F480424
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 778 | 344 | 1556 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0007103|Ga0466963_0007103_4187_4720 |
| Length | 177 |
| Sequence | MAGIGSDLLHPDARLDHATIIPVVFKLMFLAPRIPPNTGNAIRTAAATGCELHLVEPMGFDLSEPKLRRAGLDYHDLASVTVHASLADAWAALSPQRVFAFTAHAPTSFADVRYRAGDVLMFGPEPTGLDAATLADPHITGQVRIPMLAGRRSLNLSNAAAIAVYEAWRQHGYAGAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 117 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 180 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 182 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 183 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 190 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 196 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 197 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 200 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 201 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 204 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 207 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 208 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 209 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 210 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 211 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 212 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 214 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 215 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 216 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 217 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 218 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 219 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 220 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 221 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 222 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 223 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 224 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 225 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 226 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 232 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 233 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 272 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 273 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 274 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 275 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 276 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 277 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 278 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 279 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 280 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 281 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 282 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 283 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 284 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 285 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 286 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 287 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 288 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 308 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 309 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 310 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 312 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 315 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 317 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 319 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 320 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 321 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 322 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 323 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 324 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 325 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 326 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 328 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 329 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 330 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 331 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 332 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 333 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 334 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 335 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 336 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 337 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 338 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 339 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 340 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 341 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 342 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 343 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 344 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.56 |
| Metatranscriptomes | 0.39 |
| Isolates | 2.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.87 |
| Nodule | 0.13 |
| Rhizoplane | 11.18 |
| Rhizosphere | 72.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466963_0007103 | 3300044694 | Bacteria | 6671 |
| 2 | JGI24746J21847_1006306 | 3300001977 | Bacteria | 1842 |
| 3 | JGI24739J22299_10118198 | 3300001989 | Bacteria | 793 |
| 4 | JGI24743J22301_10088710 | 3300001991 | Bacteria | 658 |
| 5 | JGI24735J21928_10038804 | 3300002067 | Bacteria | 1393 |
| 6 | JGI24745J21846_1017658 | 3300002073 | Bacteria | 830 |
| 7 | JGI24748J21848_1006279 | 3300002074 | Bacteria | 1384 |
| 8 | JGI25407J50210_10139877 | 3300003373 | Bacteria | 596 |
| 9 | Ga0055540_1001102 | 3300003792 | Bacteria | 17060 |
| 10 | Ga0055540_1002635 | 3300003792 | Bacteria | 9303 |
| 11 | Ga0070676_10091460 | 3300005328 | Bacteria | 1864 |
| 12 | Ga0070676_10099059 | 3300005328 | Bacteria | 1798 |
| 13 | Ga0070676_10173799 | 3300005328 | Bacteria | 1395 |
| 14 | Ga0070683_100098269 | 3300005329 | Bacteria | 2755 |
| 15 | Ga0070690_100004124 | 3300005330 | Bacteria | 8048 |
| 16 | Ga0070670_100076870 | 3300005331 | Bacteria | 2868 |
| 17 | Ga0070670_101321862 | 3300005331 | Bacteria | 660 |
| 18 | Ga0068869_100002716 | 3300005334 | Bacteria | 10707 |
| 19 | Ga0068869_100033703 | 3300005334 | Bacteria | 3617 |
| 20 | Ga0070666_10025925 | 3300005335 | Bacteria | 3825 |
| 21 | Ga0070666_10371195 | 3300005335 | Bacteria | 1026 |
| 22 | Ga0070682_100175746 | 3300005337 | Bacteria | 1491 |
| 23 | Ga0070682_100304068 | 3300005337 | Bacteria | 1172 |
| 24 | Ga0070682_100360285 | 3300005337 | Bacteria | 1087 |
| 25 | Ga0068868_100001324 | 3300005338 | Bacteria | 17065 |
| 26 | Ga0068868_100002746 | 3300005338 | Bacteria | 12191 |
| 27 | Ga0068868_100050524 | 3300005338 | Bacteria | 3266 |
| 28 | Ga0068868_100234855 | 3300005338 | Bacteria | 1539 |
| 29 | Ga0070660_100115996 | 3300005339 | Bacteria | 2135 |
| 30 | Ga0070660_101157732 | 3300005339 | Bacteria | 655 |
| 31 | Ga0070689_100019506 | 3300005340 | Bacteria | 5015 |
| 32 | Ga0070691_10006935 | 3300005341 | Bacteria | 5185 |
| 33 | Ga0070687_100670439 | 3300005343 | Bacteria | 721 |
| 34 | Ga0070661_100050576 | 3300005344 | Bacteria | 3041 |
| 35 | Ga0070692_10828354 | 3300005345 | Bacteria | 634 |
| 36 | Ga0070668_100027901 | 3300005347 | Bacteria | 4285 |
| 37 | Ga0070668_100962676 | 3300005347 | Bacteria | 765 |
| 38 | Ga0070669_100023174 | 3300005353 | Bacteria | 4444 |
| 39 | Ga0070669_100158734 | 3300005353 | Bacteria | 1756 |
| 40 | Ga0070675_100083285 | 3300005354 | Bacteria | 2670 |
| 41 | Ga0070671_100002618 | 3300005355 | Bacteria | 13925 |
| 42 | Ga0070671_100129631 | 3300005355 | Bacteria | 2124 |
| 43 | Ga0070671_100167939 | 3300005355 | Bacteria | 1855 |
| 44 | Ga0070671_100379604 | 3300005355 | Bacteria | 1208 |
| 45 | Ga0070674_100143201 | 3300005356 | Bacteria | 1796 |
| 46 | Ga0070673_100039027 | 3300005364 | Bacteria | 3631 |
| 47 | Ga0070673_101657530 | 3300005364 | Bacteria | 605 |
| 48 | Ga0070688_100019480 | 3300005365 | Bacteria | 3932 |
| 49 | Ga0070659_100325270 | 3300005366 | Bacteria | 1286 |
| 50 | Ga0070659_100325660 | 3300005366 | Bacteria | 1285 |
| 51 | Ga0070667_100002373 | 3300005367 | Bacteria | 16492 |
| 52 | Ga0070667_100004253 | 3300005367 | Bacteria | 12093 |
| 53 | Ga0070667_100016240 | 3300005367 | Bacteria | 6159 |
| 54 | Ga0070667_100028841 | 3300005367 | Bacteria | 4621 |
| 55 | Ga0070667_100070887 | 3300005367 | Bacteria | 2967 |
| 56 | Ga0070667_100127229 | 3300005367 | Bacteria | 2221 |
| 57 | Ga0070667_100386501 | 3300005367 | Bacteria | 1272 |
| 58 | Ga0070709_10795081 | 3300005434 | Bacteria | 742 |
| 59 | Ga0070709_11059986 | 3300005434 | Bacteria | 647 |
| 60 | Ga0070714_100130206 | 3300005435 | Bacteria | 2248 |
| 61 | Ga0070714_100189520 | 3300005435 | Bacteria | 1876 |
| 62 | Ga0070714_100223263 | 3300005435 | Bacteria | 1732 |
| 63 | Ga0070714_102081827 | 3300005435 | Bacteria | 553 |
| 64 | Ga0070713_100193545 | 3300005436 | Bacteria | 1834 |
| 65 | Ga0070710_10005315 | 3300005437 | Bacteria | 6106 |
| 66 | Ga0070701_10006838 | 3300005438 | Bacteria | 4826 |
| 67 | Ga0070711_100008932 | 3300005439 | Bacteria | 6153 |
| 68 | Ga0070711_101010545 | 3300005439 | Bacteria | 714 |
| 69 | Ga0070705_100898722 | 3300005440 | Bacteria | 712 |
| 70 | Ga0070700_100202158 | 3300005441 | Bacteria | 1396 |
| 71 | Ga0070700_100255449 | 3300005441 | Bacteria | 1259 |
| 72 | Ga0070700_100541442 | 3300005441 | Bacteria | 903 |
| 73 | Ga0070694_100017886 | 3300005444 | Bacteria | 4486 |
| 74 | Ga0070663_100003573 | 3300005455 | Bacteria | 8981 |
| 75 | Ga0070663_100108884 | 3300005455 | Bacteria | 2079 |
| 76 | Ga0070663_100219770 | 3300005455 | Bacteria | 1491 |
| 77 | Ga0070678_100021136 | 3300005456 | Bacteria | 4285 |
| 78 | Ga0070678_100113382 | 3300005456 | Bacteria | 2125 |
| 79 | Ga0070678_101094884 | 3300005456 | Bacteria | 735 |
| 80 | Ga0070678_101144388 | 3300005456 | Bacteria | 720 |
| 81 | Ga0070662_100113378 | 3300005457 | Bacteria | 2068 |
| 82 | Ga0070662_101083100 | 3300005457 | Bacteria | 687 |
| 83 | Ga0068867_100008839 | 3300005459 | Bacteria | 7109 |
| 84 | Ga0070685_10010167 | 3300005466 | Bacteria | 4885 |
| 85 | Ga0070685_10019292 | 3300005466 | Bacteria | 3677 |
| 86 | Ga0070679_100520773 | 3300005530 | Bacteria | 1133 |
| 87 | Ga0070679_100772073 | 3300005530 | Bacteria | 904 |
| 88 | Ga0070679_100973846 | 3300005530 | Bacteria | 792 |
| 89 | Ga0070684_100125464 | 3300005535 | Bacteria | 2312 |
| 90 | Ga0070684_101094360 | 3300005535 | Bacteria | 749 |
| 91 | Ga0068853_100046547 | 3300005539 | Bacteria | 3720 |
| 92 | Ga0068853_100096245 | 3300005539 | Bacteria | 2612 |
| 93 | Ga0070672_100023185 | 3300005543 | Bacteria | 4572 |
| 94 | Ga0070695_100010683 | 3300005545 | Bacteria | 5485 |
| 95 | Ga0070696_100026141 | 3300005546 | Bacteria | 3971 |
| 96 | Ga0070693_100008103 | 3300005547 | Bacteria | 5160 |
| 97 | Ga0070693_100061368 | 3300005547 | Bacteria | 2185 |
| 98 | Ga0070665_100002795 | 3300005548 | Bacteria | 18921 |
| 99 | Ga0070665_100025925 | 3300005548 | Bacteria | 5904 |
| 100 | Ga0070665_100029757 | 3300005548 | Bacteria | 5496 |
| 101 | Ga0070665_100036425 | 3300005548 | Bacteria | 4948 |
| 102 | Ga0070665_100490195 | 3300005548 | Bacteria | 1240 |
| 103 | Ga0070704_100023422 | 3300005549 | Bacteria | 4033 |
| 104 | Ga0070704_100381741 | 3300005549 | Bacteria | 1197 |
| 105 | Ga0070664_100008217 | 3300005564 | Bacteria | 8439 |
| 106 | Ga0068854_100025801 | 3300005578 | Bacteria | 4033 |
| 107 | Ga0068854_100625808 | 3300005578 | Bacteria | 921 |
| 108 | Ga0068856_100104297 | 3300005614 | Bacteria | 2829 |
| 109 | Ga0068856_100492802 | 3300005614 | Bacteria | 1246 |
| 110 | Ga0068856_101530618 | 3300005614 | Bacteria | 681 |
| 111 | Ga0068856_101556462 | 3300005614 | Bacteria | 675 |
| 112 | Ga0070702_100019961 | 3300005615 | Bacteria | 3504 |
| 113 | Ga0070702_100065112 | 3300005615 | Bacteria | 2134 |
| 114 | Ga0070702_100106579 | 3300005615 | Bacteria | 1729 |
| 115 | Ga0068852_100006381 | 3300005616 | Bacteria | 8518 |
| 116 | Ga0068852_100469245 | 3300005616 | Bacteria | 1249 |
| 117 | Ga0068859_100003603 | 3300005617 | Bacteria | 15790 |
| 118 | Ga0068859_100003801 | 3300005617 | Bacteria | 15405 |
| 119 | Ga0068859_100003849 | 3300005617 | Bacteria | 15336 |
| 120 | Ga0068859_100120598 | 3300005617 | Bacteria | 2689 |
| 121 | Ga0068859_100212464 | 3300005617 | Bacteria | 2021 |
| 122 | Ga0068859_100569927 | 3300005617 | Bacteria | 1226 |
| 123 | Ga0068864_100101756 | 3300005618 | Bacteria | 2549 |
| 124 | Ga0068864_100417785 | 3300005618 | Bacteria | 1277 |
| 125 | Ga0068864_100670389 | 3300005618 | Bacteria | 1011 |
| 126 | Ga0068864_101140416 | 3300005618 | Bacteria | 777 |
| 127 | Ga0068866_10001022 | 3300005718 | Bacteria | 12313 |
| 128 | Ga0068861_100000270 | 3300005719 | Bacteria | 28965 |
| 129 | Ga0068861_100081316 | 3300005719 | Bacteria | 2536 |
| 130 | Ga0068861_100176538 | 3300005719 | Bacteria | 1774 |
| 131 | Ga0068851_10626064 | 3300005834 | Bacteria | 657 |
| 132 | Ga0068870_10323841 | 3300005840 | Bacteria | 980 |
| 133 | Ga0068870_10435358 | 3300005840 | Bacteria | 861 |
| 134 | Ga0068863_100002822 | 3300005841 | Bacteria | 17205 |
| 135 | Ga0068863_100003114 | 3300005841 | Bacteria | 16369 |
| 136 | Ga0068863_101725491 | 3300005841 | Bacteria | 636 |
| 137 | Ga0068858_100003721 | 3300005842 | Bacteria | 15098 |
| 138 | Ga0068858_100004471 | 3300005842 | Bacteria | 13709 |
| 139 | Ga0068858_100005156 | 3300005842 | Bacteria | 12801 |
| 140 | Ga0068858_100230455 | 3300005842 | Bacteria | 1756 |
| 141 | Ga0068858_100266110 | 3300005842 | Bacteria | 1630 |
| 142 | Ga0068860_100000016 | 3300005843 | Bacteria | 310468 |
| 143 | Ga0068860_100001320 | 3300005843 | Bacteria | 26894 |
| 144 | Ga0068860_100030125 | 3300005843 | Bacteria | 5219 |
| 145 | Ga0068860_100062773 | 3300005843 | Bacteria | 3530 |
| 146 | Ga0068860_100382669 | 3300005843 | Bacteria | 1389 |
| 147 | Ga0068862_100000051 | 3300005844 | Bacteria | 145362 |
| 148 | Ga0068862_100001679 | 3300005844 | Bacteria | 20044 |
| 149 | Ga0068862_100029106 | 3300005844 | Bacteria | 4652 |
| 150 | Ga0081455_10007340 | 3300005937 | Bacteria | 11625 |
| 151 | Ga0081455_10079850 | 3300005937 | Bacteria | 2684 |
| 152 | Ga0081538_10099354 | 3300005981 | Bacteria | 1471 |
| 153 | Ga0075365_10044566 | 3300006038 | Bacteria | 2907 |
| 154 | Ga0075365_10386143 | 3300006038 | Bacteria | 988 |
| 155 | Ga0075368_10052578 | 3300006042 | Bacteria | 1621 |
| 156 | Ga0075363_100053122 | 3300006048 | Bacteria | 2164 |
| 157 | Ga0075363_100111255 | 3300006048 | Bacteria | 1522 |
| 158 | Ga0075363_100119711 | 3300006048 | Bacteria | 1469 |
| 159 | Ga0075363_100262685 | 3300006048 | Bacteria | 996 |
| 160 | Ga0075363_100355729 | 3300006048 | Bacteria | 856 |
| 161 | Ga0075364_10008785 | 3300006051 | Bacteria | 6046 |
| 162 | Ga0075364_10013575 | 3300006051 | Bacteria | 5012 |
| 163 | Ga0075364_10042624 | 3300006051 | Bacteria | 2949 |
| 164 | Ga0075364_10749659 | 3300006051 | Bacteria | 666 |
| 165 | Ga0070716_100007009 | 3300006173 | Bacteria | 5528 |
| 166 | Ga0070716_100183771 | 3300006173 | Bacteria | 1375 |
| 167 | Ga0075362_10018252 | 3300006177 | Bacteria | 2900 |
| 168 | Ga0075367_10045804 | 3300006178 | Bacteria | 2568 |
| 169 | Ga0075367_10105052 | 3300006178 | Bacteria | 1729 |
| 170 | Ga0075369_10037108 | 3300006186 | Bacteria | 2075 |
| 171 | Ga0075369_10044745 | 3300006186 | Bacteria | 1902 |
| 172 | Ga0075369_10112200 | 3300006186 | Bacteria | 1229 |
| 173 | Ga0075369_10131164 | 3300006186 | Bacteria | 1139 |
| 174 | Ga0097621_100189640 | 3300006237 | Bacteria | 1780 |
| 175 | Ga0075370_10028984 | 3300006353 | Bacteria | 3080 |
| 176 | Ga0075370_10038980 | 3300006353 | Bacteria | 2676 |
| 177 | Ga0075370_10043723 | 3300006353 | Bacteria | 2532 |
| 178 | Ga0075370_10074674 | 3300006353 | Bacteria | 1943 |
| 179 | Ga0075370_10273549 | 3300006353 | Bacteria | 1003 |
| 180 | Ga0068871_100006897 | 3300006358 | Bacteria | 8087 |
| 181 | Ga0068871_100447429 | 3300006358 | Bacteria | 1157 |
| 182 | Ga0068865_100000685 | 3300006881 | Bacteria | 19088 |
| 183 | Ga0068865_100037101 | 3300006881 | Bacteria | 3289 |
| 184 | Ga0097620_100003604 | 3300006931 | Bacteria | 15790 |
| 185 | Ga0097620_100003801 | 3300006931 | Bacteria | 15405 |
| 186 | Ga0097620_100003849 | 3300006931 | Bacteria | 15336 |
| 187 | Ga0097620_100120612 | 3300006931 | Bacteria | 2689 |
| 188 | Ga0097620_100212474 | 3300006931 | Bacteria | 2021 |
| 189 | Ga0097620_100569868 | 3300006931 | Bacteria | 1226 |
| 190 | Ga0075435_100449702 | 3300007076 | Bacteria | 1111 |
| 191 | Ga0105250_10028965 | 3300009092 | Bacteria | 2228 |
| 192 | Ga0105240_10443691 | 3300009093 | Bacteria | 1454 |
| 193 | Ga0105240_10814150 | 3300009093 | Bacteria | 1011 |
| 194 | Ga0111539_10080732 | 3300009094 | Bacteria | 3825 |
| 195 | Ga0105245_10002885 | 3300009098 | Bacteria | 15437 |
| 196 | Ga0105245_10021077 | 3300009098 | Bacteria | 5717 |
| 197 | Ga0105245_10075878 | 3300009098 | Bacteria | 3062 |
| 198 | Ga0105245_10845295 | 3300009098 | Bacteria | 955 |
| 199 | Ga0105245_11975814 | 3300009098 | Bacteria | 637 |
| 200 | Ga0105247_10000017 | 3300009101 | Bacteria | 260438 |
| 201 | Ga0105247_10001432 | 3300009101 | Bacteria | 17294 |
| 202 | Ga0105247_10007485 | 3300009101 | Bacteria | 6695 |
| 203 | Ga0105247_10030027 | 3300009101 | Bacteria | 3295 |
| 204 | Ga0105247_10081126 | 3300009101 | Bacteria | 2044 |
| 205 | Ga0105243_10003841 | 3300009148 | Bacteria | 12006 |
| 206 | Ga0105243_10584890 | 3300009148 | Bacteria | 1072 |
| 207 | Ga0105241_11300485 | 3300009174 | Bacteria | 692 |
| 208 | Ga0105242_10005602 | 3300009176 | Bacteria | 9690 |
| 209 | Ga0105242_10364838 | 3300009176 | Bacteria | 1338 |
| 210 | Ga0105248_10000025 | 3300009177 | Bacteria | 259691 |
| 211 | Ga0105248_10003234 | 3300009177 | Bacteria | 18068 |
| 212 | Ga0105248_10036826 | 3300009177 | Bacteria | 5472 |
| 213 | Ga0105248_10043695 | 3300009177 | Bacteria | 5025 |
| 214 | Ga0105248_10267049 | 3300009177 | Bacteria | 1926 |
| 215 | Ga0105248_11036017 | 3300009177 | Bacteria | 927 |
| 216 | Ga0105248_11143882 | 3300009177 | Bacteria | 880 |
| 217 | Ga0105237_10000745 | 3300009545 | Bacteria | 44856 |
| 218 | Ga0105237_10013198 | 3300009545 | Bacteria | 8668 |
| 219 | Ga0105237_10020061 | 3300009545 | Bacteria | 6900 |
| 220 | Ga0105237_10990075 | 3300009545 | Bacteria | 848 |
| 221 | Ga0105238_10020619 | 3300009551 | Bacteria | 6715 |
| 222 | Ga0105238_11422633 | 3300009551 | Bacteria | 721 |
| 223 | Ga0105249_10000021 | 3300009553 | Bacteria | 260448 |
| 224 | Ga0105249_10002204 | 3300009553 | Bacteria | 16877 |
| 225 | Ga0105249_10033363 | 3300009553 | Bacteria | 4660 |
| 226 | Ga0105249_10414823 | 3300009553 | Bacteria | 1379 |
| 227 | Ga0105239_10001328 | 3300010375 | Bacteria | 33299 |
| 228 | Ga0105239_10020371 | 3300010375 | Bacteria | 7316 |
| 229 | Ga0105239_10031369 | 3300010375 | Bacteria | 5846 |
| 230 | Ga0105239_10127607 | 3300010375 | Bacteria | 2828 |
| 231 | Ga0105239_10283497 | 3300010375 | Bacteria | 1865 |
| 232 | Ga0105239_10579832 | 3300010375 | Bacteria | 1279 |
| 233 | Ga0105246_10001666 | 3300011119 | Bacteria | 13224 |
| 234 | Ga0105246_10155377 | 3300011119 | Bacteria | 1737 |
| 235 | Ga0157369_10304649 | 3300013105 | Bacteria | 1657 |
| 236 | Ga0157374_10017544 | 3300013296 | Bacteria | 6306 |
| 237 | Ga0157374_10025509 | 3300013296 | Bacteria | 5309 |
| 238 | Ga0157374_10587301 | 3300013296 | Bacteria | 1123 |
| 239 | Ga0157378_10009639 | 3300013297 | Bacteria | 8407 |
| 240 | Ga0157378_10969711 | 3300013297 | Bacteria | 883 |
| 241 | Ga0163162_10012440 | 3300013306 | Bacteria | 8314 |
| 242 | Ga0163162_10059117 | 3300013306 | Bacteria | 3864 |
| 243 | Ga0163162_10119227 | 3300013306 | Bacteria | 2741 |
| 244 | Ga0163162_10176077 | 3300013306 | Bacteria | 2265 |
| 245 | Ga0163162_10235230 | 3300013306 | Bacteria | 1962 |
| 246 | Ga0163162_10837429 | 3300013306 | Bacteria | 1036 |
| 247 | Ga0157372_10006154 | 3300013307 | Bacteria | 12757 |
| 248 | Ga0157375_10013607 | 3300013308 | Bacteria | 7249 |
| 249 | Ga0157375_10388402 | 3300013308 | Bacteria | 1562 |
| 250 | Ga0157375_10564099 | 3300013308 | Bacteria | 1299 |
| 251 | Ga0157375_11337560 | 3300013308 | Bacteria | 843 |
| 252 | Ga0157375_12736616 | 3300013308 | Bacteria | 590 |
| 253 | Ga0163163_10005761 | 3300014325 | Bacteria | 10759 |
| 254 | Ga0163163_10139323 | 3300014325 | Bacteria | 2468 |
| 255 | Ga0163163_10189240 | 3300014325 | Bacteria | 2107 |
| 256 | Ga0163163_10247511 | 3300014325 | Bacteria | 1833 |
| 257 | Ga0163163_10790638 | 3300014325 | Bacteria | 1012 |
| 258 | Ga0157380_10004514 | 3300014326 | Bacteria | 9654 |
| 259 | Ga0157380_10207701 | 3300014326 | Bacteria | 1742 |
| 260 | Ga0157380_10961760 | 3300014326 | Bacteria | 885 |
| 261 | Ga0157379_10007305 | 3300014968 | Bacteria | 9559 |
| 262 | Ga0157379_10057929 | 3300014968 | Bacteria | 3462 |
| 263 | Ga0163161_10007316 | 3300017792 | Bacteria | 7618 |
| 264 | Ga0163161_10056342 | 3300017792 | Bacteria | 2854 |
| 265 | Ga0163161_10668575 | 3300017792 | Bacteria | 862 |
| 266 | Ga0197907_10879848 | 3300020069 | Bacteria | 952 |
| 267 | Ga0206354_10023607 | 3300020081 | Bacteria | 1775 |
| 268 | Ga0206353_11808613 | 3300020082 | Bacteria | 687 |
| 269 | Ga0213872_10069523 | 3300021361 | Bacteria | 1588 |
| 270 | Ga0213876_10002857 | 3300021384 | Bacteria | 10036 |
| 271 | Ga0213876_10019073 | 3300021384 | Bacteria | 3622 |
| 272 | Ga0213875_10012643 | 3300021388 | Bacteria | 4159 |
| 273 | Ga0209051_1001777 | 3300025303 | Bacteria | 17112 |
| 274 | Ga0209051_1002102 | 3300025303 | Bacteria | 14961 |
| 275 | Ga0207656_10025895 | 3300025321 | Bacteria | 2386 |
| 276 | Ga0207692_10002331 | 3300025898 | Bacteria | 7286 |
| 277 | Ga0207642_10000980 | 3300025899 | Bacteria | 8908 |
| 278 | Ga0207710_10000033 | 3300025900 | Bacteria | 260531 |
| 279 | Ga0207710_10006967 | 3300025900 | Bacteria | 4807 |
| 280 | Ga0207710_10031025 | 3300025900 | Bacteria | 2335 |
| 281 | Ga0207710_10288720 | 3300025900 | Bacteria | 827 |
| 282 | Ga0207688_10000368 | 3300025901 | Bacteria | 20985 |
| 283 | Ga0207688_10002019 | 3300025901 | Bacteria | 10890 |
| 284 | Ga0207680_10077031 | 3300025903 | Bacteria | 2084 |
| 285 | Ga0207680_10093579 | 3300025903 | Bacteria | 1917 |
| 286 | Ga0207647_10091394 | 3300025904 | Bacteria | 1815 |
| 287 | Ga0207647_10104094 | 3300025904 | Bacteria | 1682 |
| 288 | Ga0207647_10311693 | 3300025904 | Bacteria | 895 |
| 289 | Ga0207685_10134706 | 3300025905 | Bacteria | 1101 |
| 290 | Ga0207699_10537107 | 3300025906 | Bacteria | 847 |
| 291 | Ga0207699_10908502 | 3300025906 | Bacteria | 650 |
| 292 | Ga0207645_10034578 | 3300025907 | Bacteria | 3247 |
| 293 | Ga0207643_10119925 | 3300025908 | Bacteria | 1557 |
| 294 | Ga0207643_10327690 | 3300025908 | Bacteria | 958 |
| 295 | Ga0207695_10373386 | 3300025913 | Bacteria | 1312 |
| 296 | Ga0207671_10013580 | 3300025914 | Bacteria | 6480 |
| 297 | Ga0207671_10060143 | 3300025914 | Bacteria | 2818 |
| 298 | Ga0207671_10414601 | 3300025914 | Bacteria | 1071 |
| 299 | Ga0207671_10589314 | 3300025914 | Bacteria | 886 |
| 300 | Ga0207693_10003780 | 3300025915 | Bacteria | 12889 |
| 301 | Ga0207693_10787942 | 3300025915 | Bacteria | 733 |
| 302 | Ga0207693_10922279 | 3300025915 | Bacteria | 669 |
| 303 | Ga0207663_10208510 | 3300025916 | Bacteria | 1415 |
| 304 | Ga0207662_10599612 | 3300025918 | Bacteria | 766 |
| 305 | Ga0207657_10262476 | 3300025919 | Bacteria | 1374 |
| 306 | Ga0207657_10336773 | 3300025919 | Bacteria | 1191 |
| 307 | Ga0207649_10216032 | 3300025920 | Bacteria | 1363 |
| 308 | Ga0207681_10302972 | 3300025923 | Bacteria | 1265 |
| 309 | Ga0207681_10862523 | 3300025923 | Bacteria | 757 |
| 310 | Ga0207694_10020506 | 3300025924 | Bacteria | 5002 |
| 311 | Ga0207694_10194462 | 3300025924 | Bacteria | 1649 |
| 312 | Ga0207694_11137686 | 3300025924 | Bacteria | 661 |
| 313 | Ga0207650_10292357 | 3300025925 | Bacteria | 1329 |
| 314 | Ga0207687_10054818 | 3300025927 | Bacteria | 2791 |
| 315 | Ga0207687_10541571 | 3300025927 | Bacteria | 976 |
| 316 | Ga0207700_10087887 | 3300025928 | Bacteria | 2445 |
| 317 | Ga0207664_10173896 | 3300025929 | Bacteria | 1845 |
| 318 | Ga0207664_10181301 | 3300025929 | Bacteria | 1808 |
| 319 | Ga0207664_10549310 | 3300025929 | Bacteria | 1036 |
| 320 | Ga0207664_10597988 | 3300025929 | Bacteria | 990 |
| 321 | Ga0207644_10003820 | 3300025931 | Bacteria | 9757 |
| 322 | Ga0207644_10099489 | 3300025931 | Bacteria | 2182 |
| 323 | Ga0207690_10862499 | 3300025932 | Bacteria | 750 |
| 324 | Ga0207706_10103768 | 3300025933 | Bacteria | 2501 |
| 325 | Ga0207706_10132340 | 3300025933 | Bacteria | 2194 |
| 326 | Ga0207686_10004197 | 3300025934 | Bacteria | 7728 |
| 327 | Ga0207709_10005649 | 3300025935 | Bacteria | 7069 |
| 328 | Ga0207709_10238193 | 3300025935 | Bacteria | 1322 |
| 329 | Ga0207670_10005137 | 3300025936 | Bacteria | 7152 |
| 330 | Ga0207670_10094351 | 3300025936 | Bacteria | 2123 |
| 331 | Ga0207669_10243031 | 3300025937 | Bacteria | 1335 |
| 332 | Ga0207704_10002187 | 3300025938 | Bacteria | 8763 |
| 333 | Ga0207665_10028793 | 3300025939 | Bacteria | 3672 |
| 334 | Ga0207665_10296196 | 3300025939 | Bacteria | 1208 |
| 335 | Ga0207691_10048199 | 3300025940 | Bacteria | 3907 |
| 336 | Ga0207711_10000390 | 3300025941 | Bacteria | 46512 |
| 337 | Ga0207711_10040236 | 3300025941 | Bacteria | 3976 |
| 338 | Ga0207711_10069330 | 3300025941 | Bacteria | 3056 |
| 339 | Ga0207711_10128164 | 3300025941 | Bacteria | 2272 |
| 340 | Ga0207711_10193800 | 3300025941 | Bacteria | 1853 |
| 341 | Ga0207689_10012018 | 3300025942 | Bacteria | 7419 |
| 342 | Ga0207661_10127796 | 3300025944 | Bacteria | 2173 |
| 343 | Ga0207679_10072885 | 3300025945 | Bacteria | 2596 |
| 344 | Ga0207667_10594621 | 3300025949 | Bacteria | 1116 |
| 345 | Ga0207651_10053950 | 3300025960 | Bacteria | 2751 |
| 346 | Ga0207651_10108112 | 3300025960 | Bacteria | 2081 |
| 347 | Ga0207712_10000005 | 3300025961 | Bacteria | 608697 |
| 348 | Ga0207712_10037702 | 3300025961 | Bacteria | 3300 |
| 349 | Ga0207712_10330250 | 3300025961 | Bacteria | 1261 |
| 350 | Ga0207668_10001360 | 3300025972 | Bacteria | 14447 |
| 351 | Ga0207668_10039224 | 3300025972 | Bacteria | 3186 |
| 352 | Ga0207640_10112635 | 3300025981 | Bacteria | 1932 |
| 353 | Ga0207640_10127812 | 3300025981 | Bacteria | 1832 |
| 354 | Ga0207640_10155889 | 3300025981 | Bacteria | 1683 |
| 355 | Ga0207658_10001262 | 3300025986 | Bacteria | 19997 |
| 356 | Ga0207658_10024249 | 3300025986 | Bacteria | 4242 |
| 357 | Ga0207658_10041956 | 3300025986 | Bacteria | 3316 |
| 358 | Ga0207658_10045930 | 3300025986 | Bacteria | 3186 |
| 359 | Ga0207658_10596360 | 3300025986 | Bacteria | 992 |
| 360 | Ga0207658_10885568 | 3300025986 | Bacteria | 812 |
| 361 | Ga0207677_10009000 | 3300026023 | Bacteria | 5602 |
| 362 | Ga0207677_10306949 | 3300026023 | Bacteria | 1313 |
| 363 | Ga0207677_10418851 | 3300026023 | Bacteria | 1140 |
| 364 | Ga0207677_10968272 | 3300026023 | Bacteria | 770 |
| 365 | Ga0207703_10030925 | 3300026035 | Bacteria | 4232 |
| 366 | Ga0207703_10036714 | 3300026035 | Bacteria | 3901 |
| 367 | Ga0207703_10457731 | 3300026035 | Bacteria | 1193 |
| 368 | Ga0207639_10284613 | 3300026041 | Bacteria | 1455 |
| 369 | Ga0207639_10567679 | 3300026041 | Bacteria | 1043 |
| 370 | Ga0207639_10904480 | 3300026041 | Bacteria | 825 |
| 371 | Ga0207678_10017171 | 3300026067 | Bacteria | 6353 |
| 372 | Ga0207678_10058531 | 3300026067 | Bacteria | 3316 |
| 373 | Ga0207678_10085283 | 3300026067 | Bacteria | 2700 |
| 374 | Ga0207678_10153572 | 3300026067 | Bacteria | 1966 |
| 375 | Ga0207678_10237382 | 3300026067 | Bacteria | 1561 |
| 376 | Ga0207678_10424366 | 3300026067 | Bacteria | 1153 |
| 377 | Ga0207678_10461261 | 3300026067 | Bacteria | 1105 |
| 378 | Ga0207708_10001654 | 3300026075 | Bacteria | 16572 |
| 379 | Ga0207708_10362785 | 3300026075 | Bacteria | 1191 |
| 380 | Ga0207702_10127219 | 3300026078 | Bacteria | 2289 |
| 381 | Ga0207641_10001387 | 3300026088 | Bacteria | 23866 |
| 382 | Ga0207641_10005444 | 3300026088 | Bacteria | 10864 |
| 383 | Ga0207648_10013368 | 3300026089 | Bacteria | 7640 |
| 384 | Ga0207676_10001045 | 3300026095 | Bacteria | 21108 |
| 385 | Ga0207676_10547096 | 3300026095 | Bacteria | 1105 |
| 386 | Ga0207676_10659074 | 3300026095 | Bacteria | 1011 |
| 387 | Ga0207676_11482155 | 3300026095 | Bacteria | 675 |
| 388 | Ga0207675_100009432 | 3300026118 | Bacteria | 9135 |
| 389 | Ga0207675_100701183 | 3300026118 | Bacteria | 1021 |
| 390 | Ga0207675_100826907 | 3300026118 | Bacteria | 940 |
| 391 | Ga0207683_10011348 | 3300026121 | Bacteria | 7603 |
| 392 | Ga0207683_10333027 | 3300026121 | Bacteria | 1391 |
| 393 | Ga0207698_10017217 | 3300026142 | Bacteria | 4897 |
| 394 | Ga0209813_10014539 | 3300027866 | Bacteria | 2120 |
| 395 | Ga0207428_10537362 | 3300027907 | Bacteria | 846 |
| 396 | Ga0268266_10005558 | 3300028379 | Bacteria | 11732 |
| 397 | Ga0268266_10013784 | 3300028379 | Bacteria | 6960 |
| 398 | Ga0268266_10607210 | 3300028379 | Bacteria | 1051 |
| 399 | Ga0268265_10000022 | 3300028380 | Bacteria | 270788 |
| 400 | Ga0268265_10007108 | 3300028380 | Bacteria | 7557 |
| 401 | Ga0268264_10000005 | 3300028381 | Bacteria | 934972 |
| 402 | Ga0268264_10002009 | 3300028381 | Bacteria | 18275 |
| 403 | Ga0268264_10390210 | 3300028381 | Bacteria | 1335 |
| 404 | Ga0268264_12468591 | 3300028381 | Bacteria | 525 |
| 405 | Ga0307512_10219742 | 3300030522 | Bacteria | 995 |
| 406 | Ga0265327_10000019 | 3300031251 | Bacteria | 427653 |
| 407 | Ga0316576_10009877 | 3300031727 | Bacteria | 6178 |
| 408 | Ga0316578_10022854 | 3300031728 | Bacteria | 3493 |
| 409 | Ga0316577_10035653 | 3300031733 | Bacteria | 2780 |
| 410 | Ga0307413_10168241 | 3300031824 | Bacteria | 1548 |
| 411 | Ga0307410_10383838 | 3300031852 | Bacteria | 1131 |
| 412 | Ga0307416_100052549 | 3300032002 | Bacteria | 3263 |
| 413 | Ga0307414_10170606 | 3300032004 | Bacteria | 1739 |
| 414 | Ga0307415_100140089 | 3300032126 | Bacteria | 1846 |
| 415 | Ga0316580_10010501 | 3300032139 | Bacteria | 2801 |
| 416 | Ga0373948_0191339 | 3300034817 | Bacteria | 530 |
| 417 | Ga0373956_0046790 | 3300035119 | Bacteria | 1934 |
| 418 | Ga0373960_0040046 | 3300035121 | Bacteria | 1351 |
| 419 | Ga0373943_0561848 | 3300035170 | Bacteria | 670 |
| 420 | Ga0373955_0003290 | 3300035172 | Bacteria | 7088 |
| 421 | Ga0316574_0020283 | 3300035398 | Bacteria | 3933 |
| 422 | Ga0373933_0244935 | 3300035724 | Bacteria | 1153 |
| 423 | Ga0373947_0460350 | 3300035725 | Bacteria | 862 |
| 424 | Ga0373937_0128731 | 3300036401 | Bacteria | 2363 |
| 425 | Ga0316582_0072860 | 3300036647 | Bacteria | 2228 |
| 426 | Ga0316584_0017179 | 3300036712 | Bacteria | 5197 |
| 427 | Ga0316584_0358061 | 3300036712 | Bacteria | 1046 |
| 428 | Ga0373925_0763266 | 3300037068 | Bacteria | 797 |
| 429 | Ga0395900_0413959 | 3300037418 | Bacteria | 1310 |
| 430 | Ga0436364_0178326 | 3300037853 | Bacteria | 9377 |
| 431 | Ga0400485_21326 | 3300038735 | Unclassified | 3902 |
| 432 | Ga0436365_0133306 | 3300039437 | Bacteria | 59687 |
| 433 | Ga0436365_0393632 | 3300039437 | Bacteria | 30038 |
| 434 | Ga0436365_1406222 | 3300039437 | Bacteria | 3063 |
| 435 | Ga0436361_1162518 | 3300039447 | Bacteria | 1476 |
| 436 | Ga0436363_0849090 | 3300039450 | Bacteria | 606 |
| 437 | Ga0436363_1654988 | 3300039450 | Bacteria | 685 |
| 438 | Ga0436362_0829052 | 3300039453 | Bacteria | 1019 |
| 439 | Ga0439461_0027844 | 3300041410 | Bacteria | 1161 |
| 440 | Ga0439466_0008319 | 3300041411 | Bacteria | 3910 |
| 441 | Ga0439466_0034131 | 3300041411 | Bacteria | 1726 |
| 442 | Ga0439465_0015108 | 3300041413 | Bacteria | 2409 |
| 443 | Ga0439465_0026879 | 3300041413 | Bacteria | 1821 |
| 444 | Ga0451802_0749428 | 3300041460 | Bacteria | 1167 |
| 445 | Ga0451835_0752417 | 3300041492 | Bacteria | 526 |
| 446 | Ga0451839_1597037 | 3300041496 | Bacteria | 972 |
| 447 | Ga0451853_0572343 | 3300041512 | Bacteria | 710 |
| 448 | Ga0451853_3243727 | 3300041512 | Bacteria | 686 |
| 449 | Ga0439448_0016235 | 3300042005 | Bacteria | 2264 |
| 450 | Ga0439435_0197511 | 3300042436 | Bacteria | 662 |
| 451 | Ga0439459_0000789 | 3300042438 | Bacteria | 4379 |
| 452 | Ga0466969_0010564 | 3300044656 | Bacteria | 4893 |
| 453 | Ga0466969_0037831 | 3300044656 | Bacteria | 2432 |
| 454 | Ga0466969_0290652 | 3300044656 | Bacteria | 740 |
| 455 | Ga0466972_0009271 | 3300044658 | Bacteria | 4945 |
| 456 | Ga0466972_0013691 | 3300044658 | Bacteria | 4069 |
| 457 | Ga0466965_0012053 | 3300044683 | Bacteria | 4060 |
| 458 | Ga0466965_0072495 | 3300044683 | Bacteria | 1733 |
| 459 | Ga0466965_0175790 | 3300044683 | Bacteria | 1128 |
| 460 | Ga0466965_0736405 | 3300044683 | Bacteria | 567 |
| 461 | Ga0466966_0002022 | 3300044684 | Bacteria | 13164 |
| 462 | Ga0466966_0007192 | 3300044684 | Bacteria | 7376 |
| 463 | Ga0466966_0061593 | 3300044684 | Bacteria | 2366 |
| 464 | Ga0466961_0002938 | 3300044693 | Bacteria | 10582 |
| 465 | Ga0466961_0009619 | 3300044693 | Bacteria | 6153 |
| 466 | Ga0466961_0057416 | 3300044693 | Bacteria | 2478 |
| 467 | Ga0466961_0087619 | 3300044693 | Bacteria | 1967 |
| 468 | Ga0466961_0148112 | 3300044693 | Bacteria | 1467 |
| 469 | Ga0466961_0150322 | 3300044693 | Bacteria | 1454 |
| 470 | Ga0466961_0210521 | 3300044693 | Bacteria | 1200 |
| 471 | Ga0466963_0008684 | 3300044694 | Bacteria | 6099 |
| 472 | Ga0466963_0046163 | 3300044694 | Bacteria | 2871 |
| 473 | Ga0466963_0188455 | 3300044694 | Bacteria | 1441 |
| 474 | Ga0466963_0223380 | 3300044694 | Bacteria | 1319 |
| 475 | Ga0466963_0229757 | 3300044694 | Bacteria | 1300 |
| 476 | Ga0466963_0290381 | 3300044694 | Bacteria | 1150 |
| 477 | Ga0466971_0089821 | 3300044719 | Bacteria | 1406 |
| 478 | Ga0466971_0136195 | 3300044719 | Bacteria | 1142 |
| 479 | Ga0466971_0235806 | 3300044719 | Bacteria | 869 |
| 480 | Ga0466971_0446472 | 3300044719 | Bacteria | 634 |
| 481 | Ga0466968_0073852 | 3300044735 | Bacteria | 1488 |
| 482 | Ga0466968_0075129 | 3300044735 | Bacteria | 1477 |
| 483 | Ga0466968_0082029 | 3300044735 | Bacteria | 1418 |
| 484 | Ga0466968_0098515 | 3300044735 | Bacteria | 1303 |
| 485 | Ga0466970_0002489 | 3300044765 | Bacteria | 8895 |
| 486 | Ga0466970_0012926 | 3300044765 | Bacteria | 4275 |
| 487 | Ga0466970_0029435 | 3300044765 | Bacteria | 2891 |
| 488 | Ga0466970_0051365 | 3300044765 | Bacteria | 2200 |
| 489 | Ga0466970_0494051 | 3300044765 | Bacteria | 704 |
| 490 | Ga0466957_0021395 | 3300044842 | Bacteria | 3810 |
| 491 | Ga0466957_0082925 | 3300044842 | Bacteria | 1999 |
| 492 | Ga0466957_0197542 | 3300044842 | Bacteria | 1320 |
| 493 | Ga0466957_0744969 | 3300044842 | Bacteria | 693 |
| 494 | Ga0466960_0012164 | 3300044901 | Bacteria | 3623 |
| 495 | Ga0466960_0100643 | 3300044901 | Bacteria | 1488 |
| 496 | Ga0466960_0176994 | 3300044901 | Bacteria | 1154 |
| 497 | Ga0466959_0001602 | 3300045049 | Bacteria | 13955 |
| 498 | Ga0466959_0049731 | 3300045049 | Bacteria | 3080 |
| 499 | Ga0466959_0328516 | 3300045049 | Bacteria | 1044 |
| 500 | Ga0466959_0606750 | 3300045049 | Bacteria | 736 |
| 501 | Ga0466959_1075458 | 3300045049 | Bacteria | 535 |
| 502 | Ga0451576_0164731 | 3300045051 | Bacteria | 2313 |
| 503 | Ga0466958_0004372 | 3300045836 | Bacteria | 7454 |
| 504 | Ga0466958_0008215 | 3300045836 | Bacteria | 5781 |
| 505 | Ga0466958_0010080 | 3300045836 | Bacteria | 5282 |
| 506 | Ga0466958_0044365 | 3300045836 | Bacteria | 2680 |
| 507 | Ga0466958_0086412 | 3300045836 | Bacteria | 1935 |
| 508 | Ga0466958_0164732 | 3300045836 | Bacteria | 1402 |
| 509 | Ga0466958_0244797 | 3300045836 | Bacteria | 1146 |
| 510 | Ga0466958_0752174 | 3300045836 | Bacteria | 635 |
| 511 | Ga0466958_1030142 | 3300045836 | Bacteria | 537 |
| 512 | Ga0466967_0001096 | 3300045976 | Bacteria | 14982 |
| 513 | Ga0466967_0018533 | 3300045976 | Bacteria | 5567 |
| 514 | Ga0466967_0023199 | 3300045976 | Bacteria | 5081 |
| 515 | Ga0466967_0085079 | 3300045976 | Bacteria | 2863 |
| 516 | Ga0466967_0349644 | 3300045976 | Bacteria | 1431 |
| 517 | Ga0466967_0703420 | 3300045976 | Bacteria | 1001 |
| 518 | Ga0466967_0781336 | 3300045976 | Bacteria | 948 |
| 519 | Ga0495592_0125486 | 3300046454 | Bacteria | 1802 |
| 520 | Ga0495603_0041665 | 3300046455 | Bacteria | 2745 |
| 521 | Ga0495629_0005249 | 3300046459 | Bacteria | 9685 |
| 522 | Ga0495638_0030497 | 3300046460 | Bacteria | 3470 |
| 523 | Ga0495651_0675037 | 3300046462 | Bacteria | 646 |
| 524 | Ga0495580_0595722 | 3300046472 | Bacteria | 731 |
| 525 | Ga0495582_0056388 | 3300046473 | Bacteria | 2165 |
| 526 | Ga0495639_0078936 | 3300046475 | Bacteria | 1530 |
| 527 | Ga0495606_0040470 | 3300046507 | Bacteria | 3133 |
| 528 | Ga0495620_0124790 | 3300046515 | Bacteria | 1013 |
| 529 | Ga0495620_0254246 | 3300046515 | Bacteria | 670 |
| 530 | Ga0495630_0233073 | 3300046517 | Bacteria | 1407 |
| 531 | Ga0495648_0001768 | 3300046524 | Bacteria | 20851 |
| 532 | Ga0495652_0970623 | 3300046529 | Bacteria | 557 |
| 533 | Ga0495654_0042351 | 3300046530 | Bacteria | 2261 |
| 534 | Ga0495665_0007893 | 3300046531 | Bacteria | 5769 |
| 535 | Ga0495640_0043397 | 3300046533 | Bacteria | 3132 |
| 536 | Ga0495588_0138560 | 3300046674 | Bacteria | 1285 |
| 537 | Ga0495658_0710366 | 3300046683 | Bacteria | 644 |
| 538 | Ga0495624_0035425 | 3300046690 | Bacteria | 3223 |
| 539 | Ga0495649_0286480 | 3300046694 | Bacteria | 841 |
| 540 | Ga0495581_0008106 | 3300047315 | Bacteria | 6083 |
| 541 | Ga0495636_0508218 | 3300047318 | Bacteria | 583 |
| 542 | Ga0495674_0010640 | 3300047319 | Bacteria | 8704 |
| 543 | Ga0495672_0001641 | 3300047320 | Bacteria | 21761 |
| 544 | Ga0495672_0152753 | 3300047320 | Bacteria | 1196 |
| 545 | Ga0495676_0424898 | 3300047321 | Bacteria | 879 |
| 546 | Ga0495673_0000949 | 3300047469 | Bacteria | 26223 |
| 547 | Ga0495686_0002701 | 3300047472 | Bacteria | 16248 |
| 548 | Ga0495686_0087903 | 3300047472 | Bacteria | 1890 |
| 549 | Ga0495593_0005299 | 3300047673 | Bacteria | 7619 |
| 550 | Ga0496100_0001287 | 3300048903 | Bacteria | 12243 |
| 551 | Ga0496100_0013874 | 3300048903 | Bacteria | 4662 |
| 552 | Ga0496100_0132018 | 3300048903 | Bacteria | 1760 |
| 553 | Ga0496100_0285474 | 3300048903 | Bacteria | 1231 |
| 554 | Ga0496100_0924615 | 3300048903 | Bacteria | 685 |
| 555 | Ga0496101_0000002 | 3300048904 | Bacteria | 410971 |
| 556 | Ga0496101_0000933 | 3300048904 | Bacteria | 17243 |
| 557 | Ga0496101_0006508 | 3300048904 | Bacteria | 7522 |
| 558 | Ga0496101_0044913 | 3300048904 | Bacteria | 3163 |
| 559 | Ga0496101_0345791 | 3300048904 | Bacteria | 1168 |
| 560 | Ga0496101_0932388 | 3300048904 | Bacteria | 683 |
| 561 | Ga0496102_0000003 | 3300048905 | Bacteria | 592263 |
| 562 | Ga0496102_0000782 | 3300048905 | Bacteria | 30949 |
| 563 | Ga0496102_0034519 | 3300048905 | Bacteria | 4550 |
| 564 | Ga0496102_0102925 | 3300048905 | Bacteria | 2655 |
| 565 | Ga0496102_0109481 | 3300048905 | Bacteria | 2574 |
| 566 | Ga0496102_0135057 | 3300048905 | Bacteria | 2311 |
| 567 | Ga0496102_0162908 | 3300048905 | Bacteria | 2098 |
| 568 | Ga0496102_0478115 | 3300048905 | Bacteria | 1167 |
| 569 | Ga0496102_0506584 | 3300048905 | Bacteria | 1129 |
| 570 | Ga0496102_1309946 | 3300048905 | Bacteria | 643 |
| 571 | Ga0496103_0000014 | 3300048906 | Bacteria | 290397 |
| 572 | Ga0496103_0000515 | 3300048906 | Bacteria | 31901 |
| 573 | Ga0496103_0005127 | 3300048906 | Bacteria | 7888 |
| 574 | Ga0496103_0132003 | 3300048906 | Bacteria | 1595 |
| 575 | Ga0496103_0133805 | 3300048906 | Bacteria | 1584 |
| 576 | Ga0496103_0320256 | 3300048906 | Bacteria | 997 |
| 577 | Ga0496103_0472548 | 3300048906 | Bacteria | 803 |
| 578 | Ga0496104_0015477 | 3300048907 | Bacteria | 6908 |
| 579 | Ga0496104_0026925 | 3300048907 | Bacteria | 5315 |
| 580 | Ga0496104_0079337 | 3300048907 | Bacteria | 3129 |
| 581 | Ga0496104_0226225 | 3300048907 | Bacteria | 1783 |
| 582 | Ga0496104_0402123 | 3300048907 | Bacteria | 1282 |
| 583 | Ga0496104_0416455 | 3300048907 | Bacteria | 1256 |
| 584 | Ga0496104_0676384 | 3300048907 | Bacteria | 940 |
| 585 | Ga0496105_0009653 | 3300048908 | Bacteria | 7555 |
| 586 | Ga0496105_0080763 | 3300048908 | Bacteria | 2686 |
| 587 | Ga0496105_0130155 | 3300048908 | Bacteria | 2075 |
| 588 | Ga0496105_0367110 | 3300048908 | Bacteria | 1147 |
| 589 | Ga0496105_0513487 | 3300048908 | Bacteria | 939 |
| 590 | Ga0496105_0567520 | 3300048908 | Bacteria | 884 |
| 591 | Ga0496105_1391607 | 3300048908 | Bacteria | 508 |
| 592 | Ga0496106_0006137 | 3300048909 | Bacteria | 8888 |
| 593 | Ga0496106_0010999 | 3300048909 | Bacteria | 6690 |
| 594 | Ga0496106_0077110 | 3300048909 | Bacteria | 2555 |
| 595 | Ga0496106_0081910 | 3300048909 | Bacteria | 2480 |
| 596 | Ga0496106_0113614 | 3300048909 | Bacteria | 2111 |
| 597 | Ga0496106_0311029 | 3300048909 | Bacteria | 1264 |
| 598 | Ga0496106_1069093 | 3300048909 | Bacteria | 633 |
| 599 | Ga0496107_0001748 | 3300048910 | Bacteria | 13670 |
| 600 | Ga0496107_0062420 | 3300048910 | Bacteria | 2699 |
| 601 | Ga0496107_0104046 | 3300048910 | Bacteria | 2083 |
| 602 | Ga0496107_0169238 | 3300048910 | Bacteria | 1621 |
| 603 | Ga0496108_0000369 | 3300048911 | Bacteria | 37803 |
| 604 | Ga0496108_0051416 | 3300048911 | Bacteria | 3452 |
| 605 | Ga0496108_0099990 | 3300048911 | Bacteria | 2473 |
| 606 | Ga0496108_0214382 | 3300048911 | Bacteria | 1672 |
| 607 | Ga0496108_0628649 | 3300048911 | Bacteria | 934 |
| 608 | Ga0496108_1145163 | 3300048911 | Bacteria | 659 |
| 609 | Ga0496109_0003399 | 3300048912 | Bacteria | 13314 |
| 610 | Ga0496109_0010688 | 3300048912 | Bacteria | 7853 |
| 611 | Ga0496109_0011451 | 3300048912 | Bacteria | 7626 |
| 612 | Ga0496109_0062908 | 3300048912 | Bacteria | 3394 |
| 613 | Ga0496109_0222813 | 3300048912 | Bacteria | 1774 |
| 614 | Ga0496109_0297650 | 3300048912 | Bacteria | 1521 |
| 615 | Ga0496110_0206736 | 3300048913 | Bacteria | 1784 |
| 616 | Ga0496111_0064450 | 3300048914 | Bacteria | 2658 |
| 617 | Ga0496111_0094284 | 3300048914 | Bacteria | 2195 |
| 618 | Ga0496111_0119636 | 3300048914 | Bacteria | 1945 |
| 619 | Ga0496111_0400661 | 3300048914 | Bacteria | 1014 |
| 620 | Ga0496112_0008288 | 3300048915 | Bacteria | 9300 |
| 621 | Ga0496112_0046815 | 3300048915 | Bacteria | 4243 |
| 622 | Ga0496112_0082781 | 3300048915 | Bacteria | 3173 |
| 623 | Ga0496112_0117359 | 3300048915 | Bacteria | 2631 |
| 624 | Ga0496112_0168499 | 3300048915 | Bacteria | 2156 |
| 625 | Ga0496112_1663221 | 3300048915 | Bacteria | 551 |
| 626 | Ga0496113_0100888 | 3300048916 | Bacteria | 2237 |
| 627 | Ga0496113_0105898 | 3300048916 | Bacteria | 2184 |
| 628 | Ga0496113_0874391 | 3300048916 | Bacteria | 712 |
| 629 | Ga0496114_0000712 | 3300048917 | Bacteria | 24721 |
| 630 | Ga0496114_0012185 | 3300048917 | Bacteria | 6880 |
| 631 | Ga0496114_0036308 | 3300048917 | Bacteria | 4073 |
| 632 | Ga0496114_0109200 | 3300048917 | Bacteria | 2369 |
| 633 | Ga0496114_0252571 | 3300048917 | Bacteria | 1552 |
| 634 | Ga0496115_0001474 | 3300048918 | Bacteria | 16894 |
| 635 | Ga0496115_0016508 | 3300048918 | Bacteria | 5624 |
| 636 | Ga0496116_0000071 | 3300048919 | Bacteria | 244521 |
| 637 | Ga0496116_0024374 | 3300048919 | Bacteria | 4477 |
| 638 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 639 | Ga0496117_0000417 | 3300048920 | Bacteria | 71654 |
| 640 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 641 | Ga0496118_0000350 | 3300048921 | Bacteria | 78354 |
| 642 | Ga0496118_0000604 | 3300048921 | Bacteria | 59356 |
| 643 | Ga0496118_0091150 | 3300048921 | Bacteria | 2097 |
| 644 | Ga0496119_0003282 | 3300048922 | Bacteria | 16914 |
| 645 | Ga0496119_0037686 | 3300048922 | Bacteria | 3136 |
| 646 | Ga0496120_0000157 | 3300048923 | Bacteria | 112786 |
| 647 | Ga0496120_0006256 | 3300048923 | Bacteria | 9191 |
| 648 | Ga0496121_0000019 | 3300048924 | Bacteria | 499976 |
| 649 | Ga0496121_0008927 | 3300048924 | Bacteria | 11635 |
| 650 | Ga0496122_0000695 | 3300048925 | Bacteria | 66918 |
| 651 | Ga0496123_0000119 | 3300048926 | Bacteria | 159742 |
| 652 | Ga0496124_0001956 | 3300048927 | Bacteria | 28140 |
| 653 | Ga0496124_0524118 | 3300048927 | Bacteria | 788 |
| 654 | Ga0496124_0739950 | 3300048927 | Bacteria | 618 |
| 655 | Ga0496125_0044866 | 3300048928 | Bacteria | 3730 |
| 656 | Ga0496125_0140821 | 3300048928 | Bacteria | 1677 |
| 657 | Ga0496126_0000186 | 3300048929 | Bacteria | 140016 |
| 658 | Ga0496126_0015320 | 3300048929 | Bacteria | 7714 |
| 659 | Ga0496126_0029309 | 3300048929 | Bacteria | 5230 |
| 660 | Ga0496126_0045953 | 3300048929 | Bacteria | 4009 |
| 661 | Ga0501031_0015490 | 3300049568 | Bacteria | 4950 |
| 662 | Ga0501031_0757491 | 3300049568 | Bacteria | 623 |
| 663 | Ga0501032_0004162 | 3300049569 | Bacteria | 10961 |
| 664 | Ga0501032_0107653 | 3300049569 | Bacteria | 1846 |
| 665 | Ga0501032_0544450 | 3300049569 | Bacteria | 740 |
| 666 | Ga0501033_0008684 | 3300049570 | Bacteria | 7860 |
| 667 | Ga0501033_0118148 | 3300049570 | Bacteria | 1926 |
| 668 | Ga0501033_0267048 | 3300049570 | Bacteria | 1210 |
| 669 | Ga0501034_0001377 | 3300049571 | Bacteria | 32679 |
| 670 | Ga0501034_0125952 | 3300049571 | Bacteria | 2547 |
| 671 | Ga0501034_0160426 | 3300049571 | Bacteria | 2220 |
| 672 | Ga0501034_0176978 | 3300049571 | Bacteria | 2099 |
| 673 | Ga0501034_1265262 | 3300049571 | Bacteria | 615 |
| 674 | Ga0501036_0089796 | 3300049572 | Bacteria | 2596 |
| 675 | Ga0501036_0474184 | 3300049572 | Bacteria | 1042 |
| 676 | Ga0501037_0002295 | 3300049573 | Bacteria | 13802 |
| 677 | Ga0501037_0055119 | 3300049573 | Bacteria | 2907 |
| 678 | Ga0501037_0854155 | 3300049573 | Bacteria | 599 |
| 679 | Ga0501038_0000215 | 3300049574 | Bacteria | 49658 |
| 680 | Ga0501038_0193870 | 3300049574 | Bacteria | 1634 |
| 681 | Ga0501038_0767346 | 3300049574 | Bacteria | 718 |
| 682 | Ga0501039_1164834 | 3300049575 | Bacteria | 597 |
| 683 | Ga0501043_0009121 | 3300049579 | Bacteria | 7804 |
| 684 | Ga0501043_0023762 | 3300049579 | Bacteria | 4808 |
| 685 | Ga0501046_0003003 | 3300049580 | Bacteria | 15591 |
| 686 | Ga0501046_0186178 | 3300049580 | Bacteria | 1550 |
| 687 | Ga0501047_0003729 | 3300049581 | Bacteria | 14348 |
| 688 | Ga0501047_0005540 | 3300049581 | Bacteria | 11880 |
| 689 | Ga0501047_0031165 | 3300049581 | Bacteria | 5143 |
| 690 | Ga0501047_0597059 | 3300049581 | Bacteria | 926 |
| 691 | Ga0501047_1031440 | 3300049581 | Bacteria | 636 |
| 692 | Ga0501047_1085829 | 3300049581 | Bacteria | 613 |
| 693 | Ga0501048_0000571 | 3300049582 | Bacteria | 26167 |
| 694 | Ga0501048_0010853 | 3300049582 | Bacteria | 6791 |
| 695 | Ga0501069_0014837 | 3300049585 | Bacteria | 4171 |
| 696 | Ga0501070_0001697 | 3300049586 | Bacteria | 19506 |
| 697 | Ga0501070_0119674 | 3300049586 | Bacteria | 2176 |
| 698 | Ga0501070_0283619 | 3300049586 | Bacteria | 1351 |
| 699 | Ga0501073_0011218 | 3300049589 | Bacteria | 6554 |
| 700 | Ga0501073_0278562 | 3300049589 | Bacteria | 1154 |
| 701 | Ga0501080_0008174 | 3300049742 | Bacteria | 9478 |
| 702 | Ga0501080_0044486 | 3300049742 | Bacteria | 4133 |
| 703 | Ga0501080_0566410 | 3300049742 | Bacteria | 1011 |
| 704 | Ga0501083_0910287 | 3300049744 | Bacteria | 572 |
| 705 | Ga0501035_0001307 | 3300049822 | Bacteria | 25758 |
| 706 | Ga0501035_0008131 | 3300049822 | Bacteria | 9777 |
| 707 | Ga0501035_0049778 | 3300049822 | Bacteria | 3755 |
| 708 | Ga0501035_0529502 | 3300049822 | Bacteria | 967 |
| 709 | Ga0501044_0017914 | 3300049823 | Bacteria | 7595 |
| 710 | Ga0501044_0019276 | 3300049823 | Bacteria | 7300 |
| 711 | Ga0501044_0025594 | 3300049823 | Bacteria | 6256 |
| 712 | Ga0501044_0388941 | 3300049823 | Bacteria | 1309 |
| 713 | Ga0501044_0461825 | 3300049823 | Bacteria | 1175 |
| 714 | Ga0501044_0538371 | 3300049823 | Bacteria | 1066 |
| 715 | Ga0501044_0624946 | 3300049823 | Bacteria | 968 |
| 716 | nmdc:mga03683_294119_c1 | 3300050489 | Bacteria | 760 |
| 717 | nmdc:mga03n38_104702_c1 | 3300050490 | Bacteria | 1369 |
| 718 | nmdc:mga03n38_220598_c1 | 3300050490 | Bacteria | 989 |
| 719 | nmdc:mga03n38_236856_c1 | 3300050490 | Bacteria | 959 |
| 720 | nmdc:mga03n38_39458_c1 | 3300050490 | Bacteria | 2048 |
| 721 | nmdc:mga03n38_810677_c1 | 3300050490 | Bacteria | 545 |
| 722 | nmdc:mga03n38_862699_c1 | 3300050490 | Bacteria | 530 |
| 723 | nmdc:mga00v17_18536_c1 | 3300050491 | Bacteria | 3956 |
| 724 | nmdc:mga00v17_392055_c1 | 3300050491 | Bacteria | 903 |
| 725 | nmdc:mga0yw44_1079748_c1 | 3300050492 | Bacteria | 542 |
| 726 | nmdc:mga0yw44_281319_c1 | 3300050492 | Bacteria | 1112 |
| 727 | nmdc:mga0yw44_351198_c1 | 3300050492 | Bacteria | 993 |
| 728 | nmdc:mga0yw44_405276_c1 | 3300050492 | Bacteria | 922 |
| 729 | nmdc:mga0yw44_42108_c1 | 3300050492 | Bacteria | 2722 |
| 730 | nmdc:mga06z11_323027_c1 | 3300050494 | Bacteria | 921 |
| 731 | nmdc:mga07m45_140242_c1 | 3300050496 | Bacteria | 1400 |
| 732 | nmdc:mga07m45_23859_c1 | 3300050496 | Bacteria | 3345 |
| 733 | nmdc:mga07m45_68536_c1 | 3300050496 | Bacteria | 2017 |
| 734 | nmdc:mga07m45_79869_c1 | 3300050496 | Bacteria | 1867 |
| 735 | nmdc:mga08y16_64344_c1 | 3300050511 | Bacteria | 3829 |
| 736 | nmdc:mga08y16_950904_c1 | 3300050511 | Bacteria | 842 |
| 737 | nmdc:mga0sz30_1071_c2 | 3300050516 | Bacteria | 9560 |
| 738 | nmdc:mga0sz30_134780_c1 | 3300050516 | Bacteria | 1089 |
| 739 | nmdc:mga0sz30_138986_c1 | 3300050516 | Bacteria | 1072 |
| 740 | nmdc:mga0sz30_141305_c1 | 3300050516 | Bacteria | 1063 |
| 741 | nmdc:mga0sz30_15724_c1 | 3300050516 | Bacteria | 2611 |
| 742 | nmdc:mga0sz30_208067_c1 | 3300050516 | Bacteria | 869 |
| 743 | nmdc:mga0sz30_59050_c1 | 3300050516 | Bacteria | 1636 |
| 744 | nmdc:mga0sz30_9761_c1 | 3300050516 | Bacteria | 3659 |
| 745 | Ga0495601_0005566 | 3300053077 | Bacteria | 7347 |
| 746 | Ga0500610_0110294 | 3300053079 | Bacteria | 1415 |
| 747 | Ga0495619_0120032 | 3300053085 | Bacteria | 1802 |
| 748 | Ga0500643_014815 | 3300053087 | Bacteria | 2693 |
| 749 | Ga0500583_0293913 | 3300053092 | Bacteria | 796 |
| 750 | Ga0500641_0096843 | 3300053096 | Bacteria | 1263 |
| 751 | Ga0500641_0149067 | 3300053096 | Bacteria | 1010 |
| 752 | Ga0500556_0011612 | 3300053104 | Bacteria | 2611 |
| 753 | Ga0500562_008946 | 3300053108 | Bacteria | 2529 |
| 754 | Ga0500652_183869 | 3300053131 | Bacteria | 855 |
| 755 | Ga0500588_0220668 | 3300053146 | Bacteria | 707 |
| 756 | Ga0500616_0078471 | 3300053153 | Bacteria | 1665 |
| 757 | Ga0500627_0024961 | 3300053158 | Bacteria | 2452 |
| 758 | Ga0500645_000361 | 3300053730 | Bacteria | 32453 |
| 759 | Ga0500645_010095 | 3300053730 | Bacteria | 3141 |
| 760 | Ga0466962_0009036 | 3300061719 | Bacteria | 4773 |
| 761 | Ga0466962_0025077 | 3300061719 | Bacteria | 2862 |
| 762 | Ga0466962_0283581 | 3300061719 | Bacteria | 818 |
| 763 | 2526211897 | 2526164512 | Bacteria | 4025691 |
| 764 | 2738664530 | 2738541264 | Bacteria | 5935393 |
| 765 | 2738707496 | 2738541274 | Bacteria | 6909446 |
| 766 | 2739143665 | 2738541356 | Bacteria | 5935017 |
| 767 | 2739333992 | 2738543028 | Bacteria | 6917070 |
| 768 | 2744956308 | 2744054611 | Bacteria | 5611514 |
| 769 | 2753038009 | 2751185725 | Bacteria | 5740550 |
| 770 | 2753325877 | 2751185792 | Bacteria | 5739090 |
| 771 | 2809589526 | 2808606522 | Bacteria | 9488490 |
| 772 | 2839986564 | 2839986021 | Bacteria | 3685650 |
| 773 | 2842136932 | 2842134933 | Bacteria | 5847019 |
| 774 | 2902793293 | 2902792274 | Bacteria | 7270173 |
| 775 | 2902802876 | 2902799365 | Bacteria | 5419524 |
| 776 | 2915772258 | 2915768154 | Bacteria | 8424322 |
| 777 | 2929213988 | 2929212328 | Bacteria | 7708288 |
| 778 | 8003323535 | 8003314358 | Bacteria | 10575343 |
| 779 | Ga0466963_0007103 | |||
| 780 | JGI24746J21847_1006306 | |||
| 781 | JGI24739J22299_10118198 | |||
| 782 | JGI24743J22301_10088710 | |||
| 783 | JGI24735J21928_10038804 | |||
| 784 | JGI24745J21846_1017658 | |||
| 785 | JGI24748J21848_1006279 | |||
| 786 | JGI25407J50210_10139877 | |||
| 787 | Ga0055540_1001102 | |||
| 788 | Ga0055540_1002635 | |||
| 789 | Ga0070676_10091460 | |||
| 790 | Ga0070676_10099059 | |||
| 791 | Ga0070676_10173799 | |||
| 792 | Ga0070683_100098269 | |||
| 793 | Ga0070690_100004124 | |||
| 794 | Ga0070670_100076870 | |||
| 795 | Ga0070670_101321862 | |||
| 796 | Ga0068869_100002716 | |||
| 797 | Ga0068869_100033703 | |||
| 798 | Ga0070666_10025925 | |||
| 799 | Ga0070666_10371195 | |||
| 800 | Ga0070682_100175746 | |||
| 801 | Ga0070682_100304068 | |||
| 802 | Ga0070682_100360285 | |||
| 803 | Ga0068868_100001324 | |||
| 804 | Ga0068868_100002746 | |||
| 805 | Ga0068868_100050524 | |||
| 806 | Ga0068868_100234855 | |||
| 807 | Ga0070660_100115996 | |||
| 808 | Ga0070660_101157732 | |||
| 809 | Ga0070689_100019506 | |||
| 810 | Ga0070691_10006935 | |||
| 811 | Ga0070687_100670439 | |||
| 812 | Ga0070661_100050576 | |||
| 813 | Ga0070692_10828354 | |||
| 814 | Ga0070668_100027901 | |||
| 815 | Ga0070668_100962676 | |||
| 816 | Ga0070669_100023174 | |||
| 817 | Ga0070669_100158734 | |||
| 818 | Ga0070675_100083285 | |||
| 819 | Ga0070671_100002618 | |||
| 820 | Ga0070671_100129631 | |||
| 821 | Ga0070671_100167939 | |||
| 822 | Ga0070671_100379604 | |||
| 823 | Ga0070674_100143201 | |||
| 824 | Ga0070673_100039027 | |||
| 825 | Ga0070673_101657530 | |||
| 826 | Ga0070688_100019480 | |||
| 827 | Ga0070659_100325270 | |||
| 828 | Ga0070659_100325660 | |||
| 829 | Ga0070667_100002373 | |||
| 830 | Ga0070667_100004253 | |||
| 831 | Ga0070667_100016240 | |||
| 832 | Ga0070667_100028841 | |||
| 833 | Ga0070667_100070887 | |||
| 834 | Ga0070667_100127229 | |||
| 835 | Ga0070667_100386501 | |||
| 836 | Ga0070709_10795081 | |||
| 837 | Ga0070709_11059986 | |||
| 838 | Ga0070714_100130206 | |||
| 839 | Ga0070714_100189520 | |||
| 840 | Ga0070714_100223263 | |||
| 841 | Ga0070714_102081827 | |||
| 842 | Ga0070713_100193545 | |||
| 843 | Ga0070710_10005315 | |||
| 844 | Ga0070701_10006838 | |||
| 845 | Ga0070711_100008932 | |||
| 846 | Ga0070711_101010545 | |||
| 847 | Ga0070705_100898722 | |||
| 848 | Ga0070700_100202158 | |||
| 849 | Ga0070700_100255449 | |||
| 850 | Ga0070700_100541442 | |||
| 851 | Ga0070694_100017886 | |||
| 852 | Ga0070663_100003573 | |||
| 853 | Ga0070663_100108884 | |||
| 854 | Ga0070663_100219770 | |||
| 855 | Ga0070678_100021136 | |||
| 856 | Ga0070678_100113382 | |||
| 857 | Ga0070678_101094884 | |||
| 858 | Ga0070678_101144388 | |||
| 859 | Ga0070662_100113378 | |||
| 860 | Ga0070662_101083100 | |||
| 861 | Ga0068867_100008839 | |||
| 862 | Ga0070685_10010167 | |||
| 863 | Ga0070685_10019292 | |||
| 864 | Ga0070679_100520773 | |||
| 865 | Ga0070679_100772073 | |||
| 866 | Ga0070679_100973846 | |||
| 867 | Ga0070684_100125464 | |||
| 868 | Ga0070684_101094360 | |||
| 869 | Ga0068853_100046547 | |||
| 870 | Ga0068853_100096245 | |||
| 871 | Ga0070672_100023185 | |||
| 872 | Ga0070695_100010683 | |||
| 873 | Ga0070696_100026141 | |||
| 874 | Ga0070693_100008103 | |||
| 875 | Ga0070693_100061368 | |||
| 876 | Ga0070665_100002795 | |||
| 877 | Ga0070665_100025925 | |||
| 878 | Ga0070665_100029757 | |||
| 879 | Ga0070665_100036425 | |||
| 880 | Ga0070665_100490195 | |||
| 881 | Ga0070704_100023422 | |||
| 882 | Ga0070704_100381741 | |||
| 883 | Ga0070664_100008217 | |||
| 884 | Ga0068854_100025801 | |||
| 885 | Ga0068854_100625808 | |||
| 886 | Ga0068856_100104297 | |||
| 887 | Ga0068856_100492802 | |||
| 888 | Ga0068856_101530618 | |||
| 889 | Ga0068856_101556462 | |||
| 890 | Ga0070702_100019961 | |||
| 891 | Ga0070702_100065112 | |||
| 892 | Ga0070702_100106579 | |||
| 893 | Ga0068852_100006381 | |||
| 894 | Ga0068852_100469245 | |||
| 895 | Ga0068859_100003603 | |||
| 896 | Ga0068859_100003801 | |||
| 897 | Ga0068859_100003849 | |||
| 898 | Ga0068859_100120598 | |||
| 899 | Ga0068859_100212464 | |||
| 900 | Ga0068859_100569927 | |||
| 901 | Ga0068864_100101756 | |||
| 902 | Ga0068864_100417785 | |||
| 903 | Ga0068864_100670389 | |||
| 904 | Ga0068864_101140416 | |||
| 905 | Ga0068866_10001022 | |||
| 906 | Ga0068861_100000270 | |||
| 907 | Ga0068861_100081316 | |||
| 908 | Ga0068861_100176538 | |||
| 909 | Ga0068851_10626064 | |||
| 910 | Ga0068870_10323841 | |||
| 911 | Ga0068870_10435358 | |||
| 912 | Ga0068863_100002822 | |||
| 913 | Ga0068863_100003114 | |||
| 914 | Ga0068863_101725491 | |||
| 915 | Ga0068858_100003721 | |||
| 916 | Ga0068858_100004471 | |||
| 917 | Ga0068858_100005156 | |||
| 918 | Ga0068858_100230455 | |||
| 919 | Ga0068858_100266110 | |||
| 920 | Ga0068860_100000016 | |||
| 921 | Ga0068860_100001320 | |||
| 922 | Ga0068860_100030125 | |||
| 923 | Ga0068860_100062773 | |||
| 924 | Ga0068860_100382669 | |||
| 925 | Ga0068862_100000051 | |||
| 926 | Ga0068862_100001679 | |||
| 927 | Ga0068862_100029106 | |||
| 928 | Ga0081455_10007340 | |||
| 929 | Ga0081455_10079850 | |||
| 930 | Ga0081538_10099354 | |||
| 931 | Ga0075365_10044566 | |||
| 932 | Ga0075365_10386143 | |||
| 933 | Ga0075368_10052578 | |||
| 934 | Ga0075363_100053122 | |||
| 935 | Ga0075363_100111255 | |||
| 936 | Ga0075363_100119711 | |||
| 937 | Ga0075363_100262685 | |||
| 938 | Ga0075363_100355729 | |||
| 939 | Ga0075364_10008785 | |||
| 940 | Ga0075364_10013575 | |||
| 941 | Ga0075364_10042624 | |||
| 942 | Ga0075364_10749659 | |||
| 943 | Ga0070716_100007009 | |||
| 944 | Ga0070716_100183771 | |||
| 945 | Ga0075362_10018252 | |||
| 946 | Ga0075367_10045804 | |||
| 947 | Ga0075367_10105052 | |||
| 948 | Ga0075369_10037108 | |||
| 949 | Ga0075369_10044745 | |||
| 950 | Ga0075369_10112200 | |||
| 951 | Ga0075369_10131164 | |||
| 952 | Ga0097621_100189640 | |||
| 953 | Ga0075370_10028984 | |||
| 954 | Ga0075370_10038980 | |||
| 955 | Ga0075370_10043723 | |||
| 956 | Ga0075370_10074674 | |||
| 957 | Ga0075370_10273549 | |||
| 958 | Ga0068871_100006897 | |||
| 959 | Ga0068871_100447429 | |||
| 960 | Ga0068865_100000685 | |||
| 961 | Ga0068865_100037101 | |||
| 962 | Ga0097620_100003604 | |||
| 963 | Ga0097620_100003801 | |||
| 964 | Ga0097620_100003849 | |||
| 965 | Ga0097620_100120612 | |||
| 966 | Ga0097620_100212474 | |||
| 967 | Ga0097620_100569868 | |||
| 968 | Ga0075435_100449702 | |||
| 969 | Ga0105250_10028965 | |||
| 970 | Ga0105240_10443691 | |||
| 971 | Ga0105240_10814150 | |||
| 972 | Ga0111539_10080732 | |||
| 973 | Ga0105245_10002885 | |||
| 974 | Ga0105245_10021077 | |||
| 975 | Ga0105245_10075878 | |||
| 976 | Ga0105245_10845295 | |||
| 977 | Ga0105245_11975814 | |||
| 978 | Ga0105247_10000017 | |||
| 979 | Ga0105247_10001432 | |||
| 980 | Ga0105247_10007485 | |||
| 981 | Ga0105247_10030027 | |||
| 982 | Ga0105247_10081126 | |||
| 983 | Ga0105243_10003841 | |||
| 984 | Ga0105243_10584890 | |||
| 985 | Ga0105241_11300485 | |||
| 986 | Ga0105242_10005602 | |||
| 987 | Ga0105242_10364838 | |||
| 988 | Ga0105248_10000025 | |||
| 989 | Ga0105248_10003234 | |||
| 990 | Ga0105248_10036826 | |||
| 991 | Ga0105248_10043695 | |||
| 992 | Ga0105248_10267049 | |||
| 993 | Ga0105248_11036017 | |||
| 994 | Ga0105248_11143882 | |||
| 995 | Ga0105237_10000745 | |||
| 996 | Ga0105237_10013198 | |||
| 997 | Ga0105237_10020061 | |||
| 998 | Ga0105237_10990075 | |||
| 999 | Ga0105238_10020619 | |||
| 1000 | Ga0105238_11422633 | |||
| 1001 | Ga0105249_10000021 | |||
| 1002 | Ga0105249_10002204 | |||
| 1003 | Ga0105249_10033363 | |||
| 1004 | Ga0105249_10414823 | |||
| 1005 | Ga0105239_10001328 | |||
| 1006 | Ga0105239_10020371 | |||
| 1007 | Ga0105239_10031369 | |||
| 1008 | Ga0105239_10127607 | |||
| 1009 | Ga0105239_10283497 | |||
| 1010 | Ga0105239_10579832 | |||
| 1011 | Ga0105246_10001666 | |||
| 1012 | Ga0105246_10155377 | |||
| 1013 | Ga0157369_10304649 | |||
| 1014 | Ga0157374_10017544 | |||
| 1015 | Ga0157374_10025509 | |||
| 1016 | Ga0157374_10587301 | |||
| 1017 | Ga0157378_10009639 | |||
| 1018 | Ga0157378_10969711 | |||
| 1019 | Ga0163162_10012440 | |||
| 1020 | Ga0163162_10059117 | |||
| 1021 | Ga0163162_10119227 | |||
| 1022 | Ga0163162_10176077 | |||
| 1023 | Ga0163162_10235230 | |||
| 1024 | Ga0163162_10837429 | |||
| 1025 | Ga0157372_10006154 | |||
| 1026 | Ga0157375_10013607 | |||
| 1027 | Ga0157375_10388402 | |||
| 1028 | Ga0157375_10564099 | |||
| 1029 | Ga0157375_11337560 | |||
| 1030 | Ga0157375_12736616 | |||
| 1031 | Ga0163163_10005761 | |||
| 1032 | Ga0163163_10139323 | |||
| 1033 | Ga0163163_10189240 | |||
| 1034 | Ga0163163_10247511 | |||
| 1035 | Ga0163163_10790638 | |||
| 1036 | Ga0157380_10004514 | |||
| 1037 | Ga0157380_10207701 | |||
| 1038 | Ga0157380_10961760 | |||
| 1039 | Ga0157379_10007305 | |||
| 1040 | Ga0157379_10057929 | |||
| 1041 | Ga0163161_10007316 | |||
| 1042 | Ga0163161_10056342 | |||
| 1043 | Ga0163161_10668575 | |||
| 1044 | Ga0197907_10879848 | |||
| 1045 | Ga0206354_10023607 | |||
| 1046 | Ga0206353_11808613 | |||
| 1047 | Ga0213872_10069523 | |||
| 1048 | Ga0213876_10002857 | |||
| 1049 | Ga0213876_10019073 | |||
| 1050 | Ga0213875_10012643 | |||
| 1051 | Ga0209051_1001777 | |||
| 1052 | Ga0209051_1002102 | |||
| 1053 | Ga0207656_10025895 | |||
| 1054 | Ga0207692_10002331 | |||
| 1055 | Ga0207642_10000980 | |||
| 1056 | Ga0207710_10000033 | |||
| 1057 | Ga0207710_10006967 | |||
| 1058 | Ga0207710_10031025 | |||
| 1059 | Ga0207710_10288720 | |||
| 1060 | Ga0207688_10000368 | |||
| 1061 | Ga0207688_10002019 | |||
| 1062 | Ga0207680_10077031 | |||
| 1063 | Ga0207680_10093579 | |||
| 1064 | Ga0207647_10091394 | |||
| 1065 | Ga0207647_10104094 | |||
| 1066 | Ga0207647_10311693 | |||
| 1067 | Ga0207685_10134706 | |||
| 1068 | Ga0207699_10537107 | |||
| 1069 | Ga0207699_10908502 | |||
| 1070 | Ga0207645_10034578 | |||
| 1071 | Ga0207643_10119925 | |||
| 1072 | Ga0207643_10327690 | |||
| 1073 | Ga0207695_10373386 | |||
| 1074 | Ga0207671_10013580 | |||
| 1075 | Ga0207671_10060143 | |||
| 1076 | Ga0207671_10414601 | |||
| 1077 | Ga0207671_10589314 | |||
| 1078 | Ga0207693_10003780 | |||
| 1079 | Ga0207693_10787942 | |||
| 1080 | Ga0207693_10922279 | |||
| 1081 | Ga0207663_10208510 | |||
| 1082 | Ga0207662_10599612 | |||
| 1083 | Ga0207657_10262476 | |||
| 1084 | Ga0207657_10336773 | |||
| 1085 | Ga0207649_10216032 | |||
| 1086 | Ga0207681_10302972 | |||
| 1087 | Ga0207681_10862523 | |||
| 1088 | Ga0207694_10020506 | |||
| 1089 | Ga0207694_10194462 | |||
| 1090 | Ga0207694_11137686 | |||
| 1091 | Ga0207650_10292357 | |||
| 1092 | Ga0207687_10054818 | |||
| 1093 | Ga0207687_10541571 | |||
| 1094 | Ga0207700_10087887 | |||
| 1095 | Ga0207664_10173896 | |||
| 1096 | Ga0207664_10181301 | |||
| 1097 | Ga0207664_10549310 | |||
| 1098 | Ga0207664_10597988 | |||
| 1099 | Ga0207644_10003820 | |||
| 1100 | Ga0207644_10099489 | |||
| 1101 | Ga0207690_10862499 | |||
| 1102 | Ga0207706_10103768 | |||
| 1103 | Ga0207706_10132340 | |||
| 1104 | Ga0207686_10004197 | |||
| 1105 | Ga0207709_10005649 | |||
| 1106 | Ga0207709_10238193 | |||
| 1107 | Ga0207670_10005137 | |||
| 1108 | Ga0207670_10094351 | |||
| 1109 | Ga0207669_10243031 | |||
| 1110 | Ga0207704_10002187 | |||
| 1111 | Ga0207665_10028793 | |||
| 1112 | Ga0207665_10296196 | |||
| 1113 | Ga0207691_10048199 | |||
| 1114 | Ga0207711_10000390 | |||
| 1115 | Ga0207711_10040236 | |||
| 1116 | Ga0207711_10069330 | |||
| 1117 | Ga0207711_10128164 | |||
| 1118 | Ga0207711_10193800 | |||
| 1119 | Ga0207689_10012018 | |||
| 1120 | Ga0207661_10127796 | |||
| 1121 | Ga0207679_10072885 | |||
| 1122 | Ga0207667_10594621 | |||
| 1123 | Ga0207651_10053950 | |||
| 1124 | Ga0207651_10108112 | |||
| 1125 | Ga0207712_10000005 | |||
| 1126 | Ga0207712_10037702 | |||
| 1127 | Ga0207712_10330250 | |||
| 1128 | Ga0207668_10001360 | |||
| 1129 | Ga0207668_10039224 | |||
| 1130 | Ga0207640_10112635 | |||
| 1131 | Ga0207640_10127812 | |||
| 1132 | Ga0207640_10155889 | |||
| 1133 | Ga0207658_10001262 | |||
| 1134 | Ga0207658_10024249 | |||
| 1135 | Ga0207658_10041956 | |||
| 1136 | Ga0207658_10045930 | |||
| 1137 | Ga0207658_10596360 | |||
| 1138 | Ga0207658_10885568 | |||
| 1139 | Ga0207677_10009000 | |||
| 1140 | Ga0207677_10306949 | |||
| 1141 | Ga0207677_10418851 | |||
| 1142 | Ga0207677_10968272 | |||
| 1143 | Ga0207703_10030925 | |||
| 1144 | Ga0207703_10036714 | |||
| 1145 | Ga0207703_10457731 | |||
| 1146 | Ga0207639_10284613 | |||
| 1147 | Ga0207639_10567679 | |||
| 1148 | Ga0207639_10904480 | |||
| 1149 | Ga0207678_10017171 | |||
| 1150 | Ga0207678_10058531 | |||
| 1151 | Ga0207678_10085283 | |||
| 1152 | Ga0207678_10153572 | |||
| 1153 | Ga0207678_10237382 | |||
| 1154 | Ga0207678_10424366 | |||
| 1155 | Ga0207678_10461261 | |||
| 1156 | Ga0207708_10001654 | |||
| 1157 | Ga0207708_10362785 | |||
| 1158 | Ga0207702_10127219 | |||
| 1159 | Ga0207641_10001387 | |||
| 1160 | Ga0207641_10005444 | |||
| 1161 | Ga0207648_10013368 | |||
| 1162 | Ga0207676_10001045 | |||
| 1163 | Ga0207676_10547096 | |||
| 1164 | Ga0207676_10659074 | |||
| 1165 | Ga0207676_11482155 | |||
| 1166 | Ga0207675_100009432 | |||
| 1167 | Ga0207675_100701183 | |||
| 1168 | Ga0207675_100826907 | |||
| 1169 | Ga0207683_10011348 | |||
| 1170 | Ga0207683_10333027 | |||
| 1171 | Ga0207698_10017217 | |||
| 1172 | Ga0209813_10014539 | |||
| 1173 | Ga0207428_10537362 | |||
| 1174 | Ga0268266_10005558 | |||
| 1175 | Ga0268266_10013784 | |||
| 1176 | Ga0268266_10607210 | |||
| 1177 | Ga0268265_10000022 | |||
| 1178 | Ga0268265_10007108 | |||
| 1179 | Ga0268264_10000005 | |||
| 1180 | Ga0268264_10002009 | |||
| 1181 | Ga0268264_10390210 | |||
| 1182 | Ga0268264_12468591 | |||
| 1183 | Ga0307512_10219742 | |||
| 1184 | Ga0265327_10000019 | |||
| 1185 | Ga0316576_10009877 | |||
| 1186 | Ga0316578_10022854 | |||
| 1187 | Ga0316577_10035653 | |||
| 1188 | Ga0307413_10168241 | |||
| 1189 | Ga0307410_10383838 | |||
| 1190 | Ga0307416_100052549 | |||
| 1191 | Ga0307414_10170606 | |||
| 1192 | Ga0307415_100140089 | |||
| 1193 | Ga0316580_10010501 | |||
| 1194 | Ga0373948_0191339 | |||
| 1195 | Ga0373956_0046790 | |||
| 1196 | Ga0373960_0040046 | |||
| 1197 | Ga0373943_0561848 | |||
| 1198 | Ga0373955_0003290 | |||
| 1199 | Ga0316574_0020283 | |||
| 1200 | Ga0373933_0244935 | |||
| 1201 | Ga0373947_0460350 | |||
| 1202 | Ga0373937_0128731 | |||
| 1203 | Ga0316582_0072860 | |||
| 1204 | Ga0316584_0017179 | |||
| 1205 | Ga0316584_0358061 | |||
| 1206 | Ga0373925_0763266 | |||
| 1207 | Ga0395900_0413959 | |||
| 1208 | Ga0436364_0178326 | |||
| 1209 | Ga0400485_21326 | |||
| 1210 | Ga0436365_0133306 | |||
| 1211 | Ga0436365_0393632 | |||
| 1212 | Ga0436365_1406222 | |||
| 1213 | Ga0436361_1162518 | |||
| 1214 | Ga0436363_0849090 | |||
| 1215 | Ga0436363_1654988 | |||
| 1216 | Ga0436362_0829052 | |||
| 1217 | Ga0439461_0027844 | |||
| 1218 | Ga0439466_0008319 | |||
| 1219 | Ga0439466_0034131 | |||
| 1220 | Ga0439465_0015108 | |||
| 1221 | Ga0439465_0026879 | |||
| 1222 | Ga0451802_0749428 | |||
| 1223 | Ga0451835_0752417 | |||
| 1224 | Ga0451839_1597037 | |||
| 1225 | Ga0451853_0572343 | |||
| 1226 | Ga0451853_3243727 | |||
| 1227 | Ga0439448_0016235 | |||
| 1228 | Ga0439435_0197511 | |||
| 1229 | Ga0439459_0000789 | |||
| 1230 | Ga0466969_0010564 | |||
| 1231 | Ga0466969_0037831 | |||
| 1232 | Ga0466969_0290652 | |||
| 1233 | Ga0466972_0009271 | |||
| 1234 | Ga0466972_0013691 | |||
| 1235 | Ga0466965_0012053 | |||
| 1236 | Ga0466965_0072495 | |||
| 1237 | Ga0466965_0175790 | |||
| 1238 | Ga0466965_0736405 | |||
| 1239 | Ga0466966_0002022 | |||
| 1240 | Ga0466966_0007192 | |||
| 1241 | Ga0466966_0061593 | |||
| 1242 | Ga0466961_0002938 | |||
| 1243 | Ga0466961_0009619 | |||
| 1244 | Ga0466961_0057416 | |||
| 1245 | Ga0466961_0087619 | |||
| 1246 | Ga0466961_0148112 | |||
| 1247 | Ga0466961_0150322 | |||
| 1248 | Ga0466961_0210521 | |||
| 1249 | Ga0466963_0008684 | |||
| 1250 | Ga0466963_0046163 | |||
| 1251 | Ga0466963_0188455 | |||
| 1252 | Ga0466963_0223380 | |||
| 1253 | Ga0466963_0229757 | |||
| 1254 | Ga0466963_0290381 | |||
| 1255 | Ga0466971_0089821 | |||
| 1256 | Ga0466971_0136195 | |||
| 1257 | Ga0466971_0235806 | |||
| 1258 | Ga0466971_0446472 | |||
| 1259 | Ga0466968_0073852 | |||
| 1260 | Ga0466968_0075129 | |||
| 1261 | Ga0466968_0082029 | |||
| 1262 | Ga0466968_0098515 | |||
| 1263 | Ga0466970_0002489 | |||
| 1264 | Ga0466970_0012926 | |||
| 1265 | Ga0466970_0029435 | |||
| 1266 | Ga0466970_0051365 | |||
| 1267 | Ga0466970_0494051 | |||
| 1268 | Ga0466957_0021395 | |||
| 1269 | Ga0466957_0082925 | |||
| 1270 | Ga0466957_0197542 | |||
| 1271 | Ga0466957_0744969 | |||
| 1272 | Ga0466960_0012164 | |||
| 1273 | Ga0466960_0100643 | |||
| 1274 | Ga0466960_0176994 | |||
| 1275 | Ga0466959_0001602 | |||
| 1276 | Ga0466959_0049731 | |||
| 1277 | Ga0466959_0328516 | |||
| 1278 | Ga0466959_0606750 | |||
| 1279 | Ga0466959_1075458 | |||
| 1280 | Ga0451576_0164731 | |||
| 1281 | Ga0466958_0004372 | |||
| 1282 | Ga0466958_0008215 | |||
| 1283 | Ga0466958_0010080 | |||
| 1284 | Ga0466958_0044365 | |||
| 1285 | Ga0466958_0086412 | |||
| 1286 | Ga0466958_0164732 | |||
| 1287 | Ga0466958_0244797 | |||
| 1288 | Ga0466958_0752174 | |||
| 1289 | Ga0466958_1030142 | |||
| 1290 | Ga0466967_0001096 | |||
| 1291 | Ga0466967_0018533 | |||
| 1292 | Ga0466967_0023199 | |||
| 1293 | Ga0466967_0085079 | |||
| 1294 | Ga0466967_0349644 | |||
| 1295 | Ga0466967_0703420 | |||
| 1296 | Ga0466967_0781336 | |||
| 1297 | Ga0495592_0125486 | |||
| 1298 | Ga0495603_0041665 | |||
| 1299 | Ga0495629_0005249 | |||
| 1300 | Ga0495638_0030497 | |||
| 1301 | Ga0495651_0675037 | |||
| 1302 | Ga0495580_0595722 | |||
| 1303 | Ga0495582_0056388 | |||
| 1304 | Ga0495639_0078936 | |||
| 1305 | Ga0495606_0040470 | |||
| 1306 | Ga0495620_0124790 | |||
| 1307 | Ga0495620_0254246 | |||
| 1308 | Ga0495630_0233073 | |||
| 1309 | Ga0495648_0001768 | |||
| 1310 | Ga0495652_0970623 | |||
| 1311 | Ga0495654_0042351 | |||
| 1312 | Ga0495665_0007893 | |||
| 1313 | Ga0495640_0043397 | |||
| 1314 | Ga0495588_0138560 | |||
| 1315 | Ga0495658_0710366 | |||
| 1316 | Ga0495624_0035425 | |||
| 1317 | Ga0495649_0286480 | |||
| 1318 | Ga0495581_0008106 | |||
| 1319 | Ga0495636_0508218 | |||
| 1320 | Ga0495674_0010640 | |||
| 1321 | Ga0495672_0001641 | |||
| 1322 | Ga0495672_0152753 | |||
| 1323 | Ga0495676_0424898 | |||
| 1324 | Ga0495673_0000949 | |||
| 1325 | Ga0495686_0002701 | |||
| 1326 | Ga0495686_0087903 | |||
| 1327 | Ga0495593_0005299 | |||
| 1328 | Ga0496100_0001287 | |||
| 1329 | Ga0496100_0013874 | |||
| 1330 | Ga0496100_0132018 | |||
| 1331 | Ga0496100_0285474 | |||
| 1332 | Ga0496100_0924615 | |||
| 1333 | Ga0496101_0000002 | |||
| 1334 | Ga0496101_0000933 | |||
| 1335 | Ga0496101_0006508 | |||
| 1336 | Ga0496101_0044913 | |||
| 1337 | Ga0496101_0345791 | |||
| 1338 | Ga0496101_0932388 | |||
| 1339 | Ga0496102_0000003 | |||
| 1340 | Ga0496102_0000782 | |||
| 1341 | Ga0496102_0034519 | |||
| 1342 | Ga0496102_0102925 | |||
| 1343 | Ga0496102_0109481 | |||
| 1344 | Ga0496102_0135057 | |||
| 1345 | Ga0496102_0162908 | |||
| 1346 | Ga0496102_0478115 | |||
| 1347 | Ga0496102_0506584 | |||
| 1348 | Ga0496102_1309946 | |||
| 1349 | Ga0496103_0000014 | |||
| 1350 | Ga0496103_0000515 | |||
| 1351 | Ga0496103_0005127 | |||
| 1352 | Ga0496103_0132003 | |||
| 1353 | Ga0496103_0133805 | |||
| 1354 | Ga0496103_0320256 | |||
| 1355 | Ga0496103_0472548 | |||
| 1356 | Ga0496104_0015477 | |||
| 1357 | Ga0496104_0026925 | |||
| 1358 | Ga0496104_0079337 | |||
| 1359 | Ga0496104_0226225 | |||
| 1360 | Ga0496104_0402123 | |||
| 1361 | Ga0496104_0416455 | |||
| 1362 | Ga0496104_0676384 | |||
| 1363 | Ga0496105_0009653 | |||
| 1364 | Ga0496105_0080763 | |||
| 1365 | Ga0496105_0130155 | |||
| 1366 | Ga0496105_0367110 | |||
| 1367 | Ga0496105_0513487 | |||
| 1368 | Ga0496105_0567520 | |||
| 1369 | Ga0496105_1391607 | |||
| 1370 | Ga0496106_0006137 | |||
| 1371 | Ga0496106_0010999 | |||
| 1372 | Ga0496106_0077110 | |||
| 1373 | Ga0496106_0081910 | |||
| 1374 | Ga0496106_0113614 | |||
| 1375 | Ga0496106_0311029 | |||
| 1376 | Ga0496106_1069093 | |||
| 1377 | Ga0496107_0001748 | |||
| 1378 | Ga0496107_0062420 | |||
| 1379 | Ga0496107_0104046 | |||
| 1380 | Ga0496107_0169238 | |||
| 1381 | Ga0496108_0000369 | |||
| 1382 | Ga0496108_0051416 | |||
| 1383 | Ga0496108_0099990 | |||
| 1384 | Ga0496108_0214382 | |||
| 1385 | Ga0496108_0628649 | |||
| 1386 | Ga0496108_1145163 | |||
| 1387 | Ga0496109_0003399 | |||
| 1388 | Ga0496109_0010688 | |||
| 1389 | Ga0496109_0011451 | |||
| 1390 | Ga0496109_0062908 | |||
| 1391 | Ga0496109_0222813 | |||
| 1392 | Ga0496109_0297650 | |||
| 1393 | Ga0496110_0206736 | |||
| 1394 | Ga0496111_0064450 | |||
| 1395 | Ga0496111_0094284 | |||
| 1396 | Ga0496111_0119636 | |||
| 1397 | Ga0496111_0400661 | |||
| 1398 | Ga0496112_0008288 | |||
| 1399 | Ga0496112_0046815 | |||
| 1400 | Ga0496112_0082781 | |||
| 1401 | Ga0496112_0117359 | |||
| 1402 | Ga0496112_0168499 | |||
| 1403 | Ga0496112_1663221 | |||
| 1404 | Ga0496113_0100888 | |||
| 1405 | Ga0496113_0105898 | |||
| 1406 | Ga0496113_0874391 | |||
| 1407 | Ga0496114_0000712 | |||
| 1408 | Ga0496114_0012185 | |||
| 1409 | Ga0496114_0036308 | |||
| 1410 | Ga0496114_0109200 | |||
| 1411 | Ga0496114_0252571 | |||
| 1412 | Ga0496115_0001474 | |||
| 1413 | Ga0496115_0016508 | |||
| 1414 | Ga0496116_0000071 | |||
| 1415 | Ga0496116_0024374 | |||
| 1416 | Ga0496117_0000003 | |||
| 1417 | Ga0496117_0000417 | |||
| 1418 | Ga0496118_0000001 | |||
| 1419 | Ga0496118_0000350 | |||
| 1420 | Ga0496118_0000604 | |||
| 1421 | Ga0496118_0091150 | |||
| 1422 | Ga0496119_0003282 | |||
| 1423 | Ga0496119_0037686 | |||
| 1424 | Ga0496120_0000157 | |||
| 1425 | Ga0496120_0006256 | |||
| 1426 | Ga0496121_0000019 | |||
| 1427 | Ga0496121_0008927 | |||
| 1428 | Ga0496122_0000695 | |||
| 1429 | Ga0496123_0000119 | |||
| 1430 | Ga0496124_0001956 | |||
| 1431 | Ga0496124_0524118 | |||
| 1432 | Ga0496124_0739950 | |||
| 1433 | Ga0496125_0044866 | |||
| 1434 | Ga0496125_0140821 | |||
| 1435 | Ga0496126_0000186 | |||
| 1436 | Ga0496126_0015320 | |||
| 1437 | Ga0496126_0029309 | |||
| 1438 | Ga0496126_0045953 | |||
| 1439 | Ga0501031_0015490 | |||
| 1440 | Ga0501031_0757491 | |||
| 1441 | Ga0501032_0004162 | |||
| 1442 | Ga0501032_0107653 | |||
| 1443 | Ga0501032_0544450 | |||
| 1444 | Ga0501033_0008684 | |||
| 1445 | Ga0501033_0118148 | |||
| 1446 | Ga0501033_0267048 | |||
| 1447 | Ga0501034_0001377 | |||
| 1448 | Ga0501034_0125952 | |||
| 1449 | Ga0501034_0160426 | |||
| 1450 | Ga0501034_0176978 | |||
| 1451 | Ga0501034_1265262 | |||
| 1452 | Ga0501036_0089796 | |||
| 1453 | Ga0501036_0474184 | |||
| 1454 | Ga0501037_0002295 | |||
| 1455 | Ga0501037_0055119 | |||
| 1456 | Ga0501037_0854155 | |||
| 1457 | Ga0501038_0000215 | |||
| 1458 | Ga0501038_0193870 | |||
| 1459 | Ga0501038_0767346 | |||
| 1460 | Ga0501039_1164834 | |||
| 1461 | Ga0501043_0009121 | |||
| 1462 | Ga0501043_0023762 | |||
| 1463 | Ga0501046_0003003 | |||
| 1464 | Ga0501046_0186178 | |||
| 1465 | Ga0501047_0003729 | |||
| 1466 | Ga0501047_0005540 | |||
| 1467 | Ga0501047_0031165 | |||
| 1468 | Ga0501047_0597059 | |||
| 1469 | Ga0501047_1031440 | |||
| 1470 | Ga0501047_1085829 | |||
| 1471 | Ga0501048_0000571 | |||
| 1472 | Ga0501048_0010853 | |||
| 1473 | Ga0501069_0014837 | |||
| 1474 | Ga0501070_0001697 | |||
| 1475 | Ga0501070_0119674 | |||
| 1476 | Ga0501070_0283619 | |||
| 1477 | Ga0501073_0011218 | |||
| 1478 | Ga0501073_0278562 | |||
| 1479 | Ga0501080_0008174 | |||
| 1480 | Ga0501080_0044486 | |||
| 1481 | Ga0501080_0566410 | |||
| 1482 | Ga0501083_0910287 | |||
| 1483 | Ga0501035_0001307 | |||
| 1484 | Ga0501035_0008131 | |||
| 1485 | Ga0501035_0049778 | |||
| 1486 | Ga0501035_0529502 | |||
| 1487 | Ga0501044_0017914 | |||
| 1488 | Ga0501044_0019276 | |||
| 1489 | Ga0501044_0025594 | |||
| 1490 | Ga0501044_0388941 | |||
| 1491 | Ga0501044_0461825 | |||
| 1492 | Ga0501044_0538371 | |||
| 1493 | Ga0501044_0624946 | |||
| 1494 | nmdc:mga03683_294119_c1 | |||
| 1495 | nmdc:mga03n38_104702_c1 | |||
| 1496 | nmdc:mga03n38_220598_c1 | |||
| 1497 | nmdc:mga03n38_236856_c1 | |||
| 1498 | nmdc:mga03n38_39458_c1 | |||
| 1499 | nmdc:mga03n38_810677_c1 | |||
| 1500 | nmdc:mga03n38_862699_c1 | |||
| 1501 | nmdc:mga00v17_18536_c1 | |||
| 1502 | nmdc:mga00v17_392055_c1 | |||
| 1503 | nmdc:mga0yw44_1079748_c1 | |||
| 1504 | nmdc:mga0yw44_281319_c1 | |||
| 1505 | nmdc:mga0yw44_351198_c1 | |||
| 1506 | nmdc:mga0yw44_405276_c1 | |||
| 1507 | nmdc:mga0yw44_42108_c1 | |||
| 1508 | nmdc:mga06z11_323027_c1 | |||
| 1509 | nmdc:mga07m45_140242_c1 | |||
| 1510 | nmdc:mga07m45_23859_c1 | |||
| 1511 | nmdc:mga07m45_68536_c1 | |||
| 1512 | nmdc:mga07m45_79869_c1 | |||
| 1513 | nmdc:mga08y16_64344_c1 | |||
| 1514 | nmdc:mga08y16_950904_c1 | |||
| 1515 | nmdc:mga0sz30_1071_c2 | |||
| 1516 | nmdc:mga0sz30_134780_c1 | |||
| 1517 | nmdc:mga0sz30_138986_c1 | |||
| 1518 | nmdc:mga0sz30_141305_c1 | |||
| 1519 | nmdc:mga0sz30_15724_c1 | |||
| 1520 | nmdc:mga0sz30_208067_c1 | |||
| 1521 | nmdc:mga0sz30_59050_c1 | |||
| 1522 | nmdc:mga0sz30_9761_c1 | |||
| 1523 | Ga0495601_0005566 | |||
| 1524 | Ga0500610_0110294 | |||
| 1525 | Ga0495619_0120032 | |||
| 1526 | Ga0500643_014815 | |||
| 1527 | Ga0500583_0293913 | |||
| 1528 | Ga0500641_0096843 | |||
| 1529 | Ga0500641_0149067 | |||
| 1530 | Ga0500556_0011612 | |||
| 1531 | Ga0500562_008946 | |||
| 1532 | Ga0500652_183869 | |||
| 1533 | Ga0500588_0220668 | |||
| 1534 | Ga0500616_0078471 | |||
| 1535 | Ga0500627_0024961 | |||
| 1536 | Ga0500645_000361 | |||
| 1537 | Ga0500645_010095 | |||
| 1538 | Ga0466962_0009036 | |||
| 1539 | Ga0466962_0025077 | |||
| 1540 | Ga0466962_0283581 | |||
| 1541 | 2526211897 | |||
| 1542 | 2738664530 | |||
| 1543 | 2738707496 | |||
| 1544 | 2739143665 | |||
| 1545 | 2739333992 | |||
| 1546 | 2744956308 | |||
| 1547 | 2753038009 | |||
| 1548 | 2753325877 | |||
| 1549 | 2809589526 | |||
| 1550 | 2839986564 | |||
| 1551 | 2842136932 | |||
| 1552 | 2902793293 | |||
| 1553 | 2902802876 | |||
| 1554 | 2915772258 | |||
| 1555 | 2929213988 | |||
| 1556 | 8003323535 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5co4-assembly1.cif.gz_A | structural insights into the 2-oh methylation of c/u34 on trna | 0.9363 | 2 | 149 |
| 5co4-assembly1.cif.gz_B | structural insights into the 2-oh methylation of c/u34 on trna | 0.9142 | 2 | 149 |
| 1j85-assembly1.cif.gz_A | structure of yibk from haemophilus influenzae (hi0766), a truncated sequence homolog of trna (guanosine-2'-o-) methyltransferase (spou) | 0.9136 | 1 | 154 |
| 4kdz-assembly1.cif.gz_A | crystal structure of trna/rrna methyltransferase yibk from escherichia coli (target nysgrc-012599) | 0.9107 | 1 | 154 |
| 6qkv-assembly1.cif.gz_B | structure of yibk from p. aeruginosa | 0.91 | 2 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O50394_1_154_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9395 | 1 | 154 | 3.40.1280.10 |
| 5co4A00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9363 | 2 | 149 | 3.40.1280.10 |
| af_C6TCU8_69_240_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9221 | 1 | 152 | 3.40.1280.10 |
| af_C6TCU8_69_240_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.905 | 1 | 152 | 3.40.1280.10 |
| 5co4A00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.895 | 2 | 149 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I1D367-F1-model_v4 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) | 0.9573 | 2 | 152 |
GO:0002130
GO:0003723 GO:0005737 GO:0141098 GO:0141102 |
| AF-A0A7G2JYR0-F1-model_v4 | RNA methyltransferase, TrmH family | 0.9548 | 1 | 109 |
GO:0002131
GO:0002132 GO:0003723 GO:0008173 |
| AF-D2NS65-F1-model_v4 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) | 0.9542 | 1 | 152 |
GO:0002130
GO:0003723 GO:0005737 GO:0016020 GO:0141098 GO:0141102 |
| AF-A0A2Z5R1N9-F1-model_v4 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) | 0.9523 | 1 | 150 |
GO:0002130
GO:0003723 GO:0005737 GO:0141098 GO:0141102 |
| AF-A0A1A0N489-F1-model_v4 | tRNA (Cytosine(34)-2'-O)-methyltransferase TrmL | 0.9522 | 1 | 126 |
GO:0002130
GO:0003723 GO:0008173 |