F480380

General Info

Members Datasets Scaffolds Average Seq Length
777 359 736 231

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0073965|Ga0466963_0073965_531_1355
Length 274
Sequence MCGDEHLRARAHRFDQLPMIFGRSTSQTFKRAIESEGGAMSSRITALPPVVDHQTWGAALDELRKREKAATRELDAIAAQRRRLPMVEVADYTLVGADGPIRLADVFGGRSQLIVYHHMWSDGAEWQCGGCTGFTSQFTRLEFLDNYDARFVIVTNGPIEEALAYKHKVGNRMDWYSSSQSTFAADMDAPPGGGFGVNVFLRDGETVYRTWHTNGRGTEQLSHSFGLIDILPWGRQEEWLDSPEGWPSRPTYSGWLDSPAIAAAYGPTGNKDNP

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2643221553 Microbacterium sp. Root553 Isolate Unclassified
3 2643221647 Streptomyces sp. Root369 Isolate Unclassified
4 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
5 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
6 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
7 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
8 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
9 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
10 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
11 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
12 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
13 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
14 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
15 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
16 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
17 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
18 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
19 2862574272 Streptomyces sp. AcE210 Isolate Nodule
20 2867428634 Streptomyces sp. RP5T Isolate Unclassified
21 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
22 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
23 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
24 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
25 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
26 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
27 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
28 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
29 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
30 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
31 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
32 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
33 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
34 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
35 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
36 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
37 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
38 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
39 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
40 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
41 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
42 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
66 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
67 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
105 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
109 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
124 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
152 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
153 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
220 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
225 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
226 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
227 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
228 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
229 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
230 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
231 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
232 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
233 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
236 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
237 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
244 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
245 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
246 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
247 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
258 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
276 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
323 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
324 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
327 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
328 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
331 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
332 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
333 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
334 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
335 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
336 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
337 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
338 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
339 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
344 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
345 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
346 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
347 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
348 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
349 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
350 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
351 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
352 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
353 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
358 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
359 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.47
Metatranscriptomes 0.26
Isolates 5.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.33
Nodule 0.39
Rhizoplane 12.36
Rhizosphere 65.64
Stem 0
Stem Tuber 0
Unclassified 10.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10006994 3300001991 Bacteria 1943
2 JGI24744J21845_10018574 3300002077 Bacteria 1378
3 JGI25406J46586_10000381 3300003203 Bacteria 20344
4 JGI25407J50210_10016053 3300003373 Bacteria 1937
5 Ga0055540_1000082 3300003792 Bacteria 109065
6 Ga0055540_1005754 3300003792 Bacteria 5104
7 Ga0055540_1008491 3300003792 Bacteria 3691
8 Ga0070658_10005967 3300005327 Bacteria 9878
9 Ga0070658_10228389 3300005327 Bacteria 1575
10 Ga0070676_10211489 3300005328 Bacteria 1277
11 Ga0070683_100505930 3300005329 Bacteria 1154
12 Ga0070683_101124507 3300005329 Bacteria 755
13 Ga0070690_100115387 3300005330 Bacteria 1797
14 Ga0070690_100162165 3300005330 Bacteria 1533
15 Ga0070670_100112808 3300005331 Bacteria 2343
16 Ga0068869_100759336 3300005334 Bacteria 831
17 Ga0070666_10128195 3300005335 Bacteria 1762
18 Ga0070682_100002000 3300005337 Bacteria 11373
19 Ga0070682_100010434 3300005337 Bacteria 5271
20 Ga0068868_100011304 3300005338 Bacteria 6500
21 Ga0068868_100182129 3300005338 Bacteria 1743
22 Ga0068868_100499694 3300005338 Bacteria 1065
23 Ga0070660_100484300 3300005339 Bacteria 1028
24 Ga0070689_100555737 3300005340 Bacteria 989
25 Ga0070661_100033955 3300005344 Bacteria 3698
26 Ga0070668_100001949 3300005347 Bacteria 15054
27 Ga0070668_100004049 3300005347 Bacteria 10851
28 Ga0070669_100006595 3300005353 Bacteria 8355
29 Ga0070669_100236890 3300005353 Bacteria 1448
30 Ga0070675_100401646 3300005354 Bacteria 1223
31 Ga0070671_100001885 3300005355 Bacteria 16030
32 Ga0070674_100198512 3300005356 Bacteria 1547
33 Ga0070674_100375330 3300005356 Bacteria 1155
34 Ga0070674_100407860 3300005356 Bacteria 1112
35 Ga0070674_100441766 3300005356 Bacteria 1072
36 Ga0070688_100077185 3300005365 Bacteria 2145
37 Ga0070659_100070783 3300005366 Bacteria 2771
38 Ga0070659_100260193 3300005366 Bacteria 1440
39 Ga0070659_100573543 3300005366 Bacteria 968
40 Ga0070667_100000582 3300005367 Bacteria 36093
41 Ga0070667_100001225 3300005367 Bacteria 23359
42 Ga0070667_100023395 3300005367 Bacteria 5125
43 Ga0070667_100102931 3300005367 Bacteria 2468
44 Ga0070667_100143653 3300005367 Bacteria 2091
45 Ga0070667_100446470 3300005367 Bacteria 1181
46 Ga0070709_10054689 3300005434 Bacteria 2517
47 Ga0070714_100066963 3300005435 Bacteria 3096
48 Ga0070714_100198527 3300005435 Bacteria 1834
49 Ga0070714_100243408 3300005435 Bacteria 1661
50 Ga0070713_100166250 3300005436 Bacteria 1973
51 Ga0070713_100278569 3300005436 Bacteria 1533
52 Ga0070701_10100733 3300005438 Bacteria 1599
53 Ga0070701_10123103 3300005438 Bacteria 1464
54 Ga0070711_100036965 3300005439 Bacteria 3274
55 Ga0070711_100057789 3300005439 Bacteria 2687
56 Ga0070700_100058360 3300005441 Bacteria 2424
57 Ga0070700_100224219 3300005441 Bacteria 1334
58 Ga0070708_100533107 3300005445 Bacteria 1108
59 Ga0070663_100045323 3300005455 Bacteria 3106
60 Ga0070663_100045684 3300005455 Bacteria 3095
61 Ga0070663_100426907 3300005455 Bacteria 1088
62 Ga0070678_100057565 3300005456 Bacteria 2848
63 Ga0070678_100064536 3300005456 Bacteria 2714
64 Ga0070678_100065520 3300005456 Bacteria 2698
65 Ga0068867_100159583 3300005459 Bacteria 1777
66 Ga0070685_10003055 3300005466 Bacteria 8534
67 Ga0070685_10046944 3300005466 Bacteria 2481
68 Ga0070706_100183293 3300005467 Bacteria 1955
69 Ga0070679_100500137 3300005530 Bacteria 1159
70 Ga0070684_100486432 3300005535 Bacteria 1142
71 Ga0070684_100677587 3300005535 Bacteria 961
72 Ga0068853_100034292 3300005539 Bacteria 4308
73 Ga0070672_100140950 3300005543 Bacteria 1988
74 Ga0070686_100189586 3300005544 Bacteria 1467
75 Ga0070686_100346670 3300005544 Bacteria 1114
76 Ga0070696_100013172 3300005546 Bacteria 5547
77 Ga0070693_100242888 3300005547 Bacteria 1190
78 Ga0070665_100000698 3300005548 Bacteria 44785
79 Ga0070665_100002795 3300005548 Bacteria 18921
80 Ga0070665_100011884 3300005548 Bacteria 8792
81 Ga0070665_100011959 3300005548 Bacteria 8764
82 Ga0070665_100017687 3300005548 Bacteria 7158
83 Ga0070665_100193762 3300005548 Bacteria 2033
84 Ga0070665_100354352 3300005548 Bacteria 1473
85 Ga0070665_100543321 3300005548 Bacteria 1174
86 Ga0070665_100756392 3300005548 Bacteria 985
87 Ga0068855_100523066 3300005563 Bacteria 1287
88 Ga0070664_100220375 3300005564 Bacteria 1697
89 Ga0068857_100037891 3300005577 Bacteria 4271
90 Ga0068857_100548873 3300005577 Bacteria 1088
91 Ga0068854_100077827 3300005578 Bacteria 2441
92 Ga0068856_100142643 3300005614 Bacteria 2402
93 Ga0070702_100237831 3300005615 Bacteria 1227
94 Ga0068852_100137297 3300005616 Bacteria 2258
95 Ga0068852_100142393 3300005616 Bacteria 2220
96 Ga0068852_100145080 3300005616 Bacteria 2201
97 Ga0068859_100000867 3300005617 Bacteria 30844
98 Ga0068859_100029066 3300005617 Bacteria 5546
99 Ga0068859_100478646 3300005617 Bacteria 1340
100 Ga0068864_100059557 3300005618 Bacteria 3304
101 Ga0068864_100073233 3300005618 Bacteria 2986
102 Ga0068861_100003072 3300005719 Bacteria 11027
103 Ga0068861_100095857 3300005719 Bacteria 2350
104 Ga0068861_100769305 3300005719 Bacteria 901
105 Ga0068851_10058465 3300005834 Bacteria 1971
106 Ga0068870_10249795 3300005840 Bacteria 1099
107 Ga0068863_100001111 3300005841 Bacteria 26870
108 Ga0068863_100361270 3300005841 Bacteria 1415
109 Ga0068863_100509382 3300005841 Bacteria 1186
110 Ga0068863_100540142 3300005841 Bacteria 1150
111 Ga0068858_100003601 3300005842 Bacteria 15332
112 Ga0068858_100010836 3300005842 Bacteria 8618
113 Ga0068858_100141870 3300005842 Bacteria 2255
114 Ga0068858_100694559 3300005842 Bacteria 990
115 Ga0068860_100000016 3300005843 Bacteria 310468
116 Ga0068860_100039061 3300005843 Bacteria 4541
117 Ga0068860_100901580 3300005843 Bacteria 900
118 Ga0068862_100000051 3300005844 Bacteria 145362
119 Ga0068862_100029018 3300005844 Bacteria 4660
120 Ga0081455_10006649 3300005937 Bacteria 12359
121 Ga0081455_10067379 3300005937 Bacteria 2983
122 Ga0081455_10095960 3300005937 Bacteria 2392
123 Ga0081538_10006896 3300005981 Bacteria 9886
124 Ga0081538_10166297 3300005981 Bacteria 970
125 Ga0081539_10001051 3300005985 Bacteria 50562
126 Ga0070717_10024663 3300006028 Bacteria 4778
127 Ga0070717_10383315 3300006028 Bacteria 1261
128 Ga0075365_10043568 3300006038 Bacteria 2938
129 Ga0075365_10075228 3300006038 Bacteria 2279
130 Ga0075365_10219492 3300006038 Bacteria 1334
131 Ga0075363_100000340 3300006048 Bacteria 13957
132 Ga0075363_100001062 3300006048 Bacteria 9920
133 Ga0075363_100017372 3300006048 Bacteria 3567
134 Ga0075363_100091027 3300006048 Bacteria 1679
135 Ga0075363_100098165 3300006048 Bacteria 1619
136 Ga0075363_100113221 3300006048 Bacteria 1509
137 Ga0075363_100207159 3300006048 Bacteria 1122
138 Ga0075363_100300329 3300006048 Bacteria 932
139 Ga0075364_10001139 3300006051 Bacteria 14196
140 Ga0075364_10006919 3300006051 Bacteria 6696
141 Ga0075364_10018919 3300006051 Bacteria 4319
142 Ga0075364_10020145 3300006051 Bacteria 4194
143 Ga0075364_10036522 3300006051 Bacteria 3176
144 Ga0075364_10047715 3300006051 Bacteria 2790
145 Ga0075364_10072421 3300006051 Bacteria 2271
146 Ga0075364_10167447 3300006051 Bacteria 1485
147 Ga0075364_10269858 3300006051 Bacteria 1157
148 Ga0075364_10376045 3300006051 Bacteria 969
149 Ga0075364_10409067 3300006051 Bacteria 926
150 Ga0070715_10016443 3300006163 Bacteria 2780
151 Ga0070716_100050475 3300006173 Bacteria 2361
152 Ga0070712_100006524 3300006175 Bacteria 7242
153 Ga0070712_100063839 3300006175 Bacteria 2609
154 Ga0070712_100230725 3300006175 Bacteria 1470
155 Ga0075362_10013160 3300006177 Bacteria 3305
156 Ga0075362_10042239 3300006177 Bacteria 2014
157 Ga0075362_10068268 3300006177 Bacteria 1619
158 Ga0075362_10099848 3300006177 Bacteria 1356
159 Ga0075367_10025421 3300006178 Bacteria 3349
160 Ga0075367_10048837 3300006178 Bacteria 2494
161 Ga0075367_10255654 3300006178 Bacteria 1099
162 Ga0075369_10000381 3300006186 Bacteria 13317
163 Ga0075369_10001986 3300006186 Bacteria 7191
164 Ga0075369_10004737 3300006186 Bacteria 5048
165 Ga0075369_10007067 3300006186 Bacteria 4266
166 Ga0075369_10007791 3300006186 Bacteria 4095
167 Ga0075369_10040153 3300006186 Bacteria 1999
168 Ga0075369_10141473 3300006186 Bacteria 1097
169 Ga0097621_100718589 3300006237 Bacteria 921
170 Ga0075370_10024235 3300006353 Bacteria 3350
171 Ga0075370_10042419 3300006353 Bacteria 2570
172 Ga0068871_100006999 3300006358 Bacteria 8035
173 Ga0068871_100392941 3300006358 Bacteria 1234
174 Ga0075428_100002516 3300006844 Bacteria 19930
175 Ga0075428_100020103 3300006844 Bacteria 7394
176 Ga0075430_100020143 3300006846 Bacteria 5676
177 Ga0075430_100035979 3300006846 Bacteria 4199
178 Ga0075430_100048475 3300006846 Bacteria 3587
179 Ga0075430_100131711 3300006846 Bacteria 2084
180 Ga0075430_100151102 3300006846 Bacteria 1934
181 Ga0075431_100060250 3300006847 Bacteria 3916
182 Ga0075431_100427287 3300006847 Bacteria 1323
183 Ga0075429_100030723 3300006880 Bacteria 4666
184 Ga0075429_100466140 3300006880 Bacteria 1107
185 Ga0075429_100490897 3300006880 Bacteria 1076
186 Ga0068865_100083772 3300006881 Bacteria 2296
187 Ga0068865_100085968 3300006881 Bacteria 2270
188 Ga0068865_100180145 3300006881 Bacteria 1627
189 Ga0097620_100000867 3300006931 Bacteria 30844
190 Ga0097620_100029064 3300006931 Bacteria 5546
191 Ga0097620_100478651 3300006931 Bacteria 1340
192 Ga0099826_10086676 3300006948 Bacteria 1929
193 Ga0105244_10005185 3300009036 Bacteria 8725
194 Ga0105244_10015932 3300009036 Bacteria 4299
195 Ga0105245_10009665 3300009098 Bacteria 8411
196 Ga0105245_10058238 3300009098 Bacteria 3477
197 Ga0105245_10323041 3300009098 Bacteria 1521
198 Ga0105245_10362002 3300009098 Bacteria 1440
199 Ga0105245_10891233 3300009098 Bacteria 931
200 Ga0105247_10101626 3300009101 Bacteria 1839
201 Ga0114129_10004320 3300009147 Bacteria 20095
202 Ga0114129_10014539 3300009147 Bacteria 11216
203 Ga0114129_10172432 3300009147 Bacteria 2948
204 Ga0114129_10407995 3300009147 Bacteria 1790
205 Ga0114129_10614964 3300009147 Bacteria 1406
206 Ga0105243_10004323 3300009148 Bacteria 11249
207 Ga0105243_10004529 3300009148 Bacteria 10982
208 Ga0105243_10093141 3300009148 Bacteria 2486
209 Ga0105243_10892597 3300009148 Bacteria 884
210 Ga0105241_10014318 3300009174 Bacteria 5807
211 Ga0105241_10104527 3300009174 Bacteria 2256
212 Ga0105242_10157271 3300009176 Bacteria 1986
213 Ga0105242_10243691 3300009176 Bacteria 1617
214 Ga0105242_10564876 3300009176 Bacteria 1093
215 Ga0105248_10000025 3300009177 Bacteria 259691
216 Ga0105248_10003456 3300009177 Bacteria 17545
217 Ga0105248_10528758 3300009177 Bacteria 1330
218 Ga0105237_10006529 3300009545 Bacteria 12910
219 Ga0105237_10360807 3300009545 Bacteria 1457
220 Ga0105238_10265581 3300009551 Bacteria 1696
221 Ga0105249_10000021 3300009553 Bacteria 260448
222 Ga0105249_10077260 3300009553 Bacteria 3087
223 Ga0105249_10361994 3300009553 Bacteria 1472
224 Ga0105239_10070022 3300010375 Bacteria 3853
225 Ga0105239_10288452 3300010375 Bacteria 1848
226 Ga0105239_10541030 3300010375 Bacteria 1326
227 Ga0105239_10849758 3300010375 Bacteria 1047
228 Ga0105239_10933318 3300010375 Bacteria 996
229 Ga0105246_10079010 3300011119 Bacteria 2338
230 Ga0105246_10108025 3300011119 Bacteria 2039
231 Ga0105246_10137429 3300011119 Bacteria 1833
232 Ga0157338_1006467 3300012515 Bacteria 1084
233 Ga0157371_10246841 3300013102 Bacteria 1285
234 Ga0157370_10200262 3300013104 Bacteria 1852
235 Ga0157369_10134290 3300013105 Bacteria 2620
236 Ga0157374_10111713 3300013296 Bacteria 2629
237 Ga0157378_10014219 3300013297 Bacteria 6966
238 Ga0157378_10449107 3300013297 Bacteria 1279
239 Ga0163162_10066721 3300013306 Bacteria 3647
240 Ga0163162_10110338 3300013306 Bacteria 2848
241 Ga0163162_10354905 3300013306 Bacteria 1599
242 Ga0163162_10382545 3300013306 Bacteria 1541
243 Ga0163162_10448563 3300013306 Bacteria 1422
244 Ga0157372_10035687 3300013307 Bacteria 5475
245 Ga0157375_10003762 3300013308 Bacteria 13159
246 Ga0157375_10312673 3300013308 Bacteria 1735
247 Ga0157375_10715544 3300013308 Bacteria 1154
248 Ga0163163_10015407 3300014325 Bacteria 7068
249 Ga0163163_10018207 3300014325 Bacteria 6569
250 Ga0163163_10342123 3300014325 Bacteria 1551
251 Ga0163163_10391011 3300014325 Bacteria 1449
252 Ga0163163_10479437 3300014325 Bacteria 1305
253 Ga0157380_10121192 3300014326 Bacteria 2216
254 Ga0157380_10177967 3300014326 Bacteria 1866
255 Ga0157380_10804225 3300014326 Bacteria 957
256 Ga0157377_10022444 3300014745 Bacteria 3332
257 Ga0157377_10035677 3300014745 Bacteria 2729
258 Ga0157379_10001172 3300014968 Bacteria 21361
259 Ga0157379_10124378 3300014968 Bacteria 2320
260 Ga0157379_10215443 3300014968 Bacteria 1739
261 Ga0157379_10438257 3300014968 Bacteria 1205
262 Ga0157379_10689100 3300014968 Bacteria 959
263 Ga0206352_10967457 3300020078 Bacteria 970
264 Ga0213876_10034862 3300021384 Bacteria 2654
265 Ga0213876_10038664 3300021384 Bacteria 2519
266 Ga0213875_10002224 3300021388 Bacteria 11796
267 Ga0209673_1021879 3300025273 Bacteria 2223
268 Ga0209051_1000190 3300025303 Bacteria 109110
269 Ga0209051_1000693 3300025303 Bacteria 37100
270 Ga0209051_1000725 3300025303 Bacteria 35828
271 Ga0209051_1002406 3300025303 Bacteria 13458
272 Ga0209051_1034664 3300025303 Bacteria 1889
273 Ga0207655_1007799 3300025728 Bacteria 6894
274 Ga0207655_1014667 3300025728 Bacteria 4411
275 Ga0207692_10003418 3300025898 Bacteria 6203
276 Ga0207642_10008059 3300025899 Bacteria 3594
277 Ga0207710_10000033 3300025900 Bacteria 260531
278 Ga0207710_10046464 3300025900 Bacteria 1939
279 Ga0207710_10061099 3300025900 Bacteria 1709
280 Ga0207710_10113236 3300025900 Bacteria 1290
281 Ga0207688_10002229 3300025901 Bacteria 10445
282 Ga0207688_10035709 3300025901 Bacteria 2754
283 Ga0207647_10194870 3300025904 Bacteria 1173
284 Ga0207699_10115492 3300025906 Bacteria 1727
285 Ga0207645_10023312 3300025907 Bacteria 4023
286 Ga0207645_10086954 3300025907 Bacteria 2008
287 Ga0207643_10127464 3300025908 Bacteria 1512
288 Ga0207654_10237538 3300025911 Bacteria 1216
289 Ga0207671_10002173 3300025914 Bacteria 21320
290 Ga0207671_10314568 3300025914 Bacteria 1238
291 Ga0207693_10003117 3300025915 Bacteria 14272
292 Ga0207663_10001631 3300025916 Bacteria 10572
293 Ga0207657_10123816 3300025919 Bacteria 2125
294 Ga0207652_10153880 3300025921 Bacteria 2060
295 Ga0207681_10002372 3300025923 Bacteria 11975
296 Ga0207681_10169727 3300025923 Bacteria 1653
297 Ga0207694_10218514 3300025924 Bacteria 1554
298 Ga0207650_10281526 3300025925 Bacteria 1354
299 Ga0207687_10181182 3300025927 Bacteria 1632
300 Ga0207700_10615960 3300025928 Bacteria 967
301 Ga0207644_10002168 3300025931 Bacteria 12735
302 Ga0207644_10035065 3300025931 Bacteria 3513
303 Ga0207644_10326542 3300025931 Bacteria 1242
304 Ga0207690_10032403 3300025932 Bacteria 3354
305 Ga0207706_10100312 3300025933 Bacteria 2547
306 Ga0207709_10003948 3300025935 Bacteria 8654
307 Ga0207709_10203748 3300025935 Bacteria 1415
308 Ga0207709_10245594 3300025935 Bacteria 1305
309 Ga0207669_10109831 3300025937 Bacteria 1845
310 Ga0207669_10134380 3300025937 Bacteria 1706
311 Ga0207704_10107520 3300025938 Bacteria 1876
312 Ga0207704_10431502 3300025938 Bacteria 1047
313 Ga0207665_10012984 3300025939 Bacteria 5476
314 Ga0207665_10015819 3300025939 Bacteria 4951
315 Ga0207691_10168861 3300025940 Bacteria 1916
316 Ga0207711_10000191 3300025941 Bacteria 65711
317 Ga0207711_10029096 3300025941 Bacteria 4657
318 Ga0207711_10233126 3300025941 Bacteria 1686
319 Ga0207711_10328192 3300025941 Bacteria 1415
320 Ga0207689_10005169 3300025942 Bacteria 11724
321 Ga0207679_10189497 3300025945 Bacteria 1709
322 Ga0207712_10000005 3300025961 Bacteria 608697
323 Ga0207712_10080141 3300025961 Bacteria 2374
324 Ga0207712_10330612 3300025961 Bacteria 1261
325 Ga0207668_10001360 3300025972 Bacteria 14447
326 Ga0207668_10002402 3300025972 Bacteria 10953
327 Ga0207668_10217045 3300025972 Bacteria 1533
328 Ga0207668_10633862 3300025972 Bacteria 934
329 Ga0207640_10384887 3300025981 Bacteria 1138
330 Ga0207658_10001110 3300025986 Bacteria 21726
331 Ga0207658_10005823 3300025986 Bacteria 8431
332 Ga0207658_10008274 3300025986 Bacteria 7084
333 Ga0207658_10061324 3300025986 Bacteria 2810
334 Ga0207658_10470539 3300025986 Bacteria 1115
335 Ga0207677_10009273 3300026023 Bacteria 5530
336 Ga0207677_10212658 3300026023 Bacteria 1545
337 Ga0207677_10535593 3300026023 Bacteria 1018
338 Ga0207677_10739125 3300026023 Bacteria 876
339 Ga0207703_10053025 3300026035 Bacteria 3296
340 Ga0207703_10058209 3300026035 Bacteria 3153
341 Ga0207703_10220601 3300026035 Bacteria 1695
342 Ga0207703_10601643 3300026035 Bacteria 1040
343 Ga0207639_10102053 3300026041 Bacteria 2321
344 Ga0207639_10472149 3300026041 Bacteria 1142
345 Ga0207678_10043730 3300026067 Bacteria 3875
346 Ga0207678_10070612 3300026067 Bacteria 2994
347 Ga0207678_10229847 3300026067 Bacteria 1588
348 Ga0207708_10026337 3300026075 Bacteria 4400
349 Ga0207708_10429781 3300026075 Bacteria 1096
350 Ga0207702_10632434 3300026078 Bacteria 1052
351 Ga0207641_10002206 3300026088 Bacteria 18323
352 Ga0207641_10373045 3300026088 Bacteria 1365
353 Ga0207641_10520735 3300026088 Bacteria 1157
354 Ga0207648_10118766 3300026089 Bacteria 2324
355 Ga0207676_10011210 3300026095 Bacteria 6403
356 Ga0207674_10095233 3300026116 Bacteria 2964
357 Ga0207675_100035323 3300026118 Bacteria 4662
358 Ga0207675_100063739 3300026118 Bacteria 3444
359 Ga0207675_100091284 3300026118 Bacteria 2864
360 Ga0207675_100327986 3300026118 Bacteria 1496
361 Ga0207683_10000160 3300026121 Bacteria 56965
362 Ga0207683_10007470 3300026121 Bacteria 9376
363 Ga0207683_10037033 3300026121 Bacteria 4248
364 Ga0207683_10063898 3300026121 Bacteria 3243
365 Ga0207683_10959536 3300026121 Bacteria 794
366 Ga0207698_10319502 3300026142 Bacteria 1453
367 Ga0207698_11180228 3300026142 Bacteria 779
368 Ga0268266_10002907 3300028379 Bacteria 17734
369 Ga0268266_10040839 3300028379 Bacteria 3955
370 Ga0268266_10042344 3300028379 Bacteria 3889
371 Ga0268266_10087134 3300028379 Bacteria 2731
372 Ga0268266_10120064 3300028379 Bacteria 2339
373 Ga0268266_10844151 3300028379 Bacteria 885
374 Ga0268265_10000022 3300028380 Bacteria 270788
375 Ga0268265_10020901 3300028380 Bacteria 4575
376 Ga0268265_10100729 3300028380 Bacteria 2332
377 Ga0268265_10869981 3300028380 Bacteria 883
378 Ga0268264_10000005 3300028381 Bacteria 934972
379 Ga0268264_10094996 3300028381 Bacteria 2579
380 Ga0268264_10838605 3300028381 Bacteria 920
381 Ga0307511_10183889 3300030521 Bacteria 1120
382 Ga0265327_10014002 3300031251 Bacteria 5282
383 Ga0307513_10001160 3300031456 Bacteria 38156
384 Ga0307513_10060663 3300031456 Bacteria 4009
385 Ga0307513_10097160 3300031456 Bacteria 2981
386 Ga0307508_10138971 3300031616 Bacteria 2032
387 Ga0307405_10058632 3300031731 Bacteria 2424
388 Ga0307405_10138482 3300031731 Bacteria 1693
389 Ga0307413_10227624 3300031824 Bacteria 1367
390 Ga0307518_10064274 3300031838 Bacteria 2663
391 Ga0307410_10226850 3300031852 Bacteria 1440
392 Ga0307406_10009162 3300031901 Bacteria 5545
393 Ga0307406_10100407 3300031901 Bacteria 1970
394 Ga0307406_10125006 3300031901 Bacteria 1795
395 Ga0307412_10063159 3300031911 Bacteria 2497
396 Ga0307412_10392886 3300031911 Bacteria 1127
397 Ga0307409_100251289 3300031995 Bacteria 1617
398 Ga0307409_100614315 3300031995 Bacteria 1076
399 Ga0307416_100376484 3300032002 Bacteria 1448
400 Ga0307416_100988889 3300032002 Bacteria 944
401 Ga0307414_10268222 3300032004 Bacteria 1428
402 Ga0307414_10375854 3300032004 Bacteria 1227
403 Ga0307411_10090886 3300032005 Bacteria 2131
404 Ga0307411_10431225 3300032005 Bacteria 1098
405 Ga0307411_10862146 3300032005 Bacteria 802
406 Ga0307415_100044164 3300032126 Bacteria 2978
407 Ga0395905_0582312 3300037471 Bacteria 1021
408 Ga0436364_0465034 3300037853 Bacteria 2054
409 Ga0436364_1280826 3300037853 Bacteria 93394
410 Ga0436364_1347497 3300037853 Bacteria 882
411 Ga0436365_0252527 3300039437 Bacteria 12424
412 Ga0436365_0762715 3300039437 Bacteria 1376
413 Ga0436365_1856170 3300039437 Bacteria 22649
414 Ga0439461_0007271 3300041410 Bacteria 1955
415 Ga0439466_0020509 3300041411 Bacteria 2354
416 Ga0439466_0083293 3300041411 Bacteria 1007
417 Ga0439465_0005732 3300041413 Bacteria 3951
418 Ga0451789_0844744 3300041443 Bacteria 1661
419 Ga0451793_0271601 3300041452 Bacteria 1399
420 Ga0451793_1697195 3300041452 Bacteria 966
421 Ga0451795_1091017 3300041456 Bacteria 860
422 Ga0451802_0474314 3300041460 Bacteria 923
423 Ga0451802_1512295 3300041460 Bacteria 942
424 Ga0451807_2442734 3300041486 Bacteria 1126
425 Ga0451833_0770555 3300041491 Bacteria 1041
426 Ga0451843_0980173 3300041509 Bacteria 1573
427 Ga0451853_1208357 3300041512 Bacteria 948
428 Ga0451853_1665339 3300041512 Bacteria 5029
429 Ga0451853_3689334 3300041512 Bacteria 1368
430 Ga0439431_0001990 3300041997 Bacteria 4532
431 Ga0439431_0017671 3300041997 Bacteria 1680
432 Ga0439448_0160361 3300042005 Bacteria 783
433 Ga0439463_037417 3300042016 Bacteria 1231
434 Ga0466972_0005782 3300044658 Bacteria 6196
435 Ga0466972_0019669 3300044658 Bacteria 3376
436 Ga0466972_0032942 3300044658 Bacteria 2542
437 Ga0466972_0076784 3300044658 Bacteria 1591
438 Ga0466972_0104701 3300044658 Bacteria 1338
439 Ga0466965_0018193 3300044683 Bacteria 3366
440 Ga0466965_0041423 3300044683 Bacteria 2269
441 Ga0466966_0062794 3300044684 Bacteria 2341
442 Ga0466961_0039199 3300044693 Bacteria 3037
443 Ga0466963_0017958 3300044694 Bacteria 4414
444 Ga0466963_0073965 3300044694 Bacteria 2298
445 Ga0466971_0001826 3300044719 Bacteria 9036
446 Ga0466971_0022328 3300044719 Bacteria 2819
447 Ga0466971_0118868 3300044719 Bacteria 1223
448 Ga0466968_0017421 3300044735 Bacteria 2872
449 Ga0466970_0020001 3300044765 Bacteria 3474
450 Ga0466970_0125340 3300044765 Bacteria 1408
451 Ga0466957_0011403 3300044842 Bacteria 5128
452 Ga0466957_0060934 3300044842 Bacteria 2315
453 Ga0466957_0140131 3300044842 Bacteria 1557
454 Ga0466957_0215489 3300044842 Bacteria 1266
455 Ga0466957_0348185 3300044842 Bacteria 1005
456 Ga0466960_0001499 3300044901 Bacteria 8503
457 Ga0466960_0154651 3300044901 Bacteria 1228
458 Ga0466959_0025132 3300045049 Bacteria 4411
459 Ga0466959_0025884 3300045049 Bacteria 4351
460 Ga0466959_0040772 3300045049 Bacteria 3430
461 Ga0466958_0001217 3300045836 Bacteria 12017
462 Ga0466958_0010486 3300045836 Bacteria 5192
463 Ga0466958_0132789 3300045836 Bacteria 1564
464 Ga0466958_0161001 3300045836 Bacteria 1418
465 Ga0466967_0010866 3300045976 Bacteria 6859
466 Ga0466967_0014333 3300045976 Bacteria 6170
467 Ga0466967_0030441 3300045976 Bacteria 4530
468 Ga0466967_0077103 3300045976 Bacteria 3000
469 Ga0466967_0107631 3300045976 Bacteria 2557
470 Ga0466967_0500853 3300045976 Bacteria 1192
471 Ga0466967_0537036 3300045976 Bacteria 1150
472 Ga0495627_000998 3300046453 Bacteria 19032
473 Ga0495603_0006480 3300046455 Bacteria 7011
474 Ga0495629_0209506 3300046459 Bacteria 1346
475 Ga0495638_0008424 3300046460 Bacteria 7314
476 Ga0495638_0221690 3300046460 Bacteria 1057
477 Ga0495651_0116691 3300046462 Bacteria 1966
478 Ga0495653_0156729 3300046463 Bacteria 1585
479 Ga0495605_0133463 3300046474 Bacteria 1118
480 Ga0495606_0053413 3300046507 Bacteria 2622
481 Ga0495608_0070519 3300046511 Bacteria 2281
482 Ga0495628_0401256 3300046516 Bacteria 1001
483 Ga0495648_0021295 3300046524 Bacteria 4493
484 Ga0495666_0052617 3300046526 Bacteria 1955
485 Ga0495652_0186198 3300046529 Bacteria 1588
486 Ga0495665_0298311 3300046531 Bacteria 825
487 Ga0495668_0001279 3300046616 Bacteria 24933
488 Ga0495625_0001034 3300046660 Bacteria 36610
489 Ga0495588_0029968 3300046674 Bacteria 2733
490 Ga0495599_0167394 3300046678 Bacteria 1357
491 Ga0495670_0185363 3300046691 Bacteria 1100
492 Ga0495589_0001435 3300046794 Bacteria 13752
493 Ga0495589_0039182 3300046794 Bacteria 2369
494 Ga0495581_0030301 3300047315 Bacteria 3135
495 Ga0495674_0195508 3300047319 Bacteria 1680
496 Ga0495672_0007097 3300047320 Bacteria 8492
497 Ga0495676_0004801 3300047321 Bacteria 12381
498 Ga0495676_0068064 3300047321 Bacteria 2752
499 Ga0495683_0037628 3300047323 Bacteria 2452
500 Ga0495685_003827 3300047447 Bacteria 4819
501 Ga0495685_022095 3300047447 Bacteria 2189
502 Ga0495686_0002701 3300047472 Bacteria 16248
503 Ga0495686_0332197 3300047472 Bacteria 830
504 Ga0495626_0000284 3300048091 Bacteria 55286
505 Ga0496100_0000165 3300048903 Bacteria 36771
506 Ga0496100_0000300 3300048903 Bacteria 24540
507 Ga0496100_0011906 3300048903 Bacteria 4968
508 Ga0496100_0031590 3300048903 Bacteria 3294
509 Ga0496100_0083153 3300048903 Bacteria 2166
510 Ga0496100_0256398 3300048903 Bacteria 1295
511 Ga0496101_0000271 3300048904 Bacteria 36618
512 Ga0496101_0000907 3300048904 Bacteria 17444
513 Ga0496101_0005019 3300048904 Bacteria 8411
514 Ga0496101_0012755 3300048904 Bacteria 5618
515 Ga0496101_0040163 3300048904 Bacteria 3332
516 Ga0496102_0000003 3300048905 Bacteria 592263
517 Ga0496102_0002051 3300048905 Bacteria 17370
518 Ga0496102_0003984 3300048905 Bacteria 12508
519 Ga0496102_0013106 3300048905 Bacteria 7173
520 Ga0496102_0021279 3300048905 Bacteria 5737
521 Ga0496102_0037224 3300048905 Bacteria 4388
522 Ga0496102_0039442 3300048905 Bacteria 4268
523 Ga0496102_0058204 3300048905 Bacteria 3531
524 Ga0496102_0062329 3300048905 Bacteria 3414
525 Ga0496102_0075276 3300048905 Bacteria 3103
526 Ga0496102_0149807 3300048905 Bacteria 2191
527 Ga0496102_0156815 3300048905 Bacteria 2140
528 Ga0496102_0205063 3300048905 Bacteria 1859
529 Ga0496102_0481320 3300048905 Bacteria 1163
530 Ga0496103_0000014 3300048906 Bacteria 290397
531 Ga0496103_0000448 3300048906 Bacteria 35286
532 Ga0496104_0010915 3300048907 Bacteria 8125
533 Ga0496104_0015477 3300048907 Bacteria 6908
534 Ga0496104_0319430 3300048907 Bacteria 1466
535 Ga0496105_0030081 3300048908 Bacteria 4449
536 Ga0496105_0048688 3300048908 Bacteria 3499
537 Ga0496105_0162916 3300048908 Bacteria 1830
538 Ga0496106_0001772 3300048909 Bacteria 16108
539 Ga0496106_0037062 3300048909 Bacteria 3647
540 Ga0496106_0039676 3300048909 Bacteria 3526
541 Ga0496106_0048728 3300048909 Bacteria 3191
542 Ga0496106_0280136 3300048909 Bacteria 1336
543 Ga0496106_0562750 3300048909 Bacteria 914
544 Ga0496107_0001116 3300048910 Bacteria 16176
545 Ga0496107_0001983 3300048910 Bacteria 13031
546 Ga0496107_0010772 3300048910 Bacteria 6358
547 Ga0496107_0011107 3300048910 Bacteria 6265
548 Ga0496107_0079939 3300048910 Bacteria 2384
549 Ga0496107_0271433 3300048910 Bacteria 1262
550 Ga0496107_0294006 3300048910 Bacteria 1209
551 Ga0496107_0359836 3300048910 Bacteria 1083
552 Ga0496108_0000189 3300048911 Bacteria 57428
553 Ga0496108_0012474 3300048911 Bacteria 6920
554 Ga0496108_0023886 3300048911 Bacteria 5032
555 Ga0496108_0029354 3300048911 Bacteria 4553
556 Ga0496108_0056365 3300048911 Bacteria 3302
557 Ga0496108_0068049 3300048911 Bacteria 3004
558 Ga0496109_0000622 3300048912 Bacteria 29557
559 Ga0496109_0005792 3300048912 Bacteria 10342
560 Ga0496109_0020653 3300048912 Bacteria 5818
561 Ga0496109_0101201 3300048912 Bacteria 2674
562 Ga0496109_0179896 3300048912 Bacteria 1986
563 Ga0496109_0366530 3300048912 Bacteria 1361
564 Ga0496109_1023840 3300048912 Bacteria 763
565 Ga0496110_0000274 3300048913 Bacteria 33409
566 Ga0496110_0077673 3300048913 Bacteria 2954
567 Ga0496110_0095460 3300048913 Bacteria 2663
568 Ga0496110_0354055 3300048913 Bacteria 1337
569 Ga0496110_0384138 3300048913 Bacteria 1279
570 Ga0496110_0523086 3300048913 Bacteria 1079
571 Ga0496111_0007643 3300048914 Bacteria 7105
572 Ga0496111_0010637 3300048914 Bacteria 6184
573 Ga0496111_0050607 3300048914 Bacteria 2998
574 Ga0496111_0156208 3300048914 Bacteria 1693
575 Ga0496112_0006061 3300048915 Bacteria 10562
576 Ga0496112_0009499 3300048915 Bacteria 8769
577 Ga0496112_0047178 3300048915 Bacteria 4226
578 Ga0496112_0087977 3300048915 Bacteria 3074
579 Ga0496112_0096296 3300048915 Bacteria 2930
580 Ga0496112_0133502 3300048915 Bacteria 2453
581 Ga0496113_0033135 3300048916 Bacteria 3759
582 Ga0496113_0058976 3300048916 Bacteria 2890
583 Ga0496113_0073100 3300048916 Bacteria 2611
584 Ga0496113_0114959 3300048916 Bacteria 2099
585 Ga0496114_0000720 3300048917 Bacteria 24638
586 Ga0496114_0001560 3300048917 Bacteria 17401
587 Ga0496114_0096057 3300048917 Bacteria 2522
588 Ga0496114_0158285 3300048917 Bacteria 1968
589 Ga0496114_0674512 3300048917 Bacteria 908
590 Ga0496114_0761232 3300048917 Bacteria 846
591 Ga0496115_0001133 3300048918 Bacteria 19245
592 Ga0496115_0197874 3300048918 Bacteria 1660
593 Ga0496115_0308068 3300048918 Bacteria 1297
594 Ga0496116_0000071 3300048919 Bacteria 244521
595 Ga0496116_0203265 3300048919 Bacteria 1034
596 Ga0496117_0000003 3300048920 Bacteria 1881097
597 Ga0496117_0000417 3300048920 Bacteria 71654
598 Ga0496118_0000001 3300048921 Bacteria 1881100
599 Ga0496118_0000350 3300048921 Bacteria 78354
600 Ga0496118_0003028 3300048921 Bacteria 21691
601 Ga0496119_0001317 3300048922 Bacteria 30507
602 Ga0496119_0030607 3300048922 Bacteria 3624
603 Ga0496119_0068491 3300048922 Bacteria 2089
604 Ga0496119_0141334 3300048922 Bacteria 1299
605 Ga0496120_0000157 3300048923 Bacteria 112786
606 Ga0496120_0062164 3300048923 Bacteria 2081
607 Ga0496121_0000002 3300048924 Bacteria 1494588
608 Ga0496121_0000019 3300048924 Bacteria 499976
609 Ga0496121_0011044 3300048924 Bacteria 10080
610 Ga0496121_0233623 3300048924 Bacteria 1286
611 Ga0496122_0000141 3300048925 Bacteria 168707
612 Ga0496122_0046509 3300048925 Bacteria 3360
613 Ga0496123_0010483 3300048926 Bacteria 8186
614 Ga0496123_0022614 3300048926 Bacteria 4839
615 Ga0496124_0000002 3300048927 Bacteria 1494588
616 Ga0496124_0167499 3300048927 Bacteria 1706
617 Ga0496124_0293149 3300048927 Bacteria 1179
618 Ga0496125_0000002 3300048928 Bacteria 1480920
619 Ga0496125_0000550 3300048928 Bacteria 64700
620 Ga0496125_0064123 3300048928 Bacteria 2923
621 Ga0496125_0066385 3300048928 Bacteria 2851
622 Ga0496126_0000011 3300048929 Bacteria 744275
623 Ga0496126_0000186 3300048929 Bacteria 140016
624 Ga0496126_0002515 3300048929 Bacteria 24558
625 Ga0496126_0003203 3300048929 Bacteria 21005
626 Ga0496126_0095149 3300048929 Bacteria 2613
627 Ga0496126_0095493 3300048929 Bacteria 2608
628 Ga0501031_0034909 3300049568 Bacteria 3281
629 Ga0501032_0011209 3300049569 Bacteria 6438
630 Ga0501032_0049351 3300049569 Bacteria 2839
631 Ga0501032_0097299 3300049569 Bacteria 1951
632 Ga0501032_0338668 3300049569 Bacteria 969
633 Ga0501033_0025362 3300049570 Bacteria 4465
634 Ga0501033_0075979 3300049570 Bacteria 2466
635 Ga0501034_0004055 3300049571 Bacteria 16436
636 Ga0501034_0051939 3300049571 Bacteria 4132
637 Ga0501034_0310499 3300049571 Bacteria 1511
638 Ga0501036_0004683 3300049572 Bacteria 11046
639 Ga0501036_0110721 3300049572 Bacteria 2320
640 Ga0501036_0123568 3300049572 Bacteria 2186
641 Ga0501037_0000292 3300049573 Bacteria 42483
642 Ga0501038_0000952 3300049574 Bacteria 25866
643 Ga0501038_0002523 3300049574 Bacteria 17065
644 Ga0501038_0038291 3300049574 Bacteria 4200
645 Ga0501039_0001880 3300049575 Bacteria 15523
646 Ga0501039_0162017 3300049575 Bacteria 1758
647 Ga0501040_0155557 3300049576 Bacteria 1614
648 Ga0501041_0158983 3300049577 Bacteria 1412
649 Ga0501042_0122687 3300049578 Bacteria 1871
650 Ga0501043_0001986 3300049579 Bacteria 17458
651 Ga0501043_0212618 3300049579 Bacteria 1498
652 Ga0501046_0010652 3300049580 Bacteria 7886
653 Ga0501046_0340539 3300049580 Bacteria 1090
654 Ga0501046_0398073 3300049580 Bacteria 995
655 Ga0501047_0082890 3300049581 Bacteria 3082
656 Ga0501047_0206095 3300049581 Bacteria 1826
657 Ga0501048_0000654 3300049582 Bacteria 24940
658 Ga0501048_0141360 3300049582 Bacteria 1702
659 Ga0501070_0000383 3300049586 Bacteria 40471
660 Ga0501070_0003679 3300049586 Bacteria 13251
661 Ga0501070_0014417 3300049586 Bacteria 6651
662 Ga0501070_0134080 3300049586 Bacteria 2045
663 Ga0501071_0134426 3300049587 Bacteria 1839
664 Ga0501072_0622375 3300049588 Bacteria 850
665 Ga0501073_0024340 3300049589 Bacteria 4347
666 Ga0501073_0036944 3300049589 Bacteria 3469
667 Ga0501073_0101391 3300049589 Bacteria 1999
668 Ga0501074_0065171 3300049590 Bacteria 2622
669 Ga0501079_0117676 3300049741 Bacteria 2066
670 Ga0501080_0001246 3300049742 Bacteria 21206
671 Ga0501035_0000218 3300049822 Bacteria 68475
672 Ga0501035_0120182 3300049822 Bacteria 2298
673 Ga0501044_0000639 3300049823 Bacteria 42286
674 Ga0501044_0062591 3300049823 Bacteria 3803
675 Ga0501045_0050616 3300049824 Bacteria 3031
676 nmdc:mga03683_48360_c1 3300050489 Bacteria 1767
677 nmdc:mga03683_55725_c1 3300050489 Bacteria 1661
678 nmdc:mga03683_59942_c1 3300050489 Bacteria 1606
679 nmdc:mga03n38_104587_c1 3300050490 Bacteria 1370
680 nmdc:mga03n38_1904_c1 3300050490 Bacteria 5060
681 nmdc:mga03n38_5399_c1 3300050490 Bacteria 4348
682 nmdc:mga00v17_1358_c1 3300050491 Bacteria 12808
683 nmdc:mga00v17_16738_c1 3300050491 Bacteria 4135
684 nmdc:mga00v17_222182_c1 3300050491 Bacteria 1223
685 nmdc:mga00v17_25421_c1 3300050491 Bacteria 3442
686 nmdc:mga00v17_59868_c1 3300050491 Bacteria 2338
687 nmdc:mga00v17_614_c1 3300050491 Bacteria 19754
688 nmdc:mga00v17_6949_c1 3300050491 Bacteria 6020
689 nmdc:mga0yw44_13651_c1 3300050492 Bacteria 4284
690 nmdc:mga0yw44_284096_c1 3300050492 Bacteria 1106
691 nmdc:mga0yw44_327679_c1 3300050492 Bacteria 1029
692 nmdc:mga0yw44_35043_c1 3300050492 Bacteria 2946
693 nmdc:mga06z11_54460_c1 3300050494 Bacteria 2062
694 nmdc:mga04h51_26834_c1 3300050495 Bacteria 1784
695 nmdc:mga07m45_10508_c1 3300050496 Bacteria 4837
696 nmdc:mga07m45_46292_c1 3300050496 Bacteria 2443
697 nmdc:mga07m45_57198_c1 3300050496 Bacteria 2205
698 nmdc:mga05p37_30733_c1 3300050507 Bacteria 6554
699 nmdc:mga05p37_389200_c1 3300050507 Bacteria 1631
700 nmdc:mga05p37_632364_c1 3300050507 Bacteria 1202
701 nmdc:mga05p37_65844_c1 3300050507 Bacteria 4458
702 nmdc:mga05p37_862331_c1 3300050507 Bacteria 982
703 nmdc:mga09592_124470_c1 3300050508 Bacteria 2216
704 nmdc:mga09592_86349_c1 3300050508 Bacteria 2677
705 nmdc:mga0qj67_138849_c1 3300050509 Bacteria 1970
706 nmdc:mga0qj67_230485_c1 3300050509 Bacteria 1503
707 nmdc:mga0qj67_23836_c1 3300050509 Bacteria 4713
708 nmdc:mga0qj67_24370_c1 3300050509 Bacteria 4663
709 nmdc:mga0qj67_32097_c1 3300050509 Bacteria 4094
710 nmdc:mga06r32_114004_c1 3300050510 Bacteria 2661
711 nmdc:mga06r32_227930_c1 3300050510 Bacteria 1851
712 nmdc:mga0rr50_532174_c1 3300050513 Bacteria 1000
713 nmdc:mga0sz30_14113_c1 3300050516 Bacteria 3139
714 nmdc:mga0sz30_15423_c1 3300050516 Bacteria 3020
715 nmdc:mga0sz30_33149_c2 3300050516 Bacteria 1759
716 nmdc:mga0sz30_3411_c2 3300050516 Bacteria 4668
717 nmdc:mga0sz30_343_c1 3300050516 Bacteria 17800
718 nmdc:mga0sz30_36412_c1 3300050516 Bacteria 2057
719 nmdc:mga0sz30_70724_c2 3300050516 Bacteria 1096
720 Ga0500635_0000622 3300053080 Bacteria 9253
721 Ga0500643_002664 3300053087 Bacteria 8991
722 Ga0500556_0004900 3300053104 Bacteria 3789
723 Ga0500594_0080382 3300053118 Bacteria 974
724 Ga0500608_174431 3300053122 Bacteria 918
725 Ga0500642_0092562 3300053130 Bacteria 1399
726 Ga0500652_002044 3300053131 Bacteria 6073
727 Ga0500568_0000102 3300053139 Bacteria 78197
728 Ga0500616_0004274 3300053153 Bacteria 10265
729 Ga0500616_0004909 3300053153 Bacteria 9297
730 Ga0500645_000361 3300053730 Bacteria 32453
731 Ga0500645_009070 3300053730 Bacteria 3358
732 Ga0501084_0008210 3300054114 Bacteria 8614
733 Ga0587083_0041907 3300059505 Bacteria 963
734 Ga0466962_0034609 3300061719 Bacteria 2418
735 Ga0530510_0093912 3300061734 Bacteria 2191
736 Ga0530510_0257557 3300061734 Bacteria 1301

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0197874 Ga0496115_0197874_61_678 193
2 3300048912 Ga0496109_0020653 Ga0496109_0020653_3625_4254 197
3 3300031456 Ga0307513_10097160 Ga0307513_100971604 211
4 3300014325 Ga0163163_10015407 Ga0163163_100154077 212
5 3300048907 Ga0496104_0015477 Ga0496104_0015477_438_1121 212
6 3300048913 Ga0496110_0077673 Ga0496110_0077673_1633_2316 212
7 3300041512 Ga0451853_3689334 Ga0451853_3689334_361_1029 213
8 3300013306 Ga0163162_10354905 Ga0163162_103549052 214
9 3300042005 Ga0439448_0160361 Ga0439448_0160361_14_685 214
10 3300048903 Ga0496100_0256398 Ga0496100_0256398_596_1279 214
11 3300048925 Ga0496122_0046509 Ga0496122_0046509_1415_2080 214
12 3300048928 Ga0496125_0064123 Ga0496125_0064123_109_783 214
13 3300050489 nmdc:mga03683_55725_c1 nmdc:mga03683_55725_c1_793_1464 214
14 3300050489 nmdc:mga03683_59942_c1 nmdc:mga03683_59942_c1_480_1142 214
15 3300050490 nmdc:mga03n38_1904_c1 nmdc:mga03n38_1904_c1_683_1345 214
16 3300050491 nmdc:mga00v17_16738_c1 nmdc:mga00v17_16738_c1_329_991 214
17 3300050491 nmdc:mga00v17_59868_c1 nmdc:mga00v17_59868_c1_606_1277 214
18 3300050496 nmdc:mga07m45_10508_c1 nmdc:mga07m45_10508_c1_1429_2091 214
19 3300050516 nmdc:mga0sz30_36412_c1 nmdc:mga0sz30_36412_c1_206_877 214
20 3300050516 nmdc:mga0sz30_70724_c2 nmdc:mga0sz30_70724_c2_274_966 214
21 3300049569 Ga0501032_0049351 Ga0501032_0049351_158_829 216
22 3300049822 Ga0501035_0000218 Ga0501035_0000218_11221_11892 216
23 3300049823 Ga0501044_0000639 Ga0501044_0000639_10963_11634 216
24 iso_pu_bacteria 2738541274 2738707486 216
25 iso_pu_bacteria 2738543028 2739333982 216
26 iso_pu_bacteria 2902799365 2902802300 216
27 3300005367 Ga0070667_100102931 Ga0070667_1001029312 217
28 3300009545 Ga0105237_10360807 Ga0105237_103608072 217
29 3300025986 Ga0207658_10470539 Ga0207658_104705392 217
30 3300046524 Ga0495648_0021295 Ga0495648_0021295_1583_2260 217
31 3300047320 Ga0495672_0007097 Ga0495672_0007097_7770_8447 217
32 3300049590 Ga0501074_0065171 Ga0501074_0065171_1913_2587 217
33 iso_pu_bacteria 2643221687 2644489934 217
34 iso_pu_bacteria 2643221715 2644638225 217
35 iso_pu_bacteria 2902792274 2902793304 217
36 iso_pu_bacteria 2902810491 2902812103 217
37 iso_pu_bacteria 2902837492 2902841559 217
38 3300042016 Ga0439463_037417 Ga0439463_037417_345_1055 218
39 iso_pu_bacteria 2643221647 2644267784 218
40 iso_pu_bacteria 2808606375 2808915731 218
41 iso_pu_bacteria 2867428634 2867431106 218
42 iso_pu_bacteria 2887443736 2887446236 218
43 iso_pu_bacteria 2895427314 2895433778 218
44 iso_pu_bacteria 2915358134 2915364587 218
45 iso_pu_bacteria 2946041624 2946045359 218
46 iso_pu_bacteria 2954711539 2954717022 218
47 iso_pu_bacteria 2954721474 2954726970 218
48 iso_pu_bacteria 2954731030 2954734812 218
49 iso_pu_bacteria 2954740390 2954745893 218
50 iso_pu_bacteria 2954749733 2954753697 218
51 iso_pu_bacteria 2954759201 2954764864 218
52 iso_pu_bacteria 8033684223 8033686083 218
53 iso_pu_bacteria 8054472261 8054477046 218
54 3300005347 Ga0070668_100001949 Ga0070668_1000019497 219
55 3300005467 Ga0070706_100183293 Ga0070706_1001832931 219
56 3300005548 Ga0070665_100017687 Ga0070665_1000176873 219
57 3300005844 Ga0068862_100029018 Ga0068862_1000290185 219
58 3300005937 Ga0081455_10067379 Ga0081455_100673794 219
59 3300005937 Ga0081455_10095960 Ga0081455_100959603 219
60 3300006051 Ga0075364_10072421 Ga0075364_100724211 219
61 3300006173 Ga0070716_100050475 Ga0070716_1000504752 219
62 3300006844 Ga0075428_100020103 Ga0075428_1000201033 219
63 3300006846 Ga0075430_100048475 Ga0075430_1000484755 219
64 3300006846 Ga0075430_100131711 Ga0075430_1001317113 219
65 3300006847 Ga0075431_100060250 Ga0075431_1000602501 219
66 3300006880 Ga0075429_100030723 Ga0075429_1000307236 219
67 3300006880 Ga0075429_100490897 Ga0075429_1004908971 219
68 3300009174 Ga0105241_10014318 Ga0105241_100143183 219
69 3300009176 Ga0105242_10243691 Ga0105242_102436912 219
70 3300013308 Ga0157375_10312673 Ga0157375_103126732 219
71 3300021384 Ga0213876_10034862 Ga0213876_100348622 219
72 3300025911 Ga0207654_10237538 Ga0207654_102375381 219
73 3300025939 Ga0207665_10015819 Ga0207665_100158191 219
74 3300025972 Ga0207668_10002402 Ga0207668_100024024 219
75 3300028379 Ga0268266_10087134 Ga0268266_100871341 219
76 3300028380 Ga0268265_10020901 Ga0268265_100209015 219
77 3300031731 Ga0307405_10138482 Ga0307405_101384821 219
78 3300031901 Ga0307406_10100407 Ga0307406_101004071 219
79 3300031901 Ga0307406_10125006 Ga0307406_101250061 219
80 3300031995 Ga0307409_100614315 Ga0307409_1006143152 219
81 3300032002 Ga0307416_100376484 Ga0307416_1003764842 219
82 3300032002 Ga0307416_100988889 Ga0307416_1009888891 219
83 3300032005 Ga0307411_10431225 Ga0307411_104312252 219
84 3300032126 Ga0307415_100044164 Ga0307415_1000441643 219
85 3300037853 Ga0436364_0465034 Ga0436364_0465034_370_1059 219
86 3300039437 Ga0436365_0762715 Ga0436365_0762715_618_1307 219
87 3300045049 Ga0466959_0040772 Ga0466959_0040772_1559_2233 219
88 3300048912 Ga0496109_0366530 Ga0496109_0366530_578_1291 219
89 3300050491 nmdc:mga00v17_222182_c1 nmdc:mga00v17_222182_c1_207_884 219
90 iso_pu_bacteria 2558860112 2558911847 219
91 iso_pu_bacteria 2738541264 2738664440 219
92 iso_pu_bacteria 2738541356 2739143575 219
93 iso_pu_bacteria 2808606306 2808629998 219
94 iso_pu_bacteria 2852663356 2852663936 219
95 3300005355 Ga0070671_100001885 Ga0070671_1000018857 220
96 3300005548 Ga0070665_100000698 Ga0070665_10000069811 220
97 3300005841 Ga0068863_100540142 Ga0068863_1005401422 220
98 3300005843 Ga0068860_100901580 Ga0068860_1009015801 220
99 3300006048 Ga0075363_100207159 Ga0075363_1002071592 220
100 3300006051 Ga0075364_10036522 Ga0075364_100365223 220
101 3300006186 Ga0075369_10001986 Ga0075369_100019866 220
102 3300006186 Ga0075369_10141473 Ga0075369_101414732 220
103 3300025914 Ga0207671_10314568 Ga0207671_103145682 220
104 3300025931 Ga0207644_10002168 Ga0207644_100021683 220
105 3300028379 Ga0268266_10002907 Ga0268266_100029072 220
106 3300028380 Ga0268265_10869981 Ga0268265_108699812 220
107 3300028381 Ga0268264_10838605 Ga0268264_108386051 220
108 3300031616 Ga0307508_10138971 Ga0307508_101389713 220
109 3300031838 Ga0307518_10064274 Ga0307518_100642744 220
110 3300045976 Ga0466967_0030441 Ga0466967_0030441_2966_3643 220
111 3300046460 Ga0495638_0221690 Ga0495638_0221690_240_932 220
112 3300048915 Ga0496112_0133502 Ga0496112_0133502_1361_2050 220
113 3300048916 Ga0496113_0073100 Ga0496113_0073100_531_1220 220
114 3300048918 Ga0496115_0308068 Ga0496115_0308068_456_1145 220
115 3300048924 Ga0496121_0233623 Ga0496121_0233623_91_783 220
116 3300048926 Ga0496123_0022614 Ga0496123_0022614_93_782 220
117 3300048927 Ga0496124_0167499 Ga0496124_0167499_493_1182 220
118 3300048929 Ga0496126_0003203 Ga0496126_0003203_12718_13407 220
119 3300048929 Ga0496126_0095149 Ga0496126_0095149_1239_1931 220
120 3300050516 nmdc:mga0sz30_3411_c2 nmdc:mga0sz30_3411_c2_700_1392 220
121 3300053122 Ga0500608_174431 Ga0500608_174431_48_740 220
122 3300053130 Ga0500642_0092562 Ga0500642_0092562_607_1290 220
123 3300053730 Ga0500645_000361 Ga0500645_000361_29285_29977 220
124 3300053730 Ga0500645_009070 Ga0500645_009070_463_1155 220
125 iso_pu_bacteria 2643221553 2643784996 220
126 iso_pu_bacteria 2643221724 2644680907 220
127 iso_pu_bacteria 2728369380 2730230660 220
128 iso_pu_bacteria 2747842429 2747955467 220
129 iso_pu_bacteria 2842134933 2842135414 220
130 iso_pu_bacteria 2848551377 2848554339 220
131 iso_pu_bacteria 2857723135 2857726245 220
132 iso_pu_bacteria 2862574272 2862574428 220
133 3300003792 Ga0055540_1005754 Ga0055540_10057544 221
134 3300005327 Ga0070658_10005967 Ga0070658_100059677 221
135 3300005327 Ga0070658_10228389 Ga0070658_102283892 221
136 3300005328 Ga0070676_10211489 Ga0070676_102114892 221
137 3300005330 Ga0070690_100115387 Ga0070690_1001153872 221
138 3300005331 Ga0070670_100112808 Ga0070670_1001128082 221
139 3300005335 Ga0070666_10128195 Ga0070666_101281953 221
140 3300005337 Ga0070682_100010434 Ga0070682_1000104346 221
141 3300005338 Ga0068868_100182129 Ga0068868_1001821291 221
142 3300005340 Ga0070689_100555737 Ga0070689_1005557372 221
143 3300005344 Ga0070661_100033955 Ga0070661_1000339553 221
144 3300005354 Ga0070675_100401646 Ga0070675_1004016462 221
145 3300005356 Ga0070674_100198512 Ga0070674_1001985122 221
146 3300005436 Ga0070713_100166250 Ga0070713_1001662503 221
147 3300005438 Ga0070701_10123103 Ga0070701_101231032 221
148 3300005441 Ga0070700_100058360 Ga0070700_1000583603 221
149 3300005455 Ga0070663_100045323 Ga0070663_1000453233 221
150 3300005455 Ga0070663_100045684 Ga0070663_1000456841 221
151 3300005456 Ga0070678_100064536 Ga0070678_1000645361 221
152 3300005459 Ga0068867_100159583 Ga0068867_1001595832 221
153 3300005466 Ga0070685_10003055 Ga0070685_100030553 221
154 3300005530 Ga0070679_100500137 Ga0070679_1005001372 221
155 3300005535 Ga0070684_100486432 Ga0070684_1004864322 221
156 3300005543 Ga0070672_100140950 Ga0070672_1001409502 221
157 3300005544 Ga0070686_100346670 Ga0070686_1003466702 221
158 3300005564 Ga0070664_100220375 Ga0070664_1002203752 221
159 3300005577 Ga0068857_100037891 Ga0068857_1000378913 221
160 3300005577 Ga0068857_100548873 Ga0068857_1005488732 221
161 3300005614 Ga0068856_100142643 Ga0068856_1001426433 221
162 3300005615 Ga0070702_100237831 Ga0070702_1002378311 221
163 3300005616 Ga0068852_100142393 Ga0068852_1001423932 221
164 3300005618 Ga0068864_100059557 Ga0068864_1000595573 221
165 3300005618 Ga0068864_100073233 Ga0068864_1000732333 221
166 3300005719 Ga0068861_100003072 Ga0068861_1000030725 221
167 3300005834 Ga0068851_10058465 Ga0068851_100584652 221
168 3300005842 Ga0068858_100141870 Ga0068858_1001418702 221
169 3300006028 Ga0070717_10024663 Ga0070717_100246632 221
170 3300006048 Ga0075363_100300329 Ga0075363_1003003291 221
171 3300006051 Ga0075364_10409067 Ga0075364_104090671 221
172 3300006237 Ga0097621_100718589 Ga0097621_1007185892 221
173 3300006881 Ga0068865_100085968 Ga0068865_1000859682 221
174 3300009098 Ga0105245_10058238 Ga0105245_100582383 221
175 3300009148 Ga0105243_10892597 Ga0105243_108925972 221
176 3300009176 Ga0105242_10564876 Ga0105242_105648762 221
177 3300011119 Ga0105246_10108025 Ga0105246_101080253 221
178 3300011119 Ga0105246_10137429 Ga0105246_101374293 221
179 3300013102 Ga0157371_10246841 Ga0157371_102468412 221
180 3300014326 Ga0157380_10177967 Ga0157380_101779673 221
181 3300014745 Ga0157377_10035677 Ga0157377_100356773 221
182 3300014968 Ga0157379_10215443 Ga0157379_102154432 221
183 3300020078 Ga0206352_10967457 Ga0206352_109674571 221
184 3300021384 Ga0213876_10038664 Ga0213876_100386642 221
185 3300025303 Ga0209051_1000693 Ga0209051_100069334 221
186 3300025303 Ga0209051_1000725 Ga0209051_100072535 221
187 3300025303 Ga0209051_1034664 Ga0209051_10346641 221
188 3300025899 Ga0207642_10008059 Ga0207642_100080591 221
189 3300025901 Ga0207688_10035709 Ga0207688_100357093 221
190 3300025904 Ga0207647_10194870 Ga0207647_101948702 221
191 3300025906 Ga0207699_10115492 Ga0207699_101154922 221
192 3300025907 Ga0207645_10023312 Ga0207645_100233124 221
193 3300025908 Ga0207643_10127464 Ga0207643_101274642 221
194 3300025921 Ga0207652_10153880 Ga0207652_101538803 221
195 3300025925 Ga0207650_10281526 Ga0207650_102815262 221
196 3300025931 Ga0207644_10326542 Ga0207644_103265421 221
197 3300025935 Ga0207709_10245594 Ga0207709_102455942 221
198 3300025938 Ga0207704_10107520 Ga0207704_101075203 221
199 3300025940 Ga0207691_10168861 Ga0207691_101688612 221
200 3300025941 Ga0207711_10328192 Ga0207711_103281923 221
201 3300025942 Ga0207689_10005169 Ga0207689_100051698 221
202 3300026023 Ga0207677_10212658 Ga0207677_102126582 221
203 3300026067 Ga0207678_10070612 Ga0207678_100706122 221
204 3300026075 Ga0207708_10026337 Ga0207708_100263372 221
205 3300026078 Ga0207702_10632434 Ga0207702_106324342 221
206 3300026088 Ga0207641_10520735 Ga0207641_105207351 221
207 3300026089 Ga0207648_10118766 Ga0207648_101187663 221
208 3300026116 Ga0207674_10095233 Ga0207674_100952332 221
209 3300026118 Ga0207675_100035323 Ga0207675_1000353233 221
210 3300026121 Ga0207683_10037033 Ga0207683_100370333 221
211 3300028380 Ga0268265_10100729 Ga0268265_101007293 221
212 3300031731 Ga0307405_10058632 Ga0307405_100586323 221
213 3300031824 Ga0307413_10227624 Ga0307413_102276243 221
214 3300032004 Ga0307414_10375854 Ga0307414_103758542 221
215 3300037471 Ga0395905_0582312 Ga0395905_0582312_127_819 221
216 3300039437 Ga0436365_0252527 Ga0436365_0252527_11086_11784 221
217 3300041411 Ga0439466_0020509 Ga0439466_0020509_967_1656 221
218 3300041411 Ga0439466_0083293 Ga0439466_0083293_235_924 221
219 3300041443 Ga0451789_0844744 Ga0451789_0844744_553_1233 221
220 3300041460 Ga0451802_0474314 Ga0451802_0474314_17_697 221
221 3300041997 Ga0439431_0001990 Ga0439431_0001990_548_1237 221
222 3300044658 Ga0466972_0019669 Ga0466972_0019669_1266_1979 221
223 3300044658 Ga0466972_0076784 Ga0466972_0076784_509_1198 221
224 3300046516 Ga0495628_0401256 Ga0495628_0401256_71_754 221
225 3300048905 Ga0496102_0037224 Ga0496102_0037224_2418_3107 221
226 3300048905 Ga0496102_0039442 Ga0496102_0039442_15_704 221
227 3300048907 Ga0496104_0319430 Ga0496104_0319430_776_1456 221
228 3300048910 Ga0496107_0359836 Ga0496107_0359836_325_1005 221
229 3300048912 Ga0496109_0179896 Ga0496109_0179896_751_1437 221
230 3300048913 Ga0496110_0354055 Ga0496110_0354055_460_1140 221
231 3300048921 Ga0496118_0003028 Ga0496118_0003028_17997_18686 221
232 3300049569 Ga0501032_0011209 Ga0501032_0011209_5670_6356 221
233 3300049571 Ga0501034_0004055 Ga0501034_0004055_1904_2590 221
234 3300049572 Ga0501036_0110721 Ga0501036_0110721_1592_2278 221
235 3300049573 Ga0501037_0000292 Ga0501037_0000292_32121_32807 221
236 3300049574 Ga0501038_0002523 Ga0501038_0002523_8092_8778 221
237 3300049575 Ga0501039_0001880 Ga0501039_0001880_4734_5420 221
238 3300049579 Ga0501043_0001986 Ga0501043_0001986_3604_4290 221
239 3300049586 Ga0501070_0000383 Ga0501070_0000383_13601_14287 221
240 3300049589 Ga0501073_0024340 Ga0501073_0024340_1696_2382 221
241 3300050513 nmdc:mga0rr50_532174_c1 nmdc:mga0rr50_532174_c1_55_738 221
242 3300050516 nmdc:mga0sz30_33149_c2 nmdc:mga0sz30_33149_c2_832_1533 221
243 iso_pu_bacteria 2868088558 2868091089 221
244 iso_pu_bacteria 2939582691 2939587781 221
245 iso_pu_bacteria 3002998708 3003001426 221
246 3300003792 Ga0055540_1008491 Ga0055540_10084913 222
247 3300005366 Ga0070659_100573543 Ga0070659_1005735431 222
248 3300005435 Ga0070714_100066963 Ga0070714_1000669634 222
249 3300005435 Ga0070714_100198527 Ga0070714_1001985272 222
250 3300005436 Ga0070713_100278569 Ga0070713_1002785692 222
251 3300005439 Ga0070711_100057789 Ga0070711_1000577891 222
252 3300005535 Ga0070684_100677587 Ga0070684_1006775871 222
253 3300005719 Ga0068861_100769305 Ga0068861_1007693051 222
254 3300006038 Ga0075365_10043568 Ga0075365_100435683 222
255 3300006038 Ga0075365_10075228 Ga0075365_100752282 222
256 3300006048 Ga0075363_100113221 Ga0075363_1001132213 222
257 3300006051 Ga0075364_10167447 Ga0075364_101674472 222
258 3300006175 Ga0070712_100006524 Ga0070712_1000065243 222
259 3300006177 Ga0075362_10013160 Ga0075362_100131603 222
260 3300006178 Ga0075367_10025421 Ga0075367_100254212 222
261 3300006186 Ga0075369_10040153 Ga0075369_100401532 222
262 3300006948 Ga0099826_10086676 Ga0099826_100866762 222
263 3300009098 Ga0105245_10323041 Ga0105245_103230411 222
264 3300009147 Ga0114129_10014539 Ga0114129_100145398 222
265 3300009147 Ga0114129_10172432 Ga0114129_101724322 222
266 3300010375 Ga0105239_10849758 Ga0105239_108497581 222
267 3300012515 Ga0157338_1006467 Ga0157338_10064671 222
268 3300013308 Ga0157375_10715544 Ga0157375_107155441 222
269 3300021388 Ga0213875_10002224 Ga0213875_1000222410 222
270 3300025273 Ga0209673_1021879 Ga0209673_10218793 222
271 3300025303 Ga0209051_1002406 Ga0209051_10024068 222
272 3300026067 Ga0207678_10229847 Ga0207678_102298472 222
273 3300026121 Ga0207683_10959536 Ga0207683_109595361 222
274 3300030521 Ga0307511_10183889 Ga0307511_101838891 222
275 3300032005 Ga0307411_10090886 Ga0307411_100908862 222
276 3300037853 Ga0436364_1280826 Ga0436364_1280826_83342_84028 222
277 3300041452 Ga0451793_1697195 Ga0451793_1697195_89_808 222
278 3300041456 Ga0451795_1091017 Ga0451795_1091017_137_823 222
279 3300041512 Ga0451853_1208357 Ga0451853_1208357_164_850 222
280 3300044658 Ga0466972_0005782 Ga0466972_0005782_5120_5830 222
281 3300044683 Ga0466965_0018193 Ga0466965_0018193_1740_2429 222
282 3300044842 Ga0466957_0011403 Ga0466957_0011403_2289_2999 222
283 3300045049 Ga0466959_0025132 Ga0466959_0025132_3086_3796 222
284 3300045976 Ga0466967_0010866 Ga0466967_0010866_5005_5715 222
285 3300046455 Ga0495603_0006480 Ga0495603_0006480_4667_5359 222
286 3300046459 Ga0495629_0209506 Ga0495629_0209506_632_1324 222
287 3300046474 Ga0495605_0133463 Ga0495605_0133463_305_997 222
288 3300046526 Ga0495666_0052617 Ga0495666_0052617_44_733 222
289 3300046529 Ga0495652_0186198 Ga0495652_0186198_486_1172 222
290 3300046616 Ga0495668_0001279 Ga0495668_0001279_170_856 222
291 3300046660 Ga0495625_0001034 Ga0495625_0001034_28993_29679 222
292 3300046678 Ga0495599_0167394 Ga0495599_0167394_645_1331 222
293 3300046691 Ga0495670_0185363 Ga0495670_0185363_324_1016 222
294 3300046794 Ga0495589_0001435 Ga0495589_0001435_8015_8707 222
295 3300046794 Ga0495589_0039182 Ga0495589_0039182_1576_2268 222
296 3300047321 Ga0495676_0004801 Ga0495676_0004801_291_983 222
297 3300047321 Ga0495676_0068064 Ga0495676_0068064_857_1549 222
298 3300047323 Ga0495683_0037628 Ga0495683_0037628_1653_2339 222
299 3300047447 Ga0495685_003827 Ga0495685_003827_155_847 222
300 3300047447 Ga0495685_022095 Ga0495685_022095_85_777 222
301 3300047472 Ga0495686_0332197 Ga0495686_0332197_13_708 222
302 3300048091 Ga0495626_0000284 Ga0495626_0000284_54431_55117 222
303 3300048912 Ga0496109_1023840 Ga0496109_1023840_33_716 222
304 3300048913 Ga0496110_0523086 Ga0496110_0523086_368_1051 222
305 3300048914 Ga0496111_0156208 Ga0496111_0156208_419_1102 222
306 3300048929 Ga0496126_0095493 Ga0496126_0095493_884_1570 222
307 3300049572 Ga0501036_0004683 Ga0501036_0004683_6667_7362 222
308 3300049574 Ga0501038_0038291 Ga0501038_0038291_2158_2853 222
309 3300049580 Ga0501046_0398073 Ga0501046_0398073_19_717 222
310 3300049581 Ga0501047_0206095 Ga0501047_0206095_1039_1725 222
311 3300050489 nmdc:mga03683_48360_c1 nmdc:mga03683_48360_c1_469_1155 222
312 3300050491 nmdc:mga00v17_6949_c1 nmdc:mga00v17_6949_c1_1071_1757 222
313 3300050492 nmdc:mga0yw44_13651_c1 nmdc:mga0yw44_13651_c1_967_1653 222
314 3300050492 nmdc:mga0yw44_284096_c1 nmdc:mga0yw44_284096_c1_91_774 222
315 3300050492 nmdc:mga0yw44_35043_c1 nmdc:mga0yw44_35043_c1_1745_2446 222
316 3300050494 nmdc:mga06z11_54460_c1 nmdc:mga06z11_54460_c1_876_1562 222
317 3300050495 nmdc:mga04h51_26834_c1 nmdc:mga04h51_26834_c1_1077_1763 222
318 3300050507 nmdc:mga05p37_65844_c1 nmdc:mga05p37_65844_c1_1201_1893 222
319 3300050508 nmdc:mga09592_124470_c1 nmdc:mga09592_124470_c1_250_942 222
320 3300050509 nmdc:mga0qj67_138849_c1 nmdc:mga0qj67_138849_c1_256_948 222
321 3300050509 nmdc:mga0qj67_23836_c1 nmdc:mga0qj67_23836_c1_3094_3786 222
322 3300053139 Ga0500568_0000102 Ga0500568_0000102_35728_36456 222
323 3300059505 Ga0587083_0041907 Ga0587083_0041907_242_937 222
324 iso_pu_bacteria 2883821847 2883824942 222
325 3300003792 Ga0055540_1000082 Ga0055540_100008229 223
326 3300005329 Ga0070683_100505930 Ga0070683_1005059301 223
327 3300005334 Ga0068869_100759336 Ga0068869_1007593361 223
328 3300005337 Ga0070682_100002000 Ga0070682_1000020003 223
329 3300005367 Ga0070667_100001225 Ga0070667_1000012253 223
330 3300005367 Ga0070667_100023395 Ga0070667_1000233952 223
331 3300005367 Ga0070667_100446470 Ga0070667_1004464702 223
332 3300005455 Ga0070663_100426907 Ga0070663_1004269072 223
333 3300005544 Ga0070686_100189586 Ga0070686_1001895862 223
334 3300005548 Ga0070665_100002795 Ga0070665_1000027957 223
335 3300005616 Ga0068852_100145080 Ga0068852_1001450802 223
336 3300005841 Ga0068863_100361270 Ga0068863_1003612702 223
337 3300005842 Ga0068858_100694559 Ga0068858_1006945592 223
338 3300005981 Ga0081538_10166297 Ga0081538_101662971 223
339 3300006048 Ga0075363_100000340 Ga0075363_1000003403 223
340 3300006177 Ga0075362_10099848 Ga0075362_100998481 223
341 3300006353 Ga0075370_10042419 Ga0075370_100424192 223
342 3300009036 Ga0105244_10005185 Ga0105244_100051857 223
343 3300009036 Ga0105244_10015932 Ga0105244_100159322 223
344 3300009098 Ga0105245_10362002 Ga0105245_103620022 223
345 3300009098 Ga0105245_10891233 Ga0105245_108912331 223
346 3300009148 Ga0105243_10004529 Ga0105243_100045297 223
347 3300009553 Ga0105249_10361994 Ga0105249_103619942 223
348 3300010375 Ga0105239_10070022 Ga0105239_100700226 223
349 3300010375 Ga0105239_10541030 Ga0105239_105410302 223
350 3300010375 Ga0105239_10933318 Ga0105239_109333182 223
351 3300013104 Ga0157370_10200262 Ga0157370_102002622 223
352 3300014325 Ga0163163_10391011 Ga0163163_103910112 223
353 3300014968 Ga0157379_10689100 Ga0157379_106891002 223
354 3300025303 Ga0209051_1000190 Ga0209051_100019081 223
355 3300025728 Ga0207655_1007799 Ga0207655_10077995 223
356 3300025728 Ga0207655_1014667 Ga0207655_10146676 223
357 3300025927 Ga0207687_10181182 Ga0207687_101811821 223
358 3300025931 Ga0207644_10035065 Ga0207644_100350654 223
359 3300025935 Ga0207709_10003948 Ga0207709_100039487 223
360 3300025945 Ga0207679_10189497 Ga0207679_101894972 223
361 3300025986 Ga0207658_10005823 Ga0207658_100058231 223
362 3300025986 Ga0207658_10008274 Ga0207658_100082743 223
363 3300026035 Ga0207703_10220601 Ga0207703_102206012 223
364 3300026035 Ga0207703_10601643 Ga0207703_106016432 223
365 3300026041 Ga0207639_10472149 Ga0207639_104721491 223
366 3300026067 Ga0207678_10043730 Ga0207678_100437303 223
367 3300028379 Ga0268266_10042344 Ga0268266_100423444 223
368 3300031251 Ga0265327_10014002 Ga0265327_100140025 223
369 3300031901 Ga0307406_10009162 Ga0307406_100091622 223
370 3300031911 Ga0307412_10063159 Ga0307412_100631592 223
371 3300032004 Ga0307414_10268222 Ga0307414_102682222 223
372 3300037853 Ga0436364_1347497 Ga0436364_1347497_178_870 223
373 3300041509 Ga0451843_0980173 Ga0451843_0980173_468_1163 223
374 3300044842 Ga0466957_0348185 Ga0466957_0348185_98_796 223
375 3300045976 Ga0466967_0077103 Ga0466967_0077103_1586_2293 223
376 3300045976 Ga0466967_0107631 Ga0466967_0107631_885_1592 223
377 3300046453 Ga0495627_000998 Ga0495627_000998_3630_4325 223
378 3300048903 Ga0496100_0000165 Ga0496100_0000165_25360_26067 223
379 3300048904 Ga0496101_0000271 Ga0496101_0000271_25356_26063 223
380 3300048905 Ga0496102_0003984 Ga0496102_0003984_1268_1975 223
381 3300048905 Ga0496102_0481320 Ga0496102_0481320_417_1103 223
382 3300048909 Ga0496106_0001772 Ga0496106_0001772_6873_7580 223
383 3300048909 Ga0496106_0280136 Ga0496106_0280136_363_1049 223
384 3300048910 Ga0496107_0001116 Ga0496107_0001116_12722_13429 223
385 3300048911 Ga0496108_0012474 Ga0496108_0012474_2899_3600 223
386 3300048911 Ga0496108_0023886 Ga0496108_0023886_2385_3071 223
387 3300048911 Ga0496108_0029354 Ga0496108_0029354_33_740 223
388 3300048912 Ga0496109_0000622 Ga0496109_0000622_10459_11166 223
389 3300048912 Ga0496109_0005792 Ga0496109_0005792_3460_4146 223
390 3300048913 Ga0496110_0000274 Ga0496110_0000274_10514_11221 223
391 3300048914 Ga0496111_0007643 Ga0496111_0007643_2818_3525 223
392 3300048915 Ga0496112_0006061 Ga0496112_0006061_3158_3844 223
393 3300048915 Ga0496112_0047178 Ga0496112_0047178_1169_1855 223
394 3300048917 Ga0496114_0001560 Ga0496114_0001560_6147_6854 223
395 3300048917 Ga0496114_0674512 Ga0496114_0674512_152_838 223
396 3300048922 Ga0496119_0030607 Ga0496119_0030607_1803_2510 223
397 3300048924 Ga0496121_0000002 Ga0496121_0000002_1038562_1039269 223
398 3300048925 Ga0496122_0000141 Ga0496122_0000141_54806_55513 223
399 3300048926 Ga0496123_0010483 Ga0496123_0010483_4748_5455 223
400 3300048927 Ga0496124_0000002 Ga0496124_0000002_455320_456027 223
401 3300048928 Ga0496125_0000002 Ga0496125_0000002_1038562_1039269 223
402 3300048928 Ga0496125_0000550 Ga0496125_0000550_46834_47526 223
403 3300048929 Ga0496126_0000011 Ga0496126_0000011_455320_456027 223
404 3300049586 Ga0501070_0014417 Ga0501070_0014417_2984_3685 223
405 3300050496 nmdc:mga07m45_46292_c1 nmdc:mga07m45_46292_c1_1702_2406 223
406 3300061734 Ga0530510_0093912 Ga0530510_0093912_1207_1896 223
407 iso_pu_bacteria 2929212328 2929214557 223
408 3300005435 Ga0070714_100243408 Ga0070714_1002434082 224
409 3300006028 Ga0070717_10383315 Ga0070717_103833152 224
410 3300006048 Ga0075363_100001062 Ga0075363_1000010626 224
411 3300006051 Ga0075364_10018919 Ga0075364_100189197 224
412 3300006051 Ga0075364_10020145 Ga0075364_100201454 224
413 3300006178 Ga0075367_10048837 Ga0075367_100488374 224
414 3300006186 Ga0075369_10007791 Ga0075369_100077914 224
415 3300013105 Ga0157369_10134290 Ga0157369_101342904 224
416 3300013307 Ga0157372_10035687 Ga0157372_100356875 224
417 3300028381 Ga0268264_10094996 Ga0268264_100949962 224
418 3300044658 Ga0466972_0032942 Ga0466972_0032942_253_942 224
419 3300044683 Ga0466965_0041423 Ga0466965_0041423_965_1654 224
420 3300044684 Ga0466966_0062794 Ga0466966_0062794_400_1089 224
421 3300044693 Ga0466961_0039199 Ga0466961_0039199_1769_2458 224
422 3300044694 Ga0466963_0017958 Ga0466963_0017958_1794_2501 224
423 3300044694 Ga0466963_0073965 Ga0466963_0073965_531_1355 224
424 3300044719 Ga0466971_0001826 Ga0466971_0001826_2675_3373 224
425 3300044719 Ga0466971_0022328 Ga0466971_0022328_1119_1808 224
426 3300044719 Ga0466971_0118868 Ga0466971_0118868_398_1105 224
427 3300044735 Ga0466968_0017421 Ga0466968_0017421_1273_1962 224
428 3300044765 Ga0466970_0020001 Ga0466970_0020001_696_1385 224
429 3300044842 Ga0466957_0140131 Ga0466957_0140131_371_1078 224
430 3300044842 Ga0466957_0215489 Ga0466957_0215489_208_969 224
431 3300044901 Ga0466960_0001499 Ga0466960_0001499_176_883 224
432 3300045049 Ga0466959_0025884 Ga0466959_0025884_2455_3219 224
433 3300045836 Ga0466958_0001217 Ga0466958_0001217_11301_11999 224
434 3300045836 Ga0466958_0010486 Ga0466958_0010486_4401_5090 224
435 3300045836 Ga0466958_0132789 Ga0466958_0132789_711_1409 224
436 3300045836 Ga0466958_0161001 Ga0466958_0161001_611_1318 224
437 3300045976 Ga0466967_0014333 Ga0466967_0014333_4618_5325 224
438 3300048903 Ga0496100_0011906 Ga0496100_0011906_323_1015 224
439 3300048904 Ga0496101_0005019 Ga0496101_0005019_3398_4090 224
440 3300048905 Ga0496102_0058204 Ga0496102_0058204_1844_2554 224
441 3300048908 Ga0496105_0162916 Ga0496105_0162916_36_728 224
442 3300048910 Ga0496107_0011107 Ga0496107_0011107_1300_1992 224
443 3300048911 Ga0496108_0056365 Ga0496108_0056365_16_708 224
444 3300048913 Ga0496110_0095460 Ga0496110_0095460_1583_2275 224
445 3300048914 Ga0496111_0010637 Ga0496111_0010637_3130_3822 224
446 3300048915 Ga0496112_0087977 Ga0496112_0087977_1633_2325 224
447 3300048916 Ga0496113_0033135 Ga0496113_0033135_2308_3000 224
448 3300048917 Ga0496114_0096057 Ga0496114_0096057_1569_2261 224
449 3300048922 Ga0496119_0068491 Ga0496119_0068491_948_1640 224
450 3300048929 Ga0496126_0002515 Ga0496126_0002515_19138_19830 224
451 3300049569 Ga0501032_0097299 Ga0501032_0097299_1223_1927 224
452 3300049571 Ga0501034_0051939 Ga0501034_0051939_818_1522 224
453 3300049580 Ga0501046_0010652 Ga0501046_0010652_974_1678 224
454 3300049581 Ga0501047_0082890 Ga0501047_0082890_658_1362 224
455 3300049586 Ga0501070_0134080 Ga0501070_0134080_829_1533 224
456 3300049822 Ga0501035_0120182 Ga0501035_0120182_1212_1916 224
457 3300049823 Ga0501044_0062591 Ga0501044_0062591_66_770 224
458 3300050491 nmdc:mga00v17_1358_c1 nmdc:mga00v17_1358_c1_11885_12583 224
459 3300050491 nmdc:mga00v17_25421_c1 nmdc:mga00v17_25421_c1_1793_2548 224
460 3300050496 nmdc:mga07m45_57198_c1 nmdc:mga07m45_57198_c1_710_1408 224
461 3300050516 nmdc:mga0sz30_15423_c1 nmdc:mga0sz30_15423_c1_2167_2871 224
462 3300061719 Ga0466962_0034609 Ga0466962_0034609_74_772 224
463 3300003373 JGI25407J50210_10016053 JGI25407J50210_100160532 225
464 3300005330 Ga0070690_100162165 Ga0070690_1001621652 225
465 3300005338 Ga0068868_100499694 Ga0068868_1004996941 225
466 3300005347 Ga0070668_100004049 Ga0070668_1000040494 225
467 3300005353 Ga0070669_100006595 Ga0070669_1000065957 225
468 3300005356 Ga0070674_100441766 Ga0070674_1004417661 225
469 3300005367 Ga0070667_100000582 Ga0070667_10000058220 225
470 3300005367 Ga0070667_100143653 Ga0070667_1001436532 225
471 3300005445 Ga0070708_100533107 Ga0070708_1005331072 225
472 3300005539 Ga0068853_100034292 Ga0068853_1000342924 225
473 3300005547 Ga0070693_100242888 Ga0070693_1002428882 225
474 3300005548 Ga0070665_100011959 Ga0070665_10001195910 225
475 3300005548 Ga0070665_100756392 Ga0070665_1007563922 225
476 3300005617 Ga0068859_100000867 Ga0068859_1000008675 225
477 3300005719 Ga0068861_100095857 Ga0068861_1000958572 225
478 3300005841 Ga0068863_100001111 Ga0068863_10000111126 225
479 3300005841 Ga0068863_100509382 Ga0068863_1005093822 225
480 3300005842 Ga0068858_100003601 Ga0068858_1000036013 225
481 3300005843 Ga0068860_100000016 Ga0068860_100000016215 225
482 3300005844 Ga0068862_100000051 Ga0068862_10000005162 225
483 3300005937 Ga0081455_10006649 Ga0081455_1000664911 225
484 3300005981 Ga0081538_10006896 Ga0081538_100068966 225
485 3300006048 Ga0075363_100017372 Ga0075363_1000173724 225
486 3300006048 Ga0075363_100091027 Ga0075363_1000910272 225
487 3300006048 Ga0075363_100098165 Ga0075363_1000981652 225
488 3300006051 Ga0075364_10001139 Ga0075364_100011397 225
489 3300006051 Ga0075364_10047715 Ga0075364_100477154 225
490 3300006177 Ga0075362_10042239 Ga0075362_100422393 225
491 3300006186 Ga0075369_10000381 Ga0075369_100003813 225
492 3300006186 Ga0075369_10007067 Ga0075369_100070674 225
493 3300006358 Ga0068871_100006999 Ga0068871_1000069998 225
494 3300006844 Ga0075428_100002516 Ga0075428_10000251619 225
495 3300006846 Ga0075430_100020143 Ga0075430_1000201434 225
496 3300006846 Ga0075430_100035979 Ga0075430_1000359793 225
497 3300006846 Ga0075430_100151102 Ga0075430_1001511022 225
498 3300006847 Ga0075431_100427287 Ga0075431_1004272873 225
499 3300006880 Ga0075429_100466140 Ga0075429_1004661403 225
500 3300006881 Ga0068865_100083772 Ga0068865_1000837722 225
501 3300006931 Ga0097620_100000867 Ga0097620_10000086731 225
502 3300009147 Ga0114129_10004320 Ga0114129_100043207 225
503 3300009147 Ga0114129_10407995 Ga0114129_104079952 225
504 3300009147 Ga0114129_10614964 Ga0114129_106149642 225
505 3300009148 Ga0105243_10004323 Ga0105243_100043236 225
506 3300009174 Ga0105241_10104527 Ga0105241_101045272 225
507 3300009176 Ga0105242_10157271 Ga0105242_101572712 225
508 3300009177 Ga0105248_10000025 Ga0105248_10000025167 225
509 3300009177 Ga0105248_10003456 Ga0105248_1000345615 225
510 3300009553 Ga0105249_10000021 Ga0105249_1000002187 225
511 3300009553 Ga0105249_10077260 Ga0105249_100772603 225
512 3300010375 Ga0105239_10288452 Ga0105239_102884523 225
513 3300013297 Ga0157378_10014219 Ga0157378_100142194 225
514 3300013306 Ga0163162_10066721 Ga0163162_100667213 225
515 3300013306 Ga0163162_10110338 Ga0163162_101103383 225
516 3300013306 Ga0163162_10382545 Ga0163162_103825452 225
517 3300014325 Ga0163163_10018207 Ga0163163_100182073 225
518 3300014325 Ga0163163_10342123 Ga0163163_103421233 225
519 3300014968 Ga0157379_10001172 Ga0157379_1000117220 225
520 3300014968 Ga0157379_10124378 Ga0157379_101243783 225
521 3300025900 Ga0207710_10000033 Ga0207710_1000003355 225
522 3300025900 Ga0207710_10046464 Ga0207710_100464642 225
523 3300025923 Ga0207681_10002372 Ga0207681_100023725 225
524 3300025935 Ga0207709_10203748 Ga0207709_102037482 225
525 3300025938 Ga0207704_10431502 Ga0207704_104315022 225
526 3300025941 Ga0207711_10000191 Ga0207711_100001915 225
527 3300025941 Ga0207711_10029096 Ga0207711_100290962 225
528 3300025961 Ga0207712_10000005 Ga0207712_10000005465 225
529 3300025961 Ga0207712_10080141 Ga0207712_100801412 225
530 3300025972 Ga0207668_10001360 Ga0207668_100013606 225
531 3300025972 Ga0207668_10217045 Ga0207668_102170452 225
532 3300025986 Ga0207658_10001110 Ga0207658_1000111021 225
533 3300025986 Ga0207658_10061324 Ga0207658_100613242 225
534 3300026023 Ga0207677_10739125 Ga0207677_107391251 225
535 3300026035 Ga0207703_10053025 Ga0207703_100530254 225
536 3300026035 Ga0207703_10058209 Ga0207703_100582093 225
537 3300026041 Ga0207639_10102053 Ga0207639_101020534 225
538 3300026088 Ga0207641_10002206 Ga0207641_1000220622 225
539 3300026088 Ga0207641_10373045 Ga0207641_103730452 225
540 3300026118 Ga0207675_100063739 Ga0207675_1000637394 225
541 3300026118 Ga0207675_100327986 Ga0207675_1003279862 225
542 3300026121 Ga0207683_10000160 Ga0207683_1000016047 225
543 3300028379 Ga0268266_10040839 Ga0268266_100408395 225
544 3300028379 Ga0268266_10844151 Ga0268266_108441511 225
545 3300028380 Ga0268265_10000022 Ga0268265_10000022211 225
546 3300028381 Ga0268264_10000005 Ga0268264_10000005460 225
547 3300031456 Ga0307513_10001160 Ga0307513_1000116012 225
548 3300031456 Ga0307513_10060663 Ga0307513_100606632 225
549 3300031852 Ga0307410_10226850 Ga0307410_102268502 225
550 3300031911 Ga0307412_10392886 Ga0307412_103928862 225
551 3300031995 Ga0307409_100251289 Ga0307409_1002512893 225
552 3300032005 Ga0307411_10862146 Ga0307411_108621461 225
553 3300041410 Ga0439461_0007271 Ga0439461_0007271_985_1689 225
554 3300041413 Ga0439465_0005732 Ga0439465_0005732_1860_2564 225
555 3300041452 Ga0451793_0271601 Ga0451793_0271601_100_822 225
556 3300041460 Ga0451802_1512295 Ga0451802_1512295_36_740 225
557 3300041486 Ga0451807_2442734 Ga0451807_2442734_85_816 225
558 3300041491 Ga0451833_0770555 Ga0451833_0770555_141_863 225
559 3300041512 Ga0451853_1665339 Ga0451853_1665339_3252_3956 225
560 3300041997 Ga0439431_0017671 Ga0439431_0017671_415_1119 225
561 3300044658 Ga0466972_0104701 Ga0466972_0104701_20_724 225
562 3300045976 Ga0466967_0500853 Ga0466967_0500853_348_1052 225
563 3300046460 Ga0495638_0008424 Ga0495638_0008424_1711_2418 225
564 3300046531 Ga0495665_0298311 Ga0495665_0298311_107_811 225
565 3300046674 Ga0495588_0029968 Ga0495588_0029968_143_847 225
566 3300047315 Ga0495581_0030301 Ga0495581_0030301_732_1436 225
567 3300047472 Ga0495686_0002701 Ga0495686_0002701_6239_6931 225
568 3300048903 Ga0496100_0031590 Ga0496100_0031590_1038_1808 225
569 3300048903 Ga0496100_0083153 Ga0496100_0083153_500_1219 225
570 3300048904 Ga0496101_0012755 Ga0496101_0012755_3794_4564 225
571 3300048905 Ga0496102_0002051 Ga0496102_0002051_6915_7685 225
572 3300048905 Ga0496102_0075276 Ga0496102_0075276_1205_1924 225
573 3300048905 Ga0496102_0149807 Ga0496102_0149807_593_1294 225
574 3300048905 Ga0496102_0205063 Ga0496102_0205063_381_1073 225
575 3300048906 Ga0496103_0000448 Ga0496103_0000448_29141_29911 225
576 3300048907 Ga0496104_0010915 Ga0496104_0010915_3808_4527 225
577 3300048909 Ga0496106_0037062 Ga0496106_0037062_1561_2280 225
578 3300048910 Ga0496107_0010772 Ga0496107_0010772_5304_6023 225
579 3300048910 Ga0496107_0079939 Ga0496107_0079939_748_1518 225
580 3300048915 Ga0496112_0009499 Ga0496112_0009499_7244_7948 225
581 3300048916 Ga0496113_0058976 Ga0496113_0058976_1078_1782 225
582 3300048917 Ga0496114_0761232 Ga0496114_0761232_33_803 225
583 3300048919 Ga0496116_0203265 Ga0496116_0203265_312_1016 225
584 3300048920 Ga0496117_0000417 Ga0496117_0000417_26071_26841 225
585 3300048921 Ga0496118_0000350 Ga0496118_0000350_61797_62567 225
586 3300048923 Ga0496120_0062164 Ga0496120_0062164_954_1724 225
587 3300048924 Ga0496121_0011044 Ga0496121_0011044_2011_2781 225
588 3300048927 Ga0496124_0293149 Ga0496124_0293149_19_723 225
589 3300048928 Ga0496125_0066385 Ga0496125_0066385_635_1405 225
590 3300049570 Ga0501033_0075979 Ga0501033_0075979_941_1633 225
591 3300049572 Ga0501036_0123568 Ga0501036_0123568_444_1136 225
592 3300049575 Ga0501039_0162017 Ga0501039_0162017_443_1135 225
593 3300049576 Ga0501040_0155557 Ga0501040_0155557_868_1560 225
594 3300049577 Ga0501041_0158983 Ga0501041_0158983_666_1358 225
595 3300049578 Ga0501042_0122687 Ga0501042_0122687_588_1280 225
596 3300049580 Ga0501046_0340539 Ga0501046_0340539_87_779 225
597 3300049582 Ga0501048_0141360 Ga0501048_0141360_703_1395 225
598 3300049588 Ga0501072_0622375 Ga0501072_0622375_135_827 225
599 3300049824 Ga0501045_0050616 Ga0501045_0050616_419_1111 225
600 3300050490 nmdc:mga03n38_104587_c1 nmdc:mga03n38_104587_c1_561_1265 225
601 3300050490 nmdc:mga03n38_5399_c1 nmdc:mga03n38_5399_c1_1469_2176 225
602 3300050491 nmdc:mga00v17_614_c1 nmdc:mga00v17_614_c1_12130_12834 225
603 3300050492 nmdc:mga0yw44_327679_c1 nmdc:mga0yw44_327679_c1_207_911 225
604 3300050507 nmdc:mga05p37_30733_c1 nmdc:mga05p37_30733_c1_5815_6513 225
605 3300050507 nmdc:mga05p37_389200_c1 nmdc:mga05p37_389200_c1_101_793 225
606 3300050507 nmdc:mga05p37_632364_c1 nmdc:mga05p37_632364_c1_162_854 225
607 3300050507 nmdc:mga05p37_862331_c1 nmdc:mga05p37_862331_c1_65_766 225
608 3300050508 nmdc:mga09592_86349_c1 nmdc:mga09592_86349_c1_354_1046 225
609 3300050509 nmdc:mga0qj67_230485_c1 nmdc:mga0qj67_230485_c1_271_963 225
610 3300050509 nmdc:mga0qj67_24370_c1 nmdc:mga0qj67_24370_c1_2724_3422 225
611 3300050509 nmdc:mga0qj67_32097_c1 nmdc:mga0qj67_32097_c1_2047_2751 225
612 3300050510 nmdc:mga06r32_114004_c1 nmdc:mga06r32_114004_c1_1951_2649 225
613 3300050510 nmdc:mga06r32_227930_c1 nmdc:mga06r32_227930_c1_1132_1833 225
614 3300050516 nmdc:mga0sz30_343_c1 nmdc:mga0sz30_343_c1_11173_11877 225
615 3300053104 Ga0500556_0004900 Ga0500556_0004900_2439_3146 225
616 3300053118 Ga0500594_0080382 Ga0500594_0080382_248_961 225
617 3300053153 Ga0500616_0004909 Ga0500616_0004909_4309_5004 225
618 3300061734 Ga0530510_0257557 Ga0530510_0257557_312_1004 225
619 3300005329 Ga0070683_101124507 Ga0070683_1011245071 226
620 3300005356 Ga0070674_100407860 Ga0070674_1004078602 226
621 3300005456 Ga0070678_100065520 Ga0070678_1000655202 226
622 3300005548 Ga0070665_100354352 Ga0070665_1003543521 226
623 3300005548 Ga0070665_100543321 Ga0070665_1005433211 226
624 3300006051 Ga0075364_10006919 Ga0075364_100069192 226
625 3300006175 Ga0070712_100230725 Ga0070712_1002307252 226
626 3300006177 Ga0075362_10068268 Ga0075362_100682682 226
627 3300006178 Ga0075367_10255654 Ga0075367_102556541 226
628 3300006353 Ga0075370_10024235 Ga0075370_100242353 226
629 3300009101 Ga0105247_10101626 Ga0105247_101016263 226
630 3300013297 Ga0157378_10449107 Ga0157378_104491071 226
631 3300014325 Ga0163163_10479437 Ga0163163_104794373 226
632 3300014326 Ga0157380_10804225 Ga0157380_108042251 226
633 3300014968 Ga0157379_10438257 Ga0157379_104382572 226
634 3300025900 Ga0207710_10061099 Ga0207710_100610993 226
635 3300025928 Ga0207700_10615960 Ga0207700_106159601 226
636 3300025937 Ga0207669_10109831 Ga0207669_101098312 226
637 3300026121 Ga0207683_10063898 Ga0207683_100638983 226
638 3300028379 Ga0268266_10120064 Ga0268266_101200642 226
639 3300048903 Ga0496100_0000300 Ga0496100_0000300_23136_23909 226
640 3300048904 Ga0496101_0000907 Ga0496101_0000907_15849_16556 226
641 3300048905 Ga0496102_0156815 Ga0496102_0156815_554_1261 226
642 3300048908 Ga0496105_0030081 Ga0496105_0030081_243_950 226
643 3300048910 Ga0496107_0001983 Ga0496107_0001983_7235_7942 226
644 3300048917 Ga0496114_0000720 Ga0496114_0000720_1124_1831 226
645 3300048918 Ga0496115_0001133 Ga0496115_0001133_2690_3397 226
646 3300053080 Ga0500635_0000622 Ga0500635_0000622_4326_5024 226
647 3300053131 Ga0500652_002044 Ga0500652_002044_3756_4454 226
648 3300053153 Ga0500616_0004274 Ga0500616_0004274_3765_4514 226
649 3300025937 Ga0207669_10134380 Ga0207669_101343802 227
650 3300045976 Ga0466967_0537036 Ga0466967_0537036_32_730 227
651 3300046462 Ga0495651_0116691 Ga0495651_0116691_1196_1906 227
652 3300046463 Ga0495653_0156729 Ga0495653_0156729_402_1106 227
653 3300046511 Ga0495608_0070519 Ga0495608_0070519_533_1243 227
654 3300047319 Ga0495674_0195508 Ga0495674_0195508_96_806 227
655 3300048922 Ga0496119_0141334 Ga0496119_0141334_579_1289 227
656 3300049568 Ga0501031_0034909 Ga0501031_0034909_2137_2856 227
657 3300049569 Ga0501032_0338668 Ga0501032_0338668_23_742 227
658 3300049570 Ga0501033_0025362 Ga0501033_0025362_1730_2449 227
659 3300049571 Ga0501034_0310499 Ga0501034_0310499_677_1396 227
660 3300049574 Ga0501038_0000952 Ga0501038_0000952_24865_25584 227
661 3300049579 Ga0501043_0212618 Ga0501043_0212618_64_783 227
662 3300049582 Ga0501048_0000654 Ga0501048_0000654_15095_15814 227
663 3300049586 Ga0501070_0003679 Ga0501070_0003679_229_948 227
664 3300049587 Ga0501071_0134426 Ga0501071_0134426_280_999 227
665 3300049589 Ga0501073_0036944 Ga0501073_0036944_2486_3205 227
666 3300049589 Ga0501073_0101391 Ga0501073_0101391_1190_1888 227
667 3300049741 Ga0501079_0117676 Ga0501079_0117676_390_1109 227
668 3300049742 Ga0501080_0001246 Ga0501080_0001246_15965_16684 227
669 3300054114 Ga0501084_0008210 Ga0501084_0008210_5941_6660 227
670 3300001991 JGI24743J22301_10006994 JGI24743J22301_100069942 228
671 3300002077 JGI24744J21845_10018574 JGI24744J21845_100185741 228
672 3300003203 JGI25406J46586_10000381 JGI25406J46586_100003812 228
673 3300005338 Ga0068868_100011304 Ga0068868_1000113043 228
674 3300005339 Ga0070660_100484300 Ga0070660_1004843001 228
675 3300005353 Ga0070669_100236890 Ga0070669_1002368902 228
676 3300005356 Ga0070674_100375330 Ga0070674_1003753301 228
677 3300005365 Ga0070688_100077185 Ga0070688_1000771853 228
678 3300005366 Ga0070659_100070783 Ga0070659_1000707833 228
679 3300005366 Ga0070659_100260193 Ga0070659_1002601932 228
680 3300005434 Ga0070709_10054689 Ga0070709_100546891 228
681 3300005438 Ga0070701_10100733 Ga0070701_101007332 228
682 3300005439 Ga0070711_100036965 Ga0070711_1000369652 228
683 3300005441 Ga0070700_100224219 Ga0070700_1002242193 228
684 3300005456 Ga0070678_100057565 Ga0070678_1000575652 228
685 3300005466 Ga0070685_10046944 Ga0070685_100469445 228
686 3300005546 Ga0070696_100013172 Ga0070696_1000131722 228
687 3300005548 Ga0070665_100011884 Ga0070665_1000118849 228
688 3300005548 Ga0070665_100193762 Ga0070665_1001937622 228
689 3300005563 Ga0068855_100523066 Ga0068855_1005230662 228
690 3300005578 Ga0068854_100077827 Ga0068854_1000778272 228
691 3300005616 Ga0068852_100137297 Ga0068852_1001372971 228
692 3300005617 Ga0068859_100029066 Ga0068859_1000290666 228
693 3300005617 Ga0068859_100478646 Ga0068859_1004786461 228
694 3300005840 Ga0068870_10249795 Ga0068870_102497952 228
695 3300005842 Ga0068858_100010836 Ga0068858_1000108366 228
696 3300005843 Ga0068860_100039061 Ga0068860_1000390615 228
697 3300005985 Ga0081539_10001051 Ga0081539_100010512 228
698 3300006038 Ga0075365_10219492 Ga0075365_102194921 228
699 3300006051 Ga0075364_10269858 Ga0075364_102698582 228
700 3300006051 Ga0075364_10376045 Ga0075364_103760451 228
701 3300006163 Ga0070715_10016443 Ga0070715_100164433 228
702 3300006175 Ga0070712_100063839 Ga0070712_1000638391 228
703 3300006186 Ga0075369_10004737 Ga0075369_100047373 228
704 3300006358 Ga0068871_100392941 Ga0068871_1003929412 228
705 3300006881 Ga0068865_100180145 Ga0068865_1001801452 228
706 3300006931 Ga0097620_100029064 Ga0097620_1000290646 228
707 3300006931 Ga0097620_100478651 Ga0097620_1004786511 228
708 3300009098 Ga0105245_10009665 Ga0105245_100096656 228
709 3300009148 Ga0105243_10093141 Ga0105243_100931412 228
710 3300009177 Ga0105248_10528758 Ga0105248_105287582 228
711 3300009545 Ga0105237_10006529 Ga0105237_100065292 228
712 3300009551 Ga0105238_10265581 Ga0105238_102655813 228
713 3300011119 Ga0105246_10079010 Ga0105246_100790102 228
714 3300013296 Ga0157374_10111713 Ga0157374_101117132 228
715 3300013306 Ga0163162_10448563 Ga0163162_104485633 228
716 3300013308 Ga0157375_10003762 Ga0157375_100037628 228
717 3300014326 Ga0157380_10121192 Ga0157380_101211923 228
718 3300014745 Ga0157377_10022444 Ga0157377_100224443 228
719 3300025898 Ga0207692_10003418 Ga0207692_100034186 228
720 3300025900 Ga0207710_10113236 Ga0207710_101132361 228
721 3300025901 Ga0207688_10002229 Ga0207688_100022292 228
722 3300025907 Ga0207645_10086954 Ga0207645_100869541 228
723 3300025914 Ga0207671_10002173 Ga0207671_1000217312 228
724 3300025915 Ga0207693_10003117 Ga0207693_1000311712 228
725 3300025916 Ga0207663_10001631 Ga0207663_100016312 228
726 3300025919 Ga0207657_10123816 Ga0207657_101238162 228
727 3300025923 Ga0207681_10169727 Ga0207681_101697273 228
728 3300025924 Ga0207694_10218514 Ga0207694_102185143 228
729 3300025932 Ga0207690_10032403 Ga0207690_100324032 228
730 3300025933 Ga0207706_10100312 Ga0207706_101003124 228
731 3300025939 Ga0207665_10012984 Ga0207665_100129842 228
732 3300025941 Ga0207711_10233126 Ga0207711_102331262 228
733 3300025961 Ga0207712_10330612 Ga0207712_103306121 228
734 3300025972 Ga0207668_10633862 Ga0207668_106338621 228
735 3300025981 Ga0207640_10384887 Ga0207640_103848871 228
736 3300026023 Ga0207677_10009273 Ga0207677_100092734 228
737 3300026023 Ga0207677_10535593 Ga0207677_105355931 228
738 3300026075 Ga0207708_10429781 Ga0207708_104297811 228
739 3300026095 Ga0207676_10011210 Ga0207676_100112105 228
740 3300026118 Ga0207675_100091284 Ga0207675_1000912845 228
741 3300026121 Ga0207683_10007470 Ga0207683_1000747010 228
742 3300026142 Ga0207698_10319502 Ga0207698_103195022 228
743 3300026142 Ga0207698_11180228 Ga0207698_111802281 228
744 3300039437 Ga0436365_1856170 Ga0436365_1856170_3618_4406 228
745 3300044765 Ga0466970_0125340 Ga0466970_0125340_319_1035 228
746 3300044842 Ga0466957_0060934 Ga0466957_0060934_458_1174 228
747 3300044901 Ga0466960_0154651 Ga0466960_0154651_65_781 228
748 3300046507 Ga0495606_0053413 Ga0495606_0053413_1356_2078 228
749 3300048904 Ga0496101_0040163 Ga0496101_0040163_1230_1949 228
750 3300048905 Ga0496102_0000003 Ga0496102_0000003_63699_64424 228
751 3300048905 Ga0496102_0013106 Ga0496102_0013106_6173_6874 228
752 3300048905 Ga0496102_0021279 Ga0496102_0021279_577_1296 228
753 3300048905 Ga0496102_0062329 Ga0496102_0062329_90_791 228
754 3300048906 Ga0496103_0000014 Ga0496103_0000014_226192_226917 228
755 3300048908 Ga0496105_0048688 Ga0496105_0048688_1112_1813 228
756 3300048909 Ga0496106_0039676 Ga0496106_0039676_1718_2419 228
757 3300048909 Ga0496106_0048728 Ga0496106_0048728_2352_3077 228
758 3300048909 Ga0496106_0562750 Ga0496106_0562750_19_738 228
759 3300048910 Ga0496107_0271433 Ga0496107_0271433_393_1118 228
760 3300048910 Ga0496107_0294006 Ga0496107_0294006_114_833 228
761 3300048911 Ga0496108_0000189 Ga0496108_0000189_51264_51965 228
762 3300048911 Ga0496108_0068049 Ga0496108_0068049_1868_2590 228
763 3300048912 Ga0496109_0101201 Ga0496109_0101201_837_1538 228
764 3300048913 Ga0496110_0384138 Ga0496110_0384138_269_991 228
765 3300048914 Ga0496111_0050607 Ga0496111_0050607_1040_1741 228
766 3300048915 Ga0496112_0096296 Ga0496112_0096296_1462_2163 228
767 3300048916 Ga0496113_0114959 Ga0496113_0114959_1276_1977 228
768 3300048917 Ga0496114_0158285 Ga0496114_0158285_194_895 228
769 3300048919 Ga0496116_0000071 Ga0496116_0000071_62834_63559 228
770 3300048920 Ga0496117_0000003 Ga0496117_0000003_527840_528565 228
771 3300048921 Ga0496118_0000001 Ga0496118_0000001_527843_528568 228
772 3300048922 Ga0496119_0001317 Ga0496119_0001317_21998_22723 228
773 3300048923 Ga0496120_0000157 Ga0496120_0000157_48244_48969 228
774 3300048924 Ga0496121_0000019 Ga0496121_0000019_73112_73837 228
775 3300048929 Ga0496126_0000186 Ga0496126_0000186_63717_64430 228
776 3300050516 nmdc:mga0sz30_14113_c1 nmdc:mga0sz30_14113_c1_1263_1976 228
777 3300053087 Ga0500643_002664 Ga0500643_002664_501_1214 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

45

256

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1a-assembly1.cif.gz_A resa c74a variant 0.7356 53 180
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.733 55 195
2pwj-assembly2.cif.gz_B structure of a mitochondrial type ii peroxiredoxin from pisum sativum 0.721 49 181
5epf-assembly1.cif.gz_A crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis 0.7168 49 195
2h1g-assembly1.cif.gz_A resa c74a/c77a 0.7161 53 193
ID Description Score Start End Superfamily
af_Q9D1A0_27_140_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7858 58 157 3.40.30.10
af_Q5I0C9_376_611_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7554 161 183 2.130.10.10
af_Q5A7P9_48_194_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7531 53 166 3.40.30.10
af_O94561_50_193_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7432 55 167 3.40.30.10
af_I1MS47_66_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7429 55 195 3.40.30.10
ID Description Score Start End GO Terms
AF-K0V9M3-F1-model_v4 DUF899 domain-containing protein 0.9754 12 228
AF-A0A7U5MKR8-F1-model_v4 CalU12 protein 0.9734 9 189
AF-F5XQQ2-F1-model_v4 Thioredoxin domain-containing protein 0.9641 9 226
AF-A0A1R0U0F4-F1-model_v4 deleted 0.9632 9 228
AF-A0A6F8YNX2-F1-model_v4 Thioredoxin domain-containing protein 0.962 11 228

Feature Viewer

pLDDT pTM Quality
91.7 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map