F480432
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 778 | 450 | 655 | 187 |
Family's Representative Sequence
| Representative Sequence | 3300048928|Ga0496125_0000048|Ga0496125_0000048_66435_66995 |
| Length | 186 |
| Sequence | MSSNSKEAILAAAKRTAQAHGYGGLNFRDLAAEVGIKAASIYHHFPSKADLGAAVARRYWQDTAVTLETLAESQDPVGALRQYPDTFRRALANDNRMCLGSFMAAEYDDLPDAVKKEIQTFADVNVAWLGKVLSAAAIVSPHESERRARAIFAAIAGAQLIARSRSEISLYDAIIDSYRAAGLLPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 3 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 4 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 7 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 8 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 9 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 10 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 11 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 12 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 13 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 14 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 15 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 16 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 17 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 18 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 19 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 20 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 21 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 22 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 23 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 24 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 25 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 26 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 27 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 28 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 29 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 30 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 31 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 32 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 33 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 34 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 35 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 36 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 37 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 38 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 39 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 40 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 41 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 42 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 43 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 44 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 45 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 46 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 47 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 48 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 49 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 50 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 51 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 52 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 53 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 54 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 55 | 2906610324 | |||
| 56 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 57 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 58 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 59 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 60 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 61 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 62 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 63 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 64 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 65 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 66 | 2922368715 | |||
| 67 | 2922425934 | |||
| 68 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 69 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 70 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 71 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 72 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 73 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 74 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 75 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 76 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 77 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 78 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 79 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 80 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 81 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 82 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 83 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 84 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 85 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 86 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 87 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 88 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 89 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 90 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 91 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 92 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 93 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 94 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 95 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 96 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 97 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 98 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 99 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 100 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 101 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 102 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 103 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 104 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 105 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 106 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 107 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 108 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 109 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 110 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 111 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 112 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 113 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 114 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 115 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 116 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 117 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 118 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 119 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 120 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 121 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 122 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 123 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 124 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 127 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 128 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 129 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 135 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 136 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 137 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 142 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 143 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 145 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 146 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 149 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 150 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 151 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 153 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 154 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 155 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 156 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 157 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 158 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 159 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 160 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 161 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 162 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 163 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 165 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 166 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 167 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 168 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 169 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 170 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 171 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 172 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 173 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 174 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 175 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 176 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 177 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 179 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 180 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 181 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 204 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 206 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 207 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 209 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 210 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 211 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 213 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 251 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 258 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 259 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 260 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 261 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 262 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 263 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 264 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 265 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 266 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 267 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 268 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 269 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 270 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 271 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 273 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 274 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 275 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 276 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 277 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 278 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 279 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 281 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 282 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 283 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 284 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 285 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 286 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 287 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 288 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 289 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 290 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 291 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 292 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 356 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 357 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 358 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 359 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 360 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 362 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 363 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 364 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 365 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 366 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 367 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 368 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 369 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 370 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 371 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 372 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 373 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 374 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 375 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 379 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 380 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 381 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 382 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 383 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 384 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 385 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 391 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 393 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 395 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 396 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 397 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 398 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 399 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 400 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 401 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 402 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 403 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 404 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 405 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 406 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 407 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 408 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 409 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 410 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 411 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 413 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 414 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 416 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 417 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 418 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 419 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 420 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 421 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 422 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 423 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 424 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 425 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 427 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 428 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 430 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 431 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 432 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 433 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 434 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 435 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 436 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 437 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 438 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 439 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 440 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 441 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 442 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 443 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 444 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 445 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 446 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 447 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 448 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 449 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 450 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.39 |
| Metatranscriptomes | 0 |
| Isolates | 15.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.15 |
| Nodule | 9 |
| Rhizoplane | 3.98 |
| Rhizosphere | 52.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1002612 | 3300000532 | Bacteria | 1261 |
| 2 | JGI24740J21852_10000185 | 3300001979 | Bacteria | 25442 |
| 3 | JGI24750J21931_1019772 | 3300002070 | Bacteria | 935 |
| 4 | JGI24738J21930_10081733 | 3300002075 | Bacteria | 677 |
| 5 | JGI25162J39368_1001010 | 3300002737 | Bacteria | 17537 |
| 6 | JGI25151J46595_10002485 | 3300003187 | Bacteria | 11035 |
| 7 | JGI25165J46597_1000859 | 3300003214 | Bacteria | 21876 |
| 8 | JGI25153J46596_10005600 | 3300003215 | Bacteria | 6563 |
| 9 | rootH1_10010685 | 3300003316 | Bacteria | 13982 |
| 10 | rootH2_10045382 | 3300003320 | Bacteria | 2157 |
| 11 | rootH2_10070521 | 3300003320 | Bacteria | 4126 |
| 12 | rootL2_10261710 | 3300003322 | Bacteria | 2313 |
| 13 | rootH1_10194063 | 3300003316 | Bacteria | 1401 |
| 14 | rootH1_10194063 | 3300003323 | Bacteria | 3669 |
| 15 | JGI25404J52841_10013938 | 3300003659 | Bacteria | 1744 |
| 16 | JGI25404J52841_10051800 | 3300003659 | Bacteria | 862 |
| 17 | Ga0055543_1004255 | 3300004625 | Bacteria | 3945 |
| 18 | Ga0065165_1000348 | 3300005262 | Bacteria | 75762 |
| 19 | Ga0065704_10046873 | 3300005289 | Bacteria | 941 |
| 20 | Ga0070658_10504027 | 3300005327 | Bacteria | 1046 |
| 21 | Ga0070676_10210399 | 3300005328 | Bacteria | 1279 |
| 22 | Ga0070676_10469437 | 3300005328 | Bacteria | 888 |
| 23 | Ga0068869_100026570 | 3300005334 | Bacteria | 4031 |
| 24 | Ga0068869_100296448 | 3300005334 | Bacteria | 1304 |
| 25 | Ga0070682_100215532 | 3300005337 | Bacteria | 1363 |
| 26 | Ga0068868_100256349 | 3300005338 | Bacteria | 1474 |
| 27 | Ga0068868_100542414 | 3300005338 | Bacteria | 1024 |
| 28 | Ga0070668_100000040 | 3300005347 | Bacteria | 78926 |
| 29 | Ga0070668_100025164 | 3300005347 | Bacteria | 4512 |
| 30 | Ga0070668_100228753 | 3300005347 | Bacteria | 1536 |
| 31 | Ga0070668_100265228 | 3300005347 | Bacteria | 1429 |
| 32 | Ga0070668_100983418 | 3300005347 | Bacteria | 758 |
| 33 | Ga0070669_100051671 | 3300005353 | Bacteria | 3005 |
| 34 | Ga0070667_100169048 | 3300005367 | Bacteria | 1929 |
| 35 | Ga0070703_10068774 | 3300005406 | Bacteria | 1178 |
| 36 | Ga0070713_100462710 | 3300005436 | Bacteria | 1193 |
| 37 | Ga0070710_10080555 | 3300005437 | Bacteria | 1900 |
| 38 | Ga0070710_10257581 | 3300005437 | Bacteria | 1124 |
| 39 | Ga0070700_100450168 | 3300005441 | Bacteria | 979 |
| 40 | Ga0070694_100065348 | 3300005444 | Bacteria | 2492 |
| 41 | Ga0070708_100180727 | 3300005445 | Bacteria | 1971 |
| 42 | Ga0070708_100551004 | 3300005445 | Bacteria | 1088 |
| 43 | Ga0070663_100009159 | 3300005455 | Bacteria | 6121 |
| 44 | Ga0070663_100332693 | 3300005455 | Bacteria | 1225 |
| 45 | Ga0070663_100405593 | 3300005455 | Bacteria | 1115 |
| 46 | Ga0070663_100833585 | 3300005455 | Bacteria | 793 |
| 47 | Ga0070678_100400191 | 3300005456 | Bacteria | 1193 |
| 48 | Ga0070662_100017219 | 3300005457 | Bacteria | 4866 |
| 49 | Ga0070706_100827244 | 3300005467 | Bacteria | 857 |
| 50 | Ga0070698_100044970 | 3300005471 | Bacteria | 4519 |
| 51 | Ga0070698_100388034 | 3300005471 | Bacteria | 1329 |
| 52 | Ga0070699_100102003 | 3300005518 | Bacteria | 2515 |
| 53 | Ga0070699_101412914 | 3300005518 | Bacteria | 638 |
| 54 | Ga0070697_100337469 | 3300005536 | Bacteria | 1300 |
| 55 | Ga0068853_100156110 | 3300005539 | Bacteria | 2056 |
| 56 | Ga0070695_100154990 | 3300005545 | Bacteria | 1602 |
| 57 | Ga0070665_100017575 | 3300005548 | Bacteria | 7183 |
| 58 | Ga0070665_100104728 | 3300005548 | Bacteria | 2831 |
| 59 | Ga0070665_100182965 | 3300005548 | Bacteria | 2096 |
| 60 | Ga0070665_100375960 | 3300005548 | Bacteria | 1428 |
| 61 | Ga0070665_100615955 | 3300005548 | Bacteria | 1099 |
| 62 | Ga0070665_100684528 | 3300005548 | Bacteria | 1038 |
| 63 | Ga0070704_100847356 | 3300005549 | Bacteria | 819 |
| 64 | Ga0068855_100857911 | 3300005563 | Bacteria | 962 |
| 65 | Ga0068854_100007247 | 3300005578 | Bacteria | 7081 |
| 66 | Ga0070702_100633512 | 3300005615 | Bacteria | 806 |
| 67 | Ga0068859_100581242 | 3300005617 | Bacteria | 1214 |
| 68 | Ga0068864_100277428 | 3300005618 | Bacteria | 1563 |
| 69 | Ga0068861_100002291 | 3300005719 | Bacteria | 12423 |
| 70 | Ga0068861_100310887 | 3300005719 | Bacteria | 1369 |
| 71 | Ga0068851_10089596 | 3300005834 | Bacteria | 1618 |
| 72 | Ga0068863_100489143 | 3300005841 | Bacteria | 1211 |
| 73 | Ga0068863_100722852 | 3300005841 | Bacteria | 990 |
| 74 | Ga0068858_100190057 | 3300005842 | Bacteria | 1940 |
| 75 | Ga0068858_100291897 | 3300005842 | Bacteria | 1554 |
| 76 | Ga0068858_100672370 | 3300005842 | Bacteria | 1007 |
| 77 | Ga0068858_100934296 | 3300005842 | Bacteria | 849 |
| 78 | Ga0068860_100003537 | 3300005843 | Bacteria | 16076 |
| 79 | Ga0068860_100031244 | 3300005843 | Bacteria | 5120 |
| 80 | Ga0068860_100158759 | 3300005843 | Bacteria | 2180 |
| 81 | Ga0068860_100318861 | 3300005843 | Bacteria | 1525 |
| 82 | Ga0068862_100004744 | 3300005844 | Bacteria | 11445 |
| 83 | Ga0068862_100212740 | 3300005844 | Bacteria | 1747 |
| 84 | Ga0068862_100287239 | 3300005844 | Bacteria | 1509 |
| 85 | Ga0081455_10023701 | 3300005937 | Bacteria | 5705 |
| 86 | Ga0081455_10320913 | 3300005937 | Bacteria | 1103 |
| 87 | Ga0081538_10262926 | 3300005981 | Bacteria | 650 |
| 88 | Ga0081540_1005216 | 3300005983 | Bacteria | 9725 |
| 89 | Ga0081540_1012707 | 3300005983 | Bacteria | 5523 |
| 90 | Ga0081540_1031316 | 3300005983 | Bacteria | 2927 |
| 91 | Ga0070717_10129736 | 3300006028 | Bacteria | 2167 |
| 92 | Ga0075365_10007515 | 3300006038 | Bacteria | 6113 |
| 93 | Ga0075365_10048736 | 3300006038 | Bacteria | 2789 |
| 94 | Ga0075365_10090514 | 3300006038 | Bacteria | 2084 |
| 95 | Ga0075365_10310152 | 3300006038 | Bacteria | 1111 |
| 96 | Ga0075368_10066662 | 3300006042 | Bacteria | 1448 |
| 97 | Ga0075368_10242253 | 3300006042 | Bacteria | 769 |
| 98 | Ga0075363_100021331 | 3300006048 | Bacteria | 3260 |
| 99 | Ga0075363_100051292 | 3300006048 | Bacteria | 2200 |
| 100 | Ga0075363_100151138 | 3300006048 | Bacteria | 1311 |
| 101 | Ga0075364_10066575 | 3300006051 | Bacteria | 2367 |
| 102 | Ga0075364_10072682 | 3300006051 | Bacteria | 2267 |
| 103 | Ga0075364_10144985 | 3300006051 | Bacteria | 1598 |
| 104 | Ga0070716_100343659 | 3300006173 | Bacteria | 1054 |
| 105 | Ga0075362_10392728 | 3300006177 | Bacteria | 699 |
| 106 | Ga0075367_10003448 | 3300006178 | Bacteria | 7543 |
| 107 | Ga0075367_10032709 | 3300006178 | Bacteria | 2995 |
| 108 | Ga0075367_10034965 | 3300006178 | Bacteria | 2906 |
| 109 | Ga0075367_10039863 | 3300006178 | Bacteria | 2740 |
| 110 | Ga0075367_10058146 | 3300006178 | Bacteria | 2300 |
| 111 | Ga0075367_10267404 | 3300006178 | Bacteria | 1074 |
| 112 | Ga0075369_10031130 | 3300006186 | Bacteria | 2250 |
| 113 | Ga0075369_10042314 | 3300006186 | Bacteria | 1953 |
| 114 | Ga0075369_10162881 | 3300006186 | Bacteria | 1023 |
| 115 | Ga0075369_10171176 | 3300006186 | Bacteria | 997 |
| 116 | Ga0075366_10053418 | 3300006195 | Bacteria | 2400 |
| 117 | Ga0075366_10157443 | 3300006195 | Bacteria | 1376 |
| 118 | Ga0075366_10301778 | 3300006195 | Bacteria | 980 |
| 119 | Ga0075366_10464548 | 3300006195 | Bacteria | 781 |
| 120 | Ga0075370_10001527 | 3300006353 | Bacteria | 10125 |
| 121 | Ga0075370_10019581 | 3300006353 | Bacteria | 3687 |
| 122 | Ga0075370_10045356 | 3300006353 | Bacteria | 2486 |
| 123 | Ga0075370_10222315 | 3300006353 | Bacteria | 1116 |
| 124 | Ga0075370_10371661 | 3300006353 | Bacteria | 856 |
| 125 | Ga0068871_100460062 | 3300006358 | Bacteria | 1142 |
| 126 | Ga0075434_100559077 | 3300006871 | Bacteria | 1164 |
| 127 | Ga0075429_100331228 | 3300006880 | Bacteria | 1332 |
| 128 | Ga0097620_100581240 | 3300006931 | Bacteria | 1214 |
| 129 | Ga0079104_1013522 | 3300006946 | Bacteria | 2510 |
| 130 | Ga0075435_100113203 | 3300007076 | Bacteria | 2258 |
| 131 | Ga0099794_10240932 | 3300007265 | Bacteria | 932 |
| 132 | Ga0105250_10023700 | 3300009092 | Bacteria | 2474 |
| 133 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 134 | Ga0105240_10071482 | 3300009093 | Bacteria | 4291 |
| 135 | Ga0105240_10164364 | 3300009093 | Unclassified | 2633 |
| 136 | Ga0105240_10530618 | 3300009093 | Bacteria | 1305 |
| 137 | Ga0105240_10727697 | 3300009093 | Unclassified | 1081 |
| 138 | Ga0105245_10129685 | 3300009098 | Bacteria | 2364 |
| 139 | Ga0105247_10062157 | 3300009101 | Bacteria | 2316 |
| 140 | Ga0105243_10057116 | 3300009148 | Bacteria | 3107 |
| 141 | Ga0105243_10353845 | 3300009148 | Bacteria | 1349 |
| 142 | Ga0105242_10053124 | 3300009176 | Bacteria | 3308 |
| 143 | Ga0105248_10176684 | 3300009177 | Bacteria | 2406 |
| 144 | Ga0105237_10175319 | 3300009545 | Bacteria | 2144 |
| 145 | Ga0105237_11123137 | 3300009545 | Bacteria | 793 |
| 146 | Ga0105238_10039512 | 3300009551 | Bacteria | 4785 |
| 147 | Ga0105238_11194163 | 3300009551 | Bacteria | 785 |
| 148 | Ga0105249_10007823 | 3300009553 | Bacteria | 9308 |
| 149 | Ga0105249_10013279 | 3300009553 | Bacteria | 7269 |
| 150 | Ga0105249_10941670 | 3300009553 | Bacteria | 931 |
| 151 | Ga0105239_10002635 | 3300010375 | Bacteria | 22658 |
| 152 | Ga0105239_10252385 | 3300010375 | Bacteria | 1981 |
| 153 | Ga0105239_10393914 | 3300010375 | Bacteria | 1567 |
| 154 | Ga0105239_10808814 | 3300010375 | Bacteria | 1074 |
| 155 | Ga0157373_10085955 | 3300013100 | Bacteria | 2217 |
| 156 | Ga0157371_10000886 | 3300013102 | Bacteria | 33762 |
| 157 | Ga0157371_10015143 | 3300013102 | Bacteria | 5794 |
| 158 | Ga0157370_10000163 | 3300013104 | Bacteria | 81428 |
| 159 | Ga0157370_10079586 | 3300013104 | Bacteria | 3086 |
| 160 | Ga0157374_10706211 | 3300013296 | Bacteria | 1022 |
| 161 | Ga0163162_10197376 | 3300013306 | Bacteria | 2141 |
| 162 | Ga0163162_10242867 | 3300013306 | Bacteria | 1932 |
| 163 | Ga0163162_10812607 | 3300013306 | Bacteria | 1052 |
| 164 | Ga0163162_11065220 | 3300013306 | Bacteria | 915 |
| 165 | Ga0163162_12204189 | 3300013306 | Bacteria | 632 |
| 166 | Ga0157372_11212628 | 3300013307 | Bacteria | 872 |
| 167 | Ga0157375_10143699 | 3300013308 | Bacteria | 2515 |
| 168 | Ga0163163_10045357 | 3300014325 | Bacteria | 4314 |
| 169 | Ga0163163_10117904 | 3300014325 | Bacteria | 2687 |
| 170 | Ga0163163_10434424 | 3300014325 | Bacteria | 1372 |
| 171 | Ga0163163_10607101 | 3300014325 | Bacteria | 1157 |
| 172 | Ga0163163_10913881 | 3300014325 | Bacteria | 941 |
| 173 | Ga0163163_11605844 | 3300014325 | Bacteria | 711 |
| 174 | Ga0157380_10978068 | 3300014326 | Bacteria | 878 |
| 175 | Ga0157379_10000463 | 3300014968 | Bacteria | 32854 |
| 176 | Ga0157379_10132112 | 3300014968 | Bacteria | 2247 |
| 177 | Ga0157379_10136931 | 3300014968 | Bacteria | 2206 |
| 178 | Ga0157379_10248885 | 3300014968 | Bacteria | 1613 |
| 179 | Ga0157379_10677070 | 3300014968 | Bacteria | 967 |
| 180 | Ga0157376_10810964 | 3300014969 | Bacteria | 949 |
| 181 | Ga0182006_1000325 | 3300015261 | Bacteria | 41285 |
| 182 | Ga0182006_1005246 | 3300015261 | Bacteria | 6204 |
| 183 | Ga0182006_1079966 | 3300015261 | Bacteria | 1194 |
| 184 | Ga0163161_10719287 | 3300017792 | Bacteria | 833 |
| 185 | Ga0213872_10013768 | 3300021361 | Bacteria | 3785 |
| 186 | Ga0213872_10143244 | 3300021361 | Bacteria | 1048 |
| 187 | Ga0213872_10147560 | 3300021361 | Bacteria | 1029 |
| 188 | Ga0213871_10003957 | 3300021441 | Bacteria | 2916 |
| 189 | Ga0209437_100520 | 3300025233 | Bacteria | 26929 |
| 190 | Ga0207425_1002075 | 3300025245 | Bacteria | 7443 |
| 191 | Ga0209646_1018716 | 3300025246 | Bacteria | 1011 |
| 192 | Ga0209129_1000149 | 3300025258 | Bacteria | 114222 |
| 193 | Ga0209233_1000448 | 3300025261 | Bacteria | 27344 |
| 194 | Ga0209233_1001583 | 3300025261 | Bacteria | 8907 |
| 195 | Ga0209233_1032121 | 3300025261 | Bacteria | 1217 |
| 196 | Ga0209673_1028955 | 3300025273 | Bacteria | 1772 |
| 197 | Ga0209025_1000253 | 3300025294 | Bacteria | 125975 |
| 198 | Ga0209025_1005181 | 3300025294 | Bacteria | 10773 |
| 199 | Ga0209758_1000296 | 3300025297 | Bacteria | 97937 |
| 200 | Ga0207426_1000767 | 3300025302 | Bacteria | 35679 |
| 201 | Ga0207426_1035757 | 3300025302 | Bacteria | 1583 |
| 202 | Ga0207653_10126014 | 3300025885 | Bacteria | 926 |
| 203 | Ga0207692_10136495 | 3300025898 | Bacteria | 1391 |
| 204 | Ga0207710_10073930 | 3300025900 | Bacteria | 1568 |
| 205 | Ga0207710_10074422 | 3300025900 | Bacteria | 1564 |
| 206 | Ga0207688_10025455 | 3300025901 | Bacteria | 3249 |
| 207 | Ga0207680_10067951 | 3300025903 | Bacteria | 2197 |
| 208 | Ga0207699_10072454 | 3300025906 | Bacteria | 2110 |
| 209 | Ga0207645_10046340 | 3300025907 | Bacteria | 2777 |
| 210 | Ga0207645_10401672 | 3300025907 | Bacteria | 922 |
| 211 | Ga0207684_10722699 | 3300025910 | Bacteria | 845 |
| 212 | Ga0207684_11209884 | 3300025910 | Bacteria | 625 |
| 213 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 214 | Ga0207695_10000255 | 3300025913 | Bacteria | 136470 |
| 215 | Ga0207695_10031216 | 3300025913 | Bacteria | 5848 |
| 216 | Ga0207695_10667952 | 3300025913 | Bacteria | 920 |
| 217 | Ga0207671_10398186 | 3300025914 | Bacteria | 1095 |
| 218 | Ga0207671_10717469 | 3300025914 | Bacteria | 795 |
| 219 | Ga0207681_10087782 | 3300025923 | Bacteria | 2213 |
| 220 | Ga0207681_10501412 | 3300025923 | Bacteria | 994 |
| 221 | Ga0207694_10229501 | 3300025924 | Bacteria | 1516 |
| 222 | Ga0207687_10096509 | 3300025927 | Bacteria | 2167 |
| 223 | Ga0207700_10949727 | 3300025928 | Bacteria | 769 |
| 224 | Ga0207664_10881038 | 3300025929 | Bacteria | 804 |
| 225 | Ga0207644_10649673 | 3300025931 | Bacteria | 878 |
| 226 | Ga0207706_10014354 | 3300025933 | Bacteria | 7179 |
| 227 | Ga0207686_10064592 | 3300025934 | Bacteria | 2331 |
| 228 | Ga0207709_10060899 | 3300025935 | Bacteria | 2356 |
| 229 | Ga0207704_10271350 | 3300025938 | Bacteria | 1285 |
| 230 | Ga0207665_10440338 | 3300025939 | Bacteria | 998 |
| 231 | Ga0207665_10474842 | 3300025939 | Bacteria | 963 |
| 232 | Ga0207689_10028565 | 3300025942 | Bacteria | 4665 |
| 233 | Ga0207689_10300720 | 3300025942 | Bacteria | 1330 |
| 234 | Ga0207712_10001119 | 3300025961 | Bacteria | 18702 |
| 235 | Ga0207668_10000069 | 3300025972 | Bacteria | 79827 |
| 236 | Ga0207668_10007301 | 3300025972 | Bacteria | 6564 |
| 237 | Ga0207668_10072577 | 3300025972 | Bacteria | 2463 |
| 238 | Ga0207668_10085308 | 3300025972 | Bacteria | 2304 |
| 239 | Ga0207668_10649510 | 3300025972 | Bacteria | 923 |
| 240 | Ga0207640_10005170 | 3300025981 | Bacteria | 7097 |
| 241 | Ga0207658_10076616 | 3300025986 | Bacteria | 2548 |
| 242 | Ga0207677_10268382 | 3300026023 | Bacteria | 1395 |
| 243 | Ga0207703_10090596 | 3300026035 | Bacteria | 2570 |
| 244 | Ga0207703_10349211 | 3300026035 | Bacteria | 1361 |
| 245 | Ga0207703_10409369 | 3300026035 | Bacteria | 1260 |
| 246 | Ga0207639_10195095 | 3300026041 | Bacteria | 1732 |
| 247 | Ga0207678_10028180 | 3300026067 | Bacteria | 4905 |
| 248 | Ga0207678_10037078 | 3300026067 | Bacteria | 4243 |
| 249 | Ga0207678_10056853 | 3300026067 | Bacteria | 3367 |
| 250 | Ga0207678_10251711 | 3300026067 | Bacteria | 1513 |
| 251 | Ga0207678_10444755 | 3300026067 | Bacteria | 1126 |
| 252 | Ga0207708_10065735 | 3300026075 | Bacteria | 2772 |
| 253 | Ga0207641_10142877 | 3300026088 | Bacteria | 2162 |
| 254 | Ga0207641_10389304 | 3300026088 | Bacteria | 1337 |
| 255 | Ga0207641_10579926 | 3300026088 | Bacteria | 1096 |
| 256 | Ga0207675_100006110 | 3300026118 | Bacteria | 11454 |
| 257 | Ga0207683_10097621 | 3300026121 | Bacteria | 2620 |
| 258 | Ga0209281_1002866 | 3300027111 | Bacteria | 6287 |
| 259 | Ga0209281_1003385 | 3300027111 | Bacteria | 5311 |
| 260 | Ga0209371_1000010 | 3300027312 | Bacteria | 922021 |
| 261 | Ga0209371_1004276 | 3300027312 | Bacteria | 6331 |
| 262 | Ga0209371_1005576 | 3300027312 | Bacteria | 4954 |
| 263 | Ga0209371_1008358 | 3300027312 | Bacteria | 3455 |
| 264 | Ga0209588_1047811 | 3300027671 | Bacteria | 1384 |
| 265 | Ga0209813_10074769 | 3300027866 | Bacteria | 1108 |
| 266 | Ga0268266_10001335 | 3300028379 | Bacteria | 29884 |
| 267 | Ga0268266_10009274 | 3300028379 | Bacteria | 8681 |
| 268 | Ga0268266_10009532 | 3300028379 | Bacteria | 8546 |
| 269 | Ga0268266_10018709 | 3300028379 | Bacteria | 5902 |
| 270 | Ga0268266_10024160 | 3300028379 | Bacteria | 5171 |
| 271 | Ga0268266_10066202 | 3300028379 | Bacteria | 3124 |
| 272 | Ga0268266_10367076 | 3300028379 | Bacteria | 1355 |
| 273 | Ga0268266_10400714 | 3300028379 | Bacteria | 1297 |
| 274 | Ga0268266_10625634 | 3300028379 | Bacteria | 1035 |
| 275 | Ga0268266_11346711 | 3300028379 | Bacteria | 689 |
| 276 | Ga0268265_10085188 | 3300028380 | Bacteria | 2507 |
| 277 | Ga0268265_10160753 | 3300028380 | Bacteria | 1907 |
| 278 | Ga0268264_10002518 | 3300028381 | Bacteria | 16104 |
| 279 | Ga0268264_10008540 | 3300028381 | Bacteria | 8514 |
| 280 | Ga0307515_10158226 | 3300028794 | Bacteria | 2326 |
| 281 | Ga0307515_10218442 | 3300028794 | Bacteria | 1731 |
| 282 | Ga0268256_1000022 | 3300030500 | Bacteria | 531115 |
| 283 | Ga0268256_1004608 | 3300030500 | Bacteria | 5654 |
| 284 | Ga0268256_1008686 | 3300030500 | Bacteria | 3455 |
| 285 | Ga0268256_1019328 | 3300030500 | Bacteria | 1868 |
| 286 | Ga0307509_10282258 | 3300031507 | Bacteria | 1421 |
| 287 | Ga0307408_100030448 | 3300031548 | Bacteria | 3748 |
| 288 | Ga0307408_100058024 | 3300031548 | Bacteria | 2812 |
| 289 | Ga0307516_10557114 | 3300031730 | Bacteria | 800 |
| 290 | Ga0307405_10004925 | 3300031731 | Bacteria | 6376 |
| 291 | Ga0307405_10455421 | 3300031731 | Bacteria | 1015 |
| 292 | Ga0307412_10073294 | 3300031911 | Bacteria | 2342 |
| 293 | Ga0307409_100451144 | 3300031995 | Bacteria | 1241 |
| 294 | Ga0307414_10298339 | 3300032004 | Bacteria | 1362 |
| 295 | Ga0307411_10011984 | 3300032005 | Bacteria | 4707 |
| 296 | Ga0307411_10395823 | 3300032005 | Bacteria | 1140 |
| 297 | Ga0307510_10108943 | 3300033180 | Bacteria | 2521 |
| 298 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 299 | Ga0373943_0420299 | 3300035170 | Bacteria | 774 |
| 300 | Ga0373947_0452357 | 3300035725 | Bacteria | 870 |
| 301 | Ga0373937_1118987 | 3300036401 | Bacteria | 736 |
| 302 | Ga0395898_0476189 | 3300037466 | Bacteria | 1188 |
| 303 | Ga0395905_0057923 | 3300037471 | Bacteria | 3624 |
| 304 | Ga0436360_0279990 | 3300039438 | Bacteria | 1649 |
| 305 | Ga0436360_0280789 | 3300039438 | Bacteria | 2514 |
| 306 | Ga0436361_0039495 | 3300039447 | Bacteria | 4196 |
| 307 | Ga0436361_0052850 | 3300039447 | Bacteria | 2236 |
| 308 | Ga0436361_0514043 | 3300039447 | Bacteria | 7643 |
| 309 | Ga0436361_0547814 | 3300039447 | Bacteria | 4285 |
| 310 | Ga0436361_0655121 | 3300039447 | Bacteria | 1935 |
| 311 | Ga0436361_0898932 | 3300039447 | Bacteria | 1817 |
| 312 | Ga0436361_0945239 | 3300039447 | Bacteria | 3469 |
| 313 | Ga0436362_0568463 | 3300039453 | Bacteria | 2106 |
| 314 | Ga0439436_0023955 | 3300041404 | Bacteria | 1804 |
| 315 | Ga0439438_000005 | 3300041405 | Bacteria | 408610 |
| 316 | Ga0439438_000078 | 3300041405 | Bacteria | 45720 |
| 317 | Ga0451795_0539211 | 3300041456 | Bacteria | 1021 |
| 318 | Ga0439431_0072943 | 3300041997 | Bacteria | 917 |
| 319 | Ga0439432_002011 | 3300042006 | Bacteria | 7700 |
| 320 | Ga0439432_011116 | 3300042006 | Bacteria | 3103 |
| 321 | Ga0439463_042661 | 3300042016 | Bacteria | 1154 |
| 322 | Ga0450911_000010 | 3300042115 | Bacteria | 149605 |
| 323 | Ga0450911_000303 | 3300042115 | Bacteria | 17761 |
| 324 | Ga0450906_000007 | 3300042145 | Bacteria | 42541 |
| 325 | Ga0450909_000934 | 3300042185 | Bacteria | 3995 |
| 326 | Ga0439464_0008830 | 3300042439 | Bacteria | 2642 |
| 327 | Ga0466969_0097288 | 3300044656 | Bacteria | 1389 |
| 328 | Ga0466972_0000188 | 3300044658 | Bacteria | 47766 |
| 329 | Ga0466965_0075480 | 3300044683 | Bacteria | 1700 |
| 330 | Ga0466965_0162968 | 3300044683 | Bacteria | 1170 |
| 331 | Ga0466960_0215500 | 3300044901 | Bacteria | 1054 |
| 332 | Ga0466960_0337461 | 3300044901 | Bacteria | 857 |
| 333 | Ga0466959_0311202 | 3300045049 | Bacteria | 1078 |
| 334 | Ga0495617_000578 | 3300046452 | Bacteria | 18757 |
| 335 | Ga0495617_035376 | 3300046452 | Bacteria | 1677 |
| 336 | Ga0495627_001932 | 3300046453 | Bacteria | 10812 |
| 337 | Ga0495603_0102749 | 3300046455 | Bacteria | 1668 |
| 338 | Ga0495590_0026011 | 3300046457 | Bacteria | 2056 |
| 339 | Ga0495638_0000243 | 3300046460 | Bacteria | 74582 |
| 340 | Ga0495638_0008279 | 3300046460 | Bacteria | 7381 |
| 341 | Ga0495638_0018999 | 3300046460 | Bacteria | 4552 |
| 342 | Ga0495638_0053384 | 3300046460 | Bacteria | 2515 |
| 343 | Ga0495650_0001187 | 3300046471 | Bacteria | 27632 |
| 344 | Ga0495650_0014052 | 3300046471 | Bacteria | 4194 |
| 345 | Ga0495650_0084952 | 3300046471 | Bacteria | 1213 |
| 346 | Ga0495580_0040473 | 3300046472 | Bacteria | 3328 |
| 347 | Ga0495580_0231441 | 3300046472 | Bacteria | 1269 |
| 348 | Ga0495605_0000075 | 3300046474 | Bacteria | 128702 |
| 349 | Ga0495605_0073676 | 3300046474 | Bacteria | 1608 |
| 350 | Ga0495605_0177162 | 3300046474 | Bacteria | 939 |
| 351 | Ga0495639_0402873 | 3300046475 | Bacteria | 691 |
| 352 | Ga0495664_0416913 | 3300046477 | Bacteria | 806 |
| 353 | Ga0495584_0049656 | 3300046491 | Bacteria | 2114 |
| 354 | Ga0495584_0079696 | 3300046491 | Bacteria | 1647 |
| 355 | Ga0495584_0312910 | 3300046491 | Bacteria | 797 |
| 356 | Ga0495585_0126593 | 3300046492 | Bacteria | 1347 |
| 357 | Ga0495596_0016006 | 3300046500 | Bacteria | 3122 |
| 358 | Ga0495596_0167561 | 3300046500 | Bacteria | 854 |
| 359 | Ga0495607_0060347 | 3300046501 | Bacteria | 2159 |
| 360 | Ga0495607_0132371 | 3300046501 | Bacteria | 1296 |
| 361 | Ga0495607_0189024 | 3300046501 | Bacteria | 1027 |
| 362 | Ga0495583_0182629 | 3300046506 | Bacteria | 858 |
| 363 | Ga0495606_0000022 | 3300046507 | Bacteria | 265567 |
| 364 | Ga0495606_0002482 | 3300046507 | Bacteria | 21346 |
| 365 | Ga0495606_0120738 | 3300046507 | Bacteria | 1569 |
| 366 | Ga0495606_0155367 | 3300046507 | Bacteria | 1339 |
| 367 | Ga0495606_0238215 | 3300046507 | Bacteria | 1016 |
| 368 | Ga0495606_0253277 | 3300046507 | Bacteria | 975 |
| 369 | Ga0495610_0003586 | 3300046512 | Bacteria | 11993 |
| 370 | Ga0495610_0012519 | 3300046512 | Bacteria | 5100 |
| 371 | Ga0495610_0076624 | 3300046512 | Bacteria | 1546 |
| 372 | Ga0495616_0023423 | 3300046513 | Bacteria | 3321 |
| 373 | Ga0495616_0055616 | 3300046513 | Bacteria | 1958 |
| 374 | Ga0495620_0003203 | 3300046515 | Bacteria | 9393 |
| 375 | Ga0495620_0010672 | 3300046515 | Bacteria | 4836 |
| 376 | Ga0495620_0036657 | 3300046515 | Bacteria | 2192 |
| 377 | Ga0495620_0214246 | 3300046515 | Bacteria | 738 |
| 378 | Ga0495631_0082130 | 3300046518 | Bacteria | 1389 |
| 379 | Ga0495632_0000011 | 3300046519 | Bacteria | 266804 |
| 380 | Ga0495632_0049500 | 3300046519 | Bacteria | 2077 |
| 381 | Ga0495632_0292667 | 3300046519 | Bacteria | 723 |
| 382 | Ga0495637_0003672 | 3300046520 | Bacteria | 8126 |
| 383 | Ga0495637_0241876 | 3300046520 | Bacteria | 652 |
| 384 | Ga0495643_0005027 | 3300046522 | Bacteria | 9058 |
| 385 | Ga0495643_0011673 | 3300046522 | Bacteria | 5336 |
| 386 | Ga0495644_0096312 | 3300046523 | Bacteria | 1118 |
| 387 | Ga0495648_0003954 | 3300046524 | Bacteria | 12828 |
| 388 | Ga0495648_0009452 | 3300046524 | Bacteria | 7553 |
| 389 | Ga0495648_0189133 | 3300046524 | Bacteria | 1040 |
| 390 | Ga0495648_0316920 | 3300046524 | Bacteria | 724 |
| 391 | Ga0495663_0020815 | 3300046525 | Bacteria | 1885 |
| 392 | Ga0495642_0219007 | 3300046528 | Bacteria | 831 |
| 393 | Ga0495652_0457948 | 3300046529 | Bacteria | 892 |
| 394 | Ga0495654_0088139 | 3300046530 | Bacteria | 1443 |
| 395 | Ga0495665_0223925 | 3300046531 | Bacteria | 972 |
| 396 | Ga0495598_0007307 | 3300046537 | Bacteria | 2530 |
| 397 | Ga0495609_0073627 | 3300046538 | Bacteria | 1498 |
| 398 | Ga0495609_0102447 | 3300046538 | Bacteria | 1240 |
| 399 | Ga0495622_0146191 | 3300046557 | Bacteria | 1071 |
| 400 | Ga0495633_0071738 | 3300046558 | Bacteria | 1615 |
| 401 | Ga0495656_0156195 | 3300046615 | Bacteria | 1105 |
| 402 | Ga0495668_0064177 | 3300046616 | Bacteria | 2022 |
| 403 | Ga0495668_0115717 | 3300046616 | Bacteria | 1466 |
| 404 | Ga0495668_0207589 | 3300046616 | Bacteria | 1072 |
| 405 | Ga0495611_0235320 | 3300046648 | Bacteria | 850 |
| 406 | Ga0495625_0030706 | 3300046660 | Bacteria | 4005 |
| 407 | Ga0495625_0052875 | 3300046660 | Bacteria | 2907 |
| 408 | Ga0495625_0159985 | 3300046660 | Bacteria | 1509 |
| 409 | Ga0495659_0009432 | 3300046664 | Bacteria | 3114 |
| 410 | Ga0495661_0053688 | 3300046665 | Bacteria | 2422 |
| 411 | Ga0495661_0189771 | 3300046665 | Bacteria | 1083 |
| 412 | Ga0495661_0195803 | 3300046665 | Bacteria | 1061 |
| 413 | Ga0495588_0047545 | 3300046674 | Bacteria | 2203 |
| 414 | Ga0495588_0106559 | 3300046674 | Bacteria | 1475 |
| 415 | Ga0495599_0339471 | 3300046678 | Bacteria | 902 |
| 416 | Ga0495647_0372286 | 3300046681 | Bacteria | 653 |
| 417 | Ga0495669_0040598 | 3300046684 | Bacteria | 2064 |
| 418 | Ga0495669_0100765 | 3300046684 | Unclassified | 1341 |
| 419 | Ga0495670_0000834 | 3300046691 | Bacteria | 14896 |
| 420 | Ga0495670_0022215 | 3300046691 | Bacteria | 3132 |
| 421 | Ga0495671_0074906 | 3300046692 | Bacteria | 1660 |
| 422 | Ga0495671_0101886 | 3300046692 | Bacteria | 1403 |
| 423 | Ga0495671_0181955 | 3300046692 | Bacteria | 1021 |
| 424 | Ga0495649_0119640 | 3300046694 | Bacteria | 1393 |
| 425 | Ga0495649_0305387 | 3300046694 | Bacteria | 809 |
| 426 | Ga0495589_0051993 | 3300046794 | Bacteria | 2024 |
| 427 | Ga0495589_0137409 | 3300046794 | Bacteria | 1172 |
| 428 | Ga0495660_0288861 | 3300046810 | Bacteria | 747 |
| 429 | Ga0495636_0067731 | 3300047318 | Bacteria | 1519 |
| 430 | Ga0495674_0719201 | 3300047319 | Bacteria | 782 |
| 431 | Ga0495672_0000080 | 3300047320 | Bacteria | 160361 |
| 432 | Ga0495672_0002721 | 3300047320 | Bacteria | 15870 |
| 433 | Ga0495672_0038383 | 3300047320 | Bacteria | 2921 |
| 434 | Ga0495672_0218420 | 3300047320 | Bacteria | 942 |
| 435 | Ga0495676_0082345 | 3300047321 | Bacteria | 2436 |
| 436 | Ga0495683_0056437 | 3300047323 | Bacteria | 1954 |
| 437 | Ga0495683_0064255 | 3300047323 | Bacteria | 1812 |
| 438 | Ga0495677_0024699 | 3300047445 | Bacteria | 2180 |
| 439 | Ga0495685_069775 | 3300047447 | Bacteria | 1178 |
| 440 | Ga0495673_0013372 | 3300047469 | Bacteria | 4314 |
| 441 | Ga0495673_0070201 | 3300047469 | Bacteria | 1476 |
| 442 | Ga0495673_0070236 | 3300047469 | Bacteria | 1475 |
| 443 | Ga0495681_0000066 | 3300047470 | Bacteria | 97917 |
| 444 | Ga0495681_0003582 | 3300047470 | Bacteria | 10812 |
| 445 | Ga0495686_0008665 | 3300047472 | Bacteria | 7429 |
| 446 | Ga0495686_0045797 | 3300047472 | Bacteria | 2767 |
| 447 | Ga0495686_0103696 | 3300047472 | Bacteria | 1713 |
| 448 | Ga0495686_0121966 | 3300047472 | Bacteria | 1552 |
| 449 | Ga0495686_0136702 | 3300047472 | Bacteria | 1449 |
| 450 | Ga0495686_0163953 | 3300047472 | Bacteria | 1297 |
| 451 | Ga0495686_0390127 | 3300047472 | Bacteria | 749 |
| 452 | Ga0495686_0442190 | 3300047472 | Bacteria | 692 |
| 453 | Ga0495614_0407530 | 3300048089 | Bacteria | 639 |
| 454 | Ga0495626_0054350 | 3300048091 | Bacteria | 1839 |
| 455 | Ga0495626_0104352 | 3300048091 | Bacteria | 1233 |
| 456 | Ga0496100_0443824 | 3300048903 | Bacteria | 994 |
| 457 | Ga0496100_0549187 | 3300048903 | Bacteria | 894 |
| 458 | Ga0496100_0876342 | 3300048903 | Bacteria | 705 |
| 459 | Ga0496101_0091277 | 3300048904 | Bacteria | 2267 |
| 460 | Ga0496101_0278362 | 3300048904 | Bacteria | 1307 |
| 461 | Ga0496102_0155229 | 3300048905 | Bacteria | 2152 |
| 462 | Ga0496102_0191223 | 3300048905 | Bacteria | 1929 |
| 463 | Ga0496102_0203360 | 3300048905 | Bacteria | 1867 |
| 464 | Ga0496102_0295618 | 3300048905 | Bacteria | 1526 |
| 465 | Ga0496102_0390656 | 3300048905 | Bacteria | 1309 |
| 466 | Ga0496104_0162723 | 3300048907 | Bacteria | 2140 |
| 467 | Ga0496104_0254557 | 3300048907 | Bacteria | 1669 |
| 468 | Ga0496104_0974340 | 3300048907 | Bacteria | 752 |
| 469 | Ga0496105_0003062 | 3300048908 | Bacteria | 12291 |
| 470 | Ga0496106_0042367 | 3300048909 | Bacteria | 3415 |
| 471 | Ga0496107_0084437 | 3300048910 | Bacteria | 2317 |
| 472 | Ga0496107_0235246 | 3300048910 | Bacteria | 1363 |
| 473 | Ga0496107_0394822 | 3300048910 | Bacteria | 1029 |
| 474 | Ga0496109_0849599 | 3300048912 | Bacteria | 851 |
| 475 | Ga0496111_0032134 | 3300048914 | Bacteria | 3742 |
| 476 | Ga0496111_0362209 | 3300048914 | Bacteria | 1073 |
| 477 | Ga0496112_0632427 | 3300048915 | Bacteria | 1001 |
| 478 | Ga0496115_0384279 | 3300048918 | Bacteria | 1141 |
| 479 | Ga0496116_0049501 | 3300048919 | Bacteria | 2810 |
| 480 | Ga0496116_0167024 | 3300048919 | Bacteria | 1198 |
| 481 | Ga0496116_0279246 | 3300048919 | Bacteria | 810 |
| 482 | Ga0496117_0038825 | 3300048920 | Bacteria | 3523 |
| 483 | Ga0496117_0099538 | 3300048920 | Bacteria | 1844 |
| 484 | Ga0496117_0101806 | 3300048920 | Bacteria | 1814 |
| 485 | Ga0496117_0150340 | 3300048920 | Bacteria | 1379 |
| 486 | Ga0496117_0157755 | 3300048920 | Bacteria | 1333 |
| 487 | Ga0496118_0003441 | 3300048921 | Bacteria | 19922 |
| 488 | Ga0496118_0009983 | 3300048921 | Bacteria | 9480 |
| 489 | Ga0496118_0021067 | 3300048921 | Bacteria | 5754 |
| 490 | Ga0496118_0026046 | 3300048921 | Bacteria | 4995 |
| 491 | Ga0496118_0033001 | 3300048921 | Bacteria | 4256 |
| 492 | Ga0496118_0047460 | 3300048921 | Bacteria | 3327 |
| 493 | Ga0496118_0158127 | 3300048921 | Bacteria | 1406 |
| 494 | Ga0496118_0196842 | 3300048921 | Bacteria | 1198 |
| 495 | Ga0496119_0006183 | 3300048922 | Bacteria | 11197 |
| 496 | Ga0496119_0036268 | 3300048922 | Bacteria | 3221 |
| 497 | Ga0496119_0090504 | 3300048922 | Bacteria | 1740 |
| 498 | Ga0496120_0009481 | 3300048923 | Bacteria | 6900 |
| 499 | Ga0496120_0018241 | 3300048923 | Bacteria | 4529 |
| 500 | Ga0496120_0204021 | 3300048923 | Bacteria | 955 |
| 501 | Ga0496121_0001562 | 3300048924 | Bacteria | 38246 |
| 502 | Ga0496121_0008832 | 3300048924 | Bacteria | 11736 |
| 503 | Ga0496121_0010656 | 3300048924 | Bacteria | 10321 |
| 504 | Ga0496121_0013587 | 3300048924 | Bacteria | 8731 |
| 505 | Ga0496121_0050570 | 3300048924 | Bacteria | 3509 |
| 506 | Ga0496121_0050848 | 3300048924 | Bacteria | 3496 |
| 507 | Ga0496121_0087101 | 3300048924 | Bacteria | 2452 |
| 508 | Ga0496121_0302150 | 3300048924 | Bacteria | 1085 |
| 509 | Ga0496121_0352399 | 3300048924 | Bacteria | 980 |
| 510 | Ga0496122_0000595 | 3300048925 | Bacteria | 74359 |
| 511 | Ga0496122_0000921 | 3300048925 | Bacteria | 53852 |
| 512 | Ga0496122_0011498 | 3300048925 | Bacteria | 8953 |
| 513 | Ga0496122_0028570 | 3300048925 | Bacteria | 4727 |
| 514 | Ga0496122_0101532 | 3300048925 | Bacteria | 1921 |
| 515 | Ga0496123_0000211 | 3300048926 | Bacteria | 118697 |
| 516 | Ga0496123_0001350 | 3300048926 | Bacteria | 34582 |
| 517 | Ga0496123_0009407 | 3300048926 | Bacteria | 8803 |
| 518 | Ga0496123_0027629 | 3300048926 | Bacteria | 4222 |
| 519 | Ga0496123_0031362 | 3300048926 | Bacteria | 3869 |
| 520 | Ga0496123_0116209 | 3300048926 | Bacteria | 1516 |
| 521 | Ga0496124_0002131 | 3300048927 | Bacteria | 26592 |
| 522 | Ga0496124_0003192 | 3300048927 | Bacteria | 20247 |
| 523 | Ga0496124_0015638 | 3300048927 | Bacteria | 7263 |
| 524 | Ga0496124_0026577 | 3300048927 | Bacteria | 5216 |
| 525 | Ga0496124_0050524 | 3300048927 | Bacteria | 3543 |
| 526 | Ga0496125_0000048 | 3300048928 | Bacteria | 290651 |
| 527 | Ga0496125_0000664 | 3300048928 | Bacteria | 57244 |
| 528 | Ga0496125_0002221 | 3300048928 | Bacteria | 25866 |
| 529 | Ga0496125_0020534 | 3300048928 | Bacteria | 6197 |
| 530 | Ga0496125_0026608 | 3300048928 | Bacteria | 5265 |
| 531 | Ga0496125_0035798 | 3300048928 | Bacteria | 4347 |
| 532 | Ga0496125_0047908 | 3300048928 | Bacteria | 3568 |
| 533 | Ga0496126_0002646 | 3300048929 | Bacteria | 23750 |
| 534 | Ga0496126_0044439 | 3300048929 | Bacteria | 4091 |
| 535 | Ga0496126_0068420 | 3300048929 | Bacteria | 3170 |
| 536 | Ga0496126_0087169 | 3300048929 | Bacteria | 2750 |
| 537 | Ga0496126_0111998 | 3300048929 | Bacteria | 2376 |
| 538 | Ga0496126_0113939 | 3300048929 | Bacteria | 2353 |
| 539 | Ga0496126_0145105 | 3300048929 | Bacteria | 2039 |
| 540 | Ga0496126_0231202 | 3300048929 | Bacteria | 1549 |
| 541 | Ga0496126_0270602 | 3300048929 | Bacteria | 1410 |
| 542 | Ga0496126_0282217 | 3300048929 | Bacteria | 1375 |
| 543 | Ga0496126_0392422 | 3300048929 | Bacteria | 1127 |
| 544 | Ga0496126_0586039 | 3300048929 | Bacteria | 880 |
| 545 | Ga0496126_0673917 | 3300048929 | Bacteria | 806 |
| 546 | Ga0496126_0714445 | 3300048929 | Bacteria | 777 |
| 547 | Ga0495678_003807 | 3300049459 | Bacteria | 9098 |
| 548 | Ga0495678_044841 | 3300049459 | Bacteria | 1747 |
| 549 | Ga0495678_075766 | 3300049459 | Bacteria | 1221 |
| 550 | Ga0495682_0021046 | 3300049460 | Bacteria | 2446 |
| 551 | Ga0495682_0152973 | 3300049460 | Bacteria | 822 |
| 552 | Ga0501033_0004237 | 3300049570 | Bacteria | 11539 |
| 553 | Ga0501241_000061 | 3300049758 | Bacteria | 27062 |
| 554 | nmdc:mga03n38_101664_c1 | 3300050490 | Bacteria | 1387 |
| 555 | nmdc:mga03n38_18757_c1 | 3300050490 | Bacteria | 2736 |
| 556 | nmdc:mga00v17_115485_c1 | 3300050491 | Bacteria | 1706 |
| 557 | nmdc:mga00v17_40488_c1 | 3300050491 | Bacteria | 2795 |
| 558 | nmdc:mga0yw44_19694_c1 | 3300050492 | Bacteria | 3726 |
| 559 | nmdc:mga0yw44_28618_c1 | 3300050492 | Bacteria | 3208 |
| 560 | nmdc:mga0yw44_36493_c1 | 3300050492 | Bacteria | 2896 |
| 561 | nmdc:mga0yw44_58229_c1 | 3300050492 | Bacteria | 2360 |
| 562 | nmdc:mga0yw44_6844_c1 | 3300050492 | Bacteria | 5546 |
| 563 | nmdc:mga0yw44_77371_c1 | 3300050492 | Bacteria | 2078 |
| 564 | nmdc:mga0k408_108982_c1 | 3300050493 | Bacteria | 1636 |
| 565 | nmdc:mga0k408_113151_c1 | 3300050493 | Bacteria | 1605 |
| 566 | nmdc:mga0k408_202477_c1 | 3300050493 | Bacteria | 1185 |
| 567 | nmdc:mga0k408_22463_c1 | 3300050493 | Bacteria | 3552 |
| 568 | nmdc:mga06z11_19457_c1 | 3300050494 | Bacteria | 3122 |
| 569 | nmdc:mga06z11_34575_c1 | 3300050494 | Bacteria | 2482 |
| 570 | nmdc:mga06z11_39608_c1 | 3300050494 | Bacteria | 2346 |
| 571 | nmdc:mga04h51_141456_c1 | 3300050495 | Bacteria | 913 |
| 572 | nmdc:mga07m45_180639_c2 | 3300050496 | Bacteria | 836 |
| 573 | nmdc:mga07m45_55699_c1 | 3300050496 | Bacteria | 2235 |
| 574 | nmdc:mga07m45_65164_c1 | 3300050496 | Bacteria | 2068 |
| 575 | nmdc:mga09592_298021_c1 | 3300050508 | Bacteria | 1398 |
| 576 | nmdc:mga0rr50_131901_c1 | 3300050513 | Bacteria | 2001 |
| 577 | nmdc:mga0sz30_31622_c1 | 3300050516 | Bacteria | 2191 |
| 578 | nmdc:mga0sz30_86867_c1 | 3300050516 | Bacteria | 1358 |
| 579 | Ga0495601_0488980 | 3300053077 | Bacteria | 795 |
| 580 | Ga0500635_0016922 | 3300053080 | Bacteria | 2176 |
| 581 | Ga0495655_0053228 | 3300053083 | Bacteria | 1079 |
| 582 | Ga0500643_000013 | 3300053087 | Bacteria | 324296 |
| 583 | Ga0500643_018045 | 3300053087 | Bacteria | 2350 |
| 584 | Ga0500643_033600 | 3300053087 | Bacteria | 1549 |
| 585 | Ga0500644_0003200 | 3300053088 | Bacteria | 4055 |
| 586 | Ga0500581_146383 | 3300053089 | Bacteria | 1113 |
| 587 | Ga0500646_0013751 | 3300053090 | Bacteria | 2097 |
| 588 | Ga0500646_0135900 | 3300053090 | Bacteria | 803 |
| 589 | Ga0500583_0136125 | 3300053092 | Bacteria | 1219 |
| 590 | Ga0500651_0033217 | 3300053093 | Bacteria | 3254 |
| 591 | Ga0500651_0061115 | 3300053093 | Bacteria | 2354 |
| 592 | Ga0500651_0153368 | 3300053093 | Bacteria | 1382 |
| 593 | Ga0500566_0001318 | 3300053094 | Bacteria | 14480 |
| 594 | Ga0500566_0343191 | 3300053094 | Bacteria | 687 |
| 595 | Ga0500641_0074685 | 3300053096 | Bacteria | 1432 |
| 596 | Ga0500641_0191287 | 3300053096 | Bacteria | 876 |
| 597 | Ga0500641_0215113 | 3300053096 | Bacteria | 816 |
| 598 | Ga0500650_0008263 | 3300053098 | Bacteria | 4104 |
| 599 | Ga0500554_017032 | 3300053102 | Bacteria | 1934 |
| 600 | Ga0500555_001497 | 3300053103 | Bacteria | 7094 |
| 601 | Ga0500556_0000051 | 3300053104 | Bacteria | 119031 |
| 602 | Ga0500556_0238817 | 3300053104 | Bacteria | 716 |
| 603 | Ga0500562_025797 | 3300053108 | Bacteria | 1539 |
| 604 | Ga0500572_000449 | 3300053111 | Bacteria | 14311 |
| 605 | Ga0500592_000572 | 3300053116 | Bacteria | 6094 |
| 606 | Ga0500594_0000962 | 3300053118 | Bacteria | 6189 |
| 607 | Ga0500595_061296 | 3300053119 | Bacteria | 1135 |
| 608 | Ga0500595_072753 | 3300053119 | Bacteria | 1017 |
| 609 | Ga0500607_095778 | 3300053121 | Bacteria | 1484 |
| 610 | Ga0500608_042483 | 3300053122 | Bacteria | 2181 |
| 611 | Ga0500618_002682 | 3300053125 | Bacteria | 6508 |
| 612 | Ga0500618_006698 | 3300053125 | Bacteria | 3355 |
| 613 | Ga0500642_0000664 | 3300053130 | Bacteria | 10178 |
| 614 | Ga0500642_0028091 | 3300053130 | Bacteria | 2316 |
| 615 | Ga0500652_001821 | 3300053131 | Bacteria | 6456 |
| 616 | Ga0500652_207787 | 3300053131 | Bacteria | 792 |
| 617 | Ga0500658_0113978 | 3300053134 | Bacteria | 1192 |
| 618 | Ga0500658_0123021 | 3300053134 | Bacteria | 1152 |
| 619 | Ga0500559_0000419 | 3300053136 | Bacteria | 30438 |
| 620 | Ga0500559_0001169 | 3300053136 | Bacteria | 15735 |
| 621 | Ga0500559_0003125 | 3300053136 | Bacteria | 8237 |
| 622 | Ga0500559_0011464 | 3300053136 | Bacteria | 3785 |
| 623 | Ga0500559_0195161 | 3300053136 | Bacteria | 954 |
| 624 | Ga0500568_0001400 | 3300053139 | Bacteria | 15647 |
| 625 | Ga0500568_0008131 | 3300053139 | Bacteria | 5085 |
| 626 | Ga0500573_0067037 | 3300053140 | Bacteria | 2051 |
| 627 | Ga0500573_0069121 | 3300053140 | Bacteria | 2016 |
| 628 | Ga0500577_0001891 | 3300053142 | Bacteria | 5370 |
| 629 | Ga0500577_0088159 | 3300053142 | Bacteria | 1249 |
| 630 | Ga0500577_0179666 | 3300053142 | Bacteria | 908 |
| 631 | Ga0500589_121689 | 3300053147 | Bacteria | 1104 |
| 632 | Ga0500590_067982 | 3300053148 | Bacteria | 1776 |
| 633 | Ga0500603_001245 | 3300053150 | Bacteria | 5907 |
| 634 | Ga0500604_0020872 | 3300053151 | Bacteria | 1847 |
| 635 | Ga0500604_0022533 | 3300053151 | Bacteria | 1789 |
| 636 | Ga0500616_0000150 | 3300053153 | Bacteria | 117918 |
| 637 | Ga0500622_0000502 | 3300053156 | Bacteria | 36464 |
| 638 | Ga0500622_0024835 | 3300053156 | Bacteria | 3169 |
| 639 | Ga0500622_0212599 | 3300053156 | Bacteria | 872 |
| 640 | Ga0500627_0020237 | 3300053158 | Bacteria | 2665 |
| 641 | Ga0500627_0020612 | 3300053158 | Bacteria | 2646 |
| 642 | Ga0500627_0199345 | 3300053158 | Bacteria | 897 |
| 643 | Ga0500634_0094947 | 3300053161 | Bacteria | 1505 |
| 644 | Ga0500634_0128166 | 3300053161 | Bacteria | 1223 |
| 645 | Ga0500639_069785 | 3300053163 | Bacteria | 1793 |
| 646 | Ga0500636_0144066 | 3300053177 | Bacteria | 1315 |
| 647 | Ga0500637_0179100 | 3300053178 | Bacteria | 1215 |
| 648 | Ga0500567_179385 | 3300053723 | Bacteria | 742 |
| 649 | Ga0500576_057673 | 3300053725 | Bacteria | 1706 |
| 650 | Ga0500645_017908 | 3300053730 | Bacteria | 2217 |
| 651 | Ga0500645_027875 | 3300053730 | Bacteria | 1711 |
| 652 | Ga0500596_002222 | 3300053735 | Bacteria | 3850 |
| 653 | Ga0500596_006237 | 3300053735 | Bacteria | 2034 |
| 654 | Ga0500587_009354 | 3300053739 | Bacteria | 1252 |
| 655 | Ga0500661_001224 | 3300055283 | Bacteria | 4799 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046692 | Ga0495671_0181955 | Ga0495671_0181955_109_729 | 176 |
| 2 | 3300047320 | Ga0495672_0002721 | Ga0495672_0002721_5204_5824 | 176 |
| 3 | 3300047469 | Ga0495673_0070201 | Ga0495673_0070201_166_786 | 176 |
| 4 | 3300006186 | Ga0075369_10031130 | Ga0075369_100311303 | 178 |
| 5 | 3300025261 | Ga0209233_1001583 | Ga0209233_10015838 | 178 |
| 6 | 3300025273 | Ga0209673_1028955 | Ga0209673_10289552 | 178 |
| 7 | 3300025942 | Ga0207689_10300720 | Ga0207689_103007201 | 178 |
| 8 | 3300046472 | Ga0495580_0040473 | Ga0495580_0040473_500_1075 | 178 |
| 9 | 3300049570 | Ga0501033_0004237 | Ga0501033_0004237_2100_2636 | 178 |
| 10 | 3300050516 | nmdc:mga0sz30_86867_c1 | nmdc:mga0sz30_86867_c1_26_562 | 178 |
| 11 | 3300053142 | Ga0500577_0001891 | Ga0500577_0001891_4322_4885 | 181 |
| 12 | iso_pu_bacteria | 2511231028 | 2511396688 | 181 |
| 13 | iso_pu_bacteria | 2511231028 | 2511397671 | 182 |
| 14 | iso_pu_bacteria | 2824661429 | 2824669009 | 182 |
| 15 | iso_pu_bacteria | 2879099564 | 2879106768 | 182 |
| 16 | iso_pu_bacteria | 2922368715 | 2922369071 | 182 |
| 17 | iso_pu_bacteria | 2929615660 | 2929618940 | 182 |
| 18 | iso_pu_bacteria | 2929624759 | 2929631017 | 182 |
| 19 | iso_pu_bacteria | 2932784394 | 2932788981 | 182 |
| 20 | iso_pu_bacteria | 2932809354 | 2932814380 | 182 |
| 21 | iso_pu_bacteria | 2932818245 | 2932820506 | 182 |
| 22 | iso_pu_bacteria | 2932828146 | 2932834540 | 182 |
| 23 | iso_pu_bacteria | 2933577622 | 2933580350 | 182 |
| 24 | iso_pu_bacteria | 2935616580 | 2935624522 | 182 |
| 25 | iso_pu_bacteria | 2935638405 | 2935645912 | 182 |
| 26 | iso_pu_bacteria | 2935665750 | 2935673479 | 182 |
| 27 | iso_pu_bacteria | 2935675223 | 2935682656 | 182 |
| 28 | iso_pu_bacteria | 2935684952 | 2935686730 | 182 |
| 29 | iso_pu_bacteria | 2935694250 | 2935701591 | 182 |
| 30 | iso_pu_bacteria | 2935703347 | 2935710435 | 182 |
| 31 | iso_pu_bacteria | 2935713505 | 2935716418 | 182 |
| 32 | iso_pu_bacteria | 2935722832 | 2935723457 | 182 |
| 33 | iso_pu_bacteria | 2935732158 | 2935735013 | 182 |
| 34 | iso_pu_bacteria | 2935741537 | 2935744196 | 182 |
| 35 | iso_pu_bacteria | 2935750917 | 2935752696 | 182 |
| 36 | iso_pu_bacteria | 2935760218 | 2935764756 | 182 |
| 37 | iso_pu_bacteria | 2935801545 | 2935806132 | 182 |
| 38 | iso_pu_bacteria | 2935810662 | 2935816897 | 182 |
| 39 | iso_pu_bacteria | 2935827899 | 2935835187 | 182 |
| 40 | iso_pu_bacteria | 2935837841 | 2935841432 | 182 |
| 41 | iso_pu_bacteria | 2935855204 | 2935863001 | 182 |
| 42 | iso_pu_bacteria | 2935864058 | 2935871811 | 182 |
| 43 | iso_pu_bacteria | 2935873716 | 2935882298 | 182 |
| 44 | iso_pu_bacteria | 2935992306 | 2936000131 | 182 |
| 45 | iso_pu_bacteria | 2936002035 | 2936010045 | 182 |
| 46 | iso_pu_bacteria | 2936037263 | 2936043888 | 182 |
| 47 | iso_pu_bacteria | 2940556831 | 2940558609 | 182 |
| 48 | iso_pu_bacteria | 2941538514 | 2941543658 | 182 |
| 49 | iso_pu_bacteria | 8005682033 | 8005686920 | 182 |
| 50 | iso_pu_bacteria | 8016511872 | 8016517821 | 182 |
| 51 | iso_pu_bacteria | 8017057580 | 8017058809 | 182 |
| 52 | iso_pu_bacteria | 8019576017 | 8019576848 | 182 |
| 53 | iso_pu_bacteria | 8019586578 | 8019594897 | 182 |
| 54 | iso_pu_bacteria | 8019597564 | 8019606837 | 182 |
| 55 | iso_pu_bacteria | 8019608314 | 8019611670 | 182 |
| 56 | iso_pu_bacteria | 8055742211 | 8055742789 | 182 |
| 57 | 3300055283 | Ga0500661_001224 | Ga0500661_001224_859_1416 | 183 |
| 58 | iso_pu_bacteria | 2508501128 | 2509154403 | 183 |
| 59 | iso_pu_bacteria | 2511231027 | 2511390576 | 183 |
| 60 | iso_pu_bacteria | 2513237096 | 2513657933 | 183 |
| 61 | iso_pu_bacteria | 2513237137 | 2513855630 | 183 |
| 62 | iso_pu_bacteria | 2513237145 | 2513919974 | 183 |
| 63 | iso_pu_bacteria | 2517572143 | 2517892173 | 183 |
| 64 | iso_pu_bacteria | 2582581315 | 2585329310 | 183 |
| 65 | iso_pu_bacteria | 2585427529 | 2585547034 | 183 |
| 66 | iso_pu_bacteria | 2602042107 | 2603862348 | 183 |
| 67 | iso_pu_bacteria | 2667528174 | 2671116565 | 183 |
| 68 | iso_pu_bacteria | 2667528175 | 2671120569 | 183 |
| 69 | iso_pu_bacteria | 2713897148 | 2715750736 | 183 |
| 70 | iso_pu_bacteria | 2728368998 | 2728749524 | 183 |
| 71 | iso_pu_bacteria | 2738541317 | 2738948131 | 183 |
| 72 | iso_pu_bacteria | 2775506902 | 2776270522 | 183 |
| 73 | iso_pu_bacteria | 2775506904 | 2776281557 | 183 |
| 74 | iso_pu_bacteria | 2791355197 | 2793073352 | 183 |
| 75 | iso_pu_bacteria | 2818991461 | 2819689079 | 183 |
| 76 | iso_pu_bacteria | 2824626560 | 2824632042 | 183 |
| 77 | iso_pu_bacteria | 2824635225 | 2824638753 | 183 |
| 78 | iso_pu_bacteria | 2824644064 | 2824646191 | 183 |
| 79 | iso_pu_bacteria | 2824714736 | 2824716498 | 183 |
| 80 | iso_pu_bacteria | 2824723954 | 2824726042 | 183 |
| 81 | iso_pu_bacteria | 2826581358 | 2826585354 | 183 |
| 82 | iso_pu_bacteria | 2842747753 | 2842750283 | 183 |
| 83 | iso_pu_bacteria | 2842775625 | 2842780178 | 183 |
| 84 | iso_pu_bacteria | 2842805378 | 2842805712 | 183 |
| 85 | iso_pu_bacteria | 2842843487 | 2842846922 | 183 |
| 86 | iso_pu_bacteria | 2857509624 | 2857513926 | 183 |
| 87 | iso_pu_bacteria | 2857524615 | 2857525762 | 183 |
| 88 | iso_pu_bacteria | 2874168670 | 2874174236 | 183 |
| 89 | iso_pu_bacteria | 2893066018 | 2893067944 | 183 |
| 90 | iso_pu_bacteria | 2904690495 | 2904694739 | 183 |
| 91 | iso_pu_bacteria | 2904690495 | 2904696102 | 183 |
| 92 | iso_pu_bacteria | 2906610324 | 2906617303 | 183 |
| 93 | iso_pu_bacteria | 2906626472 | 2906627197 | 183 |
| 94 | iso_pu_bacteria | 2906635258 | 2906642686 | 183 |
| 95 | iso_pu_bacteria | 2906660503 | 2906666137 | 183 |
| 96 | iso_pu_bacteria | 2908446538 | 2908449437 | 183 |
| 97 | iso_pu_bacteria | 2908756301 | 2908760737 | 183 |
| 98 | iso_pu_bacteria | 2909399089 | 2909401991 | 183 |
| 99 | iso_pu_bacteria | 2916061851 | 2916064034 | 183 |
| 100 | iso_pu_bacteria | 2919073203 | 2919074374 | 183 |
| 101 | iso_pu_bacteria | 2919385768 | 2919390073 | 183 |
| 102 | iso_pu_bacteria | 2919487758 | 2919489422 | 183 |
| 103 | iso_pu_bacteria | 2922425934 | 2922430522 | 183 |
| 104 | iso_pu_bacteria | 2929199973 | 2929203664 | 183 |
| 105 | iso_pu_bacteria | 2935959822 | 2935966188 | 183 |
| 106 | iso_pu_bacteria | 2960637947 | 2960638646 | 183 |
| 107 | iso_pu_bacteria | 2964719344 | 2964723093 | 183 |
| 108 | iso_pu_bacteria | 2998139840 | 2998142351 | 183 |
| 109 | iso_pu_bacteria | 3005474847 | 3005480439 | 183 |
| 110 | iso_pu_bacteria | 8016583857 | 8016587134 | 183 |
| 111 | iso_pu_bacteria | 8019555841 | 8019556512 | 183 |
| 112 | iso_pu_bacteria | 8019565922 | 8019568798 | 183 |
| 113 | iso_pu_bacteria | 8055909800 | 8055911145 | 183 |
| 114 | iso_pu_bacteria | 8056161164 | 8056166240 | 183 |
| 115 | iso_pu_bacteria | 8056689827 | 8056691300 | 183 |
| 116 | iso_pu_bacteria | 2818991448 | 2819613319 | 184 |
| 117 | 3300005334 | Ga0068869_100296448 | Ga0068869_1002964482 | 185 |
| 118 | 3300005471 | Ga0070698_100388034 | Ga0070698_1003880342 | 185 |
| 119 | 3300005518 | Ga0070699_101412914 | Ga0070699_1014129141 | 185 |
| 120 | 3300015261 | Ga0182006_1005246 | Ga0182006_10052465 | 185 |
| 121 | 3300025913 | Ga0207695_10000255 | Ga0207695_100002557 | 185 |
| 122 | 3300041404 | Ga0439436_0023955 | Ga0439436_0023955_507_1064 | 185 |
| 123 | 3300046506 | Ga0495583_0182629 | Ga0495583_0182629_251_808 | 185 |
| 124 | 3300046519 | Ga0495632_0000011 | Ga0495632_0000011_37709_38266 | 185 |
| 125 | 3300046522 | Ga0495643_0011673 | Ga0495643_0011673_2301_2858 | 185 |
| 126 | 3300053087 | Ga0500643_000013 | Ga0500643_000013_170184_170741 | 185 |
| 127 | 3300053090 | Ga0500646_0013751 | Ga0500646_0013751_975_1532 | 185 |
| 128 | 3300053092 | Ga0500583_0136125 | Ga0500583_0136125_615_1172 | 185 |
| 129 | 3300053096 | Ga0500641_0074685 | Ga0500641_0074685_11_568 | 185 |
| 130 | 3300053103 | Ga0500555_001497 | Ga0500555_001497_3622_4179 | 185 |
| 131 | 3300053130 | Ga0500642_0028091 | Ga0500642_0028091_1667_2224 | 185 |
| 132 | 3300053131 | Ga0500652_207787 | Ga0500652_207787_78_635 | 185 |
| 133 | 3300053139 | Ga0500568_0008131 | Ga0500568_0008131_4288_4845 | 185 |
| 134 | 3300053142 | Ga0500577_0088159 | Ga0500577_0088159_281_838 | 185 |
| 135 | 3300053147 | Ga0500589_121689 | Ga0500589_121689_303_860 | 185 |
| 136 | 3300053151 | Ga0500604_0022533 | Ga0500604_0022533_1167_1724 | 185 |
| 137 | 3300053158 | Ga0500627_0020612 | Ga0500627_0020612_1677_2234 | 185 |
| 138 | 3300053161 | Ga0500634_0128166 | Ga0500634_0128166_328_885 | 185 |
| 139 | 3300053730 | Ga0500645_017908 | Ga0500645_017908_1539_2096 | 185 |
| 140 | 3300053739 | Ga0500587_009354 | Ga0500587_009354_175_732 | 185 |
| 141 | iso_pu_bacteria | 2599185240 | 2599747927 | 185 |
| 142 | iso_pu_bacteria | 2599185355 | 2600209922 | 185 |
| 143 | iso_pu_bacteria | 2675903129 | 2676741350 | 185 |
| 144 | iso_pu_bacteria | 2824704595 | 2824707308 | 185 |
| 145 | iso_pu_bacteria | 2824753945 | 2824758767 | 185 |
| 146 | iso_pu_bacteria | 2824763712 | 2824769237 | 185 |
| 147 | iso_pu_bacteria | 2904711408 | 2904714114 | 185 |
| 148 | 3300003320 | rootH2_10045382 | rootH2_100453822 | 186 |
| 149 | 3300003323 | rootH1_10194063 | rootH1_101940632 | 186 |
| 150 | 3300003659 | JGI25404J52841_10013938 | JGI25404J52841_100139382 | 186 |
| 151 | 3300003659 | JGI25404J52841_10051800 | JGI25404J52841_100518001 | 186 |
| 152 | 3300005328 | Ga0070676_10469437 | Ga0070676_104694372 | 186 |
| 153 | 3300005337 | Ga0070682_100215532 | Ga0070682_1002155321 | 186 |
| 154 | 3300005338 | Ga0068868_100542414 | Ga0068868_1005424141 | 186 |
| 155 | 3300005347 | Ga0070668_100025164 | Ga0070668_1000251642 | 186 |
| 156 | 3300005347 | Ga0070668_100265228 | Ga0070668_1002652282 | 186 |
| 157 | 3300005347 | Ga0070668_100983418 | Ga0070668_1009834181 | 186 |
| 158 | 3300005437 | Ga0070710_10257581 | Ga0070710_102575811 | 186 |
| 159 | 3300005455 | Ga0070663_100009159 | Ga0070663_1000091594 | 186 |
| 160 | 3300005455 | Ga0070663_100833585 | Ga0070663_1008335851 | 186 |
| 161 | 3300005456 | Ga0070678_100400191 | Ga0070678_1004001913 | 186 |
| 162 | 3300005548 | Ga0070665_100017575 | Ga0070665_1000175755 | 186 |
| 163 | 3300005548 | Ga0070665_100104728 | Ga0070665_1001047282 | 186 |
| 164 | 3300005548 | Ga0070665_100684528 | Ga0070665_1006845281 | 186 |
| 165 | 3300005615 | Ga0070702_100633512 | Ga0070702_1006335121 | 186 |
| 166 | 3300005719 | Ga0068861_100310887 | Ga0068861_1003108872 | 186 |
| 167 | 3300005842 | Ga0068858_100291897 | Ga0068858_1002918972 | 186 |
| 168 | 3300005842 | Ga0068858_100934296 | Ga0068858_1009342962 | 186 |
| 169 | 3300005843 | Ga0068860_100003537 | Ga0068860_1000035376 | 186 |
| 170 | 3300005843 | Ga0068860_100318861 | Ga0068860_1003188612 | 186 |
| 171 | 3300005844 | Ga0068862_100287239 | Ga0068862_1002872392 | 186 |
| 172 | 3300005937 | Ga0081455_10023701 | Ga0081455_100237013 | 186 |
| 173 | 3300005937 | Ga0081455_10320913 | Ga0081455_103209132 | 186 |
| 174 | 3300005983 | Ga0081540_1005216 | Ga0081540_100521613 | 186 |
| 175 | 3300005983 | Ga0081540_1012707 | Ga0081540_10127072 | 186 |
| 176 | 3300006038 | Ga0075365_10007515 | Ga0075365_100075153 | 186 |
| 177 | 3300006038 | Ga0075365_10048736 | Ga0075365_100487362 | 186 |
| 178 | 3300006038 | Ga0075365_10090514 | Ga0075365_100905142 | 186 |
| 179 | 3300006038 | Ga0075365_10310152 | Ga0075365_103101522 | 186 |
| 180 | 3300006042 | Ga0075368_10066662 | Ga0075368_100666622 | 186 |
| 181 | 3300006048 | Ga0075363_100021331 | Ga0075363_1000213314 | 186 |
| 182 | 3300006048 | Ga0075363_100151138 | Ga0075363_1001511382 | 186 |
| 183 | 3300006051 | Ga0075364_10066575 | Ga0075364_100665752 | 186 |
| 184 | 3300006178 | Ga0075367_10034965 | Ga0075367_100349651 | 186 |
| 185 | 3300006178 | Ga0075367_10039863 | Ga0075367_100398632 | 186 |
| 186 | 3300006178 | Ga0075367_10058146 | Ga0075367_100581462 | 186 |
| 187 | 3300006178 | Ga0075367_10267404 | Ga0075367_102674042 | 186 |
| 188 | 3300006186 | Ga0075369_10042314 | Ga0075369_100423142 | 186 |
| 189 | 3300006195 | Ga0075366_10053418 | Ga0075366_100534182 | 186 |
| 190 | 3300006195 | Ga0075366_10157443 | Ga0075366_101574432 | 186 |
| 191 | 3300006353 | Ga0075370_10001527 | Ga0075370_100015279 | 186 |
| 192 | 3300006353 | Ga0075370_10019581 | Ga0075370_100195814 | 186 |
| 193 | 3300006353 | Ga0075370_10045356 | Ga0075370_100453564 | 186 |
| 194 | 3300006880 | Ga0075429_100331228 | Ga0075429_1003312281 | 186 |
| 195 | 3300009101 | Ga0105247_10062157 | Ga0105247_100621572 | 186 |
| 196 | 3300009148 | Ga0105243_10353845 | Ga0105243_103538451 | 186 |
| 197 | 3300009545 | Ga0105237_10175319 | Ga0105237_101753192 | 186 |
| 198 | 3300009551 | Ga0105238_11194163 | Ga0105238_111941631 | 186 |
| 199 | 3300010375 | Ga0105239_10393914 | Ga0105239_103939142 | 186 |
| 200 | 3300013104 | Ga0157370_10079586 | Ga0157370_100795863 | 186 |
| 201 | 3300013296 | Ga0157374_10706211 | Ga0157374_107062112 | 186 |
| 202 | 3300013306 | Ga0163162_10197376 | Ga0163162_101973762 | 186 |
| 203 | 3300013306 | Ga0163162_10812607 | Ga0163162_108126072 | 186 |
| 204 | 3300013306 | Ga0163162_11065220 | Ga0163162_110652201 | 186 |
| 205 | 3300013308 | Ga0157375_10143699 | Ga0157375_101436992 | 186 |
| 206 | 3300014325 | Ga0163163_10045357 | Ga0163163_100453574 | 186 |
| 207 | 3300014325 | Ga0163163_10117904 | Ga0163163_101179042 | 186 |
| 208 | 3300014325 | Ga0163163_10434424 | Ga0163163_104344242 | 186 |
| 209 | 3300014325 | Ga0163163_10913881 | Ga0163163_109138812 | 186 |
| 210 | 3300014326 | Ga0157380_10978068 | Ga0157380_109780681 | 186 |
| 211 | 3300014968 | Ga0157379_10000463 | Ga0157379_1000046315 | 186 |
| 212 | 3300014968 | Ga0157379_10248885 | Ga0157379_102488852 | 186 |
| 213 | 3300014968 | Ga0157379_10677070 | Ga0157379_106770701 | 186 |
| 214 | 3300025302 | Ga0207426_1000767 | Ga0207426_100076719 | 186 |
| 215 | 3300025302 | Ga0207426_1035757 | Ga0207426_10357572 | 186 |
| 216 | 3300025898 | Ga0207692_10136495 | Ga0207692_101364952 | 186 |
| 217 | 3300025900 | Ga0207710_10073930 | Ga0207710_100739302 | 186 |
| 218 | 3300025901 | Ga0207688_10025455 | Ga0207688_100254553 | 186 |
| 219 | 3300025907 | Ga0207645_10401672 | Ga0207645_104016722 | 186 |
| 220 | 3300025931 | Ga0207644_10649673 | Ga0207644_106496731 | 186 |
| 221 | 3300025938 | Ga0207704_10271350 | Ga0207704_102713501 | 186 |
| 222 | 3300025972 | Ga0207668_10072577 | Ga0207668_100725772 | 186 |
| 223 | 3300025972 | Ga0207668_10085308 | Ga0207668_100853082 | 186 |
| 224 | 3300025972 | Ga0207668_10649510 | Ga0207668_106495102 | 186 |
| 225 | 3300026035 | Ga0207703_10349211 | Ga0207703_103492112 | 186 |
| 226 | 3300026035 | Ga0207703_10409369 | Ga0207703_104093692 | 186 |
| 227 | 3300026067 | Ga0207678_10037078 | Ga0207678_100370782 | 186 |
| 228 | 3300026067 | Ga0207678_10056853 | Ga0207678_100568534 | 186 |
| 229 | 3300026067 | Ga0207678_10251711 | Ga0207678_102517111 | 186 |
| 230 | 3300026088 | Ga0207641_10142877 | Ga0207641_101428772 | 186 |
| 231 | 3300026121 | Ga0207683_10097621 | Ga0207683_100976212 | 186 |
| 232 | 3300027312 | Ga0209371_1005576 | Ga0209371_10055763 | 186 |
| 233 | 3300027312 | Ga0209371_1008358 | Ga0209371_10083582 | 186 |
| 234 | 3300027866 | Ga0209813_10074769 | Ga0209813_100747691 | 186 |
| 235 | 3300028379 | Ga0268266_10001335 | Ga0268266_1000133524 | 186 |
| 236 | 3300028379 | Ga0268266_10009532 | Ga0268266_100095328 | 186 |
| 237 | 3300028379 | Ga0268266_10018709 | Ga0268266_100187099 | 186 |
| 238 | 3300028379 | Ga0268266_10024160 | Ga0268266_100241605 | 186 |
| 239 | 3300028379 | Ga0268266_10066202 | Ga0268266_100662022 | 186 |
| 240 | 3300028379 | Ga0268266_10367076 | Ga0268266_103670762 | 186 |
| 241 | 3300028379 | Ga0268266_10400714 | Ga0268266_104007142 | 186 |
| 242 | 3300028379 | Ga0268266_10625634 | Ga0268266_106256343 | 186 |
| 243 | 3300028381 | Ga0268264_10002518 | Ga0268264_1000251815 | 186 |
| 244 | 3300030500 | Ga0268256_1008686 | Ga0268256_10086862 | 186 |
| 245 | 3300030500 | Ga0268256_1019328 | Ga0268256_10193282 | 186 |
| 246 | 3300032004 | Ga0307414_10298339 | Ga0307414_102983392 | 186 |
| 247 | 3300046501 | Ga0495607_0132371 | Ga0495607_0132371_139_714 | 186 |
| 248 | 3300046557 | Ga0495622_0146191 | Ga0495622_0146191_215_775 | 186 |
| 249 | 3300047320 | Ga0495672_0218420 | Ga0495672_0218420_237_797 | 186 |
| 250 | 3300047472 | Ga0495686_0136702 | Ga0495686_0136702_716_1276 | 186 |
| 251 | 3300047472 | Ga0495686_0163953 | Ga0495686_0163953_650_1210 | 186 |
| 252 | 3300048903 | Ga0496100_0876342 | Ga0496100_0876342_124_684 | 186 |
| 253 | 3300048904 | Ga0496101_0091277 | Ga0496101_0091277_608_1168 | 186 |
| 254 | 3300048905 | Ga0496102_0155229 | Ga0496102_0155229_492_1052 | 186 |
| 255 | 3300048905 | Ga0496102_0191223 | Ga0496102_0191223_568_1152 | 186 |
| 256 | 3300048905 | Ga0496102_0203360 | Ga0496102_0203360_79_663 | 186 |
| 257 | 3300048905 | Ga0496102_0390656 | Ga0496102_0390656_250_810 | 186 |
| 258 | 3300048907 | Ga0496104_0162723 | Ga0496104_0162723_1406_1966 | 186 |
| 259 | 3300048907 | Ga0496104_0254557 | Ga0496104_0254557_956_1540 | 186 |
| 260 | 3300048909 | Ga0496106_0042367 | Ga0496106_0042367_1303_1863 | 186 |
| 261 | 3300048910 | Ga0496107_0084437 | Ga0496107_0084437_1391_1951 | 186 |
| 262 | 3300048910 | Ga0496107_0394822 | Ga0496107_0394822_76_660 | 186 |
| 263 | 3300048915 | Ga0496112_0632427 | Ga0496112_0632427_53_613 | 186 |
| 264 | 3300048919 | Ga0496116_0049501 | Ga0496116_0049501_1213_1773 | 186 |
| 265 | 3300048920 | Ga0496117_0157755 | Ga0496117_0157755_43_603 | 186 |
| 266 | 3300048921 | Ga0496118_0033001 | Ga0496118_0033001_1784_2353 | 186 |
| 267 | 3300048922 | Ga0496119_0090504 | Ga0496119_0090504_529_1089 | 186 |
| 268 | 3300048924 | Ga0496121_0050570 | Ga0496121_0050570_336_896 | 186 |
| 269 | 3300048924 | Ga0496121_0050848 | Ga0496121_0050848_946_1515 | 186 |
| 270 | 3300048924 | Ga0496121_0302150 | Ga0496121_0302150_276_836 | 186 |
| 271 | 3300048928 | Ga0496125_0000048 | Ga0496125_0000048_66435_66995 | 186 |
| 272 | 3300048929 | Ga0496126_0231202 | Ga0496126_0231202_193_777 | 186 |
| 273 | 3300048929 | Ga0496126_0714445 | Ga0496126_0714445_198_758 | 186 |
| 274 | 3300049758 | Ga0501241_000061 | Ga0501241_000061_24378_24977 | 186 |
| 275 | 3300050490 | nmdc:mga03n38_18757_c1 | nmdc:mga03n38_18757_c1_977_1561 | 186 |
| 276 | 3300050492 | nmdc:mga0yw44_19694_c1 | nmdc:mga0yw44_19694_c1_247_831 | 186 |
| 277 | 3300050492 | nmdc:mga0yw44_58229_c1 | nmdc:mga0yw44_58229_c1_184_744 | 186 |
| 278 | 3300050492 | nmdc:mga0yw44_6844_c1 | nmdc:mga0yw44_6844_c1_1912_2472 | 186 |
| 279 | 3300050492 | nmdc:mga0yw44_77371_c1 | nmdc:mga0yw44_77371_c1_919_1479 | 186 |
| 280 | 3300050493 | nmdc:mga0k408_108982_c1 | nmdc:mga0k408_108982_c1_155_739 | 186 |
| 281 | 3300050493 | nmdc:mga0k408_202477_c1 | nmdc:mga0k408_202477_c1_498_1058 | 186 |
| 282 | 3300050494 | nmdc:mga06z11_19457_c1 | nmdc:mga06z11_19457_c1_397_981 | 186 |
| 283 | 3300050494 | nmdc:mga06z11_34575_c1 | nmdc:mga06z11_34575_c1_1761_2321 | 186 |
| 284 | 3300050494 | nmdc:mga06z11_39608_c1 | nmdc:mga06z11_39608_c1_813_1373 | 186 |
| 285 | 3300050495 | nmdc:mga04h51_141456_c1 | nmdc:mga04h51_141456_c1_230_790 | 186 |
| 286 | 3300050496 | nmdc:mga07m45_180639_c2 | nmdc:mga07m45_180639_c2_42_602 | 186 |
| 287 | 3300050496 | nmdc:mga07m45_55699_c1 | nmdc:mga07m45_55699_c1_258_818 | 186 |
| 288 | 3300050508 | nmdc:mga09592_298021_c1 | nmdc:mga09592_298021_c1_620_1183 | 186 |
| 289 | 3300053125 | Ga0500618_006698 | Ga0500618_006698_1360_1935 | 186 |
| 290 | 3300000532 | CNAas_1002612 | CNAas_10026122 | 187 |
| 291 | 3300001979 | JGI24740J21852_10000185 | JGI24740J21852_100001858 | 187 |
| 292 | 3300002070 | JGI24750J21931_1019772 | JGI24750J21931_10197721 | 187 |
| 293 | 3300002075 | JGI24738J21930_10081733 | JGI24738J21930_100817331 | 187 |
| 294 | 3300002737 | JGI25162J39368_1001010 | JGI25162J39368_10010101 | 187 |
| 295 | 3300003187 | JGI25151J46595_10002485 | JGI25151J46595_1000248510 | 187 |
| 296 | 3300003214 | JGI25165J46597_1000859 | JGI25165J46597_10008594 | 187 |
| 297 | 3300003215 | JGI25153J46596_10005600 | JGI25153J46596_100056004 | 187 |
| 298 | 3300003316 | rootH1_10010685 | rootH1_100106852 | 187 |
| 299 | 3300003320 | rootH2_10070521 | rootH2_100705214 | 187 |
| 300 | 3300003322 | rootL2_10261710 | rootL2_102617104 | 187 |
| 301 | 3300004625 | Ga0055543_1004255 | Ga0055543_10042555 | 187 |
| 302 | 3300005262 | Ga0065165_1000348 | Ga0065165_100034832 | 187 |
| 303 | 3300005289 | Ga0065704_10046873 | Ga0065704_100468731 | 187 |
| 304 | 3300005327 | Ga0070658_10504027 | Ga0070658_105040272 | 187 |
| 305 | 3300005328 | Ga0070676_10210399 | Ga0070676_102103991 | 187 |
| 306 | 3300005334 | Ga0068869_100026570 | Ga0068869_1000265704 | 187 |
| 307 | 3300005338 | Ga0068868_100256349 | Ga0068868_1002563492 | 187 |
| 308 | 3300005347 | Ga0070668_100000040 | Ga0070668_10000004031 | 187 |
| 309 | 3300005347 | Ga0070668_100228753 | Ga0070668_1002287531 | 187 |
| 310 | 3300005353 | Ga0070669_100051671 | Ga0070669_1000516712 | 187 |
| 311 | 3300005367 | Ga0070667_100169048 | Ga0070667_1001690482 | 187 |
| 312 | 3300005406 | Ga0070703_10068774 | Ga0070703_100687741 | 187 |
| 313 | 3300005436 | Ga0070713_100462710 | Ga0070713_1004627102 | 187 |
| 314 | 3300005437 | Ga0070710_10080555 | Ga0070710_100805552 | 187 |
| 315 | 3300005441 | Ga0070700_100450168 | Ga0070700_1004501682 | 187 |
| 316 | 3300005444 | Ga0070694_100065348 | Ga0070694_1000653481 | 187 |
| 317 | 3300005445 | Ga0070708_100180727 | Ga0070708_1001807273 | 187 |
| 318 | 3300005445 | Ga0070708_100551004 | Ga0070708_1005510041 | 187 |
| 319 | 3300005455 | Ga0070663_100332693 | Ga0070663_1003326932 | 187 |
| 320 | 3300005455 | Ga0070663_100405593 | Ga0070663_1004055931 | 187 |
| 321 | 3300005457 | Ga0070662_100017219 | Ga0070662_1000172195 | 187 |
| 322 | 3300005467 | Ga0070706_100827244 | Ga0070706_1008272442 | 187 |
| 323 | 3300005471 | Ga0070698_100044970 | Ga0070698_1000449701 | 187 |
| 324 | 3300005518 | Ga0070699_100102003 | Ga0070699_1001020032 | 187 |
| 325 | 3300005536 | Ga0070697_100337469 | Ga0070697_1003374691 | 187 |
| 326 | 3300005539 | Ga0068853_100156110 | Ga0068853_1001561103 | 187 |
| 327 | 3300005545 | Ga0070695_100154990 | Ga0070695_1001549901 | 187 |
| 328 | 3300005548 | Ga0070665_100182965 | Ga0070665_1001829652 | 187 |
| 329 | 3300005548 | Ga0070665_100375960 | Ga0070665_1003759602 | 187 |
| 330 | 3300005548 | Ga0070665_100615955 | Ga0070665_1006159552 | 187 |
| 331 | 3300005549 | Ga0070704_100847356 | Ga0070704_1008473561 | 187 |
| 332 | 3300005563 | Ga0068855_100857911 | Ga0068855_1008579111 | 187 |
| 333 | 3300005578 | Ga0068854_100007247 | Ga0068854_1000072477 | 187 |
| 334 | 3300005617 | Ga0068859_100581242 | Ga0068859_1005812422 | 187 |
| 335 | 3300005618 | Ga0068864_100277428 | Ga0068864_1002774281 | 187 |
| 336 | 3300005719 | Ga0068861_100002291 | Ga0068861_1000022918 | 187 |
| 337 | 3300005834 | Ga0068851_10089596 | Ga0068851_100895962 | 187 |
| 338 | 3300005841 | Ga0068863_100489143 | Ga0068863_1004891431 | 187 |
| 339 | 3300005841 | Ga0068863_100722852 | Ga0068863_1007228522 | 187 |
| 340 | 3300005842 | Ga0068858_100190057 | Ga0068858_1001900573 | 187 |
| 341 | 3300005842 | Ga0068858_100672370 | Ga0068858_1006723701 | 187 |
| 342 | 3300005843 | Ga0068860_100031244 | Ga0068860_1000312444 | 187 |
| 343 | 3300005843 | Ga0068860_100158759 | Ga0068860_1001587592 | 187 |
| 344 | 3300005844 | Ga0068862_100004744 | Ga0068862_1000047443 | 187 |
| 345 | 3300005844 | Ga0068862_100212740 | Ga0068862_1002127402 | 187 |
| 346 | 3300005981 | Ga0081538_10262926 | Ga0081538_102629261 | 187 |
| 347 | 3300005983 | Ga0081540_1031316 | Ga0081540_10313162 | 187 |
| 348 | 3300006028 | Ga0070717_10129736 | Ga0070717_101297362 | 187 |
| 349 | 3300006042 | Ga0075368_10242253 | Ga0075368_102422532 | 187 |
| 350 | 3300006048 | Ga0075363_100051292 | Ga0075363_1000512922 | 187 |
| 351 | 3300006051 | Ga0075364_10072682 | Ga0075364_100726823 | 187 |
| 352 | 3300006051 | Ga0075364_10144985 | Ga0075364_101449853 | 187 |
| 353 | 3300006173 | Ga0070716_100343659 | Ga0070716_1003436592 | 187 |
| 354 | 3300006177 | Ga0075362_10392728 | Ga0075362_103927281 | 187 |
| 355 | 3300006178 | Ga0075367_10003448 | Ga0075367_100034481 | 187 |
| 356 | 3300006178 | Ga0075367_10032709 | Ga0075367_100327094 | 187 |
| 357 | 3300006186 | Ga0075369_10162881 | Ga0075369_101628812 | 187 |
| 358 | 3300006186 | Ga0075369_10171176 | Ga0075369_101711761 | 187 |
| 359 | 3300006195 | Ga0075366_10301778 | Ga0075366_103017781 | 187 |
| 360 | 3300006195 | Ga0075366_10464548 | Ga0075366_104645482 | 187 |
| 361 | 3300006353 | Ga0075370_10222315 | Ga0075370_102223152 | 187 |
| 362 | 3300006353 | Ga0075370_10371661 | Ga0075370_103716611 | 187 |
| 363 | 3300006358 | Ga0068871_100460062 | Ga0068871_1004600622 | 187 |
| 364 | 3300006871 | Ga0075434_100559077 | Ga0075434_1005590772 | 187 |
| 365 | 3300006931 | Ga0097620_100581240 | Ga0097620_1005812402 | 187 |
| 366 | 3300006946 | Ga0079104_1013522 | Ga0079104_10135222 | 187 |
| 367 | 3300007076 | Ga0075435_100113203 | Ga0075435_1001132033 | 187 |
| 368 | 3300007265 | Ga0099794_10240932 | Ga0099794_102409321 | 187 |
| 369 | 3300009092 | Ga0105250_10023700 | Ga0105250_100237004 | 187 |
| 370 | 3300009093 | Ga0105240_10000005 | Ga0105240_10000005191 | 187 |
| 371 | 3300009093 | Ga0105240_10071482 | Ga0105240_100714825 | 187 |
| 372 | 3300009093 | Ga0105240_10164364 | Ga0105240_101643642 | 187 |
| 373 | 3300009093 | Ga0105240_10530618 | Ga0105240_105306182 | 187 |
| 374 | 3300009093 | Ga0105240_10727697 | Ga0105240_107276972 | 187 |
| 375 | 3300009098 | Ga0105245_10129685 | Ga0105245_101296851 | 187 |
| 376 | 3300009148 | Ga0105243_10057116 | Ga0105243_100571164 | 187 |
| 377 | 3300009176 | Ga0105242_10053124 | Ga0105242_100531243 | 187 |
| 378 | 3300009177 | Ga0105248_10176684 | Ga0105248_101766842 | 187 |
| 379 | 3300009545 | Ga0105237_11123137 | Ga0105237_111231372 | 187 |
| 380 | 3300009551 | Ga0105238_10039512 | Ga0105238_100395125 | 187 |
| 381 | 3300009553 | Ga0105249_10007823 | Ga0105249_100078231 | 187 |
| 382 | 3300009553 | Ga0105249_10013279 | Ga0105249_100132798 | 187 |
| 383 | 3300009553 | Ga0105249_10941670 | Ga0105249_109416701 | 187 |
| 384 | 3300010375 | Ga0105239_10002635 | Ga0105239_1000263524 | 187 |
| 385 | 3300010375 | Ga0105239_10252385 | Ga0105239_102523852 | 187 |
| 386 | 3300010375 | Ga0105239_10808814 | Ga0105239_108088141 | 187 |
| 387 | 3300013100 | Ga0157373_10085955 | Ga0157373_100859552 | 187 |
| 388 | 3300013102 | Ga0157371_10000886 | Ga0157371_100008863 | 187 |
| 389 | 3300013102 | Ga0157371_10015143 | Ga0157371_100151436 | 187 |
| 390 | 3300013104 | Ga0157370_10000163 | Ga0157370_1000016335 | 187 |
| 391 | 3300013306 | Ga0163162_10242867 | Ga0163162_102428671 | 187 |
| 392 | 3300013306 | Ga0163162_12204189 | Ga0163162_122041891 | 187 |
| 393 | 3300013307 | Ga0157372_11212628 | Ga0157372_112126281 | 187 |
| 394 | 3300014325 | Ga0163163_10607101 | Ga0163163_106071012 | 187 |
| 395 | 3300014325 | Ga0163163_11605844 | Ga0163163_116058441 | 187 |
| 396 | 3300014968 | Ga0157379_10132112 | Ga0157379_101321123 | 187 |
| 397 | 3300014968 | Ga0157379_10136931 | Ga0157379_101369312 | 187 |
| 398 | 3300014969 | Ga0157376_10810964 | Ga0157376_108109641 | 187 |
| 399 | 3300015261 | Ga0182006_1000325 | Ga0182006_100032520 | 187 |
| 400 | 3300015261 | Ga0182006_1079966 | Ga0182006_10799662 | 187 |
| 401 | 3300017792 | Ga0163161_10719287 | Ga0163161_107192871 | 187 |
| 402 | 3300021361 | Ga0213872_10013768 | Ga0213872_100137685 | 187 |
| 403 | 3300021361 | Ga0213872_10143244 | Ga0213872_101432442 | 187 |
| 404 | 3300021361 | Ga0213872_10147560 | Ga0213872_101475602 | 187 |
| 405 | 3300021441 | Ga0213871_10003957 | Ga0213871_100039572 | 187 |
| 406 | 3300025233 | Ga0209437_100520 | Ga0209437_10052010 | 187 |
| 407 | 3300025245 | Ga0207425_1002075 | Ga0207425_10020752 | 187 |
| 408 | 3300025246 | Ga0209646_1018716 | Ga0209646_10187161 | 187 |
| 409 | 3300025258 | Ga0209129_1000149 | Ga0209129_100014934 | 187 |
| 410 | 3300025261 | Ga0209233_1000448 | Ga0209233_100044820 | 187 |
| 411 | 3300025261 | Ga0209233_1032121 | Ga0209233_10321212 | 187 |
| 412 | 3300025294 | Ga0209025_1000253 | Ga0209025_10002536 | 187 |
| 413 | 3300025294 | Ga0209025_1005181 | Ga0209025_10051813 | 187 |
| 414 | 3300025297 | Ga0209758_1000296 | Ga0209758_10002966 | 187 |
| 415 | 3300025885 | Ga0207653_10126014 | Ga0207653_101260141 | 187 |
| 416 | 3300025900 | Ga0207710_10074422 | Ga0207710_100744222 | 187 |
| 417 | 3300025903 | Ga0207680_10067951 | Ga0207680_100679511 | 187 |
| 418 | 3300025906 | Ga0207699_10072454 | Ga0207699_100724543 | 187 |
| 419 | 3300025907 | Ga0207645_10046340 | Ga0207645_100463401 | 187 |
| 420 | 3300025910 | Ga0207684_10722699 | Ga0207684_107226991 | 187 |
| 421 | 3300025910 | Ga0207684_11209884 | Ga0207684_112098841 | 187 |
| 422 | 3300025913 | Ga0207695_10000011 | Ga0207695_10000011723 | 187 |
| 423 | 3300025913 | Ga0207695_10031216 | Ga0207695_100312164 | 187 |
| 424 | 3300025913 | Ga0207695_10667952 | Ga0207695_106679521 | 187 |
| 425 | 3300025914 | Ga0207671_10398186 | Ga0207671_103981861 | 187 |
| 426 | 3300025914 | Ga0207671_10717469 | Ga0207671_107174692 | 187 |
| 427 | 3300025923 | Ga0207681_10087782 | Ga0207681_100877822 | 187 |
| 428 | 3300025923 | Ga0207681_10501412 | Ga0207681_105014121 | 187 |
| 429 | 3300025924 | Ga0207694_10229501 | Ga0207694_102295012 | 187 |
| 430 | 3300025927 | Ga0207687_10096509 | Ga0207687_100965091 | 187 |
| 431 | 3300025928 | Ga0207700_10949727 | Ga0207700_109497271 | 187 |
| 432 | 3300025929 | Ga0207664_10881038 | Ga0207664_108810382 | 187 |
| 433 | 3300025933 | Ga0207706_10014354 | Ga0207706_100143543 | 187 |
| 434 | 3300025934 | Ga0207686_10064592 | Ga0207686_100645924 | 187 |
| 435 | 3300025935 | Ga0207709_10060899 | Ga0207709_100608991 | 187 |
| 436 | 3300025939 | Ga0207665_10440338 | Ga0207665_104403382 | 187 |
| 437 | 3300025939 | Ga0207665_10474842 | Ga0207665_104748422 | 187 |
| 438 | 3300025942 | Ga0207689_10028565 | Ga0207689_100285653 | 187 |
| 439 | 3300025961 | Ga0207712_10001119 | Ga0207712_100011193 | 187 |
| 440 | 3300025972 | Ga0207668_10000069 | Ga0207668_1000006931 | 187 |
| 441 | 3300025972 | Ga0207668_10007301 | Ga0207668_100073015 | 187 |
| 442 | 3300025981 | Ga0207640_10005170 | Ga0207640_100051707 | 187 |
| 443 | 3300025986 | Ga0207658_10076616 | Ga0207658_100766164 | 187 |
| 444 | 3300026023 | Ga0207677_10268382 | Ga0207677_102683821 | 187 |
| 445 | 3300026035 | Ga0207703_10090596 | Ga0207703_100905963 | 187 |
| 446 | 3300026041 | Ga0207639_10195095 | Ga0207639_101950952 | 187 |
| 447 | 3300026067 | Ga0207678_10028180 | Ga0207678_100281802 | 187 |
| 448 | 3300026067 | Ga0207678_10444755 | Ga0207678_104447551 | 187 |
| 449 | 3300026075 | Ga0207708_10065735 | Ga0207708_100657351 | 187 |
| 450 | 3300026088 | Ga0207641_10389304 | Ga0207641_103893042 | 187 |
| 451 | 3300026088 | Ga0207641_10579926 | Ga0207641_105799261 | 187 |
| 452 | 3300026118 | Ga0207675_100006110 | Ga0207675_1000061103 | 187 |
| 453 | 3300027111 | Ga0209281_1002866 | Ga0209281_10028665 | 187 |
| 454 | 3300027111 | Ga0209281_1003385 | Ga0209281_10033854 | 187 |
| 455 | 3300027312 | Ga0209371_1000010 | Ga0209371_1000010632 | 187 |
| 456 | 3300027312 | Ga0209371_1004276 | Ga0209371_10042763 | 187 |
| 457 | 3300027671 | Ga0209588_1047811 | Ga0209588_10478112 | 187 |
| 458 | 3300028379 | Ga0268266_10009274 | Ga0268266_100092742 | 187 |
| 459 | 3300028379 | Ga0268266_11346711 | Ga0268266_113467111 | 187 |
| 460 | 3300028380 | Ga0268265_10085188 | Ga0268265_100851882 | 187 |
| 461 | 3300028380 | Ga0268265_10160753 | Ga0268265_101607533 | 187 |
| 462 | 3300028381 | Ga0268264_10008540 | Ga0268264_100085402 | 187 |
| 463 | 3300028794 | Ga0307515_10158226 | Ga0307515_101582262 | 187 |
| 464 | 3300028794 | Ga0307515_10218442 | Ga0307515_102184423 | 187 |
| 465 | 3300030500 | Ga0268256_1000022 | Ga0268256_1000022233 | 187 |
| 466 | 3300030500 | Ga0268256_1004608 | Ga0268256_10046085 | 187 |
| 467 | 3300031507 | Ga0307509_10282258 | Ga0307509_102822583 | 187 |
| 468 | 3300031548 | Ga0307408_100030448 | Ga0307408_1000304482 | 187 |
| 469 | 3300031548 | Ga0307408_100058024 | Ga0307408_1000580244 | 187 |
| 470 | 3300031730 | Ga0307516_10557114 | Ga0307516_105571142 | 187 |
| 471 | 3300031731 | Ga0307405_10004925 | Ga0307405_100049258 | 187 |
| 472 | 3300031731 | Ga0307405_10455421 | Ga0307405_104554212 | 187 |
| 473 | 3300031911 | Ga0307412_10073294 | Ga0307412_100732942 | 187 |
| 474 | 3300031995 | Ga0307409_100451144 | Ga0307409_1004511442 | 187 |
| 475 | 3300032005 | Ga0307411_10011984 | Ga0307411_100119844 | 187 |
| 476 | 3300032005 | Ga0307411_10395823 | Ga0307411_103958232 | 187 |
| 477 | 3300033180 | Ga0307510_10108943 | Ga0307510_101089433 | 187 |
| 478 | 3300033442 | Ga0315911_1000006 | Ga0315911_100000691 | 187 |
| 479 | 3300035170 | Ga0373943_0420299 | Ga0373943_0420299_139_702 | 187 |
| 480 | 3300035725 | Ga0373947_0452357 | Ga0373947_0452357_94_657 | 187 |
| 481 | 3300036401 | Ga0373937_1118987 | Ga0373937_1118987_157_720 | 187 |
| 482 | 3300037466 | Ga0395898_0476189 | Ga0395898_0476189_147_710 | 187 |
| 483 | 3300037471 | Ga0395905_0057923 | Ga0395905_0057923_413_976 | 187 |
| 484 | 3300039438 | Ga0436360_0279990 | Ga0436360_0279990_604_1167 | 187 |
| 485 | 3300039438 | Ga0436360_0280789 | Ga0436360_0280789_1492_2055 | 187 |
| 486 | 3300039447 | Ga0436361_0039495 | Ga0436361_0039495_2129_2692 | 187 |
| 487 | 3300039447 | Ga0436361_0052850 | Ga0436361_0052850_1274_1837 | 187 |
| 488 | 3300039447 | Ga0436361_0514043 | Ga0436361_0514043_6666_7229 | 187 |
| 489 | 3300039447 | Ga0436361_0547814 | Ga0436361_0547814_3375_3965 | 187 |
| 490 | 3300039447 | Ga0436361_0655121 | Ga0436361_0655121_855_1418 | 187 |
| 491 | 3300039447 | Ga0436361_0898932 | Ga0436361_0898932_743_1306 | 187 |
| 492 | 3300039447 | Ga0436361_0945239 | Ga0436361_0945239_2016_2579 | 187 |
| 493 | 3300039453 | Ga0436362_0568463 | Ga0436362_0568463_777_1340 | 187 |
| 494 | 3300041405 | Ga0439438_000005 | Ga0439438_000005_41249_41833 | 187 |
| 495 | 3300041405 | Ga0439438_000078 | Ga0439438_000078_26756_27352 | 187 |
| 496 | 3300041456 | Ga0451795_0539211 | Ga0451795_0539211_188_751 | 187 |
| 497 | 3300041997 | Ga0439431_0072943 | Ga0439431_0072943_35_625 | 187 |
| 498 | 3300042006 | Ga0439432_002011 | Ga0439432_002011_3765_4340 | 187 |
| 499 | 3300042006 | Ga0439432_011116 | Ga0439432_011116_2267_2839 | 187 |
| 500 | 3300042016 | Ga0439463_042661 | Ga0439463_042661_65_628 | 187 |
| 501 | 3300042115 | Ga0450911_000010 | Ga0450911_000010_26871_27446 | 187 |
| 502 | 3300042115 | Ga0450911_000303 | Ga0450911_000303_6364_6927 | 187 |
| 503 | 3300042145 | Ga0450906_000007 | Ga0450906_000007_20854_21429 | 187 |
| 504 | 3300042185 | Ga0450909_000934 | Ga0450909_000934_2874_3503 | 187 |
| 505 | 3300042439 | Ga0439464_0008830 | Ga0439464_0008830_1710_2273 | 187 |
| 506 | 3300044656 | Ga0466969_0097288 | Ga0466969_0097288_760_1323 | 187 |
| 507 | 3300044658 | Ga0466972_0000188 | Ga0466972_0000188_2348_2911 | 187 |
| 508 | 3300044683 | Ga0466965_0075480 | Ga0466965_0075480_452_1015 | 187 |
| 509 | 3300044683 | Ga0466965_0162968 | Ga0466965_0162968_382_945 | 187 |
| 510 | 3300044901 | Ga0466960_0215500 | Ga0466960_0215500_102_665 | 187 |
| 511 | 3300044901 | Ga0466960_0337461 | Ga0466960_0337461_250_813 | 187 |
| 512 | 3300045049 | Ga0466959_0311202 | Ga0466959_0311202_493_1056 | 187 |
| 513 | 3300046452 | Ga0495617_000578 | Ga0495617_000578_6104_6715 | 187 |
| 514 | 3300046452 | Ga0495617_035376 | Ga0495617_035376_905_1468 | 187 |
| 515 | 3300046453 | Ga0495627_001932 | Ga0495627_001932_2534_3109 | 187 |
| 516 | 3300046455 | Ga0495603_0102749 | Ga0495603_0102749_153_716 | 187 |
| 517 | 3300046457 | Ga0495590_0026011 | Ga0495590_0026011_646_1209 | 187 |
| 518 | 3300046460 | Ga0495638_0000243 | Ga0495638_0000243_38494_39057 | 187 |
| 519 | 3300046460 | Ga0495638_0008279 | Ga0495638_0008279_4798_5361 | 187 |
| 520 | 3300046460 | Ga0495638_0018999 | Ga0495638_0018999_2935_3498 | 187 |
| 521 | 3300046460 | Ga0495638_0053384 | Ga0495638_0053384_1165_1728 | 187 |
| 522 | 3300046471 | Ga0495650_0001187 | Ga0495650_0001187_24525_25100 | 187 |
| 523 | 3300046471 | Ga0495650_0014052 | Ga0495650_0014052_3308_3871 | 187 |
| 524 | 3300046471 | Ga0495650_0084952 | Ga0495650_0084952_554_1117 | 187 |
| 525 | 3300046472 | Ga0495580_0231441 | Ga0495580_0231441_458_1021 | 187 |
| 526 | 3300046474 | Ga0495605_0000075 | Ga0495605_0000075_83344_83916 | 187 |
| 527 | 3300046474 | Ga0495605_0073676 | Ga0495605_0073676_744_1307 | 187 |
| 528 | 3300046474 | Ga0495605_0177162 | Ga0495605_0177162_141_704 | 187 |
| 529 | 3300046475 | Ga0495639_0402873 | Ga0495639_0402873_49_612 | 187 |
| 530 | 3300046477 | Ga0495664_0416913 | Ga0495664_0416913_157_720 | 187 |
| 531 | 3300046491 | Ga0495584_0049656 | Ga0495584_0049656_124_687 | 187 |
| 532 | 3300046491 | Ga0495584_0079696 | Ga0495584_0079696_733_1296 | 187 |
| 533 | 3300046491 | Ga0495584_0312910 | Ga0495584_0312910_120_683 | 187 |
| 534 | 3300046492 | Ga0495585_0126593 | Ga0495585_0126593_212_775 | 187 |
| 535 | 3300046500 | Ga0495596_0016006 | Ga0495596_0016006_1304_1867 | 187 |
| 536 | 3300046500 | Ga0495596_0167561 | Ga0495596_0167561_253_816 | 187 |
| 537 | 3300046501 | Ga0495607_0060347 | Ga0495607_0060347_585_1148 | 187 |
| 538 | 3300046501 | Ga0495607_0189024 | Ga0495607_0189024_437_1000 | 187 |
| 539 | 3300046507 | Ga0495606_0000022 | Ga0495606_0000022_90986_91558 | 187 |
| 540 | 3300046507 | Ga0495606_0002482 | Ga0495606_0002482_1654_2217 | 187 |
| 541 | 3300046507 | Ga0495606_0120738 | Ga0495606_0120738_629_1192 | 187 |
| 542 | 3300046507 | Ga0495606_0155367 | Ga0495606_0155367_645_1208 | 187 |
| 543 | 3300046507 | Ga0495606_0238215 | Ga0495606_0238215_152_715 | 187 |
| 544 | 3300046507 | Ga0495606_0253277 | Ga0495606_0253277_29_601 | 187 |
| 545 | 3300046512 | Ga0495610_0003586 | Ga0495610_0003586_3842_4417 | 187 |
| 546 | 3300046512 | Ga0495610_0012519 | Ga0495610_0012519_1885_2475 | 187 |
| 547 | 3300046512 | Ga0495610_0076624 | Ga0495610_0076624_199_762 | 187 |
| 548 | 3300046513 | Ga0495616_0023423 | Ga0495616_0023423_2546_3109 | 187 |
| 549 | 3300046513 | Ga0495616_0055616 | Ga0495616_0055616_448_1011 | 187 |
| 550 | 3300046515 | Ga0495620_0003203 | Ga0495620_0003203_1147_1722 | 187 |
| 551 | 3300046515 | Ga0495620_0010672 | Ga0495620_0010672_2688_3260 | 187 |
| 552 | 3300046515 | Ga0495620_0036657 | Ga0495620_0036657_1023_1586 | 187 |
| 553 | 3300046515 | Ga0495620_0214246 | Ga0495620_0214246_91_654 | 187 |
| 554 | 3300046518 | Ga0495631_0082130 | Ga0495631_0082130_667_1230 | 187 |
| 555 | 3300046519 | Ga0495632_0049500 | Ga0495632_0049500_696_1259 | 187 |
| 556 | 3300046519 | Ga0495632_0292667 | Ga0495632_0292667_72_635 | 187 |
| 557 | 3300046520 | Ga0495637_0003672 | Ga0495637_0003672_3946_4509 | 187 |
| 558 | 3300046520 | Ga0495637_0241876 | Ga0495637_0241876_43_606 | 187 |
| 559 | 3300046522 | Ga0495643_0005027 | Ga0495643_0005027_3289_3852 | 187 |
| 560 | 3300046523 | Ga0495644_0096312 | Ga0495644_0096312_246_809 | 187 |
| 561 | 3300046524 | Ga0495648_0003954 | Ga0495648_0003954_7401_7964 | 187 |
| 562 | 3300046524 | Ga0495648_0009452 | Ga0495648_0009452_5820_6383 | 187 |
| 563 | 3300046524 | Ga0495648_0189133 | Ga0495648_0189133_201_764 | 187 |
| 564 | 3300046524 | Ga0495648_0316920 | Ga0495648_0316920_23_586 | 187 |
| 565 | 3300046525 | Ga0495663_0020815 | Ga0495663_0020815_1058_1621 | 187 |
| 566 | 3300046528 | Ga0495642_0219007 | Ga0495642_0219007_32_595 | 187 |
| 567 | 3300046529 | Ga0495652_0457948 | Ga0495652_0457948_137_700 | 187 |
| 568 | 3300046530 | Ga0495654_0088139 | Ga0495654_0088139_766_1329 | 187 |
| 569 | 3300046531 | Ga0495665_0223925 | Ga0495665_0223925_246_809 | 187 |
| 570 | 3300046537 | Ga0495598_0007307 | Ga0495598_0007307_1763_2326 | 187 |
| 571 | 3300046538 | Ga0495609_0073627 | Ga0495609_0073627_732_1295 | 187 |
| 572 | 3300046538 | Ga0495609_0102447 | Ga0495609_0102447_162_725 | 187 |
| 573 | 3300046558 | Ga0495633_0071738 | Ga0495633_0071738_836_1399 | 187 |
| 574 | 3300046615 | Ga0495656_0156195 | Ga0495656_0156195_141_704 | 187 |
| 575 | 3300046616 | Ga0495668_0064177 | Ga0495668_0064177_457_1020 | 187 |
| 576 | 3300046616 | Ga0495668_0115717 | Ga0495668_0115717_213_776 | 187 |
| 577 | 3300046616 | Ga0495668_0207589 | Ga0495668_0207589_217_780 | 187 |
| 578 | 3300046648 | Ga0495611_0235320 | Ga0495611_0235320_141_704 | 187 |
| 579 | 3300046660 | Ga0495625_0030706 | Ga0495625_0030706_1974_2537 | 187 |
| 580 | 3300046660 | Ga0495625_0052875 | Ga0495625_0052875_2228_2791 | 187 |
| 581 | 3300046660 | Ga0495625_0159985 | Ga0495625_0159985_789_1352 | 187 |
| 582 | 3300046664 | Ga0495659_0009432 | Ga0495659_0009432_527_1090 | 187 |
| 583 | 3300046665 | Ga0495661_0053688 | Ga0495661_0053688_1526_2089 | 187 |
| 584 | 3300046665 | Ga0495661_0189771 | Ga0495661_0189771_308_871 | 187 |
| 585 | 3300046665 | Ga0495661_0195803 | Ga0495661_0195803_336_899 | 187 |
| 586 | 3300046674 | Ga0495588_0047545 | Ga0495588_0047545_504_1067 | 187 |
| 587 | 3300046674 | Ga0495588_0106559 | Ga0495588_0106559_702_1265 | 187 |
| 588 | 3300046678 | Ga0495599_0339471 | Ga0495599_0339471_194_757 | 187 |
| 589 | 3300046681 | Ga0495647_0372286 | Ga0495647_0372286_40_603 | 187 |
| 590 | 3300046684 | Ga0495669_0040598 | Ga0495669_0040598_1178_1741 | 187 |
| 591 | 3300046684 | Ga0495669_0100765 | Ga0495669_0100765_503_1066 | 187 |
| 592 | 3300046691 | Ga0495670_0000834 | Ga0495670_0000834_13112_13675 | 187 |
| 593 | 3300046691 | Ga0495670_0022215 | Ga0495670_0022215_1994_2557 | 187 |
| 594 | 3300046692 | Ga0495671_0074906 | Ga0495671_0074906_431_994 | 187 |
| 595 | 3300046692 | Ga0495671_0101886 | Ga0495671_0101886_815_1378 | 187 |
| 596 | 3300046694 | Ga0495649_0119640 | Ga0495649_0119640_58_621 | 187 |
| 597 | 3300046694 | Ga0495649_0305387 | Ga0495649_0305387_234_797 | 187 |
| 598 | 3300046794 | Ga0495589_0051993 | Ga0495589_0051993_961_1524 | 187 |
| 599 | 3300046794 | Ga0495589_0137409 | Ga0495589_0137409_515_1078 | 187 |
| 600 | 3300046810 | Ga0495660_0288861 | Ga0495660_0288861_160_723 | 187 |
| 601 | 3300047318 | Ga0495636_0067731 | Ga0495636_0067731_217_780 | 187 |
| 602 | 3300047319 | Ga0495674_0719201 | Ga0495674_0719201_29_592 | 187 |
| 603 | 3300047320 | Ga0495672_0000080 | Ga0495672_0000080_35608_36171 | 187 |
| 604 | 3300047320 | Ga0495672_0038383 | Ga0495672_0038383_1292_1855 | 187 |
| 605 | 3300047321 | Ga0495676_0082345 | Ga0495676_0082345_549_1112 | 187 |
| 606 | 3300047323 | Ga0495683_0056437 | Ga0495683_0056437_304_867 | 187 |
| 607 | 3300047323 | Ga0495683_0064255 | Ga0495683_0064255_560_1123 | 187 |
| 608 | 3300047445 | Ga0495677_0024699 | Ga0495677_0024699_649_1212 | 187 |
| 609 | 3300047447 | Ga0495685_069775 | Ga0495685_069775_413_976 | 187 |
| 610 | 3300047469 | Ga0495673_0013372 | Ga0495673_0013372_154_726 | 187 |
| 611 | 3300047469 | Ga0495673_0070236 | Ga0495673_0070236_377_940 | 187 |
| 612 | 3300047470 | Ga0495681_0000066 | Ga0495681_0000066_64495_65067 | 187 |
| 613 | 3300047470 | Ga0495681_0003582 | Ga0495681_0003582_7704_8279 | 187 |
| 614 | 3300047472 | Ga0495686_0008665 | Ga0495686_0008665_3410_3973 | 187 |
| 615 | 3300047472 | Ga0495686_0045797 | Ga0495686_0045797_738_1301 | 187 |
| 616 | 3300047472 | Ga0495686_0103696 | Ga0495686_0103696_442_1005 | 187 |
| 617 | 3300047472 | Ga0495686_0121966 | Ga0495686_0121966_291_854 | 187 |
| 618 | 3300047472 | Ga0495686_0390127 | Ga0495686_0390127_47_610 | 187 |
| 619 | 3300047472 | Ga0495686_0442190 | Ga0495686_0442190_72_635 | 187 |
| 620 | 3300048089 | Ga0495614_0407530 | Ga0495614_0407530_58_621 | 187 |
| 621 | 3300048091 | Ga0495626_0054350 | Ga0495626_0054350_190_753 | 187 |
| 622 | 3300048091 | Ga0495626_0104352 | Ga0495626_0104352_207_770 | 187 |
| 623 | 3300048903 | Ga0496100_0443824 | Ga0496100_0443824_372_935 | 187 |
| 624 | 3300048903 | Ga0496100_0549187 | Ga0496100_0549187_275_838 | 187 |
| 625 | 3300048904 | Ga0496101_0278362 | Ga0496101_0278362_52_615 | 187 |
| 626 | 3300048905 | Ga0496102_0295618 | Ga0496102_0295618_567_1136 | 187 |
| 627 | 3300048907 | Ga0496104_0974340 | Ga0496104_0974340_104_667 | 187 |
| 628 | 3300048908 | Ga0496105_0003062 | Ga0496105_0003062_140_703 | 187 |
| 629 | 3300048910 | Ga0496107_0235246 | Ga0496107_0235246_557_1120 | 187 |
| 630 | 3300048912 | Ga0496109_0849599 | Ga0496109_0849599_40_603 | 187 |
| 631 | 3300048914 | Ga0496111_0032134 | Ga0496111_0032134_67_630 | 187 |
| 632 | 3300048914 | Ga0496111_0362209 | Ga0496111_0362209_130_699 | 187 |
| 633 | 3300048918 | Ga0496115_0384279 | Ga0496115_0384279_519_1082 | 187 |
| 634 | 3300048919 | Ga0496116_0167024 | Ga0496116_0167024_396_965 | 187 |
| 635 | 3300048919 | Ga0496116_0279246 | Ga0496116_0279246_133_696 | 187 |
| 636 | 3300048920 | Ga0496117_0038825 | Ga0496117_0038825_1776_2339 | 187 |
| 637 | 3300048920 | Ga0496117_0099538 | Ga0496117_0099538_1242_1823 | 187 |
| 638 | 3300048920 | Ga0496117_0101806 | Ga0496117_0101806_275_838 | 187 |
| 639 | 3300048920 | Ga0496117_0150340 | Ga0496117_0150340_679_1248 | 187 |
| 640 | 3300048921 | Ga0496118_0003441 | Ga0496118_0003441_14671_15249 | 187 |
| 641 | 3300048921 | Ga0496118_0009983 | Ga0496118_0009983_4662_5225 | 187 |
| 642 | 3300048921 | Ga0496118_0021067 | Ga0496118_0021067_4322_4891 | 187 |
| 643 | 3300048921 | Ga0496118_0026046 | Ga0496118_0026046_1680_2243 | 187 |
| 644 | 3300048921 | Ga0496118_0047460 | Ga0496118_0047460_2151_2714 | 187 |
| 645 | 3300048921 | Ga0496118_0158127 | Ga0496118_0158127_714_1277 | 187 |
| 646 | 3300048921 | Ga0496118_0196842 | Ga0496118_0196842_506_1069 | 187 |
| 647 | 3300048922 | Ga0496119_0006183 | Ga0496119_0006183_1869_2450 | 187 |
| 648 | 3300048922 | Ga0496119_0036268 | Ga0496119_0036268_920_1483 | 187 |
| 649 | 3300048923 | Ga0496120_0009481 | Ga0496120_0009481_3632_4195 | 187 |
| 650 | 3300048923 | Ga0496120_0018241 | Ga0496120_0018241_680_1261 | 187 |
| 651 | 3300048923 | Ga0496120_0204021 | Ga0496120_0204021_82_645 | 187 |
| 652 | 3300048924 | Ga0496121_0001562 | Ga0496121_0001562_30476_31045 | 187 |
| 653 | 3300048924 | Ga0496121_0008832 | Ga0496121_0008832_9068_9631 | 187 |
| 654 | 3300048924 | Ga0496121_0010656 | Ga0496121_0010656_3385_3948 | 187 |
| 655 | 3300048924 | Ga0496121_0013587 | Ga0496121_0013587_2576_3139 | 187 |
| 656 | 3300048924 | Ga0496121_0087101 | Ga0496121_0087101_1337_1900 | 187 |
| 657 | 3300048924 | Ga0496121_0352399 | Ga0496121_0352399_61_624 | 187 |
| 658 | 3300048925 | Ga0496122_0000595 | Ga0496122_0000595_14511_15074 | 187 |
| 659 | 3300048925 | Ga0496122_0000921 | Ga0496122_0000921_38403_38981 | 187 |
| 660 | 3300048925 | Ga0496122_0011498 | Ga0496122_0011498_3464_4045 | 187 |
| 661 | 3300048925 | Ga0496122_0028570 | Ga0496122_0028570_1001_1570 | 187 |
| 662 | 3300048925 | Ga0496122_0101532 | Ga0496122_0101532_1322_1885 | 187 |
| 663 | 3300048926 | Ga0496123_0000211 | Ga0496123_0000211_48538_49101 | 187 |
| 664 | 3300048926 | Ga0496123_0001350 | Ga0496123_0001350_19993_20571 | 187 |
| 665 | 3300048926 | Ga0496123_0009407 | Ga0496123_0009407_4638_5219 | 187 |
| 666 | 3300048926 | Ga0496123_0027629 | Ga0496123_0027629_1891_2460 | 187 |
| 667 | 3300048926 | Ga0496123_0031362 | Ga0496123_0031362_1714_2277 | 187 |
| 668 | 3300048926 | Ga0496123_0116209 | Ga0496123_0116209_61_690 | 187 |
| 669 | 3300048927 | Ga0496124_0002131 | Ga0496124_0002131_13394_13957 | 187 |
| 670 | 3300048927 | Ga0496124_0003192 | Ga0496124_0003192_3468_4037 | 187 |
| 671 | 3300048927 | Ga0496124_0015638 | Ga0496124_0015638_1606_2169 | 187 |
| 672 | 3300048927 | Ga0496124_0026577 | Ga0496124_0026577_149_712 | 187 |
| 673 | 3300048927 | Ga0496124_0050524 | Ga0496124_0050524_1567_2142 | 187 |
| 674 | 3300048928 | Ga0496125_0000664 | Ga0496125_0000664_20770_21333 | 187 |
| 675 | 3300048928 | Ga0496125_0002221 | Ga0496125_0002221_17789_18352 | 187 |
| 676 | 3300048928 | Ga0496125_0020534 | Ga0496125_0020534_2627_3190 | 187 |
| 677 | 3300048928 | Ga0496125_0026608 | Ga0496125_0026608_1916_2479 | 187 |
| 678 | 3300048928 | Ga0496125_0035798 | Ga0496125_0035798_1345_1926 | 187 |
| 679 | 3300048928 | Ga0496125_0047908 | Ga0496125_0047908_450_1013 | 187 |
| 680 | 3300048929 | Ga0496126_0002646 | Ga0496126_0002646_3182_3751 | 187 |
| 681 | 3300048929 | Ga0496126_0044439 | Ga0496126_0044439_2153_2716 | 187 |
| 682 | 3300048929 | Ga0496126_0068420 | Ga0496126_0068420_2085_2648 | 187 |
| 683 | 3300048929 | Ga0496126_0087169 | Ga0496126_0087169_1535_2098 | 187 |
| 684 | 3300048929 | Ga0496126_0111998 | Ga0496126_0111998_379_942 | 187 |
| 685 | 3300048929 | Ga0496126_0113939 | Ga0496126_0113939_1345_1908 | 187 |
| 686 | 3300048929 | Ga0496126_0145105 | Ga0496126_0145105_627_1190 | 187 |
| 687 | 3300048929 | Ga0496126_0270602 | Ga0496126_0270602_769_1341 | 187 |
| 688 | 3300048929 | Ga0496126_0282217 | Ga0496126_0282217_547_1110 | 187 |
| 689 | 3300048929 | Ga0496126_0392422 | Ga0496126_0392422_339_902 | 187 |
| 690 | 3300048929 | Ga0496126_0586039 | Ga0496126_0586039_247_810 | 187 |
| 691 | 3300048929 | Ga0496126_0673917 | Ga0496126_0673917_28_645 | 187 |
| 692 | 3300049459 | Ga0495678_003807 | Ga0495678_003807_4771_5334 | 187 |
| 693 | 3300049459 | Ga0495678_044841 | Ga0495678_044841_1132_1695 | 187 |
| 694 | 3300049459 | Ga0495678_075766 | Ga0495678_075766_38_601 | 187 |
| 695 | 3300049460 | Ga0495682_0021046 | Ga0495682_0021046_1458_2021 | 187 |
| 696 | 3300049460 | Ga0495682_0152973 | Ga0495682_0152973_158_721 | 187 |
| 697 | 3300050490 | nmdc:mga03n38_101664_c1 | nmdc:mga03n38_101664_c1_126_689 | 187 |
| 698 | 3300050491 | nmdc:mga00v17_115485_c1 | nmdc:mga00v17_115485_c1_1069_1632 | 187 |
| 699 | 3300050491 | nmdc:mga00v17_40488_c1 | nmdc:mga00v17_40488_c1_810_1373 | 187 |
| 700 | 3300050492 | nmdc:mga0yw44_28618_c1 | nmdc:mga0yw44_28618_c1_929_1492 | 187 |
| 701 | 3300050492 | nmdc:mga0yw44_36493_c1 | nmdc:mga0yw44_36493_c1_94_657 | 187 |
| 702 | 3300050493 | nmdc:mga0k408_113151_c1 | nmdc:mga0k408_113151_c1_75_638 | 187 |
| 703 | 3300050493 | nmdc:mga0k408_22463_c1 | nmdc:mga0k408_22463_c1_1769_2335 | 187 |
| 704 | 3300050496 | nmdc:mga07m45_65164_c1 | nmdc:mga07m45_65164_c1_330_896 | 187 |
| 705 | 3300050513 | nmdc:mga0rr50_131901_c1 | nmdc:mga0rr50_131901_c1_432_995 | 187 |
| 706 | 3300050516 | nmdc:mga0sz30_31622_c1 | nmdc:mga0sz30_31622_c1_1317_1880 | 187 |
| 707 | 3300053077 | Ga0495601_0488980 | Ga0495601_0488980_93_656 | 187 |
| 708 | 3300053080 | Ga0500635_0016922 | Ga0500635_0016922_1355_1918 | 187 |
| 709 | 3300053083 | Ga0495655_0053228 | Ga0495655_0053228_245_808 | 187 |
| 710 | 3300053087 | Ga0500643_018045 | Ga0500643_018045_237_800 | 187 |
| 711 | 3300053087 | Ga0500643_033600 | Ga0500643_033600_562_1125 | 187 |
| 712 | 3300053088 | Ga0500644_0003200 | Ga0500644_0003200_2961_3524 | 187 |
| 713 | 3300053089 | Ga0500581_146383 | Ga0500581_146383_192_755 | 187 |
| 714 | 3300053090 | Ga0500646_0135900 | Ga0500646_0135900_154_717 | 187 |
| 715 | 3300053093 | Ga0500651_0033217 | Ga0500651_0033217_1547_2110 | 187 |
| 716 | 3300053093 | Ga0500651_0061115 | Ga0500651_0061115_697_1260 | 187 |
| 717 | 3300053093 | Ga0500651_0153368 | Ga0500651_0153368_40_615 | 187 |
| 718 | 3300053094 | Ga0500566_0001318 | Ga0500566_0001318_10240_10803 | 187 |
| 719 | 3300053094 | Ga0500566_0343191 | Ga0500566_0343191_41_604 | 187 |
| 720 | 3300053096 | Ga0500641_0191287 | Ga0500641_0191287_291_854 | 187 |
| 721 | 3300053096 | Ga0500641_0215113 | Ga0500641_0215113_232_795 | 187 |
| 722 | 3300053098 | Ga0500650_0008263 | Ga0500650_0008263_47_610 | 187 |
| 723 | 3300053102 | Ga0500554_017032 | Ga0500554_017032_967_1530 | 187 |
| 724 | 3300053104 | Ga0500556_0000051 | Ga0500556_0000051_28860_29423 | 187 |
| 725 | 3300053104 | Ga0500556_0238817 | Ga0500556_0238817_19_582 | 187 |
| 726 | 3300053108 | Ga0500562_025797 | Ga0500562_025797_345_908 | 187 |
| 727 | 3300053111 | Ga0500572_000449 | Ga0500572_000449_7978_8541 | 187 |
| 728 | 3300053116 | Ga0500592_000572 | Ga0500592_000572_5487_6050 | 187 |
| 729 | 3300053118 | Ga0500594_0000962 | Ga0500594_0000962_3417_3980 | 187 |
| 730 | 3300053119 | Ga0500595_061296 | Ga0500595_061296_370_933 | 187 |
| 731 | 3300053119 | Ga0500595_072753 | Ga0500595_072753_151_714 | 187 |
| 732 | 3300053121 | Ga0500607_095778 | Ga0500607_095778_677_1240 | 187 |
| 733 | 3300053122 | Ga0500608_042483 | Ga0500608_042483_1243_1806 | 187 |
| 734 | 3300053125 | Ga0500618_002682 | Ga0500618_002682_3205_3768 | 187 |
| 735 | 3300053130 | Ga0500642_0000664 | Ga0500642_0000664_6695_7258 | 187 |
| 736 | 3300053131 | Ga0500652_001821 | Ga0500652_001821_2913_3476 | 187 |
| 737 | 3300053134 | Ga0500658_0113978 | Ga0500658_0113978_25_588 | 187 |
| 738 | 3300053134 | Ga0500658_0123021 | Ga0500658_0123021_240_803 | 187 |
| 739 | 3300053136 | Ga0500559_0000419 | Ga0500559_0000419_28462_29025 | 187 |
| 740 | 3300053136 | Ga0500559_0001169 | Ga0500559_0001169_11963_12526 | 187 |
| 741 | 3300053136 | Ga0500559_0003125 | Ga0500559_0003125_1806_2369 | 187 |
| 742 | 3300053136 | Ga0500559_0011464 | Ga0500559_0011464_496_1089 | 187 |
| 743 | 3300053136 | Ga0500559_0195161 | Ga0500559_0195161_167_730 | 187 |
| 744 | 3300053139 | Ga0500568_0001400 | Ga0500568_0001400_7009_7572 | 187 |
| 745 | 3300053140 | Ga0500573_0067037 | Ga0500573_0067037_425_1018 | 187 |
| 746 | 3300053140 | Ga0500573_0069121 | Ga0500573_0069121_1251_1814 | 187 |
| 747 | 3300053142 | Ga0500577_0179666 | Ga0500577_0179666_191_754 | 187 |
| 748 | 3300053148 | Ga0500590_067982 | Ga0500590_067982_17_580 | 187 |
| 749 | 3300053150 | Ga0500603_001245 | Ga0500603_001245_264_827 | 187 |
| 750 | 3300053151 | Ga0500604_0020872 | Ga0500604_0020872_749_1312 | 187 |
| 751 | 3300053153 | Ga0500616_0000150 | Ga0500616_0000150_28684_29247 | 187 |
| 752 | 3300053156 | Ga0500622_0000502 | Ga0500622_0000502_963_1526 | 187 |
| 753 | 3300053156 | Ga0500622_0024835 | Ga0500622_0024835_1631_2194 | 187 |
| 754 | 3300053156 | Ga0500622_0212599 | Ga0500622_0212599_70_633 | 187 |
| 755 | 3300053158 | Ga0500627_0020237 | Ga0500627_0020237_802_1365 | 187 |
| 756 | 3300053158 | Ga0500627_0199345 | Ga0500627_0199345_130_693 | 187 |
| 757 | 3300053161 | Ga0500634_0094947 | Ga0500634_0094947_605_1168 | 187 |
| 758 | 3300053163 | Ga0500639_069785 | Ga0500639_069785_1074_1637 | 187 |
| 759 | 3300053177 | Ga0500636_0144066 | Ga0500636_0144066_631_1194 | 187 |
| 760 | 3300053178 | Ga0500637_0179100 | Ga0500637_0179100_414_977 | 187 |
| 761 | 3300053723 | Ga0500567_179385 | Ga0500567_179385_111_704 | 187 |
| 762 | 3300053725 | Ga0500576_057673 | Ga0500576_057673_351_914 | 187 |
| 763 | 3300053730 | Ga0500645_027875 | Ga0500645_027875_118_681 | 187 |
| 764 | 3300053735 | Ga0500596_002222 | Ga0500596_002222_2145_2708 | 187 |
| 765 | 3300053735 | Ga0500596_006237 | Ga0500596_006237_1035_1598 | 187 |
| 766 | iso_pu_bacteria | 2513237151 | 2513962097 | 187 |
| 767 | iso_pu_bacteria | 2738541298 | 2738833613 | 187 |
| 768 | iso_pu_bacteria | 2738541306 | 2738877020 | 187 |
| 769 | iso_pu_bacteria | 2738543002 | 2739186769 | 187 |
| 770 | iso_pu_bacteria | 2738543008 | 2739223613 | 187 |
| 771 | iso_pu_bacteria | 2842324504 | 2842325362 | 187 |
| 772 | iso_pu_bacteria | 2842348783 | 2842349641 | 187 |
| 773 | iso_pu_bacteria | 2842454564 | 2842455121 | 187 |
| 774 | iso_pu_bacteria | 2855730933 | 2855731746 | 187 |
| 775 | iso_pu_bacteria | 2855767633 | 2855768452 | 187 |
| 776 | iso_pu_bacteria | 2945934425 | 2945939427 | 187 |
| 777 | iso_pu_bacteria | 2990703756 | 2990706770 | 187 |
| 778 | iso_pu_bacteria | 641736151 | 642424689 | 187 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g7s-assembly1.cif.gz_A-2 | the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens | 0.9336 | 3 | 182 |
| 3on4-assembly4.cif.gz_F | crystal structure of tetr transcriptional regulator from legionella pneumophila | 0.9335 | 6 | 184 |
| 3bru-assembly1.cif.gz_B | crystal structure of regulatory protein tetr from rhodobacter sphaeroides | 0.8996 | 7 | 179 |
| 2g7s-assembly1.cif.gz_A-2 | the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens | 0.8954 | 3 | 182 |
| 3on4-assembly4.cif.gz_F | crystal structure of tetr transcriptional regulator from legionella pneumophila | 0.8951 | 6 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ojxA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9283 | 7 | 51 | 1.10.10.60 |
| 3on4C00 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 | 0.928 | 6 | 184 | 1.10.357.10 |
| 4jykB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9277 | 5 | 51 | 1.10.10.60 |
| 1pb6B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.927 | 3 | 51 | 1.10.10.60 |
| 4xk4A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9266 | 5 | 51 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H1JGP3-F1-model_v4 | TetR/AcrR family transcriptional regulator, transcriptional repressor for nem operon | 0.9948 | 56 | 187 |
|
| AF-A0A239G2Q0-F1-model_v4 | Transcriptional regulator, TetR family | 0.9944 | 3 | 187 |
GO:0003677
GO:0006355 |
| AF-A0A261UIG5-F1-model_v4 | TetR family transcriptional regulator | 0.9939 | 5 | 187 |
GO:0003677
GO:0006355 |
| AF-A0A0N8QW18-F1-model_v4 | Putative TetR family transcriptional regulator | 0.993 | 6 | 187 |
GO:0003677
GO:0006355 |
| AF-A0A3M5YFB9-F1-model_v4 | deleted | 0.9919 | 12 | 187 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar