F480424

General Info

Members Datasets Scaffolds Average Seq Length
778 344 1556 155

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0007103|Ga0466963_0007103_4187_4720
Length 177
Sequence MAGIGSDLLHPDARLDHATIIPVVFKLMFLAPRIPPNTGNAIRTAAATGCELHLVEPMGFDLSEPKLRRAGLDYHDLASVTVHASLADAWAALSPQRVFAFTAHAPTSFADVRYRAGDVLMFGPEPTGLDAATLADPHITGQVRIPMLAGRRSLNLSNAAAIAVYEAWRQHGYAGAR

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
182 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
183 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
190 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
200 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
211 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
212 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
213 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
214 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
217 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
218 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
221 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
224 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
225 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
281 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
284 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
319 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
320 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
321 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
322 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
323 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
324 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
325 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
326 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
327 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
328 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
329 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
330 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
331 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
332 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
333 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
334 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
335 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
336 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
337 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
338 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
339 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
340 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
341 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
342 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
343 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
344 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.56
Metatranscriptomes 0.39
Isolates 2.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.87
Nodule 0.13
Rhizoplane 11.18
Rhizosphere 72.88
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0007103 3300044694 Bacteria 6671
2 JGI24746J21847_1006306 3300001977 Bacteria 1842
3 JGI24739J22299_10118198 3300001989 Bacteria 793
4 JGI24743J22301_10088710 3300001991 Bacteria 658
5 JGI24735J21928_10038804 3300002067 Bacteria 1393
6 JGI24745J21846_1017658 3300002073 Bacteria 830
7 JGI24748J21848_1006279 3300002074 Bacteria 1384
8 JGI25407J50210_10139877 3300003373 Bacteria 596
9 Ga0055540_1001102 3300003792 Bacteria 17060
10 Ga0055540_1002635 3300003792 Bacteria 9303
11 Ga0070676_10091460 3300005328 Bacteria 1864
12 Ga0070676_10099059 3300005328 Bacteria 1798
13 Ga0070676_10173799 3300005328 Bacteria 1395
14 Ga0070683_100098269 3300005329 Bacteria 2755
15 Ga0070690_100004124 3300005330 Bacteria 8048
16 Ga0070670_100076870 3300005331 Bacteria 2868
17 Ga0070670_101321862 3300005331 Bacteria 660
18 Ga0068869_100002716 3300005334 Bacteria 10707
19 Ga0068869_100033703 3300005334 Bacteria 3617
20 Ga0070666_10025925 3300005335 Bacteria 3825
21 Ga0070666_10371195 3300005335 Bacteria 1026
22 Ga0070682_100175746 3300005337 Bacteria 1491
23 Ga0070682_100304068 3300005337 Bacteria 1172
24 Ga0070682_100360285 3300005337 Bacteria 1087
25 Ga0068868_100001324 3300005338 Bacteria 17065
26 Ga0068868_100002746 3300005338 Bacteria 12191
27 Ga0068868_100050524 3300005338 Bacteria 3266
28 Ga0068868_100234855 3300005338 Bacteria 1539
29 Ga0070660_100115996 3300005339 Bacteria 2135
30 Ga0070660_101157732 3300005339 Bacteria 655
31 Ga0070689_100019506 3300005340 Bacteria 5015
32 Ga0070691_10006935 3300005341 Bacteria 5185
33 Ga0070687_100670439 3300005343 Bacteria 721
34 Ga0070661_100050576 3300005344 Bacteria 3041
35 Ga0070692_10828354 3300005345 Bacteria 634
36 Ga0070668_100027901 3300005347 Bacteria 4285
37 Ga0070668_100962676 3300005347 Bacteria 765
38 Ga0070669_100023174 3300005353 Bacteria 4444
39 Ga0070669_100158734 3300005353 Bacteria 1756
40 Ga0070675_100083285 3300005354 Bacteria 2670
41 Ga0070671_100002618 3300005355 Bacteria 13925
42 Ga0070671_100129631 3300005355 Bacteria 2124
43 Ga0070671_100167939 3300005355 Bacteria 1855
44 Ga0070671_100379604 3300005355 Bacteria 1208
45 Ga0070674_100143201 3300005356 Bacteria 1796
46 Ga0070673_100039027 3300005364 Bacteria 3631
47 Ga0070673_101657530 3300005364 Bacteria 605
48 Ga0070688_100019480 3300005365 Bacteria 3932
49 Ga0070659_100325270 3300005366 Bacteria 1286
50 Ga0070659_100325660 3300005366 Bacteria 1285
51 Ga0070667_100002373 3300005367 Bacteria 16492
52 Ga0070667_100004253 3300005367 Bacteria 12093
53 Ga0070667_100016240 3300005367 Bacteria 6159
54 Ga0070667_100028841 3300005367 Bacteria 4621
55 Ga0070667_100070887 3300005367 Bacteria 2967
56 Ga0070667_100127229 3300005367 Bacteria 2221
57 Ga0070667_100386501 3300005367 Bacteria 1272
58 Ga0070709_10795081 3300005434 Bacteria 742
59 Ga0070709_11059986 3300005434 Bacteria 647
60 Ga0070714_100130206 3300005435 Bacteria 2248
61 Ga0070714_100189520 3300005435 Bacteria 1876
62 Ga0070714_100223263 3300005435 Bacteria 1732
63 Ga0070714_102081827 3300005435 Bacteria 553
64 Ga0070713_100193545 3300005436 Bacteria 1834
65 Ga0070710_10005315 3300005437 Bacteria 6106
66 Ga0070701_10006838 3300005438 Bacteria 4826
67 Ga0070711_100008932 3300005439 Bacteria 6153
68 Ga0070711_101010545 3300005439 Bacteria 714
69 Ga0070705_100898722 3300005440 Bacteria 712
70 Ga0070700_100202158 3300005441 Bacteria 1396
71 Ga0070700_100255449 3300005441 Bacteria 1259
72 Ga0070700_100541442 3300005441 Bacteria 903
73 Ga0070694_100017886 3300005444 Bacteria 4486
74 Ga0070663_100003573 3300005455 Bacteria 8981
75 Ga0070663_100108884 3300005455 Bacteria 2079
76 Ga0070663_100219770 3300005455 Bacteria 1491
77 Ga0070678_100021136 3300005456 Bacteria 4285
78 Ga0070678_100113382 3300005456 Bacteria 2125
79 Ga0070678_101094884 3300005456 Bacteria 735
80 Ga0070678_101144388 3300005456 Bacteria 720
81 Ga0070662_100113378 3300005457 Bacteria 2068
82 Ga0070662_101083100 3300005457 Bacteria 687
83 Ga0068867_100008839 3300005459 Bacteria 7109
84 Ga0070685_10010167 3300005466 Bacteria 4885
85 Ga0070685_10019292 3300005466 Bacteria 3677
86 Ga0070679_100520773 3300005530 Bacteria 1133
87 Ga0070679_100772073 3300005530 Bacteria 904
88 Ga0070679_100973846 3300005530 Bacteria 792
89 Ga0070684_100125464 3300005535 Bacteria 2312
90 Ga0070684_101094360 3300005535 Bacteria 749
91 Ga0068853_100046547 3300005539 Bacteria 3720
92 Ga0068853_100096245 3300005539 Bacteria 2612
93 Ga0070672_100023185 3300005543 Bacteria 4572
94 Ga0070695_100010683 3300005545 Bacteria 5485
95 Ga0070696_100026141 3300005546 Bacteria 3971
96 Ga0070693_100008103 3300005547 Bacteria 5160
97 Ga0070693_100061368 3300005547 Bacteria 2185
98 Ga0070665_100002795 3300005548 Bacteria 18921
99 Ga0070665_100025925 3300005548 Bacteria 5904
100 Ga0070665_100029757 3300005548 Bacteria 5496
101 Ga0070665_100036425 3300005548 Bacteria 4948
102 Ga0070665_100490195 3300005548 Bacteria 1240
103 Ga0070704_100023422 3300005549 Bacteria 4033
104 Ga0070704_100381741 3300005549 Bacteria 1197
105 Ga0070664_100008217 3300005564 Bacteria 8439
106 Ga0068854_100025801 3300005578 Bacteria 4033
107 Ga0068854_100625808 3300005578 Bacteria 921
108 Ga0068856_100104297 3300005614 Bacteria 2829
109 Ga0068856_100492802 3300005614 Bacteria 1246
110 Ga0068856_101530618 3300005614 Bacteria 681
111 Ga0068856_101556462 3300005614 Bacteria 675
112 Ga0070702_100019961 3300005615 Bacteria 3504
113 Ga0070702_100065112 3300005615 Bacteria 2134
114 Ga0070702_100106579 3300005615 Bacteria 1729
115 Ga0068852_100006381 3300005616 Bacteria 8518
116 Ga0068852_100469245 3300005616 Bacteria 1249
117 Ga0068859_100003603 3300005617 Bacteria 15790
118 Ga0068859_100003801 3300005617 Bacteria 15405
119 Ga0068859_100003849 3300005617 Bacteria 15336
120 Ga0068859_100120598 3300005617 Bacteria 2689
121 Ga0068859_100212464 3300005617 Bacteria 2021
122 Ga0068859_100569927 3300005617 Bacteria 1226
123 Ga0068864_100101756 3300005618 Bacteria 2549
124 Ga0068864_100417785 3300005618 Bacteria 1277
125 Ga0068864_100670389 3300005618 Bacteria 1011
126 Ga0068864_101140416 3300005618 Bacteria 777
127 Ga0068866_10001022 3300005718 Bacteria 12313
128 Ga0068861_100000270 3300005719 Bacteria 28965
129 Ga0068861_100081316 3300005719 Bacteria 2536
130 Ga0068861_100176538 3300005719 Bacteria 1774
131 Ga0068851_10626064 3300005834 Bacteria 657
132 Ga0068870_10323841 3300005840 Bacteria 980
133 Ga0068870_10435358 3300005840 Bacteria 861
134 Ga0068863_100002822 3300005841 Bacteria 17205
135 Ga0068863_100003114 3300005841 Bacteria 16369
136 Ga0068863_101725491 3300005841 Bacteria 636
137 Ga0068858_100003721 3300005842 Bacteria 15098
138 Ga0068858_100004471 3300005842 Bacteria 13709
139 Ga0068858_100005156 3300005842 Bacteria 12801
140 Ga0068858_100230455 3300005842 Bacteria 1756
141 Ga0068858_100266110 3300005842 Bacteria 1630
142 Ga0068860_100000016 3300005843 Bacteria 310468
143 Ga0068860_100001320 3300005843 Bacteria 26894
144 Ga0068860_100030125 3300005843 Bacteria 5219
145 Ga0068860_100062773 3300005843 Bacteria 3530
146 Ga0068860_100382669 3300005843 Bacteria 1389
147 Ga0068862_100000051 3300005844 Bacteria 145362
148 Ga0068862_100001679 3300005844 Bacteria 20044
149 Ga0068862_100029106 3300005844 Bacteria 4652
150 Ga0081455_10007340 3300005937 Bacteria 11625
151 Ga0081455_10079850 3300005937 Bacteria 2684
152 Ga0081538_10099354 3300005981 Bacteria 1471
153 Ga0075365_10044566 3300006038 Bacteria 2907
154 Ga0075365_10386143 3300006038 Bacteria 988
155 Ga0075368_10052578 3300006042 Bacteria 1621
156 Ga0075363_100053122 3300006048 Bacteria 2164
157 Ga0075363_100111255 3300006048 Bacteria 1522
158 Ga0075363_100119711 3300006048 Bacteria 1469
159 Ga0075363_100262685 3300006048 Bacteria 996
160 Ga0075363_100355729 3300006048 Bacteria 856
161 Ga0075364_10008785 3300006051 Bacteria 6046
162 Ga0075364_10013575 3300006051 Bacteria 5012
163 Ga0075364_10042624 3300006051 Bacteria 2949
164 Ga0075364_10749659 3300006051 Bacteria 666
165 Ga0070716_100007009 3300006173 Bacteria 5528
166 Ga0070716_100183771 3300006173 Bacteria 1375
167 Ga0075362_10018252 3300006177 Bacteria 2900
168 Ga0075367_10045804 3300006178 Bacteria 2568
169 Ga0075367_10105052 3300006178 Bacteria 1729
170 Ga0075369_10037108 3300006186 Bacteria 2075
171 Ga0075369_10044745 3300006186 Bacteria 1902
172 Ga0075369_10112200 3300006186 Bacteria 1229
173 Ga0075369_10131164 3300006186 Bacteria 1139
174 Ga0097621_100189640 3300006237 Bacteria 1780
175 Ga0075370_10028984 3300006353 Bacteria 3080
176 Ga0075370_10038980 3300006353 Bacteria 2676
177 Ga0075370_10043723 3300006353 Bacteria 2532
178 Ga0075370_10074674 3300006353 Bacteria 1943
179 Ga0075370_10273549 3300006353 Bacteria 1003
180 Ga0068871_100006897 3300006358 Bacteria 8087
181 Ga0068871_100447429 3300006358 Bacteria 1157
182 Ga0068865_100000685 3300006881 Bacteria 19088
183 Ga0068865_100037101 3300006881 Bacteria 3289
184 Ga0097620_100003604 3300006931 Bacteria 15790
185 Ga0097620_100003801 3300006931 Bacteria 15405
186 Ga0097620_100003849 3300006931 Bacteria 15336
187 Ga0097620_100120612 3300006931 Bacteria 2689
188 Ga0097620_100212474 3300006931 Bacteria 2021
189 Ga0097620_100569868 3300006931 Bacteria 1226
190 Ga0075435_100449702 3300007076 Bacteria 1111
191 Ga0105250_10028965 3300009092 Bacteria 2228
192 Ga0105240_10443691 3300009093 Bacteria 1454
193 Ga0105240_10814150 3300009093 Bacteria 1011
194 Ga0111539_10080732 3300009094 Bacteria 3825
195 Ga0105245_10002885 3300009098 Bacteria 15437
196 Ga0105245_10021077 3300009098 Bacteria 5717
197 Ga0105245_10075878 3300009098 Bacteria 3062
198 Ga0105245_10845295 3300009098 Bacteria 955
199 Ga0105245_11975814 3300009098 Bacteria 637
200 Ga0105247_10000017 3300009101 Bacteria 260438
201 Ga0105247_10001432 3300009101 Bacteria 17294
202 Ga0105247_10007485 3300009101 Bacteria 6695
203 Ga0105247_10030027 3300009101 Bacteria 3295
204 Ga0105247_10081126 3300009101 Bacteria 2044
205 Ga0105243_10003841 3300009148 Bacteria 12006
206 Ga0105243_10584890 3300009148 Bacteria 1072
207 Ga0105241_11300485 3300009174 Bacteria 692
208 Ga0105242_10005602 3300009176 Bacteria 9690
209 Ga0105242_10364838 3300009176 Bacteria 1338
210 Ga0105248_10000025 3300009177 Bacteria 259691
211 Ga0105248_10003234 3300009177 Bacteria 18068
212 Ga0105248_10036826 3300009177 Bacteria 5472
213 Ga0105248_10043695 3300009177 Bacteria 5025
214 Ga0105248_10267049 3300009177 Bacteria 1926
215 Ga0105248_11036017 3300009177 Bacteria 927
216 Ga0105248_11143882 3300009177 Bacteria 880
217 Ga0105237_10000745 3300009545 Bacteria 44856
218 Ga0105237_10013198 3300009545 Bacteria 8668
219 Ga0105237_10020061 3300009545 Bacteria 6900
220 Ga0105237_10990075 3300009545 Bacteria 848
221 Ga0105238_10020619 3300009551 Bacteria 6715
222 Ga0105238_11422633 3300009551 Bacteria 721
223 Ga0105249_10000021 3300009553 Bacteria 260448
224 Ga0105249_10002204 3300009553 Bacteria 16877
225 Ga0105249_10033363 3300009553 Bacteria 4660
226 Ga0105249_10414823 3300009553 Bacteria 1379
227 Ga0105239_10001328 3300010375 Bacteria 33299
228 Ga0105239_10020371 3300010375 Bacteria 7316
229 Ga0105239_10031369 3300010375 Bacteria 5846
230 Ga0105239_10127607 3300010375 Bacteria 2828
231 Ga0105239_10283497 3300010375 Bacteria 1865
232 Ga0105239_10579832 3300010375 Bacteria 1279
233 Ga0105246_10001666 3300011119 Bacteria 13224
234 Ga0105246_10155377 3300011119 Bacteria 1737
235 Ga0157369_10304649 3300013105 Bacteria 1657
236 Ga0157374_10017544 3300013296 Bacteria 6306
237 Ga0157374_10025509 3300013296 Bacteria 5309
238 Ga0157374_10587301 3300013296 Bacteria 1123
239 Ga0157378_10009639 3300013297 Bacteria 8407
240 Ga0157378_10969711 3300013297 Bacteria 883
241 Ga0163162_10012440 3300013306 Bacteria 8314
242 Ga0163162_10059117 3300013306 Bacteria 3864
243 Ga0163162_10119227 3300013306 Bacteria 2741
244 Ga0163162_10176077 3300013306 Bacteria 2265
245 Ga0163162_10235230 3300013306 Bacteria 1962
246 Ga0163162_10837429 3300013306 Bacteria 1036
247 Ga0157372_10006154 3300013307 Bacteria 12757
248 Ga0157375_10013607 3300013308 Bacteria 7249
249 Ga0157375_10388402 3300013308 Bacteria 1562
250 Ga0157375_10564099 3300013308 Bacteria 1299
251 Ga0157375_11337560 3300013308 Bacteria 843
252 Ga0157375_12736616 3300013308 Bacteria 590
253 Ga0163163_10005761 3300014325 Bacteria 10759
254 Ga0163163_10139323 3300014325 Bacteria 2468
255 Ga0163163_10189240 3300014325 Bacteria 2107
256 Ga0163163_10247511 3300014325 Bacteria 1833
257 Ga0163163_10790638 3300014325 Bacteria 1012
258 Ga0157380_10004514 3300014326 Bacteria 9654
259 Ga0157380_10207701 3300014326 Bacteria 1742
260 Ga0157380_10961760 3300014326 Bacteria 885
261 Ga0157379_10007305 3300014968 Bacteria 9559
262 Ga0157379_10057929 3300014968 Bacteria 3462
263 Ga0163161_10007316 3300017792 Bacteria 7618
264 Ga0163161_10056342 3300017792 Bacteria 2854
265 Ga0163161_10668575 3300017792 Bacteria 862
266 Ga0197907_10879848 3300020069 Bacteria 952
267 Ga0206354_10023607 3300020081 Bacteria 1775
268 Ga0206353_11808613 3300020082 Bacteria 687
269 Ga0213872_10069523 3300021361 Bacteria 1588
270 Ga0213876_10002857 3300021384 Bacteria 10036
271 Ga0213876_10019073 3300021384 Bacteria 3622
272 Ga0213875_10012643 3300021388 Bacteria 4159
273 Ga0209051_1001777 3300025303 Bacteria 17112
274 Ga0209051_1002102 3300025303 Bacteria 14961
275 Ga0207656_10025895 3300025321 Bacteria 2386
276 Ga0207692_10002331 3300025898 Bacteria 7286
277 Ga0207642_10000980 3300025899 Bacteria 8908
278 Ga0207710_10000033 3300025900 Bacteria 260531
279 Ga0207710_10006967 3300025900 Bacteria 4807
280 Ga0207710_10031025 3300025900 Bacteria 2335
281 Ga0207710_10288720 3300025900 Bacteria 827
282 Ga0207688_10000368 3300025901 Bacteria 20985
283 Ga0207688_10002019 3300025901 Bacteria 10890
284 Ga0207680_10077031 3300025903 Bacteria 2084
285 Ga0207680_10093579 3300025903 Bacteria 1917
286 Ga0207647_10091394 3300025904 Bacteria 1815
287 Ga0207647_10104094 3300025904 Bacteria 1682
288 Ga0207647_10311693 3300025904 Bacteria 895
289 Ga0207685_10134706 3300025905 Bacteria 1101
290 Ga0207699_10537107 3300025906 Bacteria 847
291 Ga0207699_10908502 3300025906 Bacteria 650
292 Ga0207645_10034578 3300025907 Bacteria 3247
293 Ga0207643_10119925 3300025908 Bacteria 1557
294 Ga0207643_10327690 3300025908 Bacteria 958
295 Ga0207695_10373386 3300025913 Bacteria 1312
296 Ga0207671_10013580 3300025914 Bacteria 6480
297 Ga0207671_10060143 3300025914 Bacteria 2818
298 Ga0207671_10414601 3300025914 Bacteria 1071
299 Ga0207671_10589314 3300025914 Bacteria 886
300 Ga0207693_10003780 3300025915 Bacteria 12889
301 Ga0207693_10787942 3300025915 Bacteria 733
302 Ga0207693_10922279 3300025915 Bacteria 669
303 Ga0207663_10208510 3300025916 Bacteria 1415
304 Ga0207662_10599612 3300025918 Bacteria 766
305 Ga0207657_10262476 3300025919 Bacteria 1374
306 Ga0207657_10336773 3300025919 Bacteria 1191
307 Ga0207649_10216032 3300025920 Bacteria 1363
308 Ga0207681_10302972 3300025923 Bacteria 1265
309 Ga0207681_10862523 3300025923 Bacteria 757
310 Ga0207694_10020506 3300025924 Bacteria 5002
311 Ga0207694_10194462 3300025924 Bacteria 1649
312 Ga0207694_11137686 3300025924 Bacteria 661
313 Ga0207650_10292357 3300025925 Bacteria 1329
314 Ga0207687_10054818 3300025927 Bacteria 2791
315 Ga0207687_10541571 3300025927 Bacteria 976
316 Ga0207700_10087887 3300025928 Bacteria 2445
317 Ga0207664_10173896 3300025929 Bacteria 1845
318 Ga0207664_10181301 3300025929 Bacteria 1808
319 Ga0207664_10549310 3300025929 Bacteria 1036
320 Ga0207664_10597988 3300025929 Bacteria 990
321 Ga0207644_10003820 3300025931 Bacteria 9757
322 Ga0207644_10099489 3300025931 Bacteria 2182
323 Ga0207690_10862499 3300025932 Bacteria 750
324 Ga0207706_10103768 3300025933 Bacteria 2501
325 Ga0207706_10132340 3300025933 Bacteria 2194
326 Ga0207686_10004197 3300025934 Bacteria 7728
327 Ga0207709_10005649 3300025935 Bacteria 7069
328 Ga0207709_10238193 3300025935 Bacteria 1322
329 Ga0207670_10005137 3300025936 Bacteria 7152
330 Ga0207670_10094351 3300025936 Bacteria 2123
331 Ga0207669_10243031 3300025937 Bacteria 1335
332 Ga0207704_10002187 3300025938 Bacteria 8763
333 Ga0207665_10028793 3300025939 Bacteria 3672
334 Ga0207665_10296196 3300025939 Bacteria 1208
335 Ga0207691_10048199 3300025940 Bacteria 3907
336 Ga0207711_10000390 3300025941 Bacteria 46512
337 Ga0207711_10040236 3300025941 Bacteria 3976
338 Ga0207711_10069330 3300025941 Bacteria 3056
339 Ga0207711_10128164 3300025941 Bacteria 2272
340 Ga0207711_10193800 3300025941 Bacteria 1853
341 Ga0207689_10012018 3300025942 Bacteria 7419
342 Ga0207661_10127796 3300025944 Bacteria 2173
343 Ga0207679_10072885 3300025945 Bacteria 2596
344 Ga0207667_10594621 3300025949 Bacteria 1116
345 Ga0207651_10053950 3300025960 Bacteria 2751
346 Ga0207651_10108112 3300025960 Bacteria 2081
347 Ga0207712_10000005 3300025961 Bacteria 608697
348 Ga0207712_10037702 3300025961 Bacteria 3300
349 Ga0207712_10330250 3300025961 Bacteria 1261
350 Ga0207668_10001360 3300025972 Bacteria 14447
351 Ga0207668_10039224 3300025972 Bacteria 3186
352 Ga0207640_10112635 3300025981 Bacteria 1932
353 Ga0207640_10127812 3300025981 Bacteria 1832
354 Ga0207640_10155889 3300025981 Bacteria 1683
355 Ga0207658_10001262 3300025986 Bacteria 19997
356 Ga0207658_10024249 3300025986 Bacteria 4242
357 Ga0207658_10041956 3300025986 Bacteria 3316
358 Ga0207658_10045930 3300025986 Bacteria 3186
359 Ga0207658_10596360 3300025986 Bacteria 992
360 Ga0207658_10885568 3300025986 Bacteria 812
361 Ga0207677_10009000 3300026023 Bacteria 5602
362 Ga0207677_10306949 3300026023 Bacteria 1313
363 Ga0207677_10418851 3300026023 Bacteria 1140
364 Ga0207677_10968272 3300026023 Bacteria 770
365 Ga0207703_10030925 3300026035 Bacteria 4232
366 Ga0207703_10036714 3300026035 Bacteria 3901
367 Ga0207703_10457731 3300026035 Bacteria 1193
368 Ga0207639_10284613 3300026041 Bacteria 1455
369 Ga0207639_10567679 3300026041 Bacteria 1043
370 Ga0207639_10904480 3300026041 Bacteria 825
371 Ga0207678_10017171 3300026067 Bacteria 6353
372 Ga0207678_10058531 3300026067 Bacteria 3316
373 Ga0207678_10085283 3300026067 Bacteria 2700
374 Ga0207678_10153572 3300026067 Bacteria 1966
375 Ga0207678_10237382 3300026067 Bacteria 1561
376 Ga0207678_10424366 3300026067 Bacteria 1153
377 Ga0207678_10461261 3300026067 Bacteria 1105
378 Ga0207708_10001654 3300026075 Bacteria 16572
379 Ga0207708_10362785 3300026075 Bacteria 1191
380 Ga0207702_10127219 3300026078 Bacteria 2289
381 Ga0207641_10001387 3300026088 Bacteria 23866
382 Ga0207641_10005444 3300026088 Bacteria 10864
383 Ga0207648_10013368 3300026089 Bacteria 7640
384 Ga0207676_10001045 3300026095 Bacteria 21108
385 Ga0207676_10547096 3300026095 Bacteria 1105
386 Ga0207676_10659074 3300026095 Bacteria 1011
387 Ga0207676_11482155 3300026095 Bacteria 675
388 Ga0207675_100009432 3300026118 Bacteria 9135
389 Ga0207675_100701183 3300026118 Bacteria 1021
390 Ga0207675_100826907 3300026118 Bacteria 940
391 Ga0207683_10011348 3300026121 Bacteria 7603
392 Ga0207683_10333027 3300026121 Bacteria 1391
393 Ga0207698_10017217 3300026142 Bacteria 4897
394 Ga0209813_10014539 3300027866 Bacteria 2120
395 Ga0207428_10537362 3300027907 Bacteria 846
396 Ga0268266_10005558 3300028379 Bacteria 11732
397 Ga0268266_10013784 3300028379 Bacteria 6960
398 Ga0268266_10607210 3300028379 Bacteria 1051
399 Ga0268265_10000022 3300028380 Bacteria 270788
400 Ga0268265_10007108 3300028380 Bacteria 7557
401 Ga0268264_10000005 3300028381 Bacteria 934972
402 Ga0268264_10002009 3300028381 Bacteria 18275
403 Ga0268264_10390210 3300028381 Bacteria 1335
404 Ga0268264_12468591 3300028381 Bacteria 525
405 Ga0307512_10219742 3300030522 Bacteria 995
406 Ga0265327_10000019 3300031251 Bacteria 427653
407 Ga0316576_10009877 3300031727 Bacteria 6178
408 Ga0316578_10022854 3300031728 Bacteria 3493
409 Ga0316577_10035653 3300031733 Bacteria 2780
410 Ga0307413_10168241 3300031824 Bacteria 1548
411 Ga0307410_10383838 3300031852 Bacteria 1131
412 Ga0307416_100052549 3300032002 Bacteria 3263
413 Ga0307414_10170606 3300032004 Bacteria 1739
414 Ga0307415_100140089 3300032126 Bacteria 1846
415 Ga0316580_10010501 3300032139 Bacteria 2801
416 Ga0373948_0191339 3300034817 Bacteria 530
417 Ga0373956_0046790 3300035119 Bacteria 1934
418 Ga0373960_0040046 3300035121 Bacteria 1351
419 Ga0373943_0561848 3300035170 Bacteria 670
420 Ga0373955_0003290 3300035172 Bacteria 7088
421 Ga0316574_0020283 3300035398 Bacteria 3933
422 Ga0373933_0244935 3300035724 Bacteria 1153
423 Ga0373947_0460350 3300035725 Bacteria 862
424 Ga0373937_0128731 3300036401 Bacteria 2363
425 Ga0316582_0072860 3300036647 Bacteria 2228
426 Ga0316584_0017179 3300036712 Bacteria 5197
427 Ga0316584_0358061 3300036712 Bacteria 1046
428 Ga0373925_0763266 3300037068 Bacteria 797
429 Ga0395900_0413959 3300037418 Bacteria 1310
430 Ga0436364_0178326 3300037853 Bacteria 9377
431 Ga0400485_21326 3300038735 Unclassified 3902
432 Ga0436365_0133306 3300039437 Bacteria 59687
433 Ga0436365_0393632 3300039437 Bacteria 30038
434 Ga0436365_1406222 3300039437 Bacteria 3063
435 Ga0436361_1162518 3300039447 Bacteria 1476
436 Ga0436363_0849090 3300039450 Bacteria 606
437 Ga0436363_1654988 3300039450 Bacteria 685
438 Ga0436362_0829052 3300039453 Bacteria 1019
439 Ga0439461_0027844 3300041410 Bacteria 1161
440 Ga0439466_0008319 3300041411 Bacteria 3910
441 Ga0439466_0034131 3300041411 Bacteria 1726
442 Ga0439465_0015108 3300041413 Bacteria 2409
443 Ga0439465_0026879 3300041413 Bacteria 1821
444 Ga0451802_0749428 3300041460 Bacteria 1167
445 Ga0451835_0752417 3300041492 Bacteria 526
446 Ga0451839_1597037 3300041496 Bacteria 972
447 Ga0451853_0572343 3300041512 Bacteria 710
448 Ga0451853_3243727 3300041512 Bacteria 686
449 Ga0439448_0016235 3300042005 Bacteria 2264
450 Ga0439435_0197511 3300042436 Bacteria 662
451 Ga0439459_0000789 3300042438 Bacteria 4379
452 Ga0466969_0010564 3300044656 Bacteria 4893
453 Ga0466969_0037831 3300044656 Bacteria 2432
454 Ga0466969_0290652 3300044656 Bacteria 740
455 Ga0466972_0009271 3300044658 Bacteria 4945
456 Ga0466972_0013691 3300044658 Bacteria 4069
457 Ga0466965_0012053 3300044683 Bacteria 4060
458 Ga0466965_0072495 3300044683 Bacteria 1733
459 Ga0466965_0175790 3300044683 Bacteria 1128
460 Ga0466965_0736405 3300044683 Bacteria 567
461 Ga0466966_0002022 3300044684 Bacteria 13164
462 Ga0466966_0007192 3300044684 Bacteria 7376
463 Ga0466966_0061593 3300044684 Bacteria 2366
464 Ga0466961_0002938 3300044693 Bacteria 10582
465 Ga0466961_0009619 3300044693 Bacteria 6153
466 Ga0466961_0057416 3300044693 Bacteria 2478
467 Ga0466961_0087619 3300044693 Bacteria 1967
468 Ga0466961_0148112 3300044693 Bacteria 1467
469 Ga0466961_0150322 3300044693 Bacteria 1454
470 Ga0466961_0210521 3300044693 Bacteria 1200
471 Ga0466963_0008684 3300044694 Bacteria 6099
472 Ga0466963_0046163 3300044694 Bacteria 2871
473 Ga0466963_0188455 3300044694 Bacteria 1441
474 Ga0466963_0223380 3300044694 Bacteria 1319
475 Ga0466963_0229757 3300044694 Bacteria 1300
476 Ga0466963_0290381 3300044694 Bacteria 1150
477 Ga0466971_0089821 3300044719 Bacteria 1406
478 Ga0466971_0136195 3300044719 Bacteria 1142
479 Ga0466971_0235806 3300044719 Bacteria 869
480 Ga0466971_0446472 3300044719 Bacteria 634
481 Ga0466968_0073852 3300044735 Bacteria 1488
482 Ga0466968_0075129 3300044735 Bacteria 1477
483 Ga0466968_0082029 3300044735 Bacteria 1418
484 Ga0466968_0098515 3300044735 Bacteria 1303
485 Ga0466970_0002489 3300044765 Bacteria 8895
486 Ga0466970_0012926 3300044765 Bacteria 4275
487 Ga0466970_0029435 3300044765 Bacteria 2891
488 Ga0466970_0051365 3300044765 Bacteria 2200
489 Ga0466970_0494051 3300044765 Bacteria 704
490 Ga0466957_0021395 3300044842 Bacteria 3810
491 Ga0466957_0082925 3300044842 Bacteria 1999
492 Ga0466957_0197542 3300044842 Bacteria 1320
493 Ga0466957_0744969 3300044842 Bacteria 693
494 Ga0466960_0012164 3300044901 Bacteria 3623
495 Ga0466960_0100643 3300044901 Bacteria 1488
496 Ga0466960_0176994 3300044901 Bacteria 1154
497 Ga0466959_0001602 3300045049 Bacteria 13955
498 Ga0466959_0049731 3300045049 Bacteria 3080
499 Ga0466959_0328516 3300045049 Bacteria 1044
500 Ga0466959_0606750 3300045049 Bacteria 736
501 Ga0466959_1075458 3300045049 Bacteria 535
502 Ga0451576_0164731 3300045051 Bacteria 2313
503 Ga0466958_0004372 3300045836 Bacteria 7454
504 Ga0466958_0008215 3300045836 Bacteria 5781
505 Ga0466958_0010080 3300045836 Bacteria 5282
506 Ga0466958_0044365 3300045836 Bacteria 2680
507 Ga0466958_0086412 3300045836 Bacteria 1935
508 Ga0466958_0164732 3300045836 Bacteria 1402
509 Ga0466958_0244797 3300045836 Bacteria 1146
510 Ga0466958_0752174 3300045836 Bacteria 635
511 Ga0466958_1030142 3300045836 Bacteria 537
512 Ga0466967_0001096 3300045976 Bacteria 14982
513 Ga0466967_0018533 3300045976 Bacteria 5567
514 Ga0466967_0023199 3300045976 Bacteria 5081
515 Ga0466967_0085079 3300045976 Bacteria 2863
516 Ga0466967_0349644 3300045976 Bacteria 1431
517 Ga0466967_0703420 3300045976 Bacteria 1001
518 Ga0466967_0781336 3300045976 Bacteria 948
519 Ga0495592_0125486 3300046454 Bacteria 1802
520 Ga0495603_0041665 3300046455 Bacteria 2745
521 Ga0495629_0005249 3300046459 Bacteria 9685
522 Ga0495638_0030497 3300046460 Bacteria 3470
523 Ga0495651_0675037 3300046462 Bacteria 646
524 Ga0495580_0595722 3300046472 Bacteria 731
525 Ga0495582_0056388 3300046473 Bacteria 2165
526 Ga0495639_0078936 3300046475 Bacteria 1530
527 Ga0495606_0040470 3300046507 Bacteria 3133
528 Ga0495620_0124790 3300046515 Bacteria 1013
529 Ga0495620_0254246 3300046515 Bacteria 670
530 Ga0495630_0233073 3300046517 Bacteria 1407
531 Ga0495648_0001768 3300046524 Bacteria 20851
532 Ga0495652_0970623 3300046529 Bacteria 557
533 Ga0495654_0042351 3300046530 Bacteria 2261
534 Ga0495665_0007893 3300046531 Bacteria 5769
535 Ga0495640_0043397 3300046533 Bacteria 3132
536 Ga0495588_0138560 3300046674 Bacteria 1285
537 Ga0495658_0710366 3300046683 Bacteria 644
538 Ga0495624_0035425 3300046690 Bacteria 3223
539 Ga0495649_0286480 3300046694 Bacteria 841
540 Ga0495581_0008106 3300047315 Bacteria 6083
541 Ga0495636_0508218 3300047318 Bacteria 583
542 Ga0495674_0010640 3300047319 Bacteria 8704
543 Ga0495672_0001641 3300047320 Bacteria 21761
544 Ga0495672_0152753 3300047320 Bacteria 1196
545 Ga0495676_0424898 3300047321 Bacteria 879
546 Ga0495673_0000949 3300047469 Bacteria 26223
547 Ga0495686_0002701 3300047472 Bacteria 16248
548 Ga0495686_0087903 3300047472 Bacteria 1890
549 Ga0495593_0005299 3300047673 Bacteria 7619
550 Ga0496100_0001287 3300048903 Bacteria 12243
551 Ga0496100_0013874 3300048903 Bacteria 4662
552 Ga0496100_0132018 3300048903 Bacteria 1760
553 Ga0496100_0285474 3300048903 Bacteria 1231
554 Ga0496100_0924615 3300048903 Bacteria 685
555 Ga0496101_0000002 3300048904 Bacteria 410971
556 Ga0496101_0000933 3300048904 Bacteria 17243
557 Ga0496101_0006508 3300048904 Bacteria 7522
558 Ga0496101_0044913 3300048904 Bacteria 3163
559 Ga0496101_0345791 3300048904 Bacteria 1168
560 Ga0496101_0932388 3300048904 Bacteria 683
561 Ga0496102_0000003 3300048905 Bacteria 592263
562 Ga0496102_0000782 3300048905 Bacteria 30949
563 Ga0496102_0034519 3300048905 Bacteria 4550
564 Ga0496102_0102925 3300048905 Bacteria 2655
565 Ga0496102_0109481 3300048905 Bacteria 2574
566 Ga0496102_0135057 3300048905 Bacteria 2311
567 Ga0496102_0162908 3300048905 Bacteria 2098
568 Ga0496102_0478115 3300048905 Bacteria 1167
569 Ga0496102_0506584 3300048905 Bacteria 1129
570 Ga0496102_1309946 3300048905 Bacteria 643
571 Ga0496103_0000014 3300048906 Bacteria 290397
572 Ga0496103_0000515 3300048906 Bacteria 31901
573 Ga0496103_0005127 3300048906 Bacteria 7888
574 Ga0496103_0132003 3300048906 Bacteria 1595
575 Ga0496103_0133805 3300048906 Bacteria 1584
576 Ga0496103_0320256 3300048906 Bacteria 997
577 Ga0496103_0472548 3300048906 Bacteria 803
578 Ga0496104_0015477 3300048907 Bacteria 6908
579 Ga0496104_0026925 3300048907 Bacteria 5315
580 Ga0496104_0079337 3300048907 Bacteria 3129
581 Ga0496104_0226225 3300048907 Bacteria 1783
582 Ga0496104_0402123 3300048907 Bacteria 1282
583 Ga0496104_0416455 3300048907 Bacteria 1256
584 Ga0496104_0676384 3300048907 Bacteria 940
585 Ga0496105_0009653 3300048908 Bacteria 7555
586 Ga0496105_0080763 3300048908 Bacteria 2686
587 Ga0496105_0130155 3300048908 Bacteria 2075
588 Ga0496105_0367110 3300048908 Bacteria 1147
589 Ga0496105_0513487 3300048908 Bacteria 939
590 Ga0496105_0567520 3300048908 Bacteria 884
591 Ga0496105_1391607 3300048908 Bacteria 508
592 Ga0496106_0006137 3300048909 Bacteria 8888
593 Ga0496106_0010999 3300048909 Bacteria 6690
594 Ga0496106_0077110 3300048909 Bacteria 2555
595 Ga0496106_0081910 3300048909 Bacteria 2480
596 Ga0496106_0113614 3300048909 Bacteria 2111
597 Ga0496106_0311029 3300048909 Bacteria 1264
598 Ga0496106_1069093 3300048909 Bacteria 633
599 Ga0496107_0001748 3300048910 Bacteria 13670
600 Ga0496107_0062420 3300048910 Bacteria 2699
601 Ga0496107_0104046 3300048910 Bacteria 2083
602 Ga0496107_0169238 3300048910 Bacteria 1621
603 Ga0496108_0000369 3300048911 Bacteria 37803
604 Ga0496108_0051416 3300048911 Bacteria 3452
605 Ga0496108_0099990 3300048911 Bacteria 2473
606 Ga0496108_0214382 3300048911 Bacteria 1672
607 Ga0496108_0628649 3300048911 Bacteria 934
608 Ga0496108_1145163 3300048911 Bacteria 659
609 Ga0496109_0003399 3300048912 Bacteria 13314
610 Ga0496109_0010688 3300048912 Bacteria 7853
611 Ga0496109_0011451 3300048912 Bacteria 7626
612 Ga0496109_0062908 3300048912 Bacteria 3394
613 Ga0496109_0222813 3300048912 Bacteria 1774
614 Ga0496109_0297650 3300048912 Bacteria 1521
615 Ga0496110_0206736 3300048913 Bacteria 1784
616 Ga0496111_0064450 3300048914 Bacteria 2658
617 Ga0496111_0094284 3300048914 Bacteria 2195
618 Ga0496111_0119636 3300048914 Bacteria 1945
619 Ga0496111_0400661 3300048914 Bacteria 1014
620 Ga0496112_0008288 3300048915 Bacteria 9300
621 Ga0496112_0046815 3300048915 Bacteria 4243
622 Ga0496112_0082781 3300048915 Bacteria 3173
623 Ga0496112_0117359 3300048915 Bacteria 2631
624 Ga0496112_0168499 3300048915 Bacteria 2156
625 Ga0496112_1663221 3300048915 Bacteria 551
626 Ga0496113_0100888 3300048916 Bacteria 2237
627 Ga0496113_0105898 3300048916 Bacteria 2184
628 Ga0496113_0874391 3300048916 Bacteria 712
629 Ga0496114_0000712 3300048917 Bacteria 24721
630 Ga0496114_0012185 3300048917 Bacteria 6880
631 Ga0496114_0036308 3300048917 Bacteria 4073
632 Ga0496114_0109200 3300048917 Bacteria 2369
633 Ga0496114_0252571 3300048917 Bacteria 1552
634 Ga0496115_0001474 3300048918 Bacteria 16894
635 Ga0496115_0016508 3300048918 Bacteria 5624
636 Ga0496116_0000071 3300048919 Bacteria 244521
637 Ga0496116_0024374 3300048919 Bacteria 4477
638 Ga0496117_0000003 3300048920 Bacteria 1881097
639 Ga0496117_0000417 3300048920 Bacteria 71654
640 Ga0496118_0000001 3300048921 Bacteria 1881100
641 Ga0496118_0000350 3300048921 Bacteria 78354
642 Ga0496118_0000604 3300048921 Bacteria 59356
643 Ga0496118_0091150 3300048921 Bacteria 2097
644 Ga0496119_0003282 3300048922 Bacteria 16914
645 Ga0496119_0037686 3300048922 Bacteria 3136
646 Ga0496120_0000157 3300048923 Bacteria 112786
647 Ga0496120_0006256 3300048923 Bacteria 9191
648 Ga0496121_0000019 3300048924 Bacteria 499976
649 Ga0496121_0008927 3300048924 Bacteria 11635
650 Ga0496122_0000695 3300048925 Bacteria 66918
651 Ga0496123_0000119 3300048926 Bacteria 159742
652 Ga0496124_0001956 3300048927 Bacteria 28140
653 Ga0496124_0524118 3300048927 Bacteria 788
654 Ga0496124_0739950 3300048927 Bacteria 618
655 Ga0496125_0044866 3300048928 Bacteria 3730
656 Ga0496125_0140821 3300048928 Bacteria 1677
657 Ga0496126_0000186 3300048929 Bacteria 140016
658 Ga0496126_0015320 3300048929 Bacteria 7714
659 Ga0496126_0029309 3300048929 Bacteria 5230
660 Ga0496126_0045953 3300048929 Bacteria 4009
661 Ga0501031_0015490 3300049568 Bacteria 4950
662 Ga0501031_0757491 3300049568 Bacteria 623
663 Ga0501032_0004162 3300049569 Bacteria 10961
664 Ga0501032_0107653 3300049569 Bacteria 1846
665 Ga0501032_0544450 3300049569 Bacteria 740
666 Ga0501033_0008684 3300049570 Bacteria 7860
667 Ga0501033_0118148 3300049570 Bacteria 1926
668 Ga0501033_0267048 3300049570 Bacteria 1210
669 Ga0501034_0001377 3300049571 Bacteria 32679
670 Ga0501034_0125952 3300049571 Bacteria 2547
671 Ga0501034_0160426 3300049571 Bacteria 2220
672 Ga0501034_0176978 3300049571 Bacteria 2099
673 Ga0501034_1265262 3300049571 Bacteria 615
674 Ga0501036_0089796 3300049572 Bacteria 2596
675 Ga0501036_0474184 3300049572 Bacteria 1042
676 Ga0501037_0002295 3300049573 Bacteria 13802
677 Ga0501037_0055119 3300049573 Bacteria 2907
678 Ga0501037_0854155 3300049573 Bacteria 599
679 Ga0501038_0000215 3300049574 Bacteria 49658
680 Ga0501038_0193870 3300049574 Bacteria 1634
681 Ga0501038_0767346 3300049574 Bacteria 718
682 Ga0501039_1164834 3300049575 Bacteria 597
683 Ga0501043_0009121 3300049579 Bacteria 7804
684 Ga0501043_0023762 3300049579 Bacteria 4808
685 Ga0501046_0003003 3300049580 Bacteria 15591
686 Ga0501046_0186178 3300049580 Bacteria 1550
687 Ga0501047_0003729 3300049581 Bacteria 14348
688 Ga0501047_0005540 3300049581 Bacteria 11880
689 Ga0501047_0031165 3300049581 Bacteria 5143
690 Ga0501047_0597059 3300049581 Bacteria 926
691 Ga0501047_1031440 3300049581 Bacteria 636
692 Ga0501047_1085829 3300049581 Bacteria 613
693 Ga0501048_0000571 3300049582 Bacteria 26167
694 Ga0501048_0010853 3300049582 Bacteria 6791
695 Ga0501069_0014837 3300049585 Bacteria 4171
696 Ga0501070_0001697 3300049586 Bacteria 19506
697 Ga0501070_0119674 3300049586 Bacteria 2176
698 Ga0501070_0283619 3300049586 Bacteria 1351
699 Ga0501073_0011218 3300049589 Bacteria 6554
700 Ga0501073_0278562 3300049589 Bacteria 1154
701 Ga0501080_0008174 3300049742 Bacteria 9478
702 Ga0501080_0044486 3300049742 Bacteria 4133
703 Ga0501080_0566410 3300049742 Bacteria 1011
704 Ga0501083_0910287 3300049744 Bacteria 572
705 Ga0501035_0001307 3300049822 Bacteria 25758
706 Ga0501035_0008131 3300049822 Bacteria 9777
707 Ga0501035_0049778 3300049822 Bacteria 3755
708 Ga0501035_0529502 3300049822 Bacteria 967
709 Ga0501044_0017914 3300049823 Bacteria 7595
710 Ga0501044_0019276 3300049823 Bacteria 7300
711 Ga0501044_0025594 3300049823 Bacteria 6256
712 Ga0501044_0388941 3300049823 Bacteria 1309
713 Ga0501044_0461825 3300049823 Bacteria 1175
714 Ga0501044_0538371 3300049823 Bacteria 1066
715 Ga0501044_0624946 3300049823 Bacteria 968
716 nmdc:mga03683_294119_c1 3300050489 Bacteria 760
717 nmdc:mga03n38_104702_c1 3300050490 Bacteria 1369
718 nmdc:mga03n38_220598_c1 3300050490 Bacteria 989
719 nmdc:mga03n38_236856_c1 3300050490 Bacteria 959
720 nmdc:mga03n38_39458_c1 3300050490 Bacteria 2048
721 nmdc:mga03n38_810677_c1 3300050490 Bacteria 545
722 nmdc:mga03n38_862699_c1 3300050490 Bacteria 530
723 nmdc:mga00v17_18536_c1 3300050491 Bacteria 3956
724 nmdc:mga00v17_392055_c1 3300050491 Bacteria 903
725 nmdc:mga0yw44_1079748_c1 3300050492 Bacteria 542
726 nmdc:mga0yw44_281319_c1 3300050492 Bacteria 1112
727 nmdc:mga0yw44_351198_c1 3300050492 Bacteria 993
728 nmdc:mga0yw44_405276_c1 3300050492 Bacteria 922
729 nmdc:mga0yw44_42108_c1 3300050492 Bacteria 2722
730 nmdc:mga06z11_323027_c1 3300050494 Bacteria 921
731 nmdc:mga07m45_140242_c1 3300050496 Bacteria 1400
732 nmdc:mga07m45_23859_c1 3300050496 Bacteria 3345
733 nmdc:mga07m45_68536_c1 3300050496 Bacteria 2017
734 nmdc:mga07m45_79869_c1 3300050496 Bacteria 1867
735 nmdc:mga08y16_64344_c1 3300050511 Bacteria 3829
736 nmdc:mga08y16_950904_c1 3300050511 Bacteria 842
737 nmdc:mga0sz30_1071_c2 3300050516 Bacteria 9560
738 nmdc:mga0sz30_134780_c1 3300050516 Bacteria 1089
739 nmdc:mga0sz30_138986_c1 3300050516 Bacteria 1072
740 nmdc:mga0sz30_141305_c1 3300050516 Bacteria 1063
741 nmdc:mga0sz30_15724_c1 3300050516 Bacteria 2611
742 nmdc:mga0sz30_208067_c1 3300050516 Bacteria 869
743 nmdc:mga0sz30_59050_c1 3300050516 Bacteria 1636
744 nmdc:mga0sz30_9761_c1 3300050516 Bacteria 3659
745 Ga0495601_0005566 3300053077 Bacteria 7347
746 Ga0500610_0110294 3300053079 Bacteria 1415
747 Ga0495619_0120032 3300053085 Bacteria 1802
748 Ga0500643_014815 3300053087 Bacteria 2693
749 Ga0500583_0293913 3300053092 Bacteria 796
750 Ga0500641_0096843 3300053096 Bacteria 1263
751 Ga0500641_0149067 3300053096 Bacteria 1010
752 Ga0500556_0011612 3300053104 Bacteria 2611
753 Ga0500562_008946 3300053108 Bacteria 2529
754 Ga0500652_183869 3300053131 Bacteria 855
755 Ga0500588_0220668 3300053146 Bacteria 707
756 Ga0500616_0078471 3300053153 Bacteria 1665
757 Ga0500627_0024961 3300053158 Bacteria 2452
758 Ga0500645_000361 3300053730 Bacteria 32453
759 Ga0500645_010095 3300053730 Bacteria 3141
760 Ga0466962_0009036 3300061719 Bacteria 4773
761 Ga0466962_0025077 3300061719 Bacteria 2862
762 Ga0466962_0283581 3300061719 Bacteria 818
763 2526211897 2526164512 Bacteria 4025691
764 2738664530 2738541264 Bacteria 5935393
765 2738707496 2738541274 Bacteria 6909446
766 2739143665 2738541356 Bacteria 5935017
767 2739333992 2738543028 Bacteria 6917070
768 2744956308 2744054611 Bacteria 5611514
769 2753038009 2751185725 Bacteria 5740550
770 2753325877 2751185792 Bacteria 5739090
771 2809589526 2808606522 Bacteria 9488490
772 2839986564 2839986021 Bacteria 3685650
773 2842136932 2842134933 Bacteria 5847019
774 2902793293 2902792274 Bacteria 7270173
775 2902802876 2902799365 Bacteria 5419524
776 2915772258 2915768154 Bacteria 8424322
777 2929213988 2929212328 Bacteria 7708288
778 8003323535 8003314358 Bacteria 10575343
779 Ga0466963_0007103
780 JGI24746J21847_1006306
781 JGI24739J22299_10118198
782 JGI24743J22301_10088710
783 JGI24735J21928_10038804
784 JGI24745J21846_1017658
785 JGI24748J21848_1006279
786 JGI25407J50210_10139877
787 Ga0055540_1001102
788 Ga0055540_1002635
789 Ga0070676_10091460
790 Ga0070676_10099059
791 Ga0070676_10173799
792 Ga0070683_100098269
793 Ga0070690_100004124
794 Ga0070670_100076870
795 Ga0070670_101321862
796 Ga0068869_100002716
797 Ga0068869_100033703
798 Ga0070666_10025925
799 Ga0070666_10371195
800 Ga0070682_100175746
801 Ga0070682_100304068
802 Ga0070682_100360285
803 Ga0068868_100001324
804 Ga0068868_100002746
805 Ga0068868_100050524
806 Ga0068868_100234855
807 Ga0070660_100115996
808 Ga0070660_101157732
809 Ga0070689_100019506
810 Ga0070691_10006935
811 Ga0070687_100670439
812 Ga0070661_100050576
813 Ga0070692_10828354
814 Ga0070668_100027901
815 Ga0070668_100962676
816 Ga0070669_100023174
817 Ga0070669_100158734
818 Ga0070675_100083285
819 Ga0070671_100002618
820 Ga0070671_100129631
821 Ga0070671_100167939
822 Ga0070671_100379604
823 Ga0070674_100143201
824 Ga0070673_100039027
825 Ga0070673_101657530
826 Ga0070688_100019480
827 Ga0070659_100325270
828 Ga0070659_100325660
829 Ga0070667_100002373
830 Ga0070667_100004253
831 Ga0070667_100016240
832 Ga0070667_100028841
833 Ga0070667_100070887
834 Ga0070667_100127229
835 Ga0070667_100386501
836 Ga0070709_10795081
837 Ga0070709_11059986
838 Ga0070714_100130206
839 Ga0070714_100189520
840 Ga0070714_100223263
841 Ga0070714_102081827
842 Ga0070713_100193545
843 Ga0070710_10005315
844 Ga0070701_10006838
845 Ga0070711_100008932
846 Ga0070711_101010545
847 Ga0070705_100898722
848 Ga0070700_100202158
849 Ga0070700_100255449
850 Ga0070700_100541442
851 Ga0070694_100017886
852 Ga0070663_100003573
853 Ga0070663_100108884
854 Ga0070663_100219770
855 Ga0070678_100021136
856 Ga0070678_100113382
857 Ga0070678_101094884
858 Ga0070678_101144388
859 Ga0070662_100113378
860 Ga0070662_101083100
861 Ga0068867_100008839
862 Ga0070685_10010167
863 Ga0070685_10019292
864 Ga0070679_100520773
865 Ga0070679_100772073
866 Ga0070679_100973846
867 Ga0070684_100125464
868 Ga0070684_101094360
869 Ga0068853_100046547
870 Ga0068853_100096245
871 Ga0070672_100023185
872 Ga0070695_100010683
873 Ga0070696_100026141
874 Ga0070693_100008103
875 Ga0070693_100061368
876 Ga0070665_100002795
877 Ga0070665_100025925
878 Ga0070665_100029757
879 Ga0070665_100036425
880 Ga0070665_100490195
881 Ga0070704_100023422
882 Ga0070704_100381741
883 Ga0070664_100008217
884 Ga0068854_100025801
885 Ga0068854_100625808
886 Ga0068856_100104297
887 Ga0068856_100492802
888 Ga0068856_101530618
889 Ga0068856_101556462
890 Ga0070702_100019961
891 Ga0070702_100065112
892 Ga0070702_100106579
893 Ga0068852_100006381
894 Ga0068852_100469245
895 Ga0068859_100003603
896 Ga0068859_100003801
897 Ga0068859_100003849
898 Ga0068859_100120598
899 Ga0068859_100212464
900 Ga0068859_100569927
901 Ga0068864_100101756
902 Ga0068864_100417785
903 Ga0068864_100670389
904 Ga0068864_101140416
905 Ga0068866_10001022
906 Ga0068861_100000270
907 Ga0068861_100081316
908 Ga0068861_100176538
909 Ga0068851_10626064
910 Ga0068870_10323841
911 Ga0068870_10435358
912 Ga0068863_100002822
913 Ga0068863_100003114
914 Ga0068863_101725491
915 Ga0068858_100003721
916 Ga0068858_100004471
917 Ga0068858_100005156
918 Ga0068858_100230455
919 Ga0068858_100266110
920 Ga0068860_100000016
921 Ga0068860_100001320
922 Ga0068860_100030125
923 Ga0068860_100062773
924 Ga0068860_100382669
925 Ga0068862_100000051
926 Ga0068862_100001679
927 Ga0068862_100029106
928 Ga0081455_10007340
929 Ga0081455_10079850
930 Ga0081538_10099354
931 Ga0075365_10044566
932 Ga0075365_10386143
933 Ga0075368_10052578
934 Ga0075363_100053122
935 Ga0075363_100111255
936 Ga0075363_100119711
937 Ga0075363_100262685
938 Ga0075363_100355729
939 Ga0075364_10008785
940 Ga0075364_10013575
941 Ga0075364_10042624
942 Ga0075364_10749659
943 Ga0070716_100007009
944 Ga0070716_100183771
945 Ga0075362_10018252
946 Ga0075367_10045804
947 Ga0075367_10105052
948 Ga0075369_10037108
949 Ga0075369_10044745
950 Ga0075369_10112200
951 Ga0075369_10131164
952 Ga0097621_100189640
953 Ga0075370_10028984
954 Ga0075370_10038980
955 Ga0075370_10043723
956 Ga0075370_10074674
957 Ga0075370_10273549
958 Ga0068871_100006897
959 Ga0068871_100447429
960 Ga0068865_100000685
961 Ga0068865_100037101
962 Ga0097620_100003604
963 Ga0097620_100003801
964 Ga0097620_100003849
965 Ga0097620_100120612
966 Ga0097620_100212474
967 Ga0097620_100569868
968 Ga0075435_100449702
969 Ga0105250_10028965
970 Ga0105240_10443691
971 Ga0105240_10814150
972 Ga0111539_10080732
973 Ga0105245_10002885
974 Ga0105245_10021077
975 Ga0105245_10075878
976 Ga0105245_10845295
977 Ga0105245_11975814
978 Ga0105247_10000017
979 Ga0105247_10001432
980 Ga0105247_10007485
981 Ga0105247_10030027
982 Ga0105247_10081126
983 Ga0105243_10003841
984 Ga0105243_10584890
985 Ga0105241_11300485
986 Ga0105242_10005602
987 Ga0105242_10364838
988 Ga0105248_10000025
989 Ga0105248_10003234
990 Ga0105248_10036826
991 Ga0105248_10043695
992 Ga0105248_10267049
993 Ga0105248_11036017
994 Ga0105248_11143882
995 Ga0105237_10000745
996 Ga0105237_10013198
997 Ga0105237_10020061
998 Ga0105237_10990075
999 Ga0105238_10020619
1000 Ga0105238_11422633
1001 Ga0105249_10000021
1002 Ga0105249_10002204
1003 Ga0105249_10033363
1004 Ga0105249_10414823
1005 Ga0105239_10001328
1006 Ga0105239_10020371
1007 Ga0105239_10031369
1008 Ga0105239_10127607
1009 Ga0105239_10283497
1010 Ga0105239_10579832
1011 Ga0105246_10001666
1012 Ga0105246_10155377
1013 Ga0157369_10304649
1014 Ga0157374_10017544
1015 Ga0157374_10025509
1016 Ga0157374_10587301
1017 Ga0157378_10009639
1018 Ga0157378_10969711
1019 Ga0163162_10012440
1020 Ga0163162_10059117
1021 Ga0163162_10119227
1022 Ga0163162_10176077
1023 Ga0163162_10235230
1024 Ga0163162_10837429
1025 Ga0157372_10006154
1026 Ga0157375_10013607
1027 Ga0157375_10388402
1028 Ga0157375_10564099
1029 Ga0157375_11337560
1030 Ga0157375_12736616
1031 Ga0163163_10005761
1032 Ga0163163_10139323
1033 Ga0163163_10189240
1034 Ga0163163_10247511
1035 Ga0163163_10790638
1036 Ga0157380_10004514
1037 Ga0157380_10207701
1038 Ga0157380_10961760
1039 Ga0157379_10007305
1040 Ga0157379_10057929
1041 Ga0163161_10007316
1042 Ga0163161_10056342
1043 Ga0163161_10668575
1044 Ga0197907_10879848
1045 Ga0206354_10023607
1046 Ga0206353_11808613
1047 Ga0213872_10069523
1048 Ga0213876_10002857
1049 Ga0213876_10019073
1050 Ga0213875_10012643
1051 Ga0209051_1001777
1052 Ga0209051_1002102
1053 Ga0207656_10025895
1054 Ga0207692_10002331
1055 Ga0207642_10000980
1056 Ga0207710_10000033
1057 Ga0207710_10006967
1058 Ga0207710_10031025
1059 Ga0207710_10288720
1060 Ga0207688_10000368
1061 Ga0207688_10002019
1062 Ga0207680_10077031
1063 Ga0207680_10093579
1064 Ga0207647_10091394
1065 Ga0207647_10104094
1066 Ga0207647_10311693
1067 Ga0207685_10134706
1068 Ga0207699_10537107
1069 Ga0207699_10908502
1070 Ga0207645_10034578
1071 Ga0207643_10119925
1072 Ga0207643_10327690
1073 Ga0207695_10373386
1074 Ga0207671_10013580
1075 Ga0207671_10060143
1076 Ga0207671_10414601
1077 Ga0207671_10589314
1078 Ga0207693_10003780
1079 Ga0207693_10787942
1080 Ga0207693_10922279
1081 Ga0207663_10208510
1082 Ga0207662_10599612
1083 Ga0207657_10262476
1084 Ga0207657_10336773
1085 Ga0207649_10216032
1086 Ga0207681_10302972
1087 Ga0207681_10862523
1088 Ga0207694_10020506
1089 Ga0207694_10194462
1090 Ga0207694_11137686
1091 Ga0207650_10292357
1092 Ga0207687_10054818
1093 Ga0207687_10541571
1094 Ga0207700_10087887
1095 Ga0207664_10173896
1096 Ga0207664_10181301
1097 Ga0207664_10549310
1098 Ga0207664_10597988
1099 Ga0207644_10003820
1100 Ga0207644_10099489
1101 Ga0207690_10862499
1102 Ga0207706_10103768
1103 Ga0207706_10132340
1104 Ga0207686_10004197
1105 Ga0207709_10005649
1106 Ga0207709_10238193
1107 Ga0207670_10005137
1108 Ga0207670_10094351
1109 Ga0207669_10243031
1110 Ga0207704_10002187
1111 Ga0207665_10028793
1112 Ga0207665_10296196
1113 Ga0207691_10048199
1114 Ga0207711_10000390
1115 Ga0207711_10040236
1116 Ga0207711_10069330
1117 Ga0207711_10128164
1118 Ga0207711_10193800
1119 Ga0207689_10012018
1120 Ga0207661_10127796
1121 Ga0207679_10072885
1122 Ga0207667_10594621
1123 Ga0207651_10053950
1124 Ga0207651_10108112
1125 Ga0207712_10000005
1126 Ga0207712_10037702
1127 Ga0207712_10330250
1128 Ga0207668_10001360
1129 Ga0207668_10039224
1130 Ga0207640_10112635
1131 Ga0207640_10127812
1132 Ga0207640_10155889
1133 Ga0207658_10001262
1134 Ga0207658_10024249
1135 Ga0207658_10041956
1136 Ga0207658_10045930
1137 Ga0207658_10596360
1138 Ga0207658_10885568
1139 Ga0207677_10009000
1140 Ga0207677_10306949
1141 Ga0207677_10418851
1142 Ga0207677_10968272
1143 Ga0207703_10030925
1144 Ga0207703_10036714
1145 Ga0207703_10457731
1146 Ga0207639_10284613
1147 Ga0207639_10567679
1148 Ga0207639_10904480
1149 Ga0207678_10017171
1150 Ga0207678_10058531
1151 Ga0207678_10085283
1152 Ga0207678_10153572
1153 Ga0207678_10237382
1154 Ga0207678_10424366
1155 Ga0207678_10461261
1156 Ga0207708_10001654
1157 Ga0207708_10362785
1158 Ga0207702_10127219
1159 Ga0207641_10001387
1160 Ga0207641_10005444
1161 Ga0207648_10013368
1162 Ga0207676_10001045
1163 Ga0207676_10547096
1164 Ga0207676_10659074
1165 Ga0207676_11482155
1166 Ga0207675_100009432
1167 Ga0207675_100701183
1168 Ga0207675_100826907
1169 Ga0207683_10011348
1170 Ga0207683_10333027
1171 Ga0207698_10017217
1172 Ga0209813_10014539
1173 Ga0207428_10537362
1174 Ga0268266_10005558
1175 Ga0268266_10013784
1176 Ga0268266_10607210
1177 Ga0268265_10000022
1178 Ga0268265_10007108
1179 Ga0268264_10000005
1180 Ga0268264_10002009
1181 Ga0268264_10390210
1182 Ga0268264_12468591
1183 Ga0307512_10219742
1184 Ga0265327_10000019
1185 Ga0316576_10009877
1186 Ga0316578_10022854
1187 Ga0316577_10035653
1188 Ga0307413_10168241
1189 Ga0307410_10383838
1190 Ga0307416_100052549
1191 Ga0307414_10170606
1192 Ga0307415_100140089
1193 Ga0316580_10010501
1194 Ga0373948_0191339
1195 Ga0373956_0046790
1196 Ga0373960_0040046
1197 Ga0373943_0561848
1198 Ga0373955_0003290
1199 Ga0316574_0020283
1200 Ga0373933_0244935
1201 Ga0373947_0460350
1202 Ga0373937_0128731
1203 Ga0316582_0072860
1204 Ga0316584_0017179
1205 Ga0316584_0358061
1206 Ga0373925_0763266
1207 Ga0395900_0413959
1208 Ga0436364_0178326
1209 Ga0400485_21326
1210 Ga0436365_0133306
1211 Ga0436365_0393632
1212 Ga0436365_1406222
1213 Ga0436361_1162518
1214 Ga0436363_0849090
1215 Ga0436363_1654988
1216 Ga0436362_0829052
1217 Ga0439461_0027844
1218 Ga0439466_0008319
1219 Ga0439466_0034131
1220 Ga0439465_0015108
1221 Ga0439465_0026879
1222 Ga0451802_0749428
1223 Ga0451835_0752417
1224 Ga0451839_1597037
1225 Ga0451853_0572343
1226 Ga0451853_3243727
1227 Ga0439448_0016235
1228 Ga0439435_0197511
1229 Ga0439459_0000789
1230 Ga0466969_0010564
1231 Ga0466969_0037831
1232 Ga0466969_0290652
1233 Ga0466972_0009271
1234 Ga0466972_0013691
1235 Ga0466965_0012053
1236 Ga0466965_0072495
1237 Ga0466965_0175790
1238 Ga0466965_0736405
1239 Ga0466966_0002022
1240 Ga0466966_0007192
1241 Ga0466966_0061593
1242 Ga0466961_0002938
1243 Ga0466961_0009619
1244 Ga0466961_0057416
1245 Ga0466961_0087619
1246 Ga0466961_0148112
1247 Ga0466961_0150322
1248 Ga0466961_0210521
1249 Ga0466963_0008684
1250 Ga0466963_0046163
1251 Ga0466963_0188455
1252 Ga0466963_0223380
1253 Ga0466963_0229757
1254 Ga0466963_0290381
1255 Ga0466971_0089821
1256 Ga0466971_0136195
1257 Ga0466971_0235806
1258 Ga0466971_0446472
1259 Ga0466968_0073852
1260 Ga0466968_0075129
1261 Ga0466968_0082029
1262 Ga0466968_0098515
1263 Ga0466970_0002489
1264 Ga0466970_0012926
1265 Ga0466970_0029435
1266 Ga0466970_0051365
1267 Ga0466970_0494051
1268 Ga0466957_0021395
1269 Ga0466957_0082925
1270 Ga0466957_0197542
1271 Ga0466957_0744969
1272 Ga0466960_0012164
1273 Ga0466960_0100643
1274 Ga0466960_0176994
1275 Ga0466959_0001602
1276 Ga0466959_0049731
1277 Ga0466959_0328516
1278 Ga0466959_0606750
1279 Ga0466959_1075458
1280 Ga0451576_0164731
1281 Ga0466958_0004372
1282 Ga0466958_0008215
1283 Ga0466958_0010080
1284 Ga0466958_0044365
1285 Ga0466958_0086412
1286 Ga0466958_0164732
1287 Ga0466958_0244797
1288 Ga0466958_0752174
1289 Ga0466958_1030142
1290 Ga0466967_0001096
1291 Ga0466967_0018533
1292 Ga0466967_0023199
1293 Ga0466967_0085079
1294 Ga0466967_0349644
1295 Ga0466967_0703420
1296 Ga0466967_0781336
1297 Ga0495592_0125486
1298 Ga0495603_0041665
1299 Ga0495629_0005249
1300 Ga0495638_0030497
1301 Ga0495651_0675037
1302 Ga0495580_0595722
1303 Ga0495582_0056388
1304 Ga0495639_0078936
1305 Ga0495606_0040470
1306 Ga0495620_0124790
1307 Ga0495620_0254246
1308 Ga0495630_0233073
1309 Ga0495648_0001768
1310 Ga0495652_0970623
1311 Ga0495654_0042351
1312 Ga0495665_0007893
1313 Ga0495640_0043397
1314 Ga0495588_0138560
1315 Ga0495658_0710366
1316 Ga0495624_0035425
1317 Ga0495649_0286480
1318 Ga0495581_0008106
1319 Ga0495636_0508218
1320 Ga0495674_0010640
1321 Ga0495672_0001641
1322 Ga0495672_0152753
1323 Ga0495676_0424898
1324 Ga0495673_0000949
1325 Ga0495686_0002701
1326 Ga0495686_0087903
1327 Ga0495593_0005299
1328 Ga0496100_0001287
1329 Ga0496100_0013874
1330 Ga0496100_0132018
1331 Ga0496100_0285474
1332 Ga0496100_0924615
1333 Ga0496101_0000002
1334 Ga0496101_0000933
1335 Ga0496101_0006508
1336 Ga0496101_0044913
1337 Ga0496101_0345791
1338 Ga0496101_0932388
1339 Ga0496102_0000003
1340 Ga0496102_0000782
1341 Ga0496102_0034519
1342 Ga0496102_0102925
1343 Ga0496102_0109481
1344 Ga0496102_0135057
1345 Ga0496102_0162908
1346 Ga0496102_0478115
1347 Ga0496102_0506584
1348 Ga0496102_1309946
1349 Ga0496103_0000014
1350 Ga0496103_0000515
1351 Ga0496103_0005127
1352 Ga0496103_0132003
1353 Ga0496103_0133805
1354 Ga0496103_0320256
1355 Ga0496103_0472548
1356 Ga0496104_0015477
1357 Ga0496104_0026925
1358 Ga0496104_0079337
1359 Ga0496104_0226225
1360 Ga0496104_0402123
1361 Ga0496104_0416455
1362 Ga0496104_0676384
1363 Ga0496105_0009653
1364 Ga0496105_0080763
1365 Ga0496105_0130155
1366 Ga0496105_0367110
1367 Ga0496105_0513487
1368 Ga0496105_0567520
1369 Ga0496105_1391607
1370 Ga0496106_0006137
1371 Ga0496106_0010999
1372 Ga0496106_0077110
1373 Ga0496106_0081910
1374 Ga0496106_0113614
1375 Ga0496106_0311029
1376 Ga0496106_1069093
1377 Ga0496107_0001748
1378 Ga0496107_0062420
1379 Ga0496107_0104046
1380 Ga0496107_0169238
1381 Ga0496108_0000369
1382 Ga0496108_0051416
1383 Ga0496108_0099990
1384 Ga0496108_0214382
1385 Ga0496108_0628649
1386 Ga0496108_1145163
1387 Ga0496109_0003399
1388 Ga0496109_0010688
1389 Ga0496109_0011451
1390 Ga0496109_0062908
1391 Ga0496109_0222813
1392 Ga0496109_0297650
1393 Ga0496110_0206736
1394 Ga0496111_0064450
1395 Ga0496111_0094284
1396 Ga0496111_0119636
1397 Ga0496111_0400661
1398 Ga0496112_0008288
1399 Ga0496112_0046815
1400 Ga0496112_0082781
1401 Ga0496112_0117359
1402 Ga0496112_0168499
1403 Ga0496112_1663221
1404 Ga0496113_0100888
1405 Ga0496113_0105898
1406 Ga0496113_0874391
1407 Ga0496114_0000712
1408 Ga0496114_0012185
1409 Ga0496114_0036308
1410 Ga0496114_0109200
1411 Ga0496114_0252571
1412 Ga0496115_0001474
1413 Ga0496115_0016508
1414 Ga0496116_0000071
1415 Ga0496116_0024374
1416 Ga0496117_0000003
1417 Ga0496117_0000417
1418 Ga0496118_0000001
1419 Ga0496118_0000350
1420 Ga0496118_0000604
1421 Ga0496118_0091150
1422 Ga0496119_0003282
1423 Ga0496119_0037686
1424 Ga0496120_0000157
1425 Ga0496120_0006256
1426 Ga0496121_0000019
1427 Ga0496121_0008927
1428 Ga0496122_0000695
1429 Ga0496123_0000119
1430 Ga0496124_0001956
1431 Ga0496124_0524118
1432 Ga0496124_0739950
1433 Ga0496125_0044866
1434 Ga0496125_0140821
1435 Ga0496126_0000186
1436 Ga0496126_0015320
1437 Ga0496126_0029309
1438 Ga0496126_0045953
1439 Ga0501031_0015490
1440 Ga0501031_0757491
1441 Ga0501032_0004162
1442 Ga0501032_0107653
1443 Ga0501032_0544450
1444 Ga0501033_0008684
1445 Ga0501033_0118148
1446 Ga0501033_0267048
1447 Ga0501034_0001377
1448 Ga0501034_0125952
1449 Ga0501034_0160426
1450 Ga0501034_0176978
1451 Ga0501034_1265262
1452 Ga0501036_0089796
1453 Ga0501036_0474184
1454 Ga0501037_0002295
1455 Ga0501037_0055119
1456 Ga0501037_0854155
1457 Ga0501038_0000215
1458 Ga0501038_0193870
1459 Ga0501038_0767346
1460 Ga0501039_1164834
1461 Ga0501043_0009121
1462 Ga0501043_0023762
1463 Ga0501046_0003003
1464 Ga0501046_0186178
1465 Ga0501047_0003729
1466 Ga0501047_0005540
1467 Ga0501047_0031165
1468 Ga0501047_0597059
1469 Ga0501047_1031440
1470 Ga0501047_1085829
1471 Ga0501048_0000571
1472 Ga0501048_0010853
1473 Ga0501069_0014837
1474 Ga0501070_0001697
1475 Ga0501070_0119674
1476 Ga0501070_0283619
1477 Ga0501073_0011218
1478 Ga0501073_0278562
1479 Ga0501080_0008174
1480 Ga0501080_0044486
1481 Ga0501080_0566410
1482 Ga0501083_0910287
1483 Ga0501035_0001307
1484 Ga0501035_0008131
1485 Ga0501035_0049778
1486 Ga0501035_0529502
1487 Ga0501044_0017914
1488 Ga0501044_0019276
1489 Ga0501044_0025594
1490 Ga0501044_0388941
1491 Ga0501044_0461825
1492 Ga0501044_0538371
1493 Ga0501044_0624946
1494 nmdc:mga03683_294119_c1
1495 nmdc:mga03n38_104702_c1
1496 nmdc:mga03n38_220598_c1
1497 nmdc:mga03n38_236856_c1
1498 nmdc:mga03n38_39458_c1
1499 nmdc:mga03n38_810677_c1
1500 nmdc:mga03n38_862699_c1
1501 nmdc:mga00v17_18536_c1
1502 nmdc:mga00v17_392055_c1
1503 nmdc:mga0yw44_1079748_c1
1504 nmdc:mga0yw44_281319_c1
1505 nmdc:mga0yw44_351198_c1
1506 nmdc:mga0yw44_405276_c1
1507 nmdc:mga0yw44_42108_c1
1508 nmdc:mga06z11_323027_c1
1509 nmdc:mga07m45_140242_c1
1510 nmdc:mga07m45_23859_c1
1511 nmdc:mga07m45_68536_c1
1512 nmdc:mga07m45_79869_c1
1513 nmdc:mga08y16_64344_c1
1514 nmdc:mga08y16_950904_c1
1515 nmdc:mga0sz30_1071_c2
1516 nmdc:mga0sz30_134780_c1
1517 nmdc:mga0sz30_138986_c1
1518 nmdc:mga0sz30_141305_c1
1519 nmdc:mga0sz30_15724_c1
1520 nmdc:mga0sz30_208067_c1
1521 nmdc:mga0sz30_59050_c1
1522 nmdc:mga0sz30_9761_c1
1523 Ga0495601_0005566
1524 Ga0500610_0110294
1525 Ga0495619_0120032
1526 Ga0500643_014815
1527 Ga0500583_0293913
1528 Ga0500641_0096843
1529 Ga0500641_0149067
1530 Ga0500556_0011612
1531 Ga0500562_008946
1532 Ga0500652_183869
1533 Ga0500588_0220668
1534 Ga0500616_0078471
1535 Ga0500627_0024961
1536 Ga0500645_000361
1537 Ga0500645_010095
1538 Ga0466962_0009036
1539 Ga0466962_0025077
1540 Ga0466962_0283581
1541 2526211897
1542 2738664530
1543 2738707496
1544 2739143665
1545 2739333992
1546 2744956308
1547 2753038009
1548 2753325877
1549 2809589526
1550 2839986564
1551 2842136932
1552 2902793293
1553 2902802876
1554 2915772258
1555 2929213988
1556 8003323535

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

25

165

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.9363 2 149
5co4-assembly1.cif.gz_B structural insights into the 2-oh methylation of c/u34 on trna 0.9142 2 149
1j85-assembly1.cif.gz_A structure of yibk from haemophilus influenzae (hi0766), a truncated sequence homolog of trna (guanosine-2'-o-) methyltransferase (spou) 0.9136 1 154
4kdz-assembly1.cif.gz_A crystal structure of trna/rrna methyltransferase yibk from escherichia coli (target nysgrc-012599) 0.9107 1 154
6qkv-assembly1.cif.gz_B structure of yibk from p. aeruginosa 0.91 2 150
ID Description Score Start End Superfamily
af_O50394_1_154_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9395 1 154 3.40.1280.10
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9363 2 149 3.40.1280.10
af_C6TCU8_69_240_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9221 1 152 3.40.1280.10
af_C6TCU8_69_240_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.905 1 152 3.40.1280.10
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.895 2 149 3.40.1280.10
ID Description Score Start End GO Terms
AF-I1D367-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9573 2 152 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A7G2JYR0-F1-model_v4 RNA methyltransferase, TrmH family 0.9548 1 109 GO:0002131
GO:0002132
GO:0003723
GO:0008173
AF-D2NS65-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9542 1 152 GO:0002130
GO:0003723
GO:0005737
GO:0016020
GO:0141098
GO:0141102
AF-A0A2Z5R1N9-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9523 1 150 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A1A0N489-F1-model_v4 tRNA (Cytosine(34)-2'-O)-methyltransferase TrmL 0.9522 1 126 GO:0002130
GO:0003723
GO:0008173

Map