 Bacteria 849
78 Ga0068860_100003537 3300005843 Bacteria 16076
79 Ga0068860_100031244 3300005843 Bacteria 5120
80 Ga0068860_100158759 3300005843 Bacteria 2180
81 Ga0068860_100318861 3300005843 Bacteria 1525
82 Ga0068862_100004744 3300005844 Bacteria 11445
83 Ga0068862_100212740 3300005844 Bacteria 1747
84 Ga0068862_100287239 3300005844 Bacteria 1509
85 Ga0081455_10023701 3300005937 Bacteria 5705
86 Ga0081455_10320913 3300005937 Bacteria 1103
87 Ga0081538_10262926 3300005981 Bacteria 650
88 Ga0081540_1005216 3300005983 Bacteria 9725
89 Ga0081540_1012707 3300005983 Bacteria 5523
90 Ga0081540_1031316 3300005983 Bacteria 2927
91 Ga0070717_10129736 3300006028 Bacteria 2167
92 Ga0075365_10007515 3300006038 Bacteria 6113
93 Ga0075365_10048736 3300006038 Bacteria 2789
94 Ga0075365_10090514 3300006038 Bacteria 2084
95 Ga0075365_10310152 3300006038 Bacteria 1111
96 Ga0075368_10066662 3300006042 Bacteria 1448
97 Ga0075368_10242253 3300006042 Bacteria 769
98 Ga0075363_100021331 3300006048 Bacteria 3260
99 Ga0075363_100051292 3300006048 Bacteria 2200
100 Ga0075363_100151138 3300006048 Bacteria 1311
101 Ga0075364_10066575 3300006051 Bacteria 2367
102 Ga0075364_10072682 3300006051 Bacteria 2267
103 Ga0075364_10144985 3300006051 Bacteria 1598
104 Ga0070716_100343659 3300006173 Bacteria 1054
105 Ga0075362_10392728 3300006177 Bacteria 699
106 Ga0075367_10003448 3300006178 Bacteria 7543
107 Ga0075367_10032709 3300006178 Bacteria 2995
108 Ga0075367_10034965 3300006178 Bacteria 2906
109 Ga0075367_10039863 3300006178 Bacteria 2740
110 Ga0075367_10058146 3300006178 Bacteria 2300
111 Ga0075367_10267404 3300006178 Bacteria 1074
112 Ga0075369_10031130 3300006186 Bacteria 2250
113 Ga0075369_10042314 3300006186 Bacteria 1953
114 Ga0075369_10162881 3300006186 Bacteria 1023
115 Ga0075369_10171176 3300006186 Bacteria 997
116 Ga0075366_10053418 3300006195 Bacteria 2400
117 Ga0075366_10157443 3300006195 Bacteria 1376
118 Ga0075366_10301778 3300006195 Bacteria 980
119 Ga0075366_10464548 3300006195 Bacteria 781
120 Ga0075370_10001527 3300006353 Bacteria 10125
121 Ga0075370_10019581 3300006353 Bacteria 3687
122 Ga0075370_10045356 3300006353 Bacteria 2486
123 Ga0075370_10222315 3300006353 Bacteria 1116
124 Ga0075370_10371661 3300006353 Bacteria 856
125 Ga0068871_100460062 3300006358 Bacteria 1142
126 Ga0075434_100559077 3300006871 Bacteria 1164
127 Ga0075429_100331228 3300006880 Bacteria 1332
128 Ga0097620_100581240 3300006931 Bacteria 1214
129 Ga0079104_1013522 3300006946 Bacteria 2510
130 Ga0075435_100113203 3300007076 Bacteria 2258
131 Ga0099794_10240932 3300007265 Bacteria 932
132 Ga0105250_10023700 3300009092 Bacteria 2474
133 Ga0105240_10000005 3300009093 Bacteria 702630
134 Ga0105240_10071482 3300009093 Bacteria 4291
135 Ga0105240_10164364 3300009093 Unclassified 2633
136 Ga0105240_10530618 3300009093 Bacteria 1305
137 Ga0105240_10727697 3300009093 Unclassified 1081
138 Ga0105245_10129685 3300009098 Bacteria 2364
139 Ga0105247_10062157 3300009101 Bacteria 2316
140 Ga0105243_10057116 3300009148 Bacteria 3107
141 Ga0105243_10353845 3300009148 Bacteria 1349
142 Ga0105242_10053124 3300009176 Bacteria 3308
143 Ga0105248_10176684 3300009177 Bacteria 2406
144 Ga0105237_10175319 3300009545 Bacteria 2144
145 Ga0105237_11123137 3300009545 Bacteria 793
146 Ga0105238_10039512 3300009551 Bacteria 4785
147 Ga0105238_11194163 3300009551 Bacteria 785
148 Ga0105249_10007823 3300009553 Bacteria 9308
149 Ga0105249_10013279 3300009553 Bacteria 7269
150 Ga0105249_10941670 3300009553 Bacteria 931
151 Ga0105239_10002635 3300010375 Bacteria 22658
152 Ga0105239_10252385 3300010375 Bacteria 1981
153 Ga0105239_10393914 3300010375 Bacteria 1567
154 Ga0105239_10808814 3300010375 Bacteria 1074
155 Ga0157373_10085955 3300013100 Bacteria 2217
156 Ga0157371_10000886 3300013102 Bacteria 33762
157 Ga0157371_10015143 3300013102 Bacteria 5794
158 Ga0157370_10000163 3300013104 Bacteria 81428
159 Ga0157370_10079586 3300013104 Bacteria 3086
160 Ga0157374_10706211 3300013296 Bacteria 1022
161 Ga0163162_10197376 3300013306 Bacteria 2141
162 Ga0163162_10242867 3300013306 Bacteria 1932
163 Ga0163162_10812607 3300013306 Bacteria 1052
164 Ga0163162_11065220 3300013306 Bacteria 915
165 Ga0163162_12204189 3300013306 Bacteria 632
166 Ga0157372_11212628 3300013307 Bacteria 872
167 Ga0157375_10143699 3300013308 Bacteria 2515
168 Ga0163163_10045357 3300014325 Bacteria 4314
169 Ga0163163_10117904 3300014325 Bacteria 2687
170 Ga0163163_10434424 3300014325 Bacteria 1372
171 Ga0163163_10607101 3300014325 Bacteria 1157
172 Ga0163163_10913881 3300014325 Bacteria 941
173 Ga0163163_11605844 3300014325 Bacteria 711
174 Ga0157380_10978068 3300014326 Bacteria 878
175 Ga0157379_10000463 3300014968 Bacteria 32854
176 Ga0157379_10132112 3300014968 Bacteria 2247
177 Ga0157379_10136931 3300014968 Bacteria 2206
178 Ga0157379_10248885 3300014968 Bacteria 1613
179 Ga0157379_10677070 3300014968 Bacteria 967
180 Ga0157376_10810964 3300014969 Bacteria 949
181 Ga0182006_1000325 3300015261 Bacteria 41285
182 Ga0182006_1005246 3300015261 Bacteria 6204
183 Ga0182006_1079966 3300015261 Bacteria 1194
184 Ga0163161_10719287 3300017792 Bacteria 833
185 Ga0213872_10013768 3300021361 Bacteria 3785
186 Ga0213872_10143244 3300021361 Bacteria 1048
187 Ga0213872_10147560 3300021361 Bacteria 1029
188 Ga0213871_10003957 3300021441 Bacteria 2916
189 Ga0209437_100520 3300025233 Bacteria 26929
190 Ga0207425_1002075 3300025245 Bacteria 7443
191 Ga0209646_1018716 3300025246 Bacteria 1011
192 Ga0209129_1000149 3300025258 Bacteria 114222
193 Ga0209233_1000448 3300025261 Bacteria 27344
194 Ga0209233_1001583 3300025261 Bacteria 8907
195 Ga0209233_1032121 3300025261 Bacteria 1217
196 Ga0209673_1028955 3300025273 Bacteria 1772
197 Ga0209025_1000253 3300025294 Bacteria 125975
198 Ga0209025_1005181 3300025294 Bacteria 10773
199 Ga0209758_1000296 3300025297 Bacteria 97937
200 Ga0207426_1000767 3300025302 Bacteria 35679
201 Ga0207426_1035757 3300025302 Bacteria 1583
202 Ga0207653_10126014 3300025885 Bacteria 926
203 Ga0207692_10136495 3300025898 Bacteria 1391
204 Ga0207710_10073930 3300025900 Bacteria 1568
205 Ga0207710_10074422 3300025900 Bacteria 1564
206 Ga0207688_10025455 3300025901 Bacteria 3249
207 Ga0207680_10067951 3300025903 Bacteria 2197
208 Ga0207699_10072454 3300025906 Bacteria 2110
209 Ga0207645_10046340 3300025907 Bacteria 2777
210 Ga0207645_10401672 3300025907 Bacteria 922
211 Ga0207684_10722699 3300025910 Bacteria 845
212 Ga0207684_11209884 3300025910 Bacteria 625
213 Ga0207695_10000011 3300025913 Bacteria 910221
214 Ga0207695_10000255 3300025913 Bacteria 136470
215 Ga0207695_10031216 3300025913 Bacteria 5848
216 Ga0207695_10667952 3300025913 Bacteria 920
217 Ga0207671_10398186 3300025914 Bacteria 1095
218 Ga0207671_10717469 3300025914 Bacteria 795
219 Ga0207681_10087782 3300025923 Bacteria 2213
220 Ga0207681_10501412 3300025923 Bacteria 994
221 Ga0207694_10229501 3300025924 Bacteria 1516
222 Ga0207687_10096509 3300025927 Bacteria 2167
223 Ga0207700_10949727 3300025928 Bacteria 769
224 Ga0207664_10881038 3300025929 Bacteria 804
225 Ga0207644_10649673 3300025931 Bacteria 878
226 Ga0207706_10014354 3300025933 Bacteria 7179
227 Ga0207686_10064592 3300025934 Bacteria 2331
228 Ga0207709_10060899 3300025935 Bacteria 2356
229 Ga0207704_10271350 3300025938 Bacteria 1285
230 Ga0207665_10440338 3300025939 Bacteria 998
231 Ga0207665_10474842 3300025939 Bacteria 963
232 Ga0207689_10028565 3300025942 Bacteria 4665
233 Ga0207689_10300720 3300025942 Bacteria 1330
234 Ga0207712_10001119 3300025961 Bacteria 18702
235 Ga0207668_10000069 3300025972 Bacteria 79827
236 Ga0207668_10007301 3300025972 Bacteria 6564
237 Ga0207668_10072577 3300025972 Bacteria 2463
238 Ga0207668_10085308 3300025972 Bacteria 2304
239 Ga0207668_10649510 3300025972 Bacteria 923
240 Ga0207640_10005170 3300025981 Bacteria 7097
241 Ga0207658_10076616 3300025986 Bacteria 2548
242 Ga0207677_10268382 3300026023 Bacteria 1395
243 Ga0207703_10090596 3300026035 Bacteria 2570
244 Ga0207703_10349211 3300026035 Bacteria 1361
245 Ga0207703_10409369 3300026035 Bacteria 1260
246 Ga0207639_10195095 3300026041 Bacteria 1732
247 Ga0207678_10028180 3300026067 Bacteria 4905
248 Ga0207678_10037078 3300026067 Bacteria 4243
249 Ga0207678_10056853 3300026067 Bacteria 3367
250 Ga0207678_10251711 3300026067 Bacteria 1513
251 Ga0207678_10444755 3300026067 Bacteria 1126
252 Ga0207708_10065735 3300026075 Bacteria 2772
253 Ga0207641_10142877 3300026088 Bacteria 2162
254 Ga0207641_10389304 3300026088 Bacteria 1337
255 Ga0207641_10579926 3300026088 Bacteria 1096
256 Ga0207675_100006110 3300026118 Bacteria 11454
257 Ga0207683_10097621 3300026121 Bacteria 2620
258 Ga0209281_1002866 3300027111 Bacteria 6287
259 Ga0209281_1003385 3300027111 Bacteria 5311
260 Ga0209371_1000010 3300027312 Bacteria 922021
261 Ga0209371_1004276 3300027312 Bacteria 6331
262 Ga0209371_1005576 3300027312 Bacteria 4954
263 Ga0209371_1008358 3300027312 Bacteria 3455
264 Ga0209588_1047811 3300027671 Bacteria 1384
265 Ga0209813_10074769 3300027866 Bacteria 1108
266 Ga0268266_10001335 3300028379 Bacteria 29884
267 Ga0268266_10009274 3300028379 Bacteria 8681
268 Ga0268266_10009532 3300028379 Bacteria 8546
269 Ga0268266_10018709 3300028379 Bacteria 5902
270 Ga0268266_10024160 3300028379 Bacteria 5171
271 Ga0268266_10066202 3300028379 Bacteria 3124
272 Ga0268266_10367076 3300028379 Bacteria 1355
273 Ga0268266_10400714 3300028379 Bacteria 1297
274 Ga0268266_10625634 3300028379 Bacteria 1035
275 Ga0268266_11346711 3300028379 Bacteria 689
276 Ga0268265_10085188 3300028380 Bacteria 2507
277 Ga0268265_10160753 3300028380 Bacteria 1907
278 Ga0268264_10002518 3300028381 Bacteria 16104
279 Ga0268264_10008540 3300028381 Bacteria 8514
280 Ga0307515_10158226 3300028794 Bacteria 2326
281 Ga0307515_10218442 3300028794 Bacteria 1731
282 Ga0268256_1000022 3300030500 Bacteria 531115
283 Ga0268256_1004608 3300030500 Bacteria 5654
284 Ga0268256_1008686 3300030500 Bacteria 3455
285 Ga0268256_1019328 3300030500 Bacteria 1868
286 Ga0307509_10282258 3300031507 Bacteria 1421
287 Ga0307408_100030448 3300031548 Bacteria 3748
288 Ga0307408_100058024 3300031548 Bacteria 2812
289 Ga0307516_10557114 3300031730 Bacteria 800
290 Ga0307405_10004925 3300031731 Bacteria 6376
291 Ga0307405_10455421 3300031731 Bacteria 1015
292 Ga0307412_10073294 3300031911 Bacteria 2342
293 Ga0307409_100451144 3300031995 Bacteria 1241
294 Ga0307414_10298339 3300032004 Bacteria 1362
295 Ga0307411_10011984 3300032005 Bacteria 4707
296 Ga0307411_10395823 3300032005 Bacteria 1140
297 Ga0307510_10108943 3300033180 Bacteria 2521
298 Ga0315911_1000006 3300033442 Bacteria 414563
299 Ga0373943_0420299 3300035170 Bacteria 774
300 Ga0373947_0452357 3300035725 Bacteria 870
301 Ga0373937_1118987 3300036401 Bacteria 736
302 Ga0395898_0476189 3300037466 Bacteria 1188
303 Ga0395905_0057923 3300037471 Bacteria 3624
304 Ga0436360_0279990 3300039438 Bacteria 1649
305 Ga0436360_0280789 3300039438 Bacteria 2514
306 Ga0436361_0039495 3300039447 Bacteria 4196
307 Ga0436361_0052850 3300039447 Bacteria 2236
308 Ga0436361_0514043 3300039447 Bacteria 7643
309 Ga0436361_0547814 3300039447 Bacteria 4285
310 Ga0436361_0655121 3300039447 Bacteria 1935
311 Ga0436361_0898932 3300039447 Bacteria 1817
312 Ga0436361_0945239 3300039447 Bacteria 3469
313 Ga0436362_0568463 3300039453 Bacteria 2106
314 Ga0439436_0023955 3300041404 Bacteria 1804
315 Ga0439438_000005 3300041405 Bacteria 408610
316 Ga0439438_000078 3300041405 Bacteria 45720
317 Ga0451795_0539211 3300041456 Bacteria 1021
318 Ga0439431_0072943 3300041997 Bacteria 917
319 Ga0439432_002011 3300042006 Bacteria 7700
320 Ga0439432_011116 3300042006 Bacteria 3103
321 Ga0439463_042661 3300042016 Bacteria 1154
322 Ga0450911_000010 3300042115 Bacteria 149605
323 Ga0450911_000303 3300042115 Bacteria 17761
324 Ga0450906_000007 3300042145 Bacteria 42541
325 Ga0450909_000934 3300042185 Bacteria 3995
326 Ga0439464_0008830 3300042439 Bacteria 2642
327 Ga0466969_0097288 3300044656 Bacteria 1389
328 Ga0466972_0000188 3300044658 Bacteria 47766
329 Ga0466965_0075480 3300044683 Bacteria 1700
330 Ga0466965_0162968 3300044683 Bacteria 1170
331 Ga0466960_0215500 3300044901 Bacteria 1054
332 Ga0466960_0337461 3300044901 Bacteria 857
333 Ga0466959_0311202 3300045049 Bacteria 1078
334 Ga0495617_000578 3300046452 Bacteria 18757
335 Ga0495617_035376 3300046452 Bacteria 1677
336 Ga0495627_001932 3300046453 Bacteria 10812
337 Ga0495603_0102749 3300046455 Bacteria 1668
338 Ga0495590_0026011 3300046457 Bacteria 2056
339 Ga0495638_0000243 3300046460 Bacteria 74582
340 Ga0495638_0008279 3300046460 Bacteria 7381
341 Ga0495638_0018999 3300046460 Bacteria 4552
342 Ga0495638_0053384 3300046460 Bacteria 2515
343 Ga0495650_0001187 3300046471 Bacteria 27632
344 Ga0495650_0014052 3300046471 Bacteria 4194
345 Ga0495650_0084952 3300046471 Bacteria 1213
346 Ga0495580_0040473 3300046472 Bacteria 3328
347 Ga0495580_0231441 3300046472 Bacteria 1269
348 Ga0495605_0000075 3300046474 Bacteria 128702
349 Ga0495605_0073676 3300046474 Bacteria 1608
350 Ga0495605_0177162 3300046474 Bacteria 939
351 Ga0495639_0402873 3300046475 Bacteria 691
352 Ga0495664_0416913 3300046477 Bacteria 806
353 Ga0495584_0049656 3300046491 Bacteria 2114
354 Ga0495584_0079696 3300046491 Bacteria 1647
355 Ga0495584_0312910 3300046491 Bacteria 797
356 Ga0495585_0126593 3300046492 Bacteria 1347
357 Ga0495596_0016006 3300046500 Bacteria 3122
358 Ga0495596_0167561 3300046500 Bacteria 854
359 Ga0495607_0060347 3300046501 Bacteria 2159
360 Ga0495607_0132371 3300046501 Bacteria 1296
361 Ga0495607_0189024 3300046501 Bacteria 1027
362 Ga0495583_0182629 3300046506 Bacteria 858
363 Ga0495606_0000022 3300046507 Bacteria 265567
364 Ga0495606_0002482 3300046507 Bacteria 21346
365 Ga0495606_0120738 3300046507 Bacteria 1569
366 Ga0495606_0155367 3300046507 Bacteria 1339
367 Ga0495606_0238215 3300046507 Bacteria 1016
368 Ga0495606_0253277 3300046507 Bacteria 975
369 Ga0495610_0003586 3300046512 Bacteria 11993
370 Ga0495610_0012519 3300046512 Bacteria 5100
371 Ga0495610_0076624 3300046512 Bacteria 1546
372 Ga0495616_0023423 3300046513 Bacteria 3321
373 Ga0495616_0055616 3300046513 Bacteria 1958
374 Ga0495620_0003203 3300046515 Bacteria 9393
375 Ga0495620_0010672 3300046515 Bacteria 4836
376 Ga0495620_0036657 3300046515 Bacteria 2192
377 Ga0495620_0214246 3300046515 Bacteria 738
378 Ga0495631_0082130 3300046518 Bacteria 1389
379 Ga0495632_0000011 3300046519 Bacteria 266804
380 Ga0495632_0049500 3300046519 Bacteria 2077
381 Ga0495632_0292667 3300046519 Bacteria 723
382 Ga0495637_0003672 3300046520 Bacteria 8126
383 Ga0495637_0241876 3300046520 Bacteria 652
384 Ga0495643_0005027 3300046522 Bacteria 9058
385 Ga0495643_0011673 3300046522 Bacteria 5336
386 Ga0495644_0096312 3300046523 Bacteria 1118
387 Ga0495648_0003954 3300046524 Bacteria 12828
388 Ga0495648_0009452 3300046524 Bacteria 7553
389 Ga0495648_0189133 3300046524 Bacteria 1040
390 Ga0495648_0316920 3300046524 Bacteria 724
391 Ga0495663_0020815 3300046525 Bacteria 1885
392 Ga0495642_0219007 3300046528 Bacteria 831
393 Ga0495652_0457948 3300046529 Bacteria 892
394 Ga0495654_0088139 3300046530 Bacteria 1443
395 Ga0495665_0223925 3300046531 Bacteria 972
396 Ga0495598_0007307 3300046537 Bacteria 2530
397 Ga0495609_0073627 3300046538 Bacteria 1498
398 Ga0495609_0102447 3300046538 Bacteria 1240
399 Ga0495622_0146191 3300046557 Bacteria 1071
400 Ga0495633_0071738 3300046558 Bacteria 1615
401 Ga0495656_0156195 3300046615 Bacteria 1105
402 Ga0495668_0064177 3300046616 Bacteria 2022
403 Ga0495668_0115717 3300046616 Bacteria 1466
404 Ga0495668_0207589 3300046616 Bacteria 1072
405 Ga0495611_0235320 3300046648 Bacteria 850
406 Ga0495625_0030706 3300046660 Bacteria 4005
407 Ga0495625_0052875 3300046660 Bacteria 2907
408 Ga0495625_0159985 3300046660 Bacteria 1509
409 Ga0495659_0009432 3300046664 Bacteria 3114
410 Ga0495661_0053688 3300046665 Bacteria 2422
411 Ga0495661_0189771 3300046665 Bacteria 1083
412 Ga0495661_0195803 3300046665 Bacteria 1061
413 Ga0495588_0047545 3300046674 Bacteria 2203
414 Ga0495588_0106559 3300046674 Bacteria 1475
415 Ga0495599_0339471 3300046678 Bacteria 902
416 Ga0495647_0372286 3300046681 Bacteria 653
417 Ga0495669_0040598 3300046684 Bacteria 2064
418 Ga0495669_0100765 3300046684 Unclassified 1341
419 Ga0495670_0000834 3300046691 Bacteria 14896
420 Ga0495670_0022215 3300046691 Bacteria 3132
421 Ga0495671_0074906 3300046692 Bacteria 1660
422 Ga0495671_0101886 3300046692 Bacteria 1403
423 Ga0495671_0181955 3300046692 Bacteria 1021
424 Ga0495649_0119640 3300046694 Bacteria 1393
425 Ga0495649_0305387 3300046694 Bacteria 809
426 Ga0495589_0051993 3300046794 Bacteria 2024
427 Ga0495589_0137409 3300046794 Bacteria 1172
428 Ga0495660_0288861 3300046810 Bacteria 747
429 Ga0495636_0067731 3300047318 Bacteria 1519
430 Ga0495674_0719201 3300047319 Bacteria 782
431 Ga0495672_0000080 3300047320 Bacteria 160361
432 Ga0495672_0002721 3300047320 Bacteria 15870
433 Ga0495672_0038383 3300047320 Bacteria 2921
434 Ga0495672_0218420 3300047320 Bacteria 942
435 Ga0495676_0082345 3300047321 Bacteria 2436
436 Ga0495683_0056437 3300047323 Bacteria 1954
437 Ga0495683_0064255 3300047323 Bacteria 1812
438 Ga0495677_0024699 3300047445 Bacteria 2180
439 Ga0495685_069775 3300047447 Bacteria 1178
440 Ga0495673_0013372 3300047469 Bacteria 4314
441 Ga0495673_0070201 3300047469 Bacteria 1476
442 Ga0495673_0070236 3300047469 Bacteria 1475
443 Ga0495681_0000066 3300047470 Bacteria 97917
444 Ga0495681_0003582 3300047470 Bacteria 10812
445 Ga0495686_0008665 3300047472 Bacteria 7429
446 Ga0495686_0045797 3300047472 Bacteria 2767
447 Ga0495686_0103696 3300047472 Bacteria 1713
448 Ga0495686_0121966 3300047472 Bacteria 1552
449 Ga0495686_0136702 3300047472 Bacteria 1449
450 Ga0495686_0163953 3300047472 Bacteria 1297
451 Ga0495686_0390127 3300047472 Bacteria 749
452 Ga0495686_0442190 3300047472 Bacteria 692
453 Ga0495614_0407530 3300048089 Bacteria 639
454 Ga0495626_0054350 3300048091 Bacteria 1839
455 Ga0495626_0104352 3300048091 Bacteria 1233
456 Ga0496100_0443824 3300048903 Bacteria 994
457 Ga0496100_0549187 3300048903 Bacteria 894
458 Ga0496100_0876342 3300048903 Bacteria 705
459 Ga0496101_0091277 3300048904 Bacteria 2267
460 Ga0496101_0278362 3300048904 Bacteria 1307
461 Ga0496102_0155229 3300048905 Bacteria 2152
462 Ga0496102_0191223 3300048905 Bacteria 1929
463 Ga0496102_0203360 3300048905 Bacteria 1867
464 Ga0496102_0295618 3300048905 Bacteria 1526
465 Ga0496102_0390656 3300048905 Bacteria 1309
466 Ga0496104_0162723 3300048907 Bacteria 2140
467 Ga0496104_0254557 3300048907 Bacteria 1669
468 Ga0496104_0974340 3300048907 Bacteria 752
469 Ga0496105_0003062 3300048908 Bacteria 12291
470 Ga0496106_0042367 3300048909 Bacteria 3415
471 Ga0496107_0084437 3300048910 Bacteria 2317
472 Ga0496107_0235246 3300048910 Bacteria 1363
473 Ga0496107_0394822 3300048910 Bacteria 1029
474 Ga0496109_0849599 3300048912 Bacteria 851
475 Ga0496111_0032134 3300048914 Bacteria 3742
476 Ga0496111_0362209 3300048914 Bacteria 1073
477 Ga0496112_0632427 3300048915 Bacteria 1001
478 Ga0496115_0384279 3300048918 Bacteria 1141
479 Ga0496116_0049501 3300048919 Bacteria 2810
480 Ga0496116_0167024 3300048919 Bacteria 1198
481 Ga0496116_0279246 3300048919 Bacteria 810
482 Ga0496117_0038825 3300048920 Bacteria 3523
483 Ga0496117_0099538 3300048920 Bacteria 1844
484 Ga0496117_0101806 3300048920 Bacteria 1814
485 Ga0496117_0150340 3300048920 Bacteria 1379
486 Ga0496117_0157755 3300048920 Bacteria 1333
487 Ga0496118_0003441 3300048921 Bacteria 19922
488 Ga0496118_0009983 3300048921 Bacteria 9480
489 Ga0496118_0021067 3300048921 Bacteria 5754
490 Ga0496118_0026046 3300048921 Bacteria 4995
491 Ga0496118_0033001 3300048921 Bacteria 4256
492 Ga0496118_0047460 3300048921 Bacteria 3327
493 Ga0496118_0158127 3300048921 Bacteria 1406
494 Ga0496118_0196842 3300048921 Bacteria 1198
495 Ga0496119_0006183 3300048922 Bacteria 11197
496 Ga0496119_0036268 3300048922 Bacteria 3221
497 Ga0496119_0090504 3300048922 Bacteria 1740
498 Ga0496120_0009481 3300048923 Bacteria 6900
499 Ga0496120_0018241 3300048923 Bacteria 4529
500 Ga0496120_0204021 3300048923 Bacteria 955
501 Ga0496121_0001562 3300048924 Bacteria 38246
502 Ga0496121_0008832 3300048924 Bacteria 11736
503 Ga0496121_0010656 3300048924 Bacteria 10321
504 Ga0496121_0013587 3300048924 Bacteria 8731
505 Ga0496121_0050570 3300048924 Bacteria 3509
506 Ga0496121_0050848 3300048924 Bacteria 3496
507 Ga0496121_0087101 3300048924 Bacteria 2452
508 Ga0496121_0302150 3300048924 Bacteria 1085
509 Ga0496121_0352399 3300048924 Bacteria 980
510 Ga0496122_0000595 3300048925 Bacteria 74359
511 Ga0496122_0000921 3300048925 Bacteria 53852
512 Ga0496122_0011498 3300048925 Bacteria 8953
513 Ga0496122_0028570 3300048925 Bacteria 4727
514 Ga0496122_0101532 3300048925 Bacteria 1921
515 Ga0496123_0000211 3300048926 Bacteria 118697
516 Ga0496123_0001350 3300048926 Bacteria 34582
517 Ga0496123_0009407 3300048926 Bacteria 8803
518 Ga0496123_0027629 3300048926 Bacteria 4222
519 Ga0496123_0031362 3300048926 Bacteria 3869
520 Ga0496123_0116209 3300048926 Bacteria 1516
521 Ga0496124_0002131 3300048927 Bacteria 26592
522 Ga0496124_0003192 3300048927 Bacteria 20247
523 Ga0496124_0015638 3300048927 Bacteria 7263
524 Ga0496124_0026577 3300048927 Bacteria 5216
525 Ga0496124_0050524 3300048927 Bacteria 3543
526 Ga0496125_0000048 3300048928 Bacteria 290651
527 Ga0496125_0000664 3300048928 Bacteria 57244
528 Ga0496125_0002221 3300048928 Bacteria 25866
529 Ga0496125_0020534 3300048928 Bacteria 6197
530 Ga0496125_0026608 3300048928 Bacteria 5265
531 Ga0496125_0035798 3300048928 Bacteria 4347
532 Ga0496125_0047908 3300048928 Bacteria 3568
533 Ga0496126_0002646 3300048929 Bacteria 23750
534 Ga0496126_0044439 3300048929 Bacteria 4091
535 Ga0496126_0068420 3300048929 Bacteria 3170
536 Ga0496126_0087169 3300048929 Bacteria 2750
537 Ga0496126_0111998 3300048929 Bacteria 2376
538 Ga0496126_0113939 3300048929 Bacteria 2353
539 Ga0496126_0145105 3300048929 Bacteria 2039
540 Ga0496126_0231202 3300048929 Bacteria 1549
541 Ga0496126_0270602 3300048929 Bacteria 1410
542 Ga0496126_0282217 3300048929 Bacteria 1375
543 Ga0496126_0392422 3300048929 Bacteria 1127
544 Ga0496126_0586039 3300048929 Bacteria 880
545 Ga0496126_0673917 3300048929 Bacteria 806
546 Ga0496126_0714445 3300048929 Bacteria 777
547 Ga0495678_003807 3300049459 Bacteria 9098
548 Ga0495678_044841 3300049459 Bacteria 1747
549 Ga0495678_075766 3300049459 Bacteria 1221
550 Ga0495682_0021046 3300049460 Bacteria 2446
551 Ga0495682_0152973 3300049460 Bacteria 822
552 Ga0501033_0004237 3300049570 Bacteria 11539
553 Ga0501241_000061 3300049758 Bacteria 27062
554 nmdc:mga03n38_101664_c1 3300050490 Bacteria 1387
555 nmdc:mga03n38_18757_c1 3300050490 Bacteria 2736
556 nmdc:mga00v17_115485_c1 3300050491 Bacteria 1706
557 nmdc:mga00v17_40488_c1 3300050491 Bacteria 2795
558 nmdc:mga0yw44_19694_c1 3300050492 Bacteria 3726
559 nmdc:mga0yw44_28618_c1 3300050492 Bacteria 3208
560 nmdc:mga0yw44_36493_c1 3300050492 Bacteria 2896
561 nmdc:mga0yw44_58229_c1 3300050492 Bacteria 2360
562 nmdc:mga0yw44_6844_c1 3300050492 Bacteria 5546
563 nmdc:mga0yw44_77371_c1 3300050492 Bacteria 2078
564 nmdc:mga0k408_108982_c1 3300050493 Bacteria 1636
565 nmdc:mga0k408_113151_c1 3300050493 Bacteria 1605
566 nmdc:mga0k408_202477_c1 3300050493 Bacteria 1185
567 nmdc:mga0k408_22463_c1 3300050493 Bacteria 3552
568 nmdc:mga06z11_19457_c1 3300050494 Bacteria 3122
569 nmdc:mga06z11_34575_c1 3300050494 Bacteria 2482
570 nmdc:mga06z11_39608_c1 3300050494 Bacteria 2346
571 nmdc:mga04h51_141456_c1 3300050495 Bacteria 913
572 nmdc:mga07m45_180639_c2 3300050496 Bacteria 836
573 nmdc:mga07m45_55699_c1 3300050496 Bacteria 2235
574 nmdc:mga07m45_65164_c1 3300050496 Bacteria 2068
575 nmdc:mga09592_298021_c1 3300050508 Bacteria 1398
576 nmdc:mga0rr50_131901_c1 3300050513 Bacteria 2001
577 nmdc:mga0sz30_31622_c1 3300050516 Bacteria 2191
578 nmdc:mga0sz30_86867_c1 3300050516 Bacteria 1358
579 Ga0495601_0488980 3300053077 Bacteria 795
580 Ga0500635_0016922 3300053080 Bacteria 2176
581 Ga0495655_0053228 3300053083 Bacteria 1079
582 Ga0500643_000013 3300053087 Bacteria 324296
583 Ga0500643_018045 3300053087 Bacteria 2350
584 Ga0500643_033600 3300053087 Bacteria 1549
585 Ga0500644_0003200 3300053088 Bacteria 4055
586 Ga0500581_146383 3300053089 Bacteria 1113
587 Ga0500646_0013751 3300053090 Bacteria 2097
588 Ga0500646_0135900 3300053090 Bacteria 803
589 Ga0500583_0136125 3300053092 Bacteria 1219
590 Ga0500651_0033217 3300053093 Bacteria 3254
591 Ga0500651_0061115 3300053093 Bacteria 2354
592 Ga0500651_0153368 3300053093 Bacteria 1382
593 Ga0500566_0001318 3300053094 Bacteria 14480
594 Ga0500566_0343191 3300053094 Bacteria 687
595 Ga0500641_0074685 3300053096 Bacteria 1432
596 Ga0500641_0191287 3300053096 Bacteria 876
597 Ga0500641_0215113 3300053096 Bacteria 816
598 Ga0500650_0008263 3300053098 Bacteria 4104
599 Ga0500554_017032 3300053102 Bacteria 1934
600 Ga0500555_001497 3300053103 Bacteria 7094
601 Ga0500556_0000051 3300053104 Bacteria 119031
602 Ga0500556_0238817 3300053104 Bacteria 716
603 Ga0500562_025797 3300053108 Bacteria 1539
604 Ga0500572_000449 3300053111 Bacteria 14311
605 Ga0500592_000572 3300053116 Bacteria 6094
606 Ga0500594_0000962 3300053118 Bacteria 6189
607 Ga0500595_061296 3300053119 Bacteria 1135
608 Ga0500595_072753 3300053119 Bacteria 1017
609 Ga0500607_095778 3300053121 Bacteria 1484
610 Ga0500608_042483 3300053122 Bacteria 2181
611 Ga0500618_002682 3300053125 Bacteria 6508
612 Ga0500618_006698 3300053125 Bacteria 3355
613 Ga0500642_0000664 3300053130 Bacteria 10178
614 Ga0500642_0028091 3300053130 Bacteria 2316
615 Ga0500652_001821 3300053131 Bacteria 6456
616 Ga0500652_207787 3300053131 Bacteria 792
617 Ga0500658_0113978 3300053134 Bacteria 1192
618 Ga0500658_0123021 3300053134 Bacteria 1152
619 Ga0500559_0000419 3300053136 Bacteria 30438
620 Ga0500559_0001169 3300053136 Bacteria 15735
621 Ga0500559_0003125 3300053136 Bacteria 8237
622 Ga0500559_0011464 3300053136 Bacteria 3785
623 Ga0500559_0195161 3300053136 Bacteria 954
624 Ga0500568_0001400 3300053139 Bacteria 15647
625 Ga0500568_0008131 3300053139 Bacteria 5085
626 Ga0500573_0067037 3300053140 Bacteria 2051
627 Ga0500573_0069121 3300053140 Bacteria 2016
628 Ga0500577_0001891 3300053142 Bacteria 5370
629 Ga0500577_0088159 3300053142 Bacteria 1249
630 Ga0500577_0179666 3300053142 Bacteria 908
631 Ga0500589_121689 3300053147 Bacteria 1104
632 Ga0500590_067982 3300053148 Bacteria 1776
633 Ga0500603_001245 3300053150 Bacteria 5907
634 Ga0500604_0020872 3300053151 Bacteria 1847
635 Ga0500604_0022533 3300053151 Bacteria 1789
636 Ga0500616_0000150 3300053153 Bacteria 117918
637 Ga0500622_0000502 3300053156 Bacteria 36464
638 Ga0500622_0024835 3300053156 Bacteria 3169
639 Ga0500622_0212599 3300053156 Bacteria 872
640 Ga0500627_0020237 3300053158 Bacteria 2665
641 Ga0500627_0020612 3300053158 Bacteria 2646
642 Ga0500627_0199345 3300053158 Bacteria 897
643 Ga0500634_0094947 3300053161 Bacteria 1505
644 Ga0500634_0128166 3300053161 Bacteria 1223
645 Ga0500639_069785 3300053163 Bacteria 1793
646 Ga0500636_0144066 3300053177 Bacteria 1315
647 Ga0500637_0179100 3300053178 Bacteria 1215
648 Ga0500567_179385 3300053723 Bacteria 742
649 Ga0500576_057673 3300053725 Bacteria 1706
650 Ga0500645_017908 3300053730 Bacteria 2217
651 Ga0500645_027875 3300053730 Bacteria 1711
652 Ga0500596_002222 3300053735 Bacteria 3850
653 Ga0500596_006237 3300053735 Bacteria 2034
654 Ga0500587_009354 3300053739 Bacteria 1252
655 Ga0500661_001224 3300055283 Bacteria 4799

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046692 Ga0495671_0181955 Ga0495671_0181955_109_729 176
2 3300047320 Ga0495672_0002721 Ga0495672_0002721_5204_5824 176
3 3300047469 Ga0495673_0070201 Ga0495673_0070201_166_786 176
4 3300006186 Ga0075369_10031130 Ga0075369_100311303 178
5 3300025261 Ga0209233_1001583 Ga0209233_10015838 178
6 3300025273 Ga0209673_1028955 Ga0209673_10289552 178
7 3300025942 Ga0207689_10300720 Ga0207689_103007201 178
8 3300046472 Ga0495580_0040473 Ga0495580_0040473_500_1075 178
9 3300049570 Ga0501033_0004237 Ga0501033_0004237_2100_2636 178
10 3300050516 nmdc:mga0sz30_86867_c1 nmdc:mga0sz30_86867_c1_26_562 178
11 3300053142 Ga0500577_0001891 Ga0500577_0001891_4322_4885 181
12 iso_pu_bacteria 2511231028 2511396688 181
13 iso_pu_bacteria 2511231028 2511397671 182
14 iso_pu_bacteria 2824661429 2824669009 182
15 iso_pu_bacteria 2879099564 2879106768 182
16 iso_pu_bacteria 2922368715 2922369071 182
17 iso_pu_bacteria 2929615660 2929618940 182
18 iso_pu_bacteria 2929624759 2929631017 182
19 iso_pu_bacteria 2932784394 2932788981 182
20 iso_pu_bacteria 2932809354 2932814380 182
21 iso_pu_bacteria 2932818245 2932820506 182
22 iso_pu_bacteria 2932828146 2932834540 182
23 iso_pu_bacteria 2933577622 2933580350 182
24 iso_pu_bacteria 2935616580 2935624522 182
25 iso_pu_bacteria 2935638405 2935645912 182
26 iso_pu_bacteria 2935665750 2935673479 182
27 iso_pu_bacteria 2935675223 2935682656 182
28 iso_pu_bacteria 2935684952 2935686730 182
29 iso_pu_bacteria 2935694250 2935701591 182
30 iso_pu_bacteria 2935703347 2935710435 182
31 iso_pu_bacteria 2935713505 2935716418 182
32 iso_pu_bacteria 2935722832 2935723457 182
33 iso_pu_bacteria 2935732158 2935735013 182
34 iso_pu_bacteria 2935741537 2935744196 182
35 iso_pu_bacteria 2935750917 2935752696 182
36 iso_pu_bacteria 2935760218 2935764756 182
37 iso_pu_bacteria 2935801545 2935806132 182
38 iso_pu_bacteria 2935810662 2935816897 182
39 iso_pu_bacteria 2935827899 2935835187 182
40 iso_pu_bacteria 2935837841 2935841432 182
41 iso_pu_bacteria 2935855204 2935863001 182
42 iso_pu_bacteria 2935864058 2935871811 182
43 iso_pu_bacteria 2935873716 2935882298 182
44 iso_pu_bacteria 2935992306 2936000131 182
45 iso_pu_bacteria 2936002035 2936010045 182
46 iso_pu_bacteria 2936037263 2936043888 182
47 iso_pu_bacteria 2940556831 2940558609 182
48 iso_pu_bacteria 2941538514 2941543658 182
49 iso_pu_bacteria 8005682033 8005686920 182
50 iso_pu_bacteria 8016511872 8016517821 182
51 iso_pu_bacteria 8017057580 8017058809 182
52 iso_pu_bacteria 8019576017 8019576848 182
53 iso_pu_bacteria 8019586578 8019594897 182
54 iso_pu_bacteria 8019597564 8019606837 182
55 iso_pu_bacteria 8019608314 8019611670 182
56 iso_pu_bacteria 8055742211 8055742789 182
57 3300055283 Ga0500661_001224 Ga0500661_001224_859_1416 183
58 iso_pu_bacteria 2508501128 2509154403 183
59 iso_pu_bacteria 2511231027 2511390576 183
60 iso_pu_bacteria 2513237096 2513657933 183
61 iso_pu_bacteria 2513237137 2513855630 183
62 iso_pu_bacteria 2513237145 2513919974 183
63 iso_pu_bacteria 2517572143 2517892173 183
64 iso_pu_bacteria 2582581315 2585329310 183
65 iso_pu_bacteria 2585427529 2585547034 183
66 iso_pu_bacteria 2602042107 2603862348 183
67 iso_pu_bacteria 2667528174 2671116565 183
68 iso_pu_bacteria 2667528175 2671120569 183
69 iso_pu_bacteria 2713897148 2715750736 183
70 iso_pu_bacteria 2728368998 2728749524 183
71 iso_pu_bacteria 2738541317 2738948131 183
72 iso_pu_bacteria 2775506902 2776270522 183
73 iso_pu_bacteria 2775506904 2776281557 183
74 iso_pu_bacteria 2791355197 2793073352 183
75 iso_pu_bacteria 2818991461 2819689079 183
76 iso_pu_bacteria 2824626560 2824632042 183
77 iso_pu_bacteria 2824635225 2824638753 183
78 iso_pu_bacteria 2824644064 2824646191 183
79 iso_pu_bacteria 2824714736 2824716498 183
80 iso_pu_bacteria 2824723954 2824726042 183
81 iso_pu_bacteria 2826581358 2826585354 183
82 iso_pu_bacteria 2842747753 2842750283 183
83 iso_pu_bacteria 2842775625 2842780178 183
84 iso_pu_bacteria 2842805378 2842805712 183
85 iso_pu_bacteria 2842843487 2842846922 183
86 iso_pu_bacteria 2857509624 2857513926 183
87 iso_pu_bacteria 2857524615 2857525762 183
88 iso_pu_bacteria 2874168670 2874174236 183
89 iso_pu_bacteria 2893066018 2893067944 183
90 iso_pu_bacteria 2904690495 2904694739 183
91 iso_pu_bacteria 2904690495 2904696102 183
92 iso_pu_bacteria 2906610324 2906617303 183
93 iso_pu_bacteria 2906626472 2906627197 183
94 iso_pu_bacteria 2906635258 2906642686 183
95 iso_pu_bacteria 2906660503 2906666137 183
96 iso_pu_bacteria 2908446538 2908449437 183
97 iso_pu_bacteria 2908756301 2908760737 183
98 iso_pu_bacteria 2909399089 2909401991 183
99 iso_pu_bacteria 2916061851 2916064034 183
100 iso_pu_bacteria 2919073203 2919074374 183
101 iso_pu_bacteria 2919385768 2919390073 183
102 iso_pu_bacteria 2919487758 2919489422 183
103 iso_pu_bacteria 2922425934 2922430522 183
104 iso_pu_bacteria 2929199973 2929203664 183
105 iso_pu_bacteria 2935959822 2935966188 183
106 iso_pu_bacteria 2960637947 2960638646 183
107 iso_pu_bacteria 2964719344 2964723093 183
108 iso_pu_bacteria 2998139840 2998142351 183
109 iso_pu_bacteria 3005474847 3005480439 183
110 iso_pu_bacteria 8016583857 8016587134 183
111 iso_pu_bacteria 8019555841 8019556512 183
112 iso_pu_bacteria 8019565922 8019568798 183
113 iso_pu_bacteria 8055909800 8055911145 183
114 iso_pu_bacteria 8056161164 8056166240 183
115 iso_pu_bacteria 8056689827 8056691300 183
116 iso_pu_bacteria 2818991448 2819613319 184
117 3300005334 Ga0068869_100296448 Ga0068869_1002964482 185
118 3300005471 Ga0070698_100388034 Ga0070698_1003880342 185
119 3300005518 Ga0070699_101412914 Ga0070699_1014129141 185
120 3300015261 Ga0182006_1005246 Ga0182006_10052465 185
121 3300025913 Ga0207695_10000255 Ga0207695_100002557 185
122 3300041404 Ga0439436_0023955 Ga0439436_0023955_507_1064 185
123 3300046506 Ga0495583_0182629 Ga0495583_0182629_251_808 185
124 3300046519 Ga0495632_0000011 Ga0495632_0000011_37709_38266 185
125 3300046522 Ga0495643_0011673 Ga0495643_0011673_2301_2858 185
126 3300053087 Ga0500643_000013 Ga0500643_000013_170184_170741 185
127 3300053090 Ga0500646_0013751 Ga0500646_0013751_975_1532 185
128 3300053092 Ga0500583_0136125 Ga0500583_0136125_615_1172 185
129 3300053096 Ga0500641_0074685 Ga0500641_0074685_11_568 185
130 3300053103 Ga0500555_001497 Ga0500555_001497_3622_4179 185
131 3300053130 Ga0500642_0028091 Ga0500642_0028091_1667_2224 185
132 3300053131 Ga0500652_207787 Ga0500652_207787_78_635 185
133 3300053139 Ga0500568_0008131 Ga0500568_0008131_4288_4845 185
134 3300053142 Ga0500577_0088159 Ga0500577_0088159_281_838 185
135 3300053147 Ga0500589_121689 Ga0500589_121689_303_860 185
136 3300053151 Ga0500604_0022533 Ga0500604_0022533_1167_1724 185
137 3300053158 Ga0500627_0020612 Ga0500627_0020612_1677_2234 185
138 3300053161 Ga0500634_0128166 Ga0500634_0128166_328_885 185
139 3300053730 Ga0500645_017908 Ga0500645_017908_1539_2096 185
140 3300053739 Ga0500587_009354 Ga0500587_009354_175_732 185
141 iso_pu_bacteria 2599185240 2599747927 185
142 iso_pu_bacteria 2599185355 2600209922 185
143 iso_pu_bacteria 2675903129 2676741350 185
144 iso_pu_bacteria 2824704595 2824707308 185
145 iso_pu_bacteria 2824753945 2824758767 185
146 iso_pu_bacteria 2824763712 2824769237 185
147 iso_pu_bacteria 2904711408 2904714114 185
148 3300003320 rootH2_10045382 rootH2_100453822 186
149 3300003323 rootH1_10194063 rootH1_101940632 186
150 3300003659 JGI25404J52841_10013938 JGI25404J52841_100139382 186
151 3300003659 JGI25404J52841_10051800 JGI25404J52841_100518001 186
152 3300005328 Ga0070676_10469437 Ga0070676_104694372 186
153 3300005337 Ga0070682_100215532 Ga0070682_1002155321 186
154 3300005338 Ga0068868_100542414 Ga0068868_1005424141 186
155 3300005347 Ga0070668_100025164 Ga0070668_1000251642 186
156 3300005347 Ga0070668_100265228 Ga0070668_1002652282 186
157 3300005347 Ga0070668_100983418 Ga0070668_1009834181 186
158 3300005437 Ga0070710_10257581 Ga0070710_102575811 186
159 3300005455 Ga0070663_100009159 Ga0070663_1000091594 186
160 3300005455 Ga0070663_100833585 Ga0070663_1008335851 186
161 3300005456 Ga0070678_100400191 Ga0070678_1004001913 186
162 3300005548 Ga0070665_100017575 Ga0070665_1000175755 186
163 3300005548 Ga0070665_100104728 Ga0070665_1001047282 186
164 3300005548 Ga0070665_100684528 Ga0070665_1006845281 186
165 3300005615 Ga0070702_100633512 Ga0070702_1006335121 186
166 3300005719 Ga0068861_100310887 Ga0068861_1003108872 186
167 3300005842 Ga0068858_100291897 Ga0068858_1002918972 186
168 3300005842 Ga0068858_100934296 Ga0068858_1009342962 186
169 3300005843 Ga0068860_100003537 Ga0068860_1000035376 186
170 3300005843 Ga0068860_100318861 Ga0068860_1003188612 186
171 3300005844 Ga0068862_100287239 Ga0068862_1002872392 186
172 3300005937 Ga0081455_10023701 Ga0081455_100237013 186
173 3300005937 Ga0081455_10320913 Ga0081455_103209132 186
174 3300005983 Ga0081540_1005216 Ga0081540_100521613 186
175 3300005983 Ga0081540_1012707 Ga0081540_10127072 186
176 3300006038 Ga0075365_10007515 Ga0075365_100075153 186
177 3300006038 Ga0075365_10048736 Ga0075365_100487362 186
178 3300006038 Ga0075365_10090514 Ga0075365_100905142 186
179 3300006038 Ga0075365_10310152 Ga0075365_103101522 186
180 3300006042 Ga0075368_10066662 Ga0075368_100666622 186
181 3300006048 Ga0075363_100021331 Ga0075363_1000213314 186
182 3300006048 Ga0075363_100151138 Ga0075363_1001511382 186
183 3300006051 Ga0075364_10066575 Ga0075364_100665752 186
184 3300006178 Ga0075367_10034965 Ga0075367_100349651 186
185 3300006178 Ga0075367_10039863 Ga0075367_100398632 186
186 3300006178 Ga0075367_10058146 Ga0075367_100581462 186
187 3300006178 Ga0075367_10267404 Ga0075367_102674042 186
188 3300006186 Ga0075369_10042314 Ga0075369_100423142 186
189 3300006195 Ga0075366_10053418 Ga0075366_100534182 186
190 3300006195 Ga0075366_10157443 Ga0075366_101574432 186
191 3300006353 Ga0075370_10001527 Ga0075370_100015279 186
192 3300006353 Ga0075370_10019581 Ga0075370_100195814 186
193 3300006353 Ga0075370_10045356 Ga0075370_100453564 186
194 3300006880 Ga0075429_100331228 Ga0075429_1003312281 186
195 3300009101 Ga0105247_10062157 Ga0105247_100621572 186
196 3300009148 Ga0105243_10353845 Ga0105243_103538451 186
197 3300009545 Ga0105237_10175319 Ga0105237_101753192 186
198 3300009551 Ga0105238_11194163 Ga0105238_111941631 186
199 3300010375 Ga0105239_10393914 Ga0105239_103939142 186
200 3300013104 Ga0157370_10079586 Ga0157370_100795863 186
201 3300013296 Ga0157374_10706211 Ga0157374_107062112 186
202 3300013306 Ga0163162_10197376 Ga0163162_101973762 186
203 3300013306 Ga0163162_10812607 Ga0163162_108126072 186
204 3300013306 Ga0163162_11065220 Ga0163162_110652201 186
205 3300013308 Ga0157375_10143699 Ga0157375_101436992 186
206 3300014325 Ga0163163_10045357 Ga0163163_100453574 186
207 3300014325 Ga0163163_10117904 Ga0163163_101179042 186
208 3300014325 Ga0163163_10434424 Ga0163163_104344242 186
209 3300014325 Ga0163163_10913881 Ga0163163_109138812 186
210 3300014326 Ga0157380_10978068 Ga0157380_109780681 186
211 3300014968 Ga0157379_10000463 Ga0157379_1000046315 186
212 3300014968 Ga0157379_10248885 Ga0157379_102488852 186
213 3300014968 Ga0157379_10677070 Ga0157379_106770701 186
214 3300025302 Ga0207426_1000767 Ga0207426_100076719 186
215 3300025302 Ga0207426_1035757 Ga0207426_10357572 186
216 3300025898 Ga0207692_10136495 Ga0207692_101364952 186
217 3300025900 Ga0207710_10073930 Ga0207710_100739302 186
218 3300025901 Ga0207688_10025455 Ga0207688_100254553 186
219 3300025907 Ga0207645_10401672 Ga0207645_104016722 186
220 3300025931 Ga0207644_10649673 Ga0207644_106496731 186
221 3300025938 Ga0207704_10271350 Ga0207704_102713501 186
222 3300025972 Ga0207668_10072577 Ga0207668_100725772 186
223 3300025972 Ga0207668_10085308 Ga0207668_100853082 186
224 3300025972 Ga0207668_10649510 Ga0207668_106495102 186
225 3300026035 Ga0207703_10349211 Ga0207703_103492112 186
226 3300026035 Ga0207703_10409369 Ga0207703_104093692 186
227 3300026067 Ga0207678_10037078 Ga0207678_100370782 186
228 3300026067 Ga0207678_10056853 Ga0207678_100568534 186
229 3300026067 Ga0207678_10251711 Ga0207678_102517111 186
230 3300026088 Ga0207641_10142877 Ga0207641_101428772 186
231 3300026121 Ga0207683_10097621 Ga0207683_100976212 186
232 3300027312 Ga0209371_1005576 Ga0209371_10055763 186
233 3300027312 Ga0209371_1008358 Ga0209371_10083582 186
234 3300027866 Ga0209813_10074769 Ga0209813_100747691 186
235 3300028379 Ga0268266_10001335 Ga0268266_1000133524 186
236 3300028379 Ga0268266_10009532 Ga0268266_100095328 186
237 3300028379 Ga0268266_10018709 Ga0268266_100187099 186
238 3300028379 Ga0268266_10024160 Ga0268266_100241605 186
239 3300028379 Ga0268266_10066202 Ga0268266_100662022 186
240 3300028379 Ga0268266_10367076 Ga0268266_103670762 186
241 3300028379 Ga0268266_10400714 Ga0268266_104007142 186
242 3300028379 Ga0268266_10625634 Ga0268266_106256343 186
243 3300028381 Ga0268264_10002518 Ga0268264_1000251815 186
244 3300030500 Ga0268256_1008686 Ga0268256_10086862 186
245 3300030500 Ga0268256_1019328 Ga0268256_10193282 186
246 3300032004 Ga0307414_10298339 Ga0307414_102983392 186
247 3300046501 Ga0495607_0132371 Ga0495607_0132371_139_714 186
248 3300046557 Ga0495622_0146191 Ga0495622_0146191_215_775 186
249 3300047320 Ga0495672_0218420 Ga0495672_0218420_237_797 186
250 3300047472 Ga0495686_0136702 Ga0495686_0136702_716_1276 186
251 3300047472 Ga0495686_0163953 Ga0495686_0163953_650_1210 186
252 3300048903 Ga0496100_0876342 Ga0496100_0876342_124_684 186
253 3300048904 Ga0496101_0091277 Ga0496101_0091277_608_1168 186
254 3300048905 Ga0496102_0155229 Ga0496102_0155229_492_1052 186
255 3300048905 Ga0496102_0191223 Ga0496102_0191223_568_1152 186
256 3300048905 Ga0496102_0203360 Ga0496102_0203360_79_663 186
257 3300048905 Ga0496102_0390656 Ga0496102_0390656_250_810 186
258 3300048907 Ga0496104_0162723 Ga0496104_0162723_1406_1966 186
259 3300048907 Ga0496104_0254557 Ga0496104_0254557_956_1540 186
260 3300048909 Ga0496106_0042367 Ga0496106_0042367_1303_1863 186
261 3300048910 Ga0496107_0084437 Ga0496107_0084437_1391_1951 186
262 3300048910 Ga0496107_0394822 Ga0496107_0394822_76_660 186
263 3300048915 Ga0496112_0632427 Ga0496112_0632427_53_613 186
264 3300048919 Ga0496116_0049501 Ga0496116_0049501_1213_1773 186
265 3300048920 Ga0496117_0157755 Ga0496117_0157755_43_603 186
266 3300048921 Ga0496118_0033001 Ga0496118_0033001_1784_2353 186
267 3300048922 Ga0496119_0090504 Ga0496119_0090504_529_1089 186
268 3300048924 Ga0496121_0050570 Ga0496121_0050570_336_896 186
269 3300048924 Ga0496121_0050848 Ga0496121_0050848_946_1515 186
270 3300048924 Ga0496121_0302150 Ga0496121_0302150_276_836 186
271 3300048928 Ga0496125_0000048 Ga0496125_0000048_66435_66995 186
272 3300048929 Ga0496126_0231202 Ga0496126_0231202_193_777 186
273 3300048929 Ga0496126_0714445 Ga0496126_0714445_198_758 186
274 3300049758 Ga0501241_000061 Ga0501241_000061_24378_24977 186
275 3300050490 nmdc:mga03n38_18757_c1 nmdc:mga03n38_18757_c1_977_1561 186
276 3300050492 nmdc:mga0yw44_19694_c1 nmdc:mga0yw44_19694_c1_247_831 186
277 3300050492 nmdc:mga0yw44_58229_c1 nmdc:mga0yw44_58229_c1_184_744 186
278 3300050492 nmdc:mga0yw44_6844_c1 nmdc:mga0yw44_6844_c1_1912_2472 186
279 3300050492 nmdc:mga0yw44_77371_c1 nmdc:mga0yw44_77371_c1_919_1479 186
280 3300050493 nmdc:mga0k408_108982_c1 nmdc:mga0k408_108982_c1_155_739 186
281 3300050493 nmdc:mga0k408_202477_c1 nmdc:mga0k408_202477_c1_498_1058 186
282 3300050494 nmdc:mga06z11_19457_c1 nmdc:mga06z11_19457_c1_397_981 186
283 3300050494 nmdc:mga06z11_34575_c1 nmdc:mga06z11_34575_c1_1761_2321 186
284 3300050494 nmdc:mga06z11_39608_c1 nmdc:mga06z11_39608_c1_813_1373 186
285 3300050495 nmdc:mga04h51_141456_c1 nmdc:mga04h51_141456_c1_230_790 186
286 3300050496 nmdc:mga07m45_180639_c2 nmdc:mga07m45_180639_c2_42_602 186
287 3300050496 nmdc:mga07m45_55699_c1 nmdc:mga07m45_55699_c1_258_818 186
288 3300050508 nmdc:mga09592_298021_c1 nmdc:mga09592_298021_c1_620_1183 186
289 3300053125 Ga0500618_006698 Ga0500618_006698_1360_1935 186
290 3300000532 CNAas_1002612 CNAas_10026122 187
291 3300001979 JGI24740J21852_10000185 JGI24740J21852_100001858 187
292 3300002070 JGI24750J21931_1019772 JGI24750J21931_10197721 187
293 3300002075 JGI24738J21930_10081733 JGI24738J21930_100817331 187
294 3300002737 JGI25162J39368_1001010 JGI25162J39368_10010101 187
295 3300003187 JGI25151J46595_10002485 JGI25151J46595_1000248510 187
296 3300003214 JGI25165J46597_1000859 JGI25165J46597_10008594 187
297 3300003215 JGI25153J46596_10005600 JGI25153J46596_100056004 187
298 3300003316 rootH1_10010685 rootH1_100106852 187
299 3300003320 rootH2_10070521 rootH2_100705214 187
300 3300003322 rootL2_10261710 rootL2_102617104 187
301 3300004625 Ga0055543_1004255 Ga0055543_10042555 187
302 3300005262 Ga0065165_1000348 Ga0065165_100034832 187
303 3300005289 Ga0065704_10046873 Ga0065704_100468731 187
304 3300005327 Ga0070658_10504027 Ga0070658_105040272 187
305 3300005328 Ga0070676_10210399 Ga0070676_102103991 187
306 3300005334 Ga0068869_100026570 Ga0068869_1000265704 187
307 3300005338 Ga0068868_100256349 Ga0068868_1002563492 187
308 3300005347 Ga0070668_100000040 Ga0070668_10000004031 187
309 3300005347 Ga0070668_100228753 Ga0070668_1002287531 187
310 3300005353 Ga0070669_100051671 Ga0070669_1000516712 187
311 3300005367 Ga0070667_100169048 Ga0070667_1001690482 187
312 3300005406 Ga0070703_10068774 Ga0070703_100687741 187
313 3300005436 Ga0070713_100462710 Ga0070713_1004627102 187
314 3300005437 Ga0070710_10080555 Ga0070710_100805552 187
315 3300005441 Ga0070700_100450168 Ga0070700_1004501682 187
316 3300005444 Ga0070694_100065348 Ga0070694_1000653481 187
317 3300005445 Ga0070708_100180727 Ga0070708_1001807273 187
318 3300005445 Ga0070708_100551004 Ga0070708_1005510041 187
319 3300005455 Ga0070663_100332693 Ga0070663_1003326932 187
320 3300005455 Ga0070663_100405593 Ga0070663_1004055931 187
321 3300005457 Ga0070662_100017219 Ga0070662_1000172195 187
322 3300005467 Ga0070706_100827244 Ga0070706_1008272442 187
323 3300005471 Ga0070698_100044970 Ga0070698_1000449701 187
324 3300005518 Ga0070699_100102003 Ga0070699_1001020032 187
325 3300005536 Ga0070697_100337469 Ga0070697_1003374691 187
326 3300005539 Ga0068853_100156110 Ga0068853_1001561103 187
327 3300005545 Ga0070695_100154990 Ga0070695_1001549901 187
328 3300005548 Ga0070665_100182965 Ga0070665_1001829652 187
329 3300005548 Ga0070665_100375960 Ga0070665_1003759602 187
330 3300005548 Ga0070665_100615955 Ga0070665_1006159552 187
331 3300005549 Ga0070704_100847356 Ga0070704_1008473561 187
332 3300005563 Ga0068855_100857911 Ga0068855_1008579111 187
333 3300005578 Ga0068854_100007247 Ga0068854_1000072477 187
334 3300005617 Ga0068859_100581242 Ga0068859_1005812422 187
335 3300005618 Ga0068864_100277428 Ga0068864_1002774281 187
336 3300005719 Ga0068861_100002291 Ga0068861_1000022918 187
337 3300005834 Ga0068851_10089596 Ga0068851_100895962 187
338 3300005841 Ga0068863_100489143 Ga0068863_1004891431 187
339 3300005841 Ga0068863_100722852 Ga0068863_1007228522 187
340 3300005842 Ga0068858_100190057 Ga0068858_1001900573 187
341 3300005842 Ga0068858_100672370 Ga0068858_1006723701 187
342 3300005843 Ga0068860_100031244 Ga0068860_1000312444 187
343 3300005843 Ga0068860_100158759 Ga0068860_1001587592 187
344 3300005844 Ga0068862_100004744 Ga0068862_1000047443 187
345 3300005844 Ga0068862_100212740 Ga0068862_1002127402 187
346 3300005981 Ga0081538_10262926 Ga0081538_102629261 187
347 3300005983 Ga0081540_1031316 Ga0081540_10313162 187
348 3300006028 Ga0070717_10129736 Ga0070717_101297362 187
349 3300006042 Ga0075368_10242253 Ga0075368_102422532 187
350 3300006048 Ga0075363_100051292 Ga0075363_1000512922 187
351 3300006051 Ga0075364_10072682 Ga0075364_100726823 187
352 3300006051 Ga0075364_10144985 Ga0075364_101449853 187
353 3300006173 Ga0070716_100343659 Ga0070716_1003436592 187
354 3300006177 Ga0075362_10392728 Ga0075362_103927281 187
355 3300006178 Ga0075367_10003448 Ga0075367_100034481 187
356 3300006178 Ga0075367_10032709 Ga0075367_100327094 187
357 3300006186 Ga0075369_10162881 Ga0075369_101628812 187
358 3300006186 Ga0075369_10171176 Ga0075369_101711761 187
359 3300006195 Ga0075366_10301778 Ga0075366_103017781 187
360 3300006195 Ga0075366_10464548 Ga0075366_104645482 187
361 3300006353 Ga0075370_10222315 Ga0075370_102223152 187
362 3300006353 Ga0075370_10371661 Ga0075370_103716611 187
363 3300006358 Ga0068871_100460062 Ga0068871_1004600622 187
364 3300006871 Ga0075434_100559077 Ga0075434_1005590772 187
365 3300006931 Ga0097620_100581240 Ga0097620_1005812402 187
366 3300006946 Ga0079104_1013522 Ga0079104_10135222 187
367 3300007076 Ga0075435_100113203 Ga0075435_1001132033 187
368 3300007265 Ga0099794_10240932 Ga0099794_102409321 187
369 3300009092 Ga0105250_10023700 Ga0105250_100237004 187
370 3300009093 Ga0105240_10000005 Ga0105240_10000005191 187
371 3300009093 Ga0105240_10071482 Ga0105240_100714825 187
372 3300009093 Ga0105240_10164364 Ga0105240_101643642 187
373 3300009093 Ga0105240_10530618 Ga0105240_105306182 187
374 3300009093 Ga0105240_10727697 Ga0105240_107276972 187
375 3300009098 Ga0105245_10129685 Ga0105245_101296851 187
376 3300009148 Ga0105243_10057116 Ga0105243_100571164 187
377 3300009176 Ga0105242_10053124 Ga0105242_100531243 187
378 3300009177 Ga0105248_10176684 Ga0105248_101766842 187
379 3300009545 Ga0105237_11123137 Ga0105237_111231372 187
380 3300009551 Ga0105238_10039512 Ga0105238_100395125 187
381 3300009553 Ga0105249_10007823 Ga0105249_100078231 187
382 3300009553 Ga0105249_10013279 Ga0105249_100132798 187
383 3300009553 Ga0105249_10941670 Ga0105249_109416701 187
384 3300010375 Ga0105239_10002635 Ga0105239_1000263524 187
385 3300010375 Ga0105239_10252385 Ga0105239_102523852 187
386 3300010375 Ga0105239_10808814 Ga0105239_108088141 187
387 3300013100 Ga0157373_10085955 Ga0157373_100859552 187
388 3300013102 Ga0157371_10000886 Ga0157371_100008863 187
389 3300013102 Ga0157371_10015143 Ga0157371_100151436 187
390 3300013104 Ga0157370_10000163 Ga0157370_1000016335 187
391 3300013306 Ga0163162_10242867 Ga0163162_102428671 187
392 3300013306 Ga0163162_12204189 Ga0163162_122041891 187
393 3300013307 Ga0157372_11212628 Ga0157372_112126281 187
394 3300014325 Ga0163163_10607101 Ga0163163_106071012 187
395 3300014325 Ga0163163_11605844 Ga0163163_116058441 187
396 3300014968 Ga0157379_10132112 Ga0157379_101321123 187
397 3300014968 Ga0157379_10136931 Ga0157379_101369312 187
398 3300014969 Ga0157376_10810964 Ga0157376_108109641 187
399 3300015261 Ga0182006_1000325 Ga0182006_100032520 187
400 3300015261 Ga0182006_1079966 Ga0182006_10799662 187
401 3300017792 Ga0163161_10719287 Ga0163161_107192871 187
402 3300021361 Ga0213872_10013768 Ga0213872_100137685 187
403 3300021361 Ga0213872_10143244 Ga0213872_101432442 187
404 3300021361 Ga0213872_10147560 Ga0213872_101475602 187
405 3300021441 Ga0213871_10003957 Ga0213871_100039572 187
406 3300025233 Ga0209437_100520 Ga0209437_10052010 187
407 3300025245 Ga0207425_1002075 Ga0207425_10020752 187
408 3300025246 Ga0209646_1018716 Ga0209646_10187161 187
409 3300025258 Ga0209129_1000149 Ga0209129_100014934 187
410 3300025261 Ga0209233_1000448 Ga0209233_100044820 187
411 3300025261 Ga0209233_1032121 Ga0209233_10321212 187
412 3300025294 Ga0209025_1000253 Ga0209025_10002536 187
413 3300025294 Ga0209025_1005181 Ga0209025_10051813 187
414 3300025297 Ga0209758_1000296 Ga0209758_10002966 187
415 3300025885 Ga0207653_10126014 Ga0207653_101260141 187
416 3300025900 Ga0207710_10074422 Ga0207710_100744222 187
417 3300025903 Ga0207680_10067951 Ga0207680_100679511 187
418 3300025906 Ga0207699_10072454 Ga0207699_100724543 187
419 3300025907 Ga0207645_10046340 Ga0207645_100463401 187
420 3300025910 Ga0207684_10722699 Ga0207684_107226991 187
421 3300025910 Ga0207684_11209884 Ga0207684_112098841 187
422 3300025913 Ga0207695_10000011 Ga0207695_10000011723 187
423 3300025913 Ga0207695_10031216 Ga0207695_100312164 187
424 3300025913 Ga0207695_10667952 Ga0207695_106679521 187
425 3300025914 Ga0207671_10398186 Ga0207671_103981861 187
426 3300025914 Ga0207671_10717469 Ga0207671_107174692 187
427 3300025923 Ga0207681_10087782 Ga0207681_100877822 187
428 3300025923 Ga0207681_10501412 Ga0207681_105014121 187
429 3300025924 Ga0207694_10229501 Ga0207694_102295012 187
430 3300025927 Ga0207687_10096509 Ga0207687_100965091 187
431 3300025928 Ga0207700_10949727 Ga0207700_109497271 187
432 3300025929 Ga0207664_10881038 Ga0207664_108810382 187
433 3300025933 Ga0207706_10014354 Ga0207706_100143543 187
434 3300025934 Ga0207686_10064592 Ga0207686_100645924 187
435 3300025935 Ga0207709_10060899 Ga0207709_100608991 187
436 3300025939 Ga0207665_10440338 Ga0207665_104403382 187
437 3300025939 Ga0207665_10474842 Ga0207665_104748422 187
438 3300025942 Ga0207689_10028565 Ga0207689_100285653 187
439 3300025961 Ga0207712_10001119 Ga0207712_100011193 187
440 3300025972 Ga0207668_10000069 Ga0207668_1000006931 187
441 3300025972 Ga0207668_10007301 Ga0207668_100073015 187
442 3300025981 Ga0207640_10005170 Ga0207640_100051707 187
443 3300025986 Ga0207658_10076616 Ga0207658_100766164 187
444 3300026023 Ga0207677_10268382 Ga0207677_102683821 187
445 3300026035 Ga0207703_10090596 Ga0207703_100905963 187
446 3300026041 Ga0207639_10195095 Ga0207639_101950952 187
447 3300026067 Ga0207678_10028180 Ga0207678_100281802 187
448 3300026067 Ga0207678_10444755 Ga0207678_104447551 187
449 3300026075 Ga0207708_10065735 Ga0207708_100657351 187
450 3300026088 Ga0207641_10389304 Ga0207641_103893042 187
451 3300026088 Ga0207641_10579926 Ga0207641_105799261 187
452 3300026118 Ga0207675_100006110 Ga0207675_1000061103 187
453 3300027111 Ga0209281_1002866 Ga0209281_10028665 187
454 3300027111 Ga0209281_1003385 Ga0209281_10033854 187
455 3300027312 Ga0209371_1000010 Ga0209371_1000010632 187
456 3300027312 Ga0209371_1004276 Ga0209371_10042763 187
457 3300027671 Ga0209588_1047811 Ga0209588_10478112 187
458 3300028379 Ga0268266_10009274 Ga0268266_100092742 187
459 3300028379 Ga0268266_11346711 Ga0268266_113467111 187
460 3300028380 Ga0268265_10085188 Ga0268265_100851882 187
461 3300028380 Ga0268265_10160753 Ga0268265_101607533 187
462 3300028381 Ga0268264_10008540 Ga0268264_100085402 187
463 3300028794 Ga0307515_10158226 Ga0307515_101582262 187
464 3300028794 Ga0307515_10218442 Ga0307515_102184423 187
465 3300030500 Ga0268256_1000022 Ga0268256_1000022233 187
466 3300030500 Ga0268256_1004608 Ga0268256_10046085 187
467 3300031507 Ga0307509_10282258 Ga0307509_102822583 187
468 3300031548 Ga0307408_100030448 Ga0307408_1000304482 187
469 3300031548 Ga0307408_100058024 Ga0307408_1000580244 187
470 3300031730 Ga0307516_10557114 Ga0307516_105571142 187
471 3300031731 Ga0307405_10004925 Ga0307405_100049258 187
472 3300031731 Ga0307405_10455421 Ga0307405_104554212 187
473 3300031911 Ga0307412_10073294 Ga0307412_100732942 187
474 3300031995 Ga0307409_100451144 Ga0307409_1004511442 187
475 3300032005 Ga0307411_10011984 Ga0307411_100119844 187
476 3300032005 Ga0307411_10395823 Ga0307411_103958232 187
477 3300033180 Ga0307510_10108943 Ga0307510_101089433 187
478 3300033442 Ga0315911_1000006 Ga0315911_100000691 187
479 3300035170 Ga0373943_0420299 Ga0373943_0420299_139_702 187
480 3300035725 Ga0373947_0452357 Ga0373947_0452357_94_657 187
481 3300036401 Ga0373937_1118987 Ga0373937_1118987_157_720 187
482 3300037466 Ga0395898_0476189 Ga0395898_0476189_147_710 187
483 3300037471 Ga0395905_0057923 Ga0395905_0057923_413_976 187
484 3300039438 Ga0436360_0279990 Ga0436360_0279990_604_1167 187
485 3300039438 Ga0436360_0280789 Ga0436360_0280789_1492_2055 187
486 3300039447 Ga0436361_0039495 Ga0436361_0039495_2129_2692 187
487 3300039447 Ga0436361_0052850 Ga0436361_0052850_1274_1837 187
488 3300039447 Ga0436361_0514043 Ga0436361_0514043_6666_7229 187
489 3300039447 Ga0436361_0547814 Ga0436361_0547814_3375_3965 187
490 3300039447 Ga0436361_0655121 Ga0436361_0655121_855_1418 187
491 3300039447 Ga0436361_0898932 Ga0436361_0898932_743_1306 187
492 3300039447 Ga0436361_0945239 Ga0436361_0945239_2016_2579 187
493 3300039453 Ga0436362_0568463 Ga0436362_0568463_777_1340 187
494 3300041405 Ga0439438_000005 Ga0439438_000005_41249_41833 187
495 3300041405 Ga0439438_000078 Ga0439438_000078_26756_27352 187
496 3300041456 Ga0451795_0539211 Ga0451795_0539211_188_751 187
497 3300041997 Ga0439431_0072943 Ga0439431_0072943_35_625 187
498 3300042006 Ga0439432_002011 Ga0439432_002011_3765_4340 187
499 3300042006 Ga0439432_011116 Ga0439432_011116_2267_2839 187
500 3300042016 Ga0439463_042661 Ga0439463_042661_65_628 187
501 3300042115 Ga0450911_000010 Ga0450911_000010_26871_27446 187
502 3300042115 Ga0450911_000303 Ga0450911_000303_6364_6927 187
503 3300042145 Ga0450906_000007 Ga0450906_000007_20854_21429 187
504 3300042185 Ga0450909_000934 Ga0450909_000934_2874_3503 187
505 3300042439 Ga0439464_0008830 Ga0439464_0008830_1710_2273 187
506 3300044656 Ga0466969_0097288 Ga0466969_0097288_760_1323 187
507 3300044658 Ga0466972_0000188 Ga0466972_0000188_2348_2911 187
508 3300044683 Ga0466965_0075480 Ga0466965_0075480_452_1015 187
509 3300044683 Ga0466965_0162968 Ga0466965_0162968_382_945 187
510 3300044901 Ga0466960_0215500 Ga0466960_0215500_102_665 187
511 3300044901 Ga0466960_0337461 Ga0466960_0337461_250_813 187
512 3300045049 Ga0466959_0311202 Ga0466959_0311202_493_1056 187
513 3300046452 Ga0495617_000578 Ga0495617_000578_6104_6715 187
514 3300046452 Ga0495617_035376 Ga0495617_035376_905_1468 187
515 3300046453 Ga0495627_001932 Ga0495627_001932_2534_3109 187
516 3300046455 Ga0495603_0102749 Ga0495603_0102749_153_716 187
517 3300046457 Ga0495590_0026011 Ga0495590_0026011_646_1209 187
518 3300046460 Ga0495638_0000243 Ga0495638_0000243_38494_39057 187
519 3300046460 Ga0495638_0008279 Ga0495638_0008279_4798_5361 187
520 3300046460 Ga0495638_0018999 Ga0495638_0018999_2935_3498 187
521 3300046460 Ga0495638_0053384 Ga0495638_0053384_1165_1728 187
522 3300046471 Ga0495650_0001187 Ga0495650_0001187_24525_25100 187
523 3300046471 Ga0495650_0014052 Ga0495650_0014052_3308_3871 187
524 3300046471 Ga0495650_0084952 Ga0495650_0084952_554_1117 187
525 3300046472 Ga0495580_0231441 Ga0495580_0231441_458_1021 187
526 3300046474 Ga0495605_0000075 Ga0495605_0000075_83344_83916 187
527 3300046474 Ga0495605_0073676 Ga0495605_0073676_744_1307 187
528 3300046474 Ga0495605_0177162 Ga0495605_0177162_141_704 187
529 3300046475 Ga0495639_0402873 Ga0495639_0402873_49_612 187
530 3300046477 Ga0495664_0416913 Ga0495664_0416913_157_720 187
531 3300046491 Ga0495584_0049656 Ga0495584_0049656_124_687 187
532 3300046491 Ga0495584_0079696 Ga0495584_0079696_733_1296 187
533 3300046491 Ga0495584_0312910 Ga0495584_0312910_120_683 187
534 3300046492 Ga0495585_0126593 Ga0495585_0126593_212_775 187
535 3300046500 Ga0495596_0016006 Ga0495596_0016006_1304_1867 187
536 3300046500 Ga0495596_0167561 Ga0495596_0167561_253_816 187
537 3300046501 Ga0495607_0060347 Ga0495607_0060347_585_1148 187
538 3300046501 Ga0495607_0189024 Ga0495607_0189024_437_1000 187
539 3300046507 Ga0495606_0000022 Ga0495606_0000022_90986_91558 187
540 3300046507 Ga0495606_0002482 Ga0495606_0002482_1654_2217 187
541 3300046507 Ga0495606_0120738 Ga0495606_0120738_629_1192 187
542 3300046507 Ga0495606_0155367 Ga0495606_0155367_645_1208 187
543 3300046507 Ga0495606_0238215 Ga0495606_0238215_152_715 187
544 3300046507 Ga0495606_0253277 Ga0495606_0253277_29_601 187
545 3300046512 Ga0495610_0003586 Ga0495610_0003586_3842_4417 187
546 3300046512 Ga0495610_0012519 Ga0495610_0012519_1885_2475 187
547 3300046512 Ga0495610_0076624 Ga0495610_0076624_199_762 187
548 3300046513 Ga0495616_0023423 Ga0495616_0023423_2546_3109 187
549 3300046513 Ga0495616_0055616 Ga0495616_0055616_448_1011 187
550 3300046515 Ga0495620_0003203 Ga0495620_0003203_1147_1722 187
551 3300046515 Ga0495620_0010672 Ga0495620_0010672_2688_3260 187
552 3300046515 Ga0495620_0036657 Ga0495620_0036657_1023_1586 187
553 3300046515 Ga0495620_0214246 Ga0495620_0214246_91_654 187
554 3300046518 Ga0495631_0082130 Ga0495631_0082130_667_1230 187
555 3300046519 Ga0495632_0049500 Ga0495632_0049500_696_1259 187
556 3300046519 Ga0495632_0292667 Ga0495632_0292667_72_635 187
557 3300046520 Ga0495637_0003672 Ga0495637_0003672_3946_4509 187
558 3300046520 Ga0495637_0241876 Ga0495637_0241876_43_606 187
559 3300046522 Ga0495643_0005027 Ga0495643_0005027_3289_3852 187
560 3300046523 Ga0495644_0096312 Ga0495644_0096312_246_809 187
561 3300046524 Ga0495648_0003954 Ga0495648_0003954_7401_7964 187
562 3300046524 Ga0495648_0009452 Ga0495648_0009452_5820_6383 187
563 3300046524 Ga0495648_0189133 Ga0495648_0189133_201_764 187
564 3300046524 Ga0495648_0316920 Ga0495648_0316920_23_586 187
565 3300046525 Ga0495663_0020815 Ga0495663_0020815_1058_1621 187
566 3300046528 Ga0495642_0219007 Ga0495642_0219007_32_595 187
567 3300046529 Ga0495652_0457948 Ga0495652_0457948_137_700 187
568 3300046530 Ga0495654_0088139 Ga0495654_0088139_766_1329 187
569 3300046531 Ga0495665_0223925 Ga0495665_0223925_246_809 187
570 3300046537 Ga0495598_0007307 Ga0495598_0007307_1763_2326 187
571 3300046538 Ga0495609_0073627 Ga0495609_0073627_732_1295 187
572 3300046538 Ga0495609_0102447 Ga0495609_0102447_162_725 187
573 3300046558 Ga0495633_0071738 Ga0495633_0071738_836_1399 187
574 3300046615 Ga0495656_0156195 Ga0495656_0156195_141_704 187
575 3300046616 Ga0495668_0064177 Ga0495668_0064177_457_1020 187
576 3300046616 Ga0495668_0115717 Ga0495668_0115717_213_776 187
577 3300046616 Ga0495668_0207589 Ga0495668_0207589_217_780 187
578 3300046648 Ga0495611_0235320 Ga0495611_0235320_141_704 187
579 3300046660 Ga0495625_0030706 Ga0495625_0030706_1974_2537 187
580 3300046660 Ga0495625_0052875 Ga0495625_0052875_2228_2791 187
581 3300046660 Ga0495625_0159985 Ga0495625_0159985_789_1352 187
582 3300046664 Ga0495659_0009432 Ga0495659_0009432_527_1090 187
583 3300046665 Ga0495661_0053688 Ga0495661_0053688_1526_2089 187
584 3300046665 Ga0495661_0189771 Ga0495661_0189771_308_871 187
585 3300046665 Ga0495661_0195803 Ga0495661_0195803_336_899 187
586 3300046674 Ga0495588_0047545 Ga0495588_0047545_504_1067 187
587 3300046674 Ga0495588_0106559 Ga0495588_0106559_702_1265 187
588 3300046678 Ga0495599_0339471 Ga0495599_0339471_194_757 187
589 3300046681 Ga0495647_0372286 Ga0495647_0372286_40_603 187
590 3300046684 Ga0495669_0040598 Ga0495669_0040598_1178_1741 187
591 3300046684 Ga0495669_0100765 Ga0495669_0100765_503_1066 187
592 3300046691 Ga0495670_0000834 Ga0495670_0000834_13112_13675 187
593 3300046691 Ga0495670_0022215 Ga0495670_0022215_1994_2557 187
594 3300046692 Ga0495671_0074906 Ga0495671_0074906_431_994 187
595 3300046692 Ga0495671_0101886 Ga0495671_0101886_815_1378 187
596 3300046694 Ga0495649_0119640 Ga0495649_0119640_58_621 187
597 3300046694 Ga0495649_0305387 Ga0495649_0305387_234_797 187
598 3300046794 Ga0495589_0051993 Ga0495589_0051993_961_1524 187
599 3300046794 Ga0495589_0137409 Ga0495589_0137409_515_1078 187
600 3300046810 Ga0495660_0288861 Ga0495660_0288861_160_723 187
601 3300047318 Ga0495636_0067731 Ga0495636_0067731_217_780 187
602 3300047319 Ga0495674_0719201 Ga0495674_0719201_29_592 187
603 3300047320 Ga0495672_0000080 Ga0495672_0000080_35608_36171 187
604 3300047320 Ga0495672_0038383 Ga0495672_0038383_1292_1855 187
605 3300047321 Ga0495676_0082345 Ga0495676_0082345_549_1112 187
606 3300047323 Ga0495683_0056437 Ga0495683_0056437_304_867 187
607 3300047323 Ga0495683_0064255 Ga0495683_0064255_560_1123 187
608 3300047445 Ga0495677_0024699 Ga0495677_0024699_649_1212 187
609 3300047447 Ga0495685_069775 Ga0495685_069775_413_976 187
610 3300047469 Ga0495673_0013372 Ga0495673_0013372_154_726 187
611 3300047469 Ga0495673_0070236 Ga0495673_0070236_377_940 187
612 3300047470 Ga0495681_0000066 Ga0495681_0000066_64495_65067 187
613 3300047470 Ga0495681_0003582 Ga0495681_0003582_7704_8279 187
614 3300047472 Ga0495686_0008665 Ga0495686_0008665_3410_3973 187
615 3300047472 Ga0495686_0045797 Ga0495686_0045797_738_1301 187
616 3300047472 Ga0495686_0103696 Ga0495686_0103696_442_1005 187
617 3300047472 Ga0495686_0121966 Ga0495686_0121966_291_854 187
618 3300047472 Ga0495686_0390127 Ga0495686_0390127_47_610 187
619 3300047472 Ga0495686_0442190 Ga0495686_0442190_72_635 187
620 3300048089 Ga0495614_0407530 Ga0495614_0407530_58_621 187
621 3300048091 Ga0495626_0054350 Ga0495626_0054350_190_753 187
622 3300048091 Ga0495626_0104352 Ga0495626_0104352_207_770 187
623 3300048903 Ga0496100_0443824 Ga0496100_0443824_372_935 187
624 3300048903 Ga0496100_0549187 Ga0496100_0549187_275_838 187
625 3300048904 Ga0496101_0278362 Ga0496101_0278362_52_615 187
626 3300048905 Ga0496102_0295618 Ga0496102_0295618_567_1136 187
627 3300048907 Ga0496104_0974340 Ga0496104_0974340_104_667 187
628 3300048908 Ga0496105_0003062 Ga0496105_0003062_140_703 187
629 3300048910 Ga0496107_0235246 Ga0496107_0235246_557_1120 187
630 3300048912 Ga0496109_0849599 Ga0496109_0849599_40_603 187
631 3300048914 Ga0496111_0032134 Ga0496111_0032134_67_630 187
632 3300048914 Ga0496111_0362209 Ga0496111_0362209_130_699 187
633 3300048918 Ga0496115_0384279 Ga0496115_0384279_519_1082 187
634 3300048919 Ga0496116_0167024 Ga0496116_0167024_396_965 187
635 3300048919 Ga0496116_0279246 Ga0496116_0279246_133_696 187
636 3300048920 Ga0496117_0038825 Ga0496117_0038825_1776_2339 187
637 3300048920 Ga0496117_0099538 Ga0496117_0099538_1242_1823 187
638 3300048920 Ga0496117_0101806 Ga0496117_0101806_275_838 187
639 3300048920 Ga0496117_0150340 Ga0496117_0150340_679_1248 187
640 3300048921 Ga0496118_0003441 Ga0496118_0003441_14671_15249 187
641 3300048921 Ga0496118_0009983 Ga0496118_0009983_4662_5225 187
642 3300048921 Ga0496118_0021067 Ga0496118_0021067_4322_4891 187
643 3300048921 Ga0496118_0026046 Ga0496118_0026046_1680_2243 187
644 3300048921 Ga0496118_0047460 Ga0496118_0047460_2151_2714 187
645 3300048921 Ga0496118_0158127 Ga0496118_0158127_714_1277 187
646 3300048921 Ga0496118_0196842 Ga0496118_0196842_506_1069 187
647 3300048922 Ga0496119_0006183 Ga0496119_0006183_1869_2450 187
648 3300048922 Ga0496119_0036268 Ga0496119_0036268_920_1483 187
649 3300048923 Ga0496120_0009481 Ga0496120_0009481_3632_4195 187
650 3300048923 Ga0496120_0018241 Ga0496120_0018241_680_1261 187
651 3300048923 Ga0496120_0204021 Ga0496120_0204021_82_645 187
652 3300048924 Ga0496121_0001562 Ga0496121_0001562_30476_31045 187
653 3300048924 Ga0496121_0008832 Ga0496121_0008832_9068_9631 187
654 3300048924 Ga0496121_0010656 Ga0496121_0010656_3385_3948 187
655 3300048924 Ga0496121_0013587 Ga0496121_0013587_2576_3139 187
656 3300048924 Ga0496121_0087101 Ga0496121_0087101_1337_1900 187
657 3300048924 Ga0496121_0352399 Ga0496121_0352399_61_624 187
658 3300048925 Ga0496122_0000595 Ga0496122_0000595_14511_15074 187
659 3300048925 Ga0496122_0000921 Ga0496122_0000921_38403_38981 187
660 3300048925 Ga0496122_0011498 Ga0496122_0011498_3464_4045 187
661 3300048925 Ga0496122_0028570 Ga0496122_0028570_1001_1570 187
662 3300048925 Ga0496122_0101532 Ga0496122_0101532_1322_1885 187
663 3300048926 Ga0496123_0000211 Ga0496123_0000211_48538_49101 187
664 3300048926 Ga0496123_0001350 Ga0496123_0001350_19993_20571 187
665 3300048926 Ga0496123_0009407 Ga0496123_0009407_4638_5219 187
666 3300048926 Ga0496123_0027629 Ga0496123_0027629_1891_2460 187
667 3300048926 Ga0496123_0031362 Ga0496123_0031362_1714_2277 187
668 3300048926 Ga0496123_0116209 Ga0496123_0116209_61_690 187
669 3300048927 Ga0496124_0002131 Ga0496124_0002131_13394_13957 187
670 3300048927 Ga0496124_0003192 Ga0496124_0003192_3468_4037 187
671 3300048927 Ga0496124_0015638 Ga0496124_0015638_1606_2169 187
672 3300048927 Ga0496124_0026577 Ga0496124_0026577_149_712 187
673 3300048927 Ga0496124_0050524 Ga0496124_0050524_1567_2142 187
674 3300048928 Ga0496125_0000664 Ga0496125_0000664_20770_21333 187
675 3300048928 Ga0496125_0002221 Ga0496125_0002221_17789_18352 187
676 3300048928 Ga0496125_0020534 Ga0496125_0020534_2627_3190 187
677 3300048928 Ga0496125_0026608 Ga0496125_0026608_1916_2479 187
678 3300048928 Ga0496125_0035798 Ga0496125_0035798_1345_1926 187
679 3300048928 Ga0496125_0047908 Ga0496125_0047908_450_1013 187
680 3300048929 Ga0496126_0002646 Ga0496126_0002646_3182_3751 187
681 3300048929 Ga0496126_0044439 Ga0496126_0044439_2153_2716 187
682 3300048929 Ga0496126_0068420 Ga0496126_0068420_2085_2648 187
683 3300048929 Ga0496126_0087169 Ga0496126_0087169_1535_2098 187
684 3300048929 Ga0496126_0111998 Ga0496126_0111998_379_942 187
685 3300048929 Ga0496126_0113939 Ga0496126_0113939_1345_1908 187
686 3300048929 Ga0496126_0145105 Ga0496126_0145105_627_1190 187
687 3300048929 Ga0496126_0270602 Ga0496126_0270602_769_1341 187
688 3300048929 Ga0496126_0282217 Ga0496126_0282217_547_1110 187
689 3300048929 Ga0496126_0392422 Ga0496126_0392422_339_902 187
690 3300048929 Ga0496126_0586039 Ga0496126_0586039_247_810 187
691 3300048929 Ga0496126_0673917 Ga0496126_0673917_28_645 187
692 3300049459 Ga0495678_003807 Ga0495678_003807_4771_5334 187
693 3300049459 Ga0495678_044841 Ga0495678_044841_1132_1695 187
694 3300049459 Ga0495678_075766 Ga0495678_075766_38_601 187
695 3300049460 Ga0495682_0021046 Ga0495682_0021046_1458_2021 187
696 3300049460 Ga0495682_0152973 Ga0495682_0152973_158_721 187
697 3300050490 nmdc:mga03n38_101664_c1 nmdc:mga03n38_101664_c1_126_689 187
698 3300050491 nmdc:mga00v17_115485_c1 nmdc:mga00v17_115485_c1_1069_1632 187
699 3300050491 nmdc:mga00v17_40488_c1 nmdc:mga00v17_40488_c1_810_1373 187
700 3300050492 nmdc:mga0yw44_28618_c1 nmdc:mga0yw44_28618_c1_929_1492 187
701 3300050492 nmdc:mga0yw44_36493_c1 nmdc:mga0yw44_36493_c1_94_657 187
702 3300050493 nmdc:mga0k408_113151_c1 nmdc:mga0k408_113151_c1_75_638 187
703 3300050493 nmdc:mga0k408_22463_c1 nmdc:mga0k408_22463_c1_1769_2335 187
704 3300050496 nmdc:mga07m45_65164_c1 nmdc:mga07m45_65164_c1_330_896 187
705 3300050513 nmdc:mga0rr50_131901_c1 nmdc:mga0rr50_131901_c1_432_995 187
706 3300050516 nmdc:mga0sz30_31622_c1 nmdc:mga0sz30_31622_c1_1317_1880 187
707 3300053077 Ga0495601_0488980 Ga0495601_0488980_93_656 187
708 3300053080 Ga0500635_0016922 Ga0500635_0016922_1355_1918 187
709 3300053083 Ga0495655_0053228 Ga0495655_0053228_245_808 187
710 3300053087 Ga0500643_018045 Ga0500643_018045_237_800 187
711 3300053087 Ga0500643_033600 Ga0500643_033600_562_1125 187
712 3300053088 Ga0500644_0003200 Ga0500644_0003200_2961_3524 187
713 3300053089 Ga0500581_146383 Ga0500581_146383_192_755 187
714 3300053090 Ga0500646_0135900 Ga0500646_0135900_154_717 187
715 3300053093 Ga0500651_0033217 Ga0500651_0033217_1547_2110 187
716 3300053093 Ga0500651_0061115 Ga0500651_0061115_697_1260 187
717 3300053093 Ga0500651_0153368 Ga0500651_0153368_40_615 187
718 3300053094 Ga0500566_0001318 Ga0500566_0001318_10240_10803 187
719 3300053094 Ga0500566_0343191 Ga0500566_0343191_41_604 187
720 3300053096 Ga0500641_0191287 Ga0500641_0191287_291_854 187
721 3300053096 Ga0500641_0215113 Ga0500641_0215113_232_795 187
722 3300053098 Ga0500650_0008263 Ga0500650_0008263_47_610 187
723 3300053102 Ga0500554_017032 Ga0500554_017032_967_1530 187
724 3300053104 Ga0500556_0000051 Ga0500556_0000051_28860_29423 187
725 3300053104 Ga0500556_0238817 Ga0500556_0238817_19_582 187
726 3300053108 Ga0500562_025797 Ga0500562_025797_345_908 187
727 3300053111 Ga0500572_000449 Ga0500572_000449_7978_8541 187
728 3300053116 Ga0500592_000572 Ga0500592_000572_5487_6050 187
729 3300053118 Ga0500594_0000962 Ga0500594_0000962_3417_3980 187
730 3300053119 Ga0500595_061296 Ga0500595_061296_370_933 187
731 3300053119 Ga0500595_072753 Ga0500595_072753_151_714 187
732 3300053121 Ga0500607_095778 Ga0500607_095778_677_1240 187
733 3300053122 Ga0500608_042483 Ga0500608_042483_1243_1806 187
734 3300053125 Ga0500618_002682 Ga0500618_002682_3205_3768 187
735 3300053130 Ga0500642_0000664 Ga0500642_0000664_6695_7258 187
736 3300053131 Ga0500652_001821 Ga0500652_001821_2913_3476 187
737 3300053134 Ga0500658_0113978 Ga0500658_0113978_25_588 187
738 3300053134 Ga0500658_0123021 Ga0500658_0123021_240_803 187
739 3300053136 Ga0500559_0000419 Ga0500559_0000419_28462_29025 187
740 3300053136 Ga0500559_0001169 Ga0500559_0001169_11963_12526 187
741 3300053136 Ga0500559_0003125 Ga0500559_0003125_1806_2369 187
742 3300053136 Ga0500559_0011464 Ga0500559_0011464_496_1089 187
743 3300053136 Ga0500559_0195161 Ga0500559_0195161_167_730 187
744 3300053139 Ga0500568_0001400 Ga0500568_0001400_7009_7572 187
745 3300053140 Ga0500573_0067037 Ga0500573_0067037_425_1018 187
746 3300053140 Ga0500573_0069121 Ga0500573_0069121_1251_1814 187
747 3300053142 Ga0500577_0179666 Ga0500577_0179666_191_754 187
748 3300053148 Ga0500590_067982 Ga0500590_067982_17_580 187
749 3300053150 Ga0500603_001245 Ga0500603_001245_264_827 187
750 3300053151 Ga0500604_0020872 Ga0500604_0020872_749_1312 187
751 3300053153 Ga0500616_0000150 Ga0500616_0000150_28684_29247 187
752 3300053156 Ga0500622_0000502 Ga0500622_0000502_963_1526 187
753 3300053156 Ga0500622_0024835 Ga0500622_0024835_1631_2194 187
754 3300053156 Ga0500622_0212599 Ga0500622_0212599_70_633 187
755 3300053158 Ga0500627_0020237 Ga0500627_0020237_802_1365 187
756 3300053158 Ga0500627_0199345 Ga0500627_0199345_130_693 187
757 3300053161 Ga0500634_0094947 Ga0500634_0094947_605_1168 187
758 3300053163 Ga0500639_069785 Ga0500639_069785_1074_1637 187
759 3300053177 Ga0500636_0144066 Ga0500636_0144066_631_1194 187
760 3300053178 Ga0500637_0179100 Ga0500637_0179100_414_977 187
761 3300053723 Ga0500567_179385 Ga0500567_179385_111_704 187
762 3300053725 Ga0500576_057673 Ga0500576_057673_351_914 187
763 3300053730 Ga0500645_027875 Ga0500645_027875_118_681 187
764 3300053735 Ga0500596_002222 Ga0500596_002222_2145_2708 187
765 3300053735 Ga0500596_006237 Ga0500596_006237_1035_1598 187
766 iso_pu_bacteria 2513237151 2513962097 187
767 iso_pu_bacteria 2738541298 2738833613 187
768 iso_pu_bacteria 2738541306 2738877020 187
769 iso_pu_bacteria 2738543002 2739186769 187
770 iso_pu_bacteria 2738543008 2739223613 187
771 iso_pu_bacteria 2842324504 2842325362 187
772 iso_pu_bacteria 2842348783 2842349641 187
773 iso_pu_bacteria 2842454564 2842455121 187
774 iso_pu_bacteria 2855730933 2855731746 187
775 iso_pu_bacteria 2855767633 2855768452 187
776 iso_pu_bacteria 2945934425 2945939427 187
777 iso_pu_bacteria 2990703756 2990706770 187
778 iso_pu_bacteria 641736151 642424689 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

9

55

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.9336 3 182
3on4-assembly4.cif.gz_F crystal structure of tetr transcriptional regulator from legionella pneumophila 0.9335 6 184
3bru-assembly1.cif.gz_B crystal structure of regulatory protein tetr from rhodobacter sphaeroides 0.8996 7 179
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.8954 3 182
3on4-assembly4.cif.gz_F crystal structure of tetr transcriptional regulator from legionella pneumophila 0.8951 6 184
ID Description Score Start End Superfamily
5ojxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9283 7 51 1.10.10.60
3on4C00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.928 6 184 1.10.357.10
4jykB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9277 5 51 1.10.10.60
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.927 3 51 1.10.10.60
4xk4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9266 5 51 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1H1JGP3-F1-model_v4 TetR/AcrR family transcriptional regulator, transcriptional repressor for nem operon 0.9948 56 187
AF-A0A239G2Q0-F1-model_v4 Transcriptional regulator, TetR family 0.9944 3 187 GO:0003677
GO:0006355
AF-A0A261UIG5-F1-model_v4 TetR family transcriptional regulator 0.9939 5 187 GO:0003677
GO:0006355
AF-A0A0N8QW18-F1-model_v4 Putative TetR family transcriptional regulator 0.993 6 187 GO:0003677
GO:0006355
AF-A0A3M5YFB9-F1-model_v4 deleted 0.9919 12 187

Feature Viewer

pLDDT pTM Quality
93.48 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map