F480380
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 777 | 359 | 736 | 231 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0073965|Ga0466963_0073965_531_1355 |
| Length | 274 |
| Sequence | MCGDEHLRARAHRFDQLPMIFGRSTSQTFKRAIESEGGAMSSRITALPPVVDHQTWGAALDELRKREKAATRELDAIAAQRRRLPMVEVADYTLVGADGPIRLADVFGGRSQLIVYHHMWSDGAEWQCGGCTGFTSQFTRLEFLDNYDARFVIVTNGPIEEALAYKHKVGNRMDWYSSSQSTFAADMDAPPGGGFGVNVFLRDGETVYRTWHTNGRGTEQLSHSFGLIDILPWGRQEEWLDSPEGWPSRPTYSGWLDSPAIAAAYGPTGNKDNP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 2 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 3 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 4 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 5 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 6 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 7 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 8 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 9 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 10 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 11 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 12 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 13 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 14 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 15 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 16 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 17 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 18 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 19 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 20 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 21 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 22 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 23 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 24 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 25 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 26 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 27 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 28 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 29 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 30 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 31 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 32 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 33 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 34 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 35 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 36 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 37 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 38 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 39 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 40 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 41 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 42 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 44 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 51 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 103 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 104 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 106 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 118 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 119 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 120 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 124 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 152 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 153 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 212 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 213 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 214 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 219 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 220 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 225 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 226 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 227 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 233 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 236 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 237 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 238 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 239 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 240 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 241 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 242 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 243 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 244 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 245 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 246 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 247 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 248 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 249 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 282 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 283 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 284 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 285 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 286 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 287 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 297 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 298 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 299 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 302 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 303 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 304 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 305 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 306 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 332 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 333 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 334 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 335 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 336 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 337 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 338 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 345 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 346 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 347 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 348 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 349 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 350 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 351 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 352 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 353 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 354 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 357 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 358 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 359 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.47 |
| Metatranscriptomes | 0.26 |
| Isolates | 5.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.33 |
| Nodule | 0.39 |
| Rhizoplane | 12.36 |
| Rhizosphere | 65.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10006994 | 3300001991 | Bacteria | 1943 |
| 2 | JGI24744J21845_10018574 | 3300002077 | Bacteria | 1378 |
| 3 | JGI25406J46586_10000381 | 3300003203 | Bacteria | 20344 |
| 4 | JGI25407J50210_10016053 | 3300003373 | Bacteria | 1937 |
| 5 | Ga0055540_1000082 | 3300003792 | Bacteria | 109065 |
| 6 | Ga0055540_1005754 | 3300003792 | Bacteria | 5104 |
| 7 | Ga0055540_1008491 | 3300003792 | Bacteria | 3691 |
| 8 | Ga0070658_10005967 | 3300005327 | Bacteria | 9878 |
| 9 | Ga0070658_10228389 | 3300005327 | Bacteria | 1575 |
| 10 | Ga0070676_10211489 | 3300005328 | Bacteria | 1277 |
| 11 | Ga0070683_100505930 | 3300005329 | Bacteria | 1154 |
| 12 | Ga0070683_101124507 | 3300005329 | Bacteria | 755 |
| 13 | Ga0070690_100115387 | 3300005330 | Bacteria | 1797 |
| 14 | Ga0070690_100162165 | 3300005330 | Bacteria | 1533 |
| 15 | Ga0070670_100112808 | 3300005331 | Bacteria | 2343 |
| 16 | Ga0068869_100759336 | 3300005334 | Bacteria | 831 |
| 17 | Ga0070666_10128195 | 3300005335 | Bacteria | 1762 |
| 18 | Ga0070682_100002000 | 3300005337 | Bacteria | 11373 |
| 19 | Ga0070682_100010434 | 3300005337 | Bacteria | 5271 |
| 20 | Ga0068868_100011304 | 3300005338 | Bacteria | 6500 |
| 21 | Ga0068868_100182129 | 3300005338 | Bacteria | 1743 |
| 22 | Ga0068868_100499694 | 3300005338 | Bacteria | 1065 |
| 23 | Ga0070660_100484300 | 3300005339 | Bacteria | 1028 |
| 24 | Ga0070689_100555737 | 3300005340 | Bacteria | 989 |
| 25 | Ga0070661_100033955 | 3300005344 | Bacteria | 3698 |
| 26 | Ga0070668_100001949 | 3300005347 | Bacteria | 15054 |
| 27 | Ga0070668_100004049 | 3300005347 | Bacteria | 10851 |
| 28 | Ga0070669_100006595 | 3300005353 | Bacteria | 8355 |
| 29 | Ga0070669_100236890 | 3300005353 | Bacteria | 1448 |
| 30 | Ga0070675_100401646 | 3300005354 | Bacteria | 1223 |
| 31 | Ga0070671_100001885 | 3300005355 | Bacteria | 16030 |
| 32 | Ga0070674_100198512 | 3300005356 | Bacteria | 1547 |
| 33 | Ga0070674_100375330 | 3300005356 | Bacteria | 1155 |
| 34 | Ga0070674_100407860 | 3300005356 | Bacteria | 1112 |
| 35 | Ga0070674_100441766 | 3300005356 | Bacteria | 1072 |
| 36 | Ga0070688_100077185 | 3300005365 | Bacteria | 2145 |
| 37 | Ga0070659_100070783 | 3300005366 | Bacteria | 2771 |
| 38 | Ga0070659_100260193 | 3300005366 | Bacteria | 1440 |
| 39 | Ga0070659_100573543 | 3300005366 | Bacteria | 968 |
| 40 | Ga0070667_100000582 | 3300005367 | Bacteria | 36093 |
| 41 | Ga0070667_100001225 | 3300005367 | Bacteria | 23359 |
| 42 | Ga0070667_100023395 | 3300005367 | Bacteria | 5125 |
| 43 | Ga0070667_100102931 | 3300005367 | Bacteria | 2468 |
| 44 | Ga0070667_100143653 | 3300005367 | Bacteria | 2091 |
| 45 | Ga0070667_100446470 | 3300005367 | Bacteria | 1181 |
| 46 | Ga0070709_10054689 | 3300005434 | Bacteria | 2517 |
| 47 | Ga0070714_100066963 | 3300005435 | Bacteria | 3096 |
| 48 | Ga0070714_100198527 | 3300005435 | Bacteria | 1834 |
| 49 | Ga0070714_100243408 | 3300005435 | Bacteria | 1661 |
| 50 | Ga0070713_100166250 | 3300005436 | Bacteria | 1973 |
| 51 | Ga0070713_100278569 | 3300005436 | Bacteria | 1533 |
| 52 | Ga0070701_10100733 | 3300005438 | Bacteria | 1599 |
| 53 | Ga0070701_10123103 | 3300005438 | Bacteria | 1464 |
| 54 | Ga0070711_100036965 | 3300005439 | Bacteria | 3274 |
| 55 | Ga0070711_100057789 | 3300005439 | Bacteria | 2687 |
| 56 | Ga0070700_100058360 | 3300005441 | Bacteria | 2424 |
| 57 | Ga0070700_100224219 | 3300005441 | Bacteria | 1334 |
| 58 | Ga0070708_100533107 | 3300005445 | Bacteria | 1108 |
| 59 | Ga0070663_100045323 | 3300005455 | Bacteria | 3106 |
| 60 | Ga0070663_100045684 | 3300005455 | Bacteria | 3095 |
| 61 | Ga0070663_100426907 | 3300005455 | Bacteria | 1088 |
| 62 | Ga0070678_100057565 | 3300005456 | Bacteria | 2848 |
| 63 | Ga0070678_100064536 | 3300005456 | Bacteria | 2714 |
| 64 | Ga0070678_100065520 | 3300005456 | Bacteria | 2698 |
| 65 | Ga0068867_100159583 | 3300005459 | Bacteria | 1777 |
| 66 | Ga0070685_10003055 | 3300005466 | Bacteria | 8534 |
| 67 | Ga0070685_10046944 | 3300005466 | Bacteria | 2481 |
| 68 | Ga0070706_100183293 | 3300005467 | Bacteria | 1955 |
| 69 | Ga0070679_100500137 | 3300005530 | Bacteria | 1159 |
| 70 | Ga0070684_100486432 | 3300005535 | Bacteria | 1142 |
| 71 | Ga0070684_100677587 | 3300005535 | Bacteria | 961 |
| 72 | Ga0068853_100034292 | 3300005539 | Bacteria | 4308 |
| 73 | Ga0070672_100140950 | 3300005543 | Bacteria | 1988 |
| 74 | Ga0070686_100189586 | 3300005544 | Bacteria | 1467 |
| 75 | Ga0070686_100346670 | 3300005544 | Bacteria | 1114 |
| 76 | Ga0070696_100013172 | 3300005546 | Bacteria | 5547 |
| 77 | Ga0070693_100242888 | 3300005547 | Bacteria | 1190 |
| 78 | Ga0070665_100000698 | 3300005548 | Bacteria | 44785 |
| 79 | Ga0070665_100002795 | 3300005548 | Bacteria | 18921 |
| 80 | Ga0070665_100011884 | 3300005548 | Bacteria | 8792 |
| 81 | Ga0070665_100011959 | 3300005548 | Bacteria | 8764 |
| 82 | Ga0070665_100017687 | 3300005548 | Bacteria | 7158 |
| 83 | Ga0070665_100193762 | 3300005548 | Bacteria | 2033 |
| 84 | Ga0070665_100354352 | 3300005548 | Bacteria | 1473 |
| 85 | Ga0070665_100543321 | 3300005548 | Bacteria | 1174 |
| 86 | Ga0070665_100756392 | 3300005548 | Bacteria | 985 |
| 87 | Ga0068855_100523066 | 3300005563 | Bacteria | 1287 |
| 88 | Ga0070664_100220375 | 3300005564 | Bacteria | 1697 |
| 89 | Ga0068857_100037891 | 3300005577 | Bacteria | 4271 |
| 90 | Ga0068857_100548873 | 3300005577 | Bacteria | 1088 |
| 91 | Ga0068854_100077827 | 3300005578 | Bacteria | 2441 |
| 92 | Ga0068856_100142643 | 3300005614 | Bacteria | 2402 |
| 93 | Ga0070702_100237831 | 3300005615 | Bacteria | 1227 |
| 94 | Ga0068852_100137297 | 3300005616 | Bacteria | 2258 |
| 95 | Ga0068852_100142393 | 3300005616 | Bacteria | 2220 |
| 96 | Ga0068852_100145080 | 3300005616 | Bacteria | 2201 |
| 97 | Ga0068859_100000867 | 3300005617 | Bacteria | 30844 |
| 98 | Ga0068859_100029066 | 3300005617 | Bacteria | 5546 |
| 99 | Ga0068859_100478646 | 3300005617 | Bacteria | 1340 |
| 100 | Ga0068864_100059557 | 3300005618 | Bacteria | 3304 |
| 101 | Ga0068864_100073233 | 3300005618 | Bacteria | 2986 |
| 102 | Ga0068861_100003072 | 3300005719 | Bacteria | 11027 |
| 103 | Ga0068861_100095857 | 3300005719 | Bacteria | 2350 |
| 104 | Ga0068861_100769305 | 3300005719 | Bacteria | 901 |
| 105 | Ga0068851_10058465 | 3300005834 | Bacteria | 1971 |
| 106 | Ga0068870_10249795 | 3300005840 | Bacteria | 1099 |
| 107 | Ga0068863_100001111 | 3300005841 | Bacteria | 26870 |
| 108 | Ga0068863_100361270 | 3300005841 | Bacteria | 1415 |
| 109 | Ga0068863_100509382 | 3300005841 | Bacteria | 1186 |
| 110 | Ga0068863_100540142 | 3300005841 | Bacteria | 1150 |
| 111 | Ga0068858_100003601 | 3300005842 | Bacteria | 15332 |
| 112 | Ga0068858_100010836 | 3300005842 | Bacteria | 8618 |
| 113 | Ga0068858_100141870 | 3300005842 | Bacteria | 2255 |
| 114 | Ga0068858_100694559 | 3300005842 | Bacteria | 990 |
| 115 | Ga0068860_100000016 | 3300005843 | Bacteria | 310468 |
| 116 | Ga0068860_100039061 | 3300005843 | Bacteria | 4541 |
| 117 | Ga0068860_100901580 | 3300005843 | Bacteria | 900 |
| 118 | Ga0068862_100000051 | 3300005844 | Bacteria | 145362 |
| 119 | Ga0068862_100029018 | 3300005844 | Bacteria | 4660 |
| 120 | Ga0081455_10006649 | 3300005937 | Bacteria | 12359 |
| 121 | Ga0081455_10067379 | 3300005937 | Bacteria | 2983 |
| 122 | Ga0081455_10095960 | 3300005937 | Bacteria | 2392 |
| 123 | Ga0081538_10006896 | 3300005981 | Bacteria | 9886 |
| 124 | Ga0081538_10166297 | 3300005981 | Bacteria | 970 |
| 125 | Ga0081539_10001051 | 3300005985 | Bacteria | 50562 |
| 126 | Ga0070717_10024663 | 3300006028 | Bacteria | 4778 |
| 127 | Ga0070717_10383315 | 3300006028 | Bacteria | 1261 |
| 128 | Ga0075365_10043568 | 3300006038 | Bacteria | 2938 |
| 129 | Ga0075365_10075228 | 3300006038 | Bacteria | 2279 |
| 130 | Ga0075365_10219492 | 3300006038 | Bacteria | 1334 |
| 131 | Ga0075363_100000340 | 3300006048 | Bacteria | 13957 |
| 132 | Ga0075363_100001062 | 3300006048 | Bacteria | 9920 |
| 133 | Ga0075363_100017372 | 3300006048 | Bacteria | 3567 |
| 134 | Ga0075363_100091027 | 3300006048 | Bacteria | 1679 |
| 135 | Ga0075363_100098165 | 3300006048 | Bacteria | 1619 |
| 136 | Ga0075363_100113221 | 3300006048 | Bacteria | 1509 |
| 137 | Ga0075363_100207159 | 3300006048 | Bacteria | 1122 |
| 138 | Ga0075363_100300329 | 3300006048 | Bacteria | 932 |
| 139 | Ga0075364_10001139 | 3300006051 | Bacteria | 14196 |
| 140 | Ga0075364_10006919 | 3300006051 | Bacteria | 6696 |
| 141 | Ga0075364_10018919 | 3300006051 | Bacteria | 4319 |
| 142 | Ga0075364_10020145 | 3300006051 | Bacteria | 4194 |
| 143 | Ga0075364_10036522 | 3300006051 | Bacteria | 3176 |
| 144 | Ga0075364_10047715 | 3300006051 | Bacteria | 2790 |
| 145 | Ga0075364_10072421 | 3300006051 | Bacteria | 2271 |
| 146 | Ga0075364_10167447 | 3300006051 | Bacteria | 1485 |
| 147 | Ga0075364_10269858 | 3300006051 | Bacteria | 1157 |
| 148 | Ga0075364_10376045 | 3300006051 | Bacteria | 969 |
| 149 | Ga0075364_10409067 | 3300006051 | Bacteria | 926 |
| 150 | Ga0070715_10016443 | 3300006163 | Bacteria | 2780 |
| 151 | Ga0070716_100050475 | 3300006173 | Bacteria | 2361 |
| 152 | Ga0070712_100006524 | 3300006175 | Bacteria | 7242 |
| 153 | Ga0070712_100063839 | 3300006175 | Bacteria | 2609 |
| 154 | Ga0070712_100230725 | 3300006175 | Bacteria | 1470 |
| 155 | Ga0075362_10013160 | 3300006177 | Bacteria | 3305 |
| 156 | Ga0075362_10042239 | 3300006177 | Bacteria | 2014 |
| 157 | Ga0075362_10068268 | 3300006177 | Bacteria | 1619 |
| 158 | Ga0075362_10099848 | 3300006177 | Bacteria | 1356 |
| 159 | Ga0075367_10025421 | 3300006178 | Bacteria | 3349 |
| 160 | Ga0075367_10048837 | 3300006178 | Bacteria | 2494 |
| 161 | Ga0075367_10255654 | 3300006178 | Bacteria | 1099 |
| 162 | Ga0075369_10000381 | 3300006186 | Bacteria | 13317 |
| 163 | Ga0075369_10001986 | 3300006186 | Bacteria | 7191 |
| 164 | Ga0075369_10004737 | 3300006186 | Bacteria | 5048 |
| 165 | Ga0075369_10007067 | 3300006186 | Bacteria | 4266 |
| 166 | Ga0075369_10007791 | 3300006186 | Bacteria | 4095 |
| 167 | Ga0075369_10040153 | 3300006186 | Bacteria | 1999 |
| 168 | Ga0075369_10141473 | 3300006186 | Bacteria | 1097 |
| 169 | Ga0097621_100718589 | 3300006237 | Bacteria | 921 |
| 170 | Ga0075370_10024235 | 3300006353 | Bacteria | 3350 |
| 171 | Ga0075370_10042419 | 3300006353 | Bacteria | 2570 |
| 172 | Ga0068871_100006999 | 3300006358 | Bacteria | 8035 |
| 173 | Ga0068871_100392941 | 3300006358 | Bacteria | 1234 |
| 174 | Ga0075428_100002516 | 3300006844 | Bacteria | 19930 |
| 175 | Ga0075428_100020103 | 3300006844 | Bacteria | 7394 |
| 176 | Ga0075430_100020143 | 3300006846 | Bacteria | 5676 |
| 177 | Ga0075430_100035979 | 3300006846 | Bacteria | 4199 |
| 178 | Ga0075430_100048475 | 3300006846 | Bacteria | 3587 |
| 179 | Ga0075430_100131711 | 3300006846 | Bacteria | 2084 |
| 180 | Ga0075430_100151102 | 3300006846 | Bacteria | 1934 |
| 181 | Ga0075431_100060250 | 3300006847 | Bacteria | 3916 |
| 182 | Ga0075431_100427287 | 3300006847 | Bacteria | 1323 |
| 183 | Ga0075429_100030723 | 3300006880 | Bacteria | 4666 |
| 184 | Ga0075429_100466140 | 3300006880 | Bacteria | 1107 |
| 185 | Ga0075429_100490897 | 3300006880 | Bacteria | 1076 |
| 186 | Ga0068865_100083772 | 3300006881 | Bacteria | 2296 |
| 187 | Ga0068865_100085968 | 3300006881 | Bacteria | 2270 |
| 188 | Ga0068865_100180145 | 3300006881 | Bacteria | 1627 |
| 189 | Ga0097620_100000867 | 3300006931 | Bacteria | 30844 |
| 190 | Ga0097620_100029064 | 3300006931 | Bacteria | 5546 |
| 191 | Ga0097620_100478651 | 3300006931 | Bacteria | 1340 |
| 192 | Ga0099826_10086676 | 3300006948 | Bacteria | 1929 |
| 193 | Ga0105244_10005185 | 3300009036 | Bacteria | 8725 |
| 194 | Ga0105244_10015932 | 3300009036 | Bacteria | 4299 |
| 195 | Ga0105245_10009665 | 3300009098 | Bacteria | 8411 |
| 196 | Ga0105245_10058238 | 3300009098 | Bacteria | 3477 |
| 197 | Ga0105245_10323041 | 3300009098 | Bacteria | 1521 |
| 198 | Ga0105245_10362002 | 3300009098 | Bacteria | 1440 |
| 199 | Ga0105245_10891233 | 3300009098 | Bacteria | 931 |
| 200 | Ga0105247_10101626 | 3300009101 | Bacteria | 1839 |
| 201 | Ga0114129_10004320 | 3300009147 | Bacteria | 20095 |
| 202 | Ga0114129_10014539 | 3300009147 | Bacteria | 11216 |
| 203 | Ga0114129_10172432 | 3300009147 | Bacteria | 2948 |
| 204 | Ga0114129_10407995 | 3300009147 | Bacteria | 1790 |
| 205 | Ga0114129_10614964 | 3300009147 | Bacteria | 1406 |
| 206 | Ga0105243_10004323 | 3300009148 | Bacteria | 11249 |
| 207 | Ga0105243_10004529 | 3300009148 | Bacteria | 10982 |
| 208 | Ga0105243_10093141 | 3300009148 | Bacteria | 2486 |
| 209 | Ga0105243_10892597 | 3300009148 | Bacteria | 884 |
| 210 | Ga0105241_10014318 | 3300009174 | Bacteria | 5807 |
| 211 | Ga0105241_10104527 | 3300009174 | Bacteria | 2256 |
| 212 | Ga0105242_10157271 | 3300009176 | Bacteria | 1986 |
| 213 | Ga0105242_10243691 | 3300009176 | Bacteria | 1617 |
| 214 | Ga0105242_10564876 | 3300009176 | Bacteria | 1093 |
| 215 | Ga0105248_10000025 | 3300009177 | Bacteria | 259691 |
| 216 | Ga0105248_10003456 | 3300009177 | Bacteria | 17545 |
| 217 | Ga0105248_10528758 | 3300009177 | Bacteria | 1330 |
| 218 | Ga0105237_10006529 | 3300009545 | Bacteria | 12910 |
| 219 | Ga0105237_10360807 | 3300009545 | Bacteria | 1457 |
| 220 | Ga0105238_10265581 | 3300009551 | Bacteria | 1696 |
| 221 | Ga0105249_10000021 | 3300009553 | Bacteria | 260448 |
| 222 | Ga0105249_10077260 | 3300009553 | Bacteria | 3087 |
| 223 | Ga0105249_10361994 | 3300009553 | Bacteria | 1472 |
| 224 | Ga0105239_10070022 | 3300010375 | Bacteria | 3853 |
| 225 | Ga0105239_10288452 | 3300010375 | Bacteria | 1848 |
| 226 | Ga0105239_10541030 | 3300010375 | Bacteria | 1326 |
| 227 | Ga0105239_10849758 | 3300010375 | Bacteria | 1047 |
| 228 | Ga0105239_10933318 | 3300010375 | Bacteria | 996 |
| 229 | Ga0105246_10079010 | 3300011119 | Bacteria | 2338 |
| 230 | Ga0105246_10108025 | 3300011119 | Bacteria | 2039 |
| 231 | Ga0105246_10137429 | 3300011119 | Bacteria | 1833 |
| 232 | Ga0157338_1006467 | 3300012515 | Bacteria | 1084 |
| 233 | Ga0157371_10246841 | 3300013102 | Bacteria | 1285 |
| 234 | Ga0157370_10200262 | 3300013104 | Bacteria | 1852 |
| 235 | Ga0157369_10134290 | 3300013105 | Bacteria | 2620 |
| 236 | Ga0157374_10111713 | 3300013296 | Bacteria | 2629 |
| 237 | Ga0157378_10014219 | 3300013297 | Bacteria | 6966 |
| 238 | Ga0157378_10449107 | 3300013297 | Bacteria | 1279 |
| 239 | Ga0163162_10066721 | 3300013306 | Bacteria | 3647 |
| 240 | Ga0163162_10110338 | 3300013306 | Bacteria | 2848 |
| 241 | Ga0163162_10354905 | 3300013306 | Bacteria | 1599 |
| 242 | Ga0163162_10382545 | 3300013306 | Bacteria | 1541 |
| 243 | Ga0163162_10448563 | 3300013306 | Bacteria | 1422 |
| 244 | Ga0157372_10035687 | 3300013307 | Bacteria | 5475 |
| 245 | Ga0157375_10003762 | 3300013308 | Bacteria | 13159 |
| 246 | Ga0157375_10312673 | 3300013308 | Bacteria | 1735 |
| 247 | Ga0157375_10715544 | 3300013308 | Bacteria | 1154 |
| 248 | Ga0163163_10015407 | 3300014325 | Bacteria | 7068 |
| 249 | Ga0163163_10018207 | 3300014325 | Bacteria | 6569 |
| 250 | Ga0163163_10342123 | 3300014325 | Bacteria | 1551 |
| 251 | Ga0163163_10391011 | 3300014325 | Bacteria | 1449 |
| 252 | Ga0163163_10479437 | 3300014325 | Bacteria | 1305 |
| 253 | Ga0157380_10121192 | 3300014326 | Bacteria | 2216 |
| 254 | Ga0157380_10177967 | 3300014326 | Bacteria | 1866 |
| 255 | Ga0157380_10804225 | 3300014326 | Bacteria | 957 |
| 256 | Ga0157377_10022444 | 3300014745 | Bacteria | 3332 |
| 257 | Ga0157377_10035677 | 3300014745 | Bacteria | 2729 |
| 258 | Ga0157379_10001172 | 3300014968 | Bacteria | 21361 |
| 259 | Ga0157379_10124378 | 3300014968 | Bacteria | 2320 |
| 260 | Ga0157379_10215443 | 3300014968 | Bacteria | 1739 |
| 261 | Ga0157379_10438257 | 3300014968 | Bacteria | 1205 |
| 262 | Ga0157379_10689100 | 3300014968 | Bacteria | 959 |
| 263 | Ga0206352_10967457 | 3300020078 | Bacteria | 970 |
| 264 | Ga0213876_10034862 | 3300021384 | Bacteria | 2654 |
| 265 | Ga0213876_10038664 | 3300021384 | Bacteria | 2519 |
| 266 | Ga0213875_10002224 | 3300021388 | Bacteria | 11796 |
| 267 | Ga0209673_1021879 | 3300025273 | Bacteria | 2223 |
| 268 | Ga0209051_1000190 | 3300025303 | Bacteria | 109110 |
| 269 | Ga0209051_1000693 | 3300025303 | Bacteria | 37100 |
| 270 | Ga0209051_1000725 | 3300025303 | Bacteria | 35828 |
| 271 | Ga0209051_1002406 | 3300025303 | Bacteria | 13458 |
| 272 | Ga0209051_1034664 | 3300025303 | Bacteria | 1889 |
| 273 | Ga0207655_1007799 | 3300025728 | Bacteria | 6894 |
| 274 | Ga0207655_1014667 | 3300025728 | Bacteria | 4411 |
| 275 | Ga0207692_10003418 | 3300025898 | Bacteria | 6203 |
| 276 | Ga0207642_10008059 | 3300025899 | Bacteria | 3594 |
| 277 | Ga0207710_10000033 | 3300025900 | Bacteria | 260531 |
| 278 | Ga0207710_10046464 | 3300025900 | Bacteria | 1939 |
| 279 | Ga0207710_10061099 | 3300025900 | Bacteria | 1709 |
| 280 | Ga0207710_10113236 | 3300025900 | Bacteria | 1290 |
| 281 | Ga0207688_10002229 | 3300025901 | Bacteria | 10445 |
| 282 | Ga0207688_10035709 | 3300025901 | Bacteria | 2754 |
| 283 | Ga0207647_10194870 | 3300025904 | Bacteria | 1173 |
| 284 | Ga0207699_10115492 | 3300025906 | Bacteria | 1727 |
| 285 | Ga0207645_10023312 | 3300025907 | Bacteria | 4023 |
| 286 | Ga0207645_10086954 | 3300025907 | Bacteria | 2008 |
| 287 | Ga0207643_10127464 | 3300025908 | Bacteria | 1512 |
| 288 | Ga0207654_10237538 | 3300025911 | Bacteria | 1216 |
| 289 | Ga0207671_10002173 | 3300025914 | Bacteria | 21320 |
| 290 | Ga0207671_10314568 | 3300025914 | Bacteria | 1238 |
| 291 | Ga0207693_10003117 | 3300025915 | Bacteria | 14272 |
| 292 | Ga0207663_10001631 | 3300025916 | Bacteria | 10572 |
| 293 | Ga0207657_10123816 | 3300025919 | Bacteria | 2125 |
| 294 | Ga0207652_10153880 | 3300025921 | Bacteria | 2060 |
| 295 | Ga0207681_10002372 | 3300025923 | Bacteria | 11975 |
| 296 | Ga0207681_10169727 | 3300025923 | Bacteria | 1653 |
| 297 | Ga0207694_10218514 | 3300025924 | Bacteria | 1554 |
| 298 | Ga0207650_10281526 | 3300025925 | Bacteria | 1354 |
| 299 | Ga0207687_10181182 | 3300025927 | Bacteria | 1632 |
| 300 | Ga0207700_10615960 | 3300025928 | Bacteria | 967 |
| 301 | Ga0207644_10002168 | 3300025931 | Bacteria | 12735 |
| 302 | Ga0207644_10035065 | 3300025931 | Bacteria | 3513 |
| 303 | Ga0207644_10326542 | 3300025931 | Bacteria | 1242 |
| 304 | Ga0207690_10032403 | 3300025932 | Bacteria | 3354 |
| 305 | Ga0207706_10100312 | 3300025933 | Bacteria | 2547 |
| 306 | Ga0207709_10003948 | 3300025935 | Bacteria | 8654 |
| 307 | Ga0207709_10203748 | 3300025935 | Bacteria | 1415 |
| 308 | Ga0207709_10245594 | 3300025935 | Bacteria | 1305 |
| 309 | Ga0207669_10109831 | 3300025937 | Bacteria | 1845 |
| 310 | Ga0207669_10134380 | 3300025937 | Bacteria | 1706 |
| 311 | Ga0207704_10107520 | 3300025938 | Bacteria | 1876 |
| 312 | Ga0207704_10431502 | 3300025938 | Bacteria | 1047 |
| 313 | Ga0207665_10012984 | 3300025939 | Bacteria | 5476 |
| 314 | Ga0207665_10015819 | 3300025939 | Bacteria | 4951 |
| 315 | Ga0207691_10168861 | 3300025940 | Bacteria | 1916 |
| 316 | Ga0207711_10000191 | 3300025941 | Bacteria | 65711 |
| 317 | Ga0207711_10029096 | 3300025941 | Bacteria | 4657 |
| 318 | Ga0207711_10233126 | 3300025941 | Bacteria | 1686 |
| 319 | Ga0207711_10328192 | 3300025941 | Bacteria | 1415 |
| 320 | Ga0207689_10005169 | 3300025942 | Bacteria | 11724 |
| 321 | Ga0207679_10189497 | 3300025945 | Bacteria | 1709 |
| 322 | Ga0207712_10000005 | 3300025961 | Bacteria | 608697 |
| 323 | Ga0207712_10080141 | 3300025961 | Bacteria | 2374 |
| 324 | Ga0207712_10330612 | 3300025961 | Bacteria | 1261 |
| 325 | Ga0207668_10001360 | 3300025972 | Bacteria | 14447 |
| 326 | Ga0207668_10002402 | 3300025972 | Bacteria | 10953 |
| 327 | Ga0207668_10217045 | 3300025972 | Bacteria | 1533 |
| 328 | Ga0207668_10633862 | 3300025972 | Bacteria | 934 |
| 329 | Ga0207640_10384887 | 3300025981 | Bacteria | 1138 |
| 330 | Ga0207658_10001110 | 3300025986 | Bacteria | 21726 |
| 331 | Ga0207658_10005823 | 3300025986 | Bacteria | 8431 |
| 332 | Ga0207658_10008274 | 3300025986 | Bacteria | 7084 |
| 333 | Ga0207658_10061324 | 3300025986 | Bacteria | 2810 |
| 334 | Ga0207658_10470539 | 3300025986 | Bacteria | 1115 |
| 335 | Ga0207677_10009273 | 3300026023 | Bacteria | 5530 |
| 336 | Ga0207677_10212658 | 3300026023 | Bacteria | 1545 |
| 337 | Ga0207677_10535593 | 3300026023 | Bacteria | 1018 |
| 338 | Ga0207677_10739125 | 3300026023 | Bacteria | 876 |
| 339 | Ga0207703_10053025 | 3300026035 | Bacteria | 3296 |
| 340 | Ga0207703_10058209 | 3300026035 | Bacteria | 3153 |
| 341 | Ga0207703_10220601 | 3300026035 | Bacteria | 1695 |
| 342 | Ga0207703_10601643 | 3300026035 | Bacteria | 1040 |
| 343 | Ga0207639_10102053 | 3300026041 | Bacteria | 2321 |
| 344 | Ga0207639_10472149 | 3300026041 | Bacteria | 1142 |
| 345 | Ga0207678_10043730 | 3300026067 | Bacteria | 3875 |
| 346 | Ga0207678_10070612 | 3300026067 | Bacteria | 2994 |
| 347 | Ga0207678_10229847 | 3300026067 | Bacteria | 1588 |
| 348 | Ga0207708_10026337 | 3300026075 | Bacteria | 4400 |
| 349 | Ga0207708_10429781 | 3300026075 | Bacteria | 1096 |
| 350 | Ga0207702_10632434 | 3300026078 | Bacteria | 1052 |
| 351 | Ga0207641_10002206 | 3300026088 | Bacteria | 18323 |
| 352 | Ga0207641_10373045 | 3300026088 | Bacteria | 1365 |
| 353 | Ga0207641_10520735 | 3300026088 | Bacteria | 1157 |
| 354 | Ga0207648_10118766 | 3300026089 | Bacteria | 2324 |
| 355 | Ga0207676_10011210 | 3300026095 | Bacteria | 6403 |
| 356 | Ga0207674_10095233 | 3300026116 | Bacteria | 2964 |
| 357 | Ga0207675_100035323 | 3300026118 | Bacteria | 4662 |
| 358 | Ga0207675_100063739 | 3300026118 | Bacteria | 3444 |
| 359 | Ga0207675_100091284 | 3300026118 | Bacteria | 2864 |
| 360 | Ga0207675_100327986 | 3300026118 | Bacteria | 1496 |
| 361 | Ga0207683_10000160 | 3300026121 | Bacteria | 56965 |
| 362 | Ga0207683_10007470 | 3300026121 | Bacteria | 9376 |
| 363 | Ga0207683_10037033 | 3300026121 | Bacteria | 4248 |
| 364 | Ga0207683_10063898 | 3300026121 | Bacteria | 3243 |
| 365 | Ga0207683_10959536 | 3300026121 | Bacteria | 794 |
| 366 | Ga0207698_10319502 | 3300026142 | Bacteria | 1453 |
| 367 | Ga0207698_11180228 | 3300026142 | Bacteria | 779 |
| 368 | Ga0268266_10002907 | 3300028379 | Bacteria | 17734 |
| 369 | Ga0268266_10040839 | 3300028379 | Bacteria | 3955 |
| 370 | Ga0268266_10042344 | 3300028379 | Bacteria | 3889 |
| 371 | Ga0268266_10087134 | 3300028379 | Bacteria | 2731 |
| 372 | Ga0268266_10120064 | 3300028379 | Bacteria | 2339 |
| 373 | Ga0268266_10844151 | 3300028379 | Bacteria | 885 |
| 374 | Ga0268265_10000022 | 3300028380 | Bacteria | 270788 |
| 375 | Ga0268265_10020901 | 3300028380 | Bacteria | 4575 |
| 376 | Ga0268265_10100729 | 3300028380 | Bacteria | 2332 |
| 377 | Ga0268265_10869981 | 3300028380 | Bacteria | 883 |
| 378 | Ga0268264_10000005 | 3300028381 | Bacteria | 934972 |
| 379 | Ga0268264_10094996 | 3300028381 | Bacteria | 2579 |
| 380 | Ga0268264_10838605 | 3300028381 | Bacteria | 920 |
| 381 | Ga0307511_10183889 | 3300030521 | Bacteria | 1120 |
| 382 | Ga0265327_10014002 | 3300031251 | Bacteria | 5282 |
| 383 | Ga0307513_10001160 | 3300031456 | Bacteria | 38156 |
| 384 | Ga0307513_10060663 | 3300031456 | Bacteria | 4009 |
| 385 | Ga0307513_10097160 | 3300031456 | Bacteria | 2981 |
| 386 | Ga0307508_10138971 | 3300031616 | Bacteria | 2032 |
| 387 | Ga0307405_10058632 | 3300031731 | Bacteria | 2424 |
| 388 | Ga0307405_10138482 | 3300031731 | Bacteria | 1693 |
| 389 | Ga0307413_10227624 | 3300031824 | Bacteria | 1367 |
| 390 | Ga0307518_10064274 | 3300031838 | Bacteria | 2663 |
| 391 | Ga0307410_10226850 | 3300031852 | Bacteria | 1440 |
| 392 | Ga0307406_10009162 | 3300031901 | Bacteria | 5545 |
| 393 | Ga0307406_10100407 | 3300031901 | Bacteria | 1970 |
| 394 | Ga0307406_10125006 | 3300031901 | Bacteria | 1795 |
| 395 | Ga0307412_10063159 | 3300031911 | Bacteria | 2497 |
| 396 | Ga0307412_10392886 | 3300031911 | Bacteria | 1127 |
| 397 | Ga0307409_100251289 | 3300031995 | Bacteria | 1617 |
| 398 | Ga0307409_100614315 | 3300031995 | Bacteria | 1076 |
| 399 | Ga0307416_100376484 | 3300032002 | Bacteria | 1448 |
| 400 | Ga0307416_100988889 | 3300032002 | Bacteria | 944 |
| 401 | Ga0307414_10268222 | 3300032004 | Bacteria | 1428 |
| 402 | Ga0307414_10375854 | 3300032004 | Bacteria | 1227 |
| 403 | Ga0307411_10090886 | 3300032005 | Bacteria | 2131 |
| 404 | Ga0307411_10431225 | 3300032005 | Bacteria | 1098 |
| 405 | Ga0307411_10862146 | 3300032005 | Bacteria | 802 |
| 406 | Ga0307415_100044164 | 3300032126 | Bacteria | 2978 |
| 407 | Ga0395905_0582312 | 3300037471 | Bacteria | 1021 |
| 408 | Ga0436364_0465034 | 3300037853 | Bacteria | 2054 |
| 409 | Ga0436364_1280826 | 3300037853 | Bacteria | 93394 |
| 410 | Ga0436364_1347497 | 3300037853 | Bacteria | 882 |
| 411 | Ga0436365_0252527 | 3300039437 | Bacteria | 12424 |
| 412 | Ga0436365_0762715 | 3300039437 | Bacteria | 1376 |
| 413 | Ga0436365_1856170 | 3300039437 | Bacteria | 22649 |
| 414 | Ga0439461_0007271 | 3300041410 | Bacteria | 1955 |
| 415 | Ga0439466_0020509 | 3300041411 | Bacteria | 2354 |
| 416 | Ga0439466_0083293 | 3300041411 | Bacteria | 1007 |
| 417 | Ga0439465_0005732 | 3300041413 | Bacteria | 3951 |
| 418 | Ga0451789_0844744 | 3300041443 | Bacteria | 1661 |
| 419 | Ga0451793_0271601 | 3300041452 | Bacteria | 1399 |
| 420 | Ga0451793_1697195 | 3300041452 | Bacteria | 966 |
| 421 | Ga0451795_1091017 | 3300041456 | Bacteria | 860 |
| 422 | Ga0451802_0474314 | 3300041460 | Bacteria | 923 |
| 423 | Ga0451802_1512295 | 3300041460 | Bacteria | 942 |
| 424 | Ga0451807_2442734 | 3300041486 | Bacteria | 1126 |
| 425 | Ga0451833_0770555 | 3300041491 | Bacteria | 1041 |
| 426 | Ga0451843_0980173 | 3300041509 | Bacteria | 1573 |
| 427 | Ga0451853_1208357 | 3300041512 | Bacteria | 948 |
| 428 | Ga0451853_1665339 | 3300041512 | Bacteria | 5029 |
| 429 | Ga0451853_3689334 | 3300041512 | Bacteria | 1368 |
| 430 | Ga0439431_0001990 | 3300041997 | Bacteria | 4532 |
| 431 | Ga0439431_0017671 | 3300041997 | Bacteria | 1680 |
| 432 | Ga0439448_0160361 | 3300042005 | Bacteria | 783 |
| 433 | Ga0439463_037417 | 3300042016 | Bacteria | 1231 |
| 434 | Ga0466972_0005782 | 3300044658 | Bacteria | 6196 |
| 435 | Ga0466972_0019669 | 3300044658 | Bacteria | 3376 |
| 436 | Ga0466972_0032942 | 3300044658 | Bacteria | 2542 |
| 437 | Ga0466972_0076784 | 3300044658 | Bacteria | 1591 |
| 438 | Ga0466972_0104701 | 3300044658 | Bacteria | 1338 |
| 439 | Ga0466965_0018193 | 3300044683 | Bacteria | 3366 |
| 440 | Ga0466965_0041423 | 3300044683 | Bacteria | 2269 |
| 441 | Ga0466966_0062794 | 3300044684 | Bacteria | 2341 |
| 442 | Ga0466961_0039199 | 3300044693 | Bacteria | 3037 |
| 443 | Ga0466963_0017958 | 3300044694 | Bacteria | 4414 |
| 444 | Ga0466963_0073965 | 3300044694 | Bacteria | 2298 |
| 445 | Ga0466971_0001826 | 3300044719 | Bacteria | 9036 |
| 446 | Ga0466971_0022328 | 3300044719 | Bacteria | 2819 |
| 447 | Ga0466971_0118868 | 3300044719 | Bacteria | 1223 |
| 448 | Ga0466968_0017421 | 3300044735 | Bacteria | 2872 |
| 449 | Ga0466970_0020001 | 3300044765 | Bacteria | 3474 |
| 450 | Ga0466970_0125340 | 3300044765 | Bacteria | 1408 |
| 451 | Ga0466957_0011403 | 3300044842 | Bacteria | 5128 |
| 452 | Ga0466957_0060934 | 3300044842 | Bacteria | 2315 |
| 453 | Ga0466957_0140131 | 3300044842 | Bacteria | 1557 |
| 454 | Ga0466957_0215489 | 3300044842 | Bacteria | 1266 |
| 455 | Ga0466957_0348185 | 3300044842 | Bacteria | 1005 |
| 456 | Ga0466960_0001499 | 3300044901 | Bacteria | 8503 |
| 457 | Ga0466960_0154651 | 3300044901 | Bacteria | 1228 |
| 458 | Ga0466959_0025132 | 3300045049 | Bacteria | 4411 |
| 459 | Ga0466959_0025884 | 3300045049 | Bacteria | 4351 |
| 460 | Ga0466959_0040772 | 3300045049 | Bacteria | 3430 |
| 461 | Ga0466958_0001217 | 3300045836 | Bacteria | 12017 |
| 462 | Ga0466958_0010486 | 3300045836 | Bacteria | 5192 |
| 463 | Ga0466958_0132789 | 3300045836 | Bacteria | 1564 |
| 464 | Ga0466958_0161001 | 3300045836 | Bacteria | 1418 |
| 465 | Ga0466967_0010866 | 3300045976 | Bacteria | 6859 |
| 466 | Ga0466967_0014333 | 3300045976 | Bacteria | 6170 |
| 467 | Ga0466967_0030441 | 3300045976 | Bacteria | 4530 |
| 468 | Ga0466967_0077103 | 3300045976 | Bacteria | 3000 |
| 469 | Ga0466967_0107631 | 3300045976 | Bacteria | 2557 |
| 470 | Ga0466967_0500853 | 3300045976 | Bacteria | 1192 |
| 471 | Ga0466967_0537036 | 3300045976 | Bacteria | 1150 |
| 472 | Ga0495627_000998 | 3300046453 | Bacteria | 19032 |
| 473 | Ga0495603_0006480 | 3300046455 | Bacteria | 7011 |
| 474 | Ga0495629_0209506 | 3300046459 | Bacteria | 1346 |
| 475 | Ga0495638_0008424 | 3300046460 | Bacteria | 7314 |
| 476 | Ga0495638_0221690 | 3300046460 | Bacteria | 1057 |
| 477 | Ga0495651_0116691 | 3300046462 | Bacteria | 1966 |
| 478 | Ga0495653_0156729 | 3300046463 | Bacteria | 1585 |
| 479 | Ga0495605_0133463 | 3300046474 | Bacteria | 1118 |
| 480 | Ga0495606_0053413 | 3300046507 | Bacteria | 2622 |
| 481 | Ga0495608_0070519 | 3300046511 | Bacteria | 2281 |
| 482 | Ga0495628_0401256 | 3300046516 | Bacteria | 1001 |
| 483 | Ga0495648_0021295 | 3300046524 | Bacteria | 4493 |
| 484 | Ga0495666_0052617 | 3300046526 | Bacteria | 1955 |
| 485 | Ga0495652_0186198 | 3300046529 | Bacteria | 1588 |
| 486 | Ga0495665_0298311 | 3300046531 | Bacteria | 825 |
| 487 | Ga0495668_0001279 | 3300046616 | Bacteria | 24933 |
| 488 | Ga0495625_0001034 | 3300046660 | Bacteria | 36610 |
| 489 | Ga0495588_0029968 | 3300046674 | Bacteria | 2733 |
| 490 | Ga0495599_0167394 | 3300046678 | Bacteria | 1357 |
| 491 | Ga0495670_0185363 | 3300046691 | Bacteria | 1100 |
| 492 | Ga0495589_0001435 | 3300046794 | Bacteria | 13752 |
| 493 | Ga0495589_0039182 | 3300046794 | Bacteria | 2369 |
| 494 | Ga0495581_0030301 | 3300047315 | Bacteria | 3135 |
| 495 | Ga0495674_0195508 | 3300047319 | Bacteria | 1680 |
| 496 | Ga0495672_0007097 | 3300047320 | Bacteria | 8492 |
| 497 | Ga0495676_0004801 | 3300047321 | Bacteria | 12381 |
| 498 | Ga0495676_0068064 | 3300047321 | Bacteria | 2752 |
| 499 | Ga0495683_0037628 | 3300047323 | Bacteria | 2452 |
| 500 | Ga0495685_003827 | 3300047447 | Bacteria | 4819 |
| 501 | Ga0495685_022095 | 3300047447 | Bacteria | 2189 |
| 502 | Ga0495686_0002701 | 3300047472 | Bacteria | 16248 |
| 503 | Ga0495686_0332197 | 3300047472 | Bacteria | 830 |
| 504 | Ga0495626_0000284 | 3300048091 | Bacteria | 55286 |
| 505 | Ga0496100_0000165 | 3300048903 | Bacteria | 36771 |
| 506 | Ga0496100_0000300 | 3300048903 | Bacteria | 24540 |
| 507 | Ga0496100_0011906 | 3300048903 | Bacteria | 4968 |
| 508 | Ga0496100_0031590 | 3300048903 | Bacteria | 3294 |
| 509 | Ga0496100_0083153 | 3300048903 | Bacteria | 2166 |
| 510 | Ga0496100_0256398 | 3300048903 | Bacteria | 1295 |
| 511 | Ga0496101_0000271 | 3300048904 | Bacteria | 36618 |
| 512 | Ga0496101_0000907 | 3300048904 | Bacteria | 17444 |
| 513 | Ga0496101_0005019 | 3300048904 | Bacteria | 8411 |
| 514 | Ga0496101_0012755 | 3300048904 | Bacteria | 5618 |
| 515 | Ga0496101_0040163 | 3300048904 | Bacteria | 3332 |
| 516 | Ga0496102_0000003 | 3300048905 | Bacteria | 592263 |
| 517 | Ga0496102_0002051 | 3300048905 | Bacteria | 17370 |
| 518 | Ga0496102_0003984 | 3300048905 | Bacteria | 12508 |
| 519 | Ga0496102_0013106 | 3300048905 | Bacteria | 7173 |
| 520 | Ga0496102_0021279 | 3300048905 | Bacteria | 5737 |
| 521 | Ga0496102_0037224 | 3300048905 | Bacteria | 4388 |
| 522 | Ga0496102_0039442 | 3300048905 | Bacteria | 4268 |
| 523 | Ga0496102_0058204 | 3300048905 | Bacteria | 3531 |
| 524 | Ga0496102_0062329 | 3300048905 | Bacteria | 3414 |
| 525 | Ga0496102_0075276 | 3300048905 | Bacteria | 3103 |
| 526 | Ga0496102_0149807 | 3300048905 | Bacteria | 2191 |
| 527 | Ga0496102_0156815 | 3300048905 | Bacteria | 2140 |
| 528 | Ga0496102_0205063 | 3300048905 | Bacteria | 1859 |
| 529 | Ga0496102_0481320 | 3300048905 | Bacteria | 1163 |
| 530 | Ga0496103_0000014 | 3300048906 | Bacteria | 290397 |
| 531 | Ga0496103_0000448 | 3300048906 | Bacteria | 35286 |
| 532 | Ga0496104_0010915 | 3300048907 | Bacteria | 8125 |
| 533 | Ga0496104_0015477 | 3300048907 | Bacteria | 6908 |
| 534 | Ga0496104_0319430 | 3300048907 | Bacteria | 1466 |
| 535 | Ga0496105_0030081 | 3300048908 | Bacteria | 4449 |
| 536 | Ga0496105_0048688 | 3300048908 | Bacteria | 3499 |
| 537 | Ga0496105_0162916 | 3300048908 | Bacteria | 1830 |
| 538 | Ga0496106_0001772 | 3300048909 | Bacteria | 16108 |
| 539 | Ga0496106_0037062 | 3300048909 | Bacteria | 3647 |
| 540 | Ga0496106_0039676 | 3300048909 | Bacteria | 3526 |
| 541 | Ga0496106_0048728 | 3300048909 | Bacteria | 3191 |
| 542 | Ga0496106_0280136 | 3300048909 | Bacteria | 1336 |
| 543 | Ga0496106_0562750 | 3300048909 | Bacteria | 914 |
| 544 | Ga0496107_0001116 | 3300048910 | Bacteria | 16176 |
| 545 | Ga0496107_0001983 | 3300048910 | Bacteria | 13031 |
| 546 | Ga0496107_0010772 | 3300048910 | Bacteria | 6358 |
| 547 | Ga0496107_0011107 | 3300048910 | Bacteria | 6265 |
| 548 | Ga0496107_0079939 | 3300048910 | Bacteria | 2384 |
| 549 | Ga0496107_0271433 | 3300048910 | Bacteria | 1262 |
| 550 | Ga0496107_0294006 | 3300048910 | Bacteria | 1209 |
| 551 | Ga0496107_0359836 | 3300048910 | Bacteria | 1083 |
| 552 | Ga0496108_0000189 | 3300048911 | Bacteria | 57428 |
| 553 | Ga0496108_0012474 | 3300048911 | Bacteria | 6920 |
| 554 | Ga0496108_0023886 | 3300048911 | Bacteria | 5032 |
| 555 | Ga0496108_0029354 | 3300048911 | Bacteria | 4553 |
| 556 | Ga0496108_0056365 | 3300048911 | Bacteria | 3302 |
| 557 | Ga0496108_0068049 | 3300048911 | Bacteria | 3004 |
| 558 | Ga0496109_0000622 | 3300048912 | Bacteria | 29557 |
| 559 | Ga0496109_0005792 | 3300048912 | Bacteria | 10342 |
| 560 | Ga0496109_0020653 | 3300048912 | Bacteria | 5818 |
| 561 | Ga0496109_0101201 | 3300048912 | Bacteria | 2674 |
| 562 | Ga0496109_0179896 | 3300048912 | Bacteria | 1986 |
| 563 | Ga0496109_0366530 | 3300048912 | Bacteria | 1361 |
| 564 | Ga0496109_1023840 | 3300048912 | Bacteria | 763 |
| 565 | Ga0496110_0000274 | 3300048913 | Bacteria | 33409 |
| 566 | Ga0496110_0077673 | 3300048913 | Bacteria | 2954 |
| 567 | Ga0496110_0095460 | 3300048913 | Bacteria | 2663 |
| 568 | Ga0496110_0354055 | 3300048913 | Bacteria | 1337 |
| 569 | Ga0496110_0384138 | 3300048913 | Bacteria | 1279 |
| 570 | Ga0496110_0523086 | 3300048913 | Bacteria | 1079 |
| 571 | Ga0496111_0007643 | 3300048914 | Bacteria | 7105 |
| 572 | Ga0496111_0010637 | 3300048914 | Bacteria | 6184 |
| 573 | Ga0496111_0050607 | 3300048914 | Bacteria | 2998 |
| 574 | Ga0496111_0156208 | 3300048914 | Bacteria | 1693 |
| 575 | Ga0496112_0006061 | 3300048915 | Bacteria | 10562 |
| 576 | Ga0496112_0009499 | 3300048915 | Bacteria | 8769 |
| 577 | Ga0496112_0047178 | 3300048915 | Bacteria | 4226 |
| 578 | Ga0496112_0087977 | 3300048915 | Bacteria | 3074 |
| 579 | Ga0496112_0096296 | 3300048915 | Bacteria | 2930 |
| 580 | Ga0496112_0133502 | 3300048915 | Bacteria | 2453 |
| 581 | Ga0496113_0033135 | 3300048916 | Bacteria | 3759 |
| 582 | Ga0496113_0058976 | 3300048916 | Bacteria | 2890 |
| 583 | Ga0496113_0073100 | 3300048916 | Bacteria | 2611 |
| 584 | Ga0496113_0114959 | 3300048916 | Bacteria | 2099 |
| 585 | Ga0496114_0000720 | 3300048917 | Bacteria | 24638 |
| 586 | Ga0496114_0001560 | 3300048917 | Bacteria | 17401 |
| 587 | Ga0496114_0096057 | 3300048917 | Bacteria | 2522 |
| 588 | Ga0496114_0158285 | 3300048917 | Bacteria | 1968 |
| 589 | Ga0496114_0674512 | 3300048917 | Bacteria | 908 |
| 590 | Ga0496114_0761232 | 3300048917 | Bacteria | 846 |
| 591 | Ga0496115_0001133 | 3300048918 | Bacteria | 19245 |
| 592 | Ga0496115_0197874 | 3300048918 | Bacteria | 1660 |
| 593 | Ga0496115_0308068 | 3300048918 | Bacteria | 1297 |
| 594 | Ga0496116_0000071 | 3300048919 | Bacteria | 244521 |
| 595 | Ga0496116_0203265 | 3300048919 | Bacteria | 1034 |
| 596 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 597 | Ga0496117_0000417 | 3300048920 | Bacteria | 71654 |
| 598 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 599 | Ga0496118_0000350 | 3300048921 | Bacteria | 78354 |
| 600 | Ga0496118_0003028 | 3300048921 | Bacteria | 21691 |
| 601 | Ga0496119_0001317 | 3300048922 | Bacteria | 30507 |
| 602 | Ga0496119_0030607 | 3300048922 | Bacteria | 3624 |
| 603 | Ga0496119_0068491 | 3300048922 | Bacteria | 2089 |
| 604 | Ga0496119_0141334 | 3300048922 | Bacteria | 1299 |
| 605 | Ga0496120_0000157 | 3300048923 | Bacteria | 112786 |
| 606 | Ga0496120_0062164 | 3300048923 | Bacteria | 2081 |
| 607 | Ga0496121_0000002 | 3300048924 | Bacteria | 1494588 |
| 608 | Ga0496121_0000019 | 3300048924 | Bacteria | 499976 |
| 609 | Ga0496121_0011044 | 3300048924 | Bacteria | 10080 |
| 610 | Ga0496121_0233623 | 3300048924 | Bacteria | 1286 |
| 611 | Ga0496122_0000141 | 3300048925 | Bacteria | 168707 |
| 612 | Ga0496122_0046509 | 3300048925 | Bacteria | 3360 |
| 613 | Ga0496123_0010483 | 3300048926 | Bacteria | 8186 |
| 614 | Ga0496123_0022614 | 3300048926 | Bacteria | 4839 |
| 615 | Ga0496124_0000002 | 3300048927 | Bacteria | 1494588 |
| 616 | Ga0496124_0167499 | 3300048927 | Bacteria | 1706 |
| 617 | Ga0496124_0293149 | 3300048927 | Bacteria | 1179 |
| 618 | Ga0496125_0000002 | 3300048928 | Bacteria | 1480920 |
| 619 | Ga0496125_0000550 | 3300048928 | Bacteria | 64700 |
| 620 | Ga0496125_0064123 | 3300048928 | Bacteria | 2923 |
| 621 | Ga0496125_0066385 | 3300048928 | Bacteria | 2851 |
| 622 | Ga0496126_0000011 | 3300048929 | Bacteria | 744275 |
| 623 | Ga0496126_0000186 | 3300048929 | Bacteria | 140016 |
| 624 | Ga0496126_0002515 | 3300048929 | Bacteria | 24558 |
| 625 | Ga0496126_0003203 | 3300048929 | Bacteria | 21005 |
| 626 | Ga0496126_0095149 | 3300048929 | Bacteria | 2613 |
| 627 | Ga0496126_0095493 | 3300048929 | Bacteria | 2608 |
| 628 | Ga0501031_0034909 | 3300049568 | Bacteria | 3281 |
| 629 | Ga0501032_0011209 | 3300049569 | Bacteria | 6438 |
| 630 | Ga0501032_0049351 | 3300049569 | Bacteria | 2839 |
| 631 | Ga0501032_0097299 | 3300049569 | Bacteria | 1951 |
| 632 | Ga0501032_0338668 | 3300049569 | Bacteria | 969 |
| 633 | Ga0501033_0025362 | 3300049570 | Bacteria | 4465 |
| 634 | Ga0501033_0075979 | 3300049570 | Bacteria | 2466 |
| 635 | Ga0501034_0004055 | 3300049571 | Bacteria | 16436 |
| 636 | Ga0501034_0051939 | 3300049571 | Bacteria | 4132 |
| 637 | Ga0501034_0310499 | 3300049571 | Bacteria | 1511 |
| 638 | Ga0501036_0004683 | 3300049572 | Bacteria | 11046 |
| 639 | Ga0501036_0110721 | 3300049572 | Bacteria | 2320 |
| 640 | Ga0501036_0123568 | 3300049572 | Bacteria | 2186 |
| 641 | Ga0501037_0000292 | 3300049573 | Bacteria | 42483 |
| 642 | Ga0501038_0000952 | 3300049574 | Bacteria | 25866 |
| 643 | Ga0501038_0002523 | 3300049574 | Bacteria | 17065 |
| 644 | Ga0501038_0038291 | 3300049574 | Bacteria | 4200 |
| 645 | Ga0501039_0001880 | 3300049575 | Bacteria | 15523 |
| 646 | Ga0501039_0162017 | 3300049575 | Bacteria | 1758 |
| 647 | Ga0501040_0155557 | 3300049576 | Bacteria | 1614 |
| 648 | Ga0501041_0158983 | 3300049577 | Bacteria | 1412 |
| 649 | Ga0501042_0122687 | 3300049578 | Bacteria | 1871 |
| 650 | Ga0501043_0001986 | 3300049579 | Bacteria | 17458 |
| 651 | Ga0501043_0212618 | 3300049579 | Bacteria | 1498 |
| 652 | Ga0501046_0010652 | 3300049580 | Bacteria | 7886 |
| 653 | Ga0501046_0340539 | 3300049580 | Bacteria | 1090 |
| 654 | Ga0501046_0398073 | 3300049580 | Bacteria | 995 |
| 655 | Ga0501047_0082890 | 3300049581 | Bacteria | 3082 |
| 656 | Ga0501047_0206095 | 3300049581 | Bacteria | 1826 |
| 657 | Ga0501048_0000654 | 3300049582 | Bacteria | 24940 |
| 658 | Ga0501048_0141360 | 3300049582 | Bacteria | 1702 |
| 659 | Ga0501070_0000383 | 3300049586 | Bacteria | 40471 |
| 660 | Ga0501070_0003679 | 3300049586 | Bacteria | 13251 |
| 661 | Ga0501070_0014417 | 3300049586 | Bacteria | 6651 |
| 662 | Ga0501070_0134080 | 3300049586 | Bacteria | 2045 |
| 663 | Ga0501071_0134426 | 3300049587 | Bacteria | 1839 |
| 664 | Ga0501072_0622375 | 3300049588 | Bacteria | 850 |
| 665 | Ga0501073_0024340 | 3300049589 | Bacteria | 4347 |
| 666 | Ga0501073_0036944 | 3300049589 | Bacteria | 3469 |
| 667 | Ga0501073_0101391 | 3300049589 | Bacteria | 1999 |
| 668 | Ga0501074_0065171 | 3300049590 | Bacteria | 2622 |
| 669 | Ga0501079_0117676 | 3300049741 | Bacteria | 2066 |
| 670 | Ga0501080_0001246 | 3300049742 | Bacteria | 21206 |
| 671 | Ga0501035_0000218 | 3300049822 | Bacteria | 68475 |
| 672 | Ga0501035_0120182 | 3300049822 | Bacteria | 2298 |
| 673 | Ga0501044_0000639 | 3300049823 | Bacteria | 42286 |
| 674 | Ga0501044_0062591 | 3300049823 | Bacteria | 3803 |
| 675 | Ga0501045_0050616 | 3300049824 | Bacteria | 3031 |
| 676 | nmdc:mga03683_48360_c1 | 3300050489 | Bacteria | 1767 |
| 677 | nmdc:mga03683_55725_c1 | 3300050489 | Bacteria | 1661 |
| 678 | nmdc:mga03683_59942_c1 | 3300050489 | Bacteria | 1606 |
| 679 | nmdc:mga03n38_104587_c1 | 3300050490 | Bacteria | 1370 |
| 680 | nmdc:mga03n38_1904_c1 | 3300050490 | Bacteria | 5060 |
| 681 | nmdc:mga03n38_5399_c1 | 3300050490 | Bacteria | 4348 |
| 682 | nmdc:mga00v17_1358_c1 | 3300050491 | Bacteria | 12808 |
| 683 | nmdc:mga00v17_16738_c1 | 3300050491 | Bacteria | 4135 |
| 684 | nmdc:mga00v17_222182_c1 | 3300050491 | Bacteria | 1223 |
| 685 | nmdc:mga00v17_25421_c1 | 3300050491 | Bacteria | 3442 |
| 686 | nmdc:mga00v17_59868_c1 | 3300050491 | Bacteria | 2338 |
| 687 | nmdc:mga00v17_614_c1 | 3300050491 | Bacteria | 19754 |
| 688 | nmdc:mga00v17_6949_c1 | 3300050491 | Bacteria | 6020 |
| 689 | nmdc:mga0yw44_13651_c1 | 3300050492 | Bacteria | 4284 |
| 690 | nmdc:mga0yw44_284096_c1 | 3300050492 | Bacteria | 1106 |
| 691 | nmdc:mga0yw44_327679_c1 | 3300050492 | Bacteria | 1029 |
| 692 | nmdc:mga0yw44_35043_c1 | 3300050492 | Bacteria | 2946 |
| 693 | nmdc:mga06z11_54460_c1 | 3300050494 | Bacteria | 2062 |
| 694 | nmdc:mga04h51_26834_c1 | 3300050495 | Bacteria | 1784 |
| 695 | nmdc:mga07m45_10508_c1 | 3300050496 | Bacteria | 4837 |
| 696 | nmdc:mga07m45_46292_c1 | 3300050496 | Bacteria | 2443 |
| 697 | nmdc:mga07m45_57198_c1 | 3300050496 | Bacteria | 2205 |
| 698 | nmdc:mga05p37_30733_c1 | 3300050507 | Bacteria | 6554 |
| 699 | nmdc:mga05p37_389200_c1 | 3300050507 | Bacteria | 1631 |
| 700 | nmdc:mga05p37_632364_c1 | 3300050507 | Bacteria | 1202 |
| 701 | nmdc:mga05p37_65844_c1 | 3300050507 | Bacteria | 4458 |
| 702 | nmdc:mga05p37_862331_c1 | 3300050507 | Bacteria | 982 |
| 703 | nmdc:mga09592_124470_c1 | 3300050508 | Bacteria | 2216 |
| 704 | nmdc:mga09592_86349_c1 | 3300050508 | Bacteria | 2677 |
| 705 | nmdc:mga0qj67_138849_c1 | 3300050509 | Bacteria | 1970 |
| 706 | nmdc:mga0qj67_230485_c1 | 3300050509 | Bacteria | 1503 |
| 707 | nmdc:mga0qj67_23836_c1 | 3300050509 | Bacteria | 4713 |
| 708 | nmdc:mga0qj67_24370_c1 | 3300050509 | Bacteria | 4663 |
| 709 | nmdc:mga0qj67_32097_c1 | 3300050509 | Bacteria | 4094 |
| 710 | nmdc:mga06r32_114004_c1 | 3300050510 | Bacteria | 2661 |
| 711 | nmdc:mga06r32_227930_c1 | 3300050510 | Bacteria | 1851 |
| 712 | nmdc:mga0rr50_532174_c1 | 3300050513 | Bacteria | 1000 |
| 713 | nmdc:mga0sz30_14113_c1 | 3300050516 | Bacteria | 3139 |
| 714 | nmdc:mga0sz30_15423_c1 | 3300050516 | Bacteria | 3020 |
| 715 | nmdc:mga0sz30_33149_c2 | 3300050516 | Bacteria | 1759 |
| 716 | nmdc:mga0sz30_3411_c2 | 3300050516 | Bacteria | 4668 |
| 717 | nmdc:mga0sz30_343_c1 | 3300050516 | Bacteria | 17800 |
| 718 | nmdc:mga0sz30_36412_c1 | 3300050516 | Bacteria | 2057 |
| 719 | nmdc:mga0sz30_70724_c2 | 3300050516 | Bacteria | 1096 |
| 720 | Ga0500635_0000622 | 3300053080 | Bacteria | 9253 |
| 721 | Ga0500643_002664 | 3300053087 | Bacteria | 8991 |
| 722 | Ga0500556_0004900 | 3300053104 | Bacteria | 3789 |
| 723 | Ga0500594_0080382 | 3300053118 | Bacteria | 974 |
| 724 | Ga0500608_174431 | 3300053122 | Bacteria | 918 |
| 725 | Ga0500642_0092562 | 3300053130 | Bacteria | 1399 |
| 726 | Ga0500652_002044 | 3300053131 | Bacteria | 6073 |
| 727 | Ga0500568_0000102 | 3300053139 | Bacteria | 78197 |
| 728 | Ga0500616_0004274 | 3300053153 | Bacteria | 10265 |
| 729 | Ga0500616_0004909 | 3300053153 | Bacteria | 9297 |
| 730 | Ga0500645_000361 | 3300053730 | Bacteria | 32453 |
| 731 | Ga0500645_009070 | 3300053730 | Bacteria | 3358 |
| 732 | Ga0501084_0008210 | 3300054114 | Bacteria | 8614 |
| 733 | Ga0587083_0041907 | 3300059505 | Bacteria | 963 |
| 734 | Ga0466962_0034609 | 3300061719 | Bacteria | 2418 |
| 735 | Ga0530510_0093912 | 3300061734 | Bacteria | 2191 |
| 736 | Ga0530510_0257557 | 3300061734 | Bacteria | 1301 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048918 | Ga0496115_0197874 | Ga0496115_0197874_61_678 | 193 |
| 2 | 3300048912 | Ga0496109_0020653 | Ga0496109_0020653_3625_4254 | 197 |
| 3 | 3300031456 | Ga0307513_10097160 | Ga0307513_100971604 | 211 |
| 4 | 3300014325 | Ga0163163_10015407 | Ga0163163_100154077 | 212 |
| 5 | 3300048907 | Ga0496104_0015477 | Ga0496104_0015477_438_1121 | 212 |
| 6 | 3300048913 | Ga0496110_0077673 | Ga0496110_0077673_1633_2316 | 212 |
| 7 | 3300041512 | Ga0451853_3689334 | Ga0451853_3689334_361_1029 | 213 |
| 8 | 3300013306 | Ga0163162_10354905 | Ga0163162_103549052 | 214 |
| 9 | 3300042005 | Ga0439448_0160361 | Ga0439448_0160361_14_685 | 214 |
| 10 | 3300048903 | Ga0496100_0256398 | Ga0496100_0256398_596_1279 | 214 |
| 11 | 3300048925 | Ga0496122_0046509 | Ga0496122_0046509_1415_2080 | 214 |
| 12 | 3300048928 | Ga0496125_0064123 | Ga0496125_0064123_109_783 | 214 |
| 13 | 3300050489 | nmdc:mga03683_55725_c1 | nmdc:mga03683_55725_c1_793_1464 | 214 |
| 14 | 3300050489 | nmdc:mga03683_59942_c1 | nmdc:mga03683_59942_c1_480_1142 | 214 |
| 15 | 3300050490 | nmdc:mga03n38_1904_c1 | nmdc:mga03n38_1904_c1_683_1345 | 214 |
| 16 | 3300050491 | nmdc:mga00v17_16738_c1 | nmdc:mga00v17_16738_c1_329_991 | 214 |
| 17 | 3300050491 | nmdc:mga00v17_59868_c1 | nmdc:mga00v17_59868_c1_606_1277 | 214 |
| 18 | 3300050496 | nmdc:mga07m45_10508_c1 | nmdc:mga07m45_10508_c1_1429_2091 | 214 |
| 19 | 3300050516 | nmdc:mga0sz30_36412_c1 | nmdc:mga0sz30_36412_c1_206_877 | 214 |
| 20 | 3300050516 | nmdc:mga0sz30_70724_c2 | nmdc:mga0sz30_70724_c2_274_966 | 214 |
| 21 | 3300049569 | Ga0501032_0049351 | Ga0501032_0049351_158_829 | 216 |
| 22 | 3300049822 | Ga0501035_0000218 | Ga0501035_0000218_11221_11892 | 216 |
| 23 | 3300049823 | Ga0501044_0000639 | Ga0501044_0000639_10963_11634 | 216 |
| 24 | iso_pu_bacteria | 2738541274 | 2738707486 | 216 |
| 25 | iso_pu_bacteria | 2738543028 | 2739333982 | 216 |
| 26 | iso_pu_bacteria | 2902799365 | 2902802300 | 216 |
| 27 | 3300005367 | Ga0070667_100102931 | Ga0070667_1001029312 | 217 |
| 28 | 3300009545 | Ga0105237_10360807 | Ga0105237_103608072 | 217 |
| 29 | 3300025986 | Ga0207658_10470539 | Ga0207658_104705392 | 217 |
| 30 | 3300046524 | Ga0495648_0021295 | Ga0495648_0021295_1583_2260 | 217 |
| 31 | 3300047320 | Ga0495672_0007097 | Ga0495672_0007097_7770_8447 | 217 |
| 32 | 3300049590 | Ga0501074_0065171 | Ga0501074_0065171_1913_2587 | 217 |
| 33 | iso_pu_bacteria | 2643221687 | 2644489934 | 217 |
| 34 | iso_pu_bacteria | 2643221715 | 2644638225 | 217 |
| 35 | iso_pu_bacteria | 2902792274 | 2902793304 | 217 |
| 36 | iso_pu_bacteria | 2902810491 | 2902812103 | 217 |
| 37 | iso_pu_bacteria | 2902837492 | 2902841559 | 217 |
| 38 | 3300042016 | Ga0439463_037417 | Ga0439463_037417_345_1055 | 218 |
| 39 | iso_pu_bacteria | 2643221647 | 2644267784 | 218 |
| 40 | iso_pu_bacteria | 2808606375 | 2808915731 | 218 |
| 41 | iso_pu_bacteria | 2867428634 | 2867431106 | 218 |
| 42 | iso_pu_bacteria | 2887443736 | 2887446236 | 218 |
| 43 | iso_pu_bacteria | 2895427314 | 2895433778 | 218 |
| 44 | iso_pu_bacteria | 2915358134 | 2915364587 | 218 |
| 45 | iso_pu_bacteria | 2946041624 | 2946045359 | 218 |
| 46 | iso_pu_bacteria | 2954711539 | 2954717022 | 218 |
| 47 | iso_pu_bacteria | 2954721474 | 2954726970 | 218 |
| 48 | iso_pu_bacteria | 2954731030 | 2954734812 | 218 |
| 49 | iso_pu_bacteria | 2954740390 | 2954745893 | 218 |
| 50 | iso_pu_bacteria | 2954749733 | 2954753697 | 218 |
| 51 | iso_pu_bacteria | 2954759201 | 2954764864 | 218 |
| 52 | iso_pu_bacteria | 8033684223 | 8033686083 | 218 |
| 53 | iso_pu_bacteria | 8054472261 | 8054477046 | 218 |
| 54 | 3300005347 | Ga0070668_100001949 | Ga0070668_1000019497 | 219 |
| 55 | 3300005467 | Ga0070706_100183293 | Ga0070706_1001832931 | 219 |
| 56 | 3300005548 | Ga0070665_100017687 | Ga0070665_1000176873 | 219 |
| 57 | 3300005844 | Ga0068862_100029018 | Ga0068862_1000290185 | 219 |
| 58 | 3300005937 | Ga0081455_10067379 | Ga0081455_100673794 | 219 |
| 59 | 3300005937 | Ga0081455_10095960 | Ga0081455_100959603 | 219 |
| 60 | 3300006051 | Ga0075364_10072421 | Ga0075364_100724211 | 219 |
| 61 | 3300006173 | Ga0070716_100050475 | Ga0070716_1000504752 | 219 |
| 62 | 3300006844 | Ga0075428_100020103 | Ga0075428_1000201033 | 219 |
| 63 | 3300006846 | Ga0075430_100048475 | Ga0075430_1000484755 | 219 |
| 64 | 3300006846 | Ga0075430_100131711 | Ga0075430_1001317113 | 219 |
| 65 | 3300006847 | Ga0075431_100060250 | Ga0075431_1000602501 | 219 |
| 66 | 3300006880 | Ga0075429_100030723 | Ga0075429_1000307236 | 219 |
| 67 | 3300006880 | Ga0075429_100490897 | Ga0075429_1004908971 | 219 |
| 68 | 3300009174 | Ga0105241_10014318 | Ga0105241_100143183 | 219 |
| 69 | 3300009176 | Ga0105242_10243691 | Ga0105242_102436912 | 219 |
| 70 | 3300013308 | Ga0157375_10312673 | Ga0157375_103126732 | 219 |
| 71 | 3300021384 | Ga0213876_10034862 | Ga0213876_100348622 | 219 |
| 72 | 3300025911 | Ga0207654_10237538 | Ga0207654_102375381 | 219 |
| 73 | 3300025939 | Ga0207665_10015819 | Ga0207665_100158191 | 219 |
| 74 | 3300025972 | Ga0207668_10002402 | Ga0207668_100024024 | 219 |
| 75 | 3300028379 | Ga0268266_10087134 | Ga0268266_100871341 | 219 |
| 76 | 3300028380 | Ga0268265_10020901 | Ga0268265_100209015 | 219 |
| 77 | 3300031731 | Ga0307405_10138482 | Ga0307405_101384821 | 219 |
| 78 | 3300031901 | Ga0307406_10100407 | Ga0307406_101004071 | 219 |
| 79 | 3300031901 | Ga0307406_10125006 | Ga0307406_101250061 | 219 |
| 80 | 3300031995 | Ga0307409_100614315 | Ga0307409_1006143152 | 219 |
| 81 | 3300032002 | Ga0307416_100376484 | Ga0307416_1003764842 | 219 |
| 82 | 3300032002 | Ga0307416_100988889 | Ga0307416_1009888891 | 219 |
| 83 | 3300032005 | Ga0307411_10431225 | Ga0307411_104312252 | 219 |
| 84 | 3300032126 | Ga0307415_100044164 | Ga0307415_1000441643 | 219 |
| 85 | 3300037853 | Ga0436364_0465034 | Ga0436364_0465034_370_1059 | 219 |
| 86 | 3300039437 | Ga0436365_0762715 | Ga0436365_0762715_618_1307 | 219 |
| 87 | 3300045049 | Ga0466959_0040772 | Ga0466959_0040772_1559_2233 | 219 |
| 88 | 3300048912 | Ga0496109_0366530 | Ga0496109_0366530_578_1291 | 219 |
| 89 | 3300050491 | nmdc:mga00v17_222182_c1 | nmdc:mga00v17_222182_c1_207_884 | 219 |
| 90 | iso_pu_bacteria | 2558860112 | 2558911847 | 219 |
| 91 | iso_pu_bacteria | 2738541264 | 2738664440 | 219 |
| 92 | iso_pu_bacteria | 2738541356 | 2739143575 | 219 |
| 93 | iso_pu_bacteria | 2808606306 | 2808629998 | 219 |
| 94 | iso_pu_bacteria | 2852663356 | 2852663936 | 219 |
| 95 | 3300005355 | Ga0070671_100001885 | Ga0070671_1000018857 | 220 |
| 96 | 3300005548 | Ga0070665_100000698 | Ga0070665_10000069811 | 220 |
| 97 | 3300005841 | Ga0068863_100540142 | Ga0068863_1005401422 | 220 |
| 98 | 3300005843 | Ga0068860_100901580 | Ga0068860_1009015801 | 220 |
| 99 | 3300006048 | Ga0075363_100207159 | Ga0075363_1002071592 | 220 |
| 100 | 3300006051 | Ga0075364_10036522 | Ga0075364_100365223 | 220 |
| 101 | 3300006186 | Ga0075369_10001986 | Ga0075369_100019866 | 220 |
| 102 | 3300006186 | Ga0075369_10141473 | Ga0075369_101414732 | 220 |
| 103 | 3300025914 | Ga0207671_10314568 | Ga0207671_103145682 | 220 |
| 104 | 3300025931 | Ga0207644_10002168 | Ga0207644_100021683 | 220 |
| 105 | 3300028379 | Ga0268266_10002907 | Ga0268266_100029072 | 220 |
| 106 | 3300028380 | Ga0268265_10869981 | Ga0268265_108699812 | 220 |
| 107 | 3300028381 | Ga0268264_10838605 | Ga0268264_108386051 | 220 |
| 108 | 3300031616 | Ga0307508_10138971 | Ga0307508_101389713 | 220 |
| 109 | 3300031838 | Ga0307518_10064274 | Ga0307518_100642744 | 220 |
| 110 | 3300045976 | Ga0466967_0030441 | Ga0466967_0030441_2966_3643 | 220 |
| 111 | 3300046460 | Ga0495638_0221690 | Ga0495638_0221690_240_932 | 220 |
| 112 | 3300048915 | Ga0496112_0133502 | Ga0496112_0133502_1361_2050 | 220 |
| 113 | 3300048916 | Ga0496113_0073100 | Ga0496113_0073100_531_1220 | 220 |
| 114 | 3300048918 | Ga0496115_0308068 | Ga0496115_0308068_456_1145 | 220 |
| 115 | 3300048924 | Ga0496121_0233623 | Ga0496121_0233623_91_783 | 220 |
| 116 | 3300048926 | Ga0496123_0022614 | Ga0496123_0022614_93_782 | 220 |
| 117 | 3300048927 | Ga0496124_0167499 | Ga0496124_0167499_493_1182 | 220 |
| 118 | 3300048929 | Ga0496126_0003203 | Ga0496126_0003203_12718_13407 | 220 |
| 119 | 3300048929 | Ga0496126_0095149 | Ga0496126_0095149_1239_1931 | 220 |
| 120 | 3300050516 | nmdc:mga0sz30_3411_c2 | nmdc:mga0sz30_3411_c2_700_1392 | 220 |
| 121 | 3300053122 | Ga0500608_174431 | Ga0500608_174431_48_740 | 220 |
| 122 | 3300053130 | Ga0500642_0092562 | Ga0500642_0092562_607_1290 | 220 |
| 123 | 3300053730 | Ga0500645_000361 | Ga0500645_000361_29285_29977 | 220 |
| 124 | 3300053730 | Ga0500645_009070 | Ga0500645_009070_463_1155 | 220 |
| 125 | iso_pu_bacteria | 2643221553 | 2643784996 | 220 |
| 126 | iso_pu_bacteria | 2643221724 | 2644680907 | 220 |
| 127 | iso_pu_bacteria | 2728369380 | 2730230660 | 220 |
| 128 | iso_pu_bacteria | 2747842429 | 2747955467 | 220 |
| 129 | iso_pu_bacteria | 2842134933 | 2842135414 | 220 |
| 130 | iso_pu_bacteria | 2848551377 | 2848554339 | 220 |
| 131 | iso_pu_bacteria | 2857723135 | 2857726245 | 220 |
| 132 | iso_pu_bacteria | 2862574272 | 2862574428 | 220 |
| 133 | 3300003792 | Ga0055540_1005754 | Ga0055540_10057544 | 221 |
| 134 | 3300005327 | Ga0070658_10005967 | Ga0070658_100059677 | 221 |
| 135 | 3300005327 | Ga0070658_10228389 | Ga0070658_102283892 | 221 |
| 136 | 3300005328 | Ga0070676_10211489 | Ga0070676_102114892 | 221 |
| 137 | 3300005330 | Ga0070690_100115387 | Ga0070690_1001153872 | 221 |
| 138 | 3300005331 | Ga0070670_100112808 | Ga0070670_1001128082 | 221 |
| 139 | 3300005335 | Ga0070666_10128195 | Ga0070666_101281953 | 221 |
| 140 | 3300005337 | Ga0070682_100010434 | Ga0070682_1000104346 | 221 |
| 141 | 3300005338 | Ga0068868_100182129 | Ga0068868_1001821291 | 221 |
| 142 | 3300005340 | Ga0070689_100555737 | Ga0070689_1005557372 | 221 |
| 143 | 3300005344 | Ga0070661_100033955 | Ga0070661_1000339553 | 221 |
| 144 | 3300005354 | Ga0070675_100401646 | Ga0070675_1004016462 | 221 |
| 145 | 3300005356 | Ga0070674_100198512 | Ga0070674_1001985122 | 221 |
| 146 | 3300005436 | Ga0070713_100166250 | Ga0070713_1001662503 | 221 |
| 147 | 3300005438 | Ga0070701_10123103 | Ga0070701_101231032 | 221 |
| 148 | 3300005441 | Ga0070700_100058360 | Ga0070700_1000583603 | 221 |
| 149 | 3300005455 | Ga0070663_100045323 | Ga0070663_1000453233 | 221 |
| 150 | 3300005455 | Ga0070663_100045684 | Ga0070663_1000456841 | 221 |
| 151 | 3300005456 | Ga0070678_100064536 | Ga0070678_1000645361 | 221 |
| 152 | 3300005459 | Ga0068867_100159583 | Ga0068867_1001595832 | 221 |
| 153 | 3300005466 | Ga0070685_10003055 | Ga0070685_100030553 | 221 |
| 154 | 3300005530 | Ga0070679_100500137 | Ga0070679_1005001372 | 221 |
| 155 | 3300005535 | Ga0070684_100486432 | Ga0070684_1004864322 | 221 |
| 156 | 3300005543 | Ga0070672_100140950 | Ga0070672_1001409502 | 221 |
| 157 | 3300005544 | Ga0070686_100346670 | Ga0070686_1003466702 | 221 |
| 158 | 3300005564 | Ga0070664_100220375 | Ga0070664_1002203752 | 221 |
| 159 | 3300005577 | Ga0068857_100037891 | Ga0068857_1000378913 | 221 |
| 160 | 3300005577 | Ga0068857_100548873 | Ga0068857_1005488732 | 221 |
| 161 | 3300005614 | Ga0068856_100142643 | Ga0068856_1001426433 | 221 |
| 162 | 3300005615 | Ga0070702_100237831 | Ga0070702_1002378311 | 221 |
| 163 | 3300005616 | Ga0068852_100142393 | Ga0068852_1001423932 | 221 |
| 164 | 3300005618 | Ga0068864_100059557 | Ga0068864_1000595573 | 221 |
| 165 | 3300005618 | Ga0068864_100073233 | Ga0068864_1000732333 | 221 |
| 166 | 3300005719 | Ga0068861_100003072 | Ga0068861_1000030725 | 221 |
| 167 | 3300005834 | Ga0068851_10058465 | Ga0068851_100584652 | 221 |
| 168 | 3300005842 | Ga0068858_100141870 | Ga0068858_1001418702 | 221 |
| 169 | 3300006028 | Ga0070717_10024663 | Ga0070717_100246632 | 221 |
| 170 | 3300006048 | Ga0075363_100300329 | Ga0075363_1003003291 | 221 |
| 171 | 3300006051 | Ga0075364_10409067 | Ga0075364_104090671 | 221 |
| 172 | 3300006237 | Ga0097621_100718589 | Ga0097621_1007185892 | 221 |
| 173 | 3300006881 | Ga0068865_100085968 | Ga0068865_1000859682 | 221 |
| 174 | 3300009098 | Ga0105245_10058238 | Ga0105245_100582383 | 221 |
| 175 | 3300009148 | Ga0105243_10892597 | Ga0105243_108925972 | 221 |
| 176 | 3300009176 | Ga0105242_10564876 | Ga0105242_105648762 | 221 |
| 177 | 3300011119 | Ga0105246_10108025 | Ga0105246_101080253 | 221 |
| 178 | 3300011119 | Ga0105246_10137429 | Ga0105246_101374293 | 221 |
| 179 | 3300013102 | Ga0157371_10246841 | Ga0157371_102468412 | 221 |
| 180 | 3300014326 | Ga0157380_10177967 | Ga0157380_101779673 | 221 |
| 181 | 3300014745 | Ga0157377_10035677 | Ga0157377_100356773 | 221 |
| 182 | 3300014968 | Ga0157379_10215443 | Ga0157379_102154432 | 221 |
| 183 | 3300020078 | Ga0206352_10967457 | Ga0206352_109674571 | 221 |
| 184 | 3300021384 | Ga0213876_10038664 | Ga0213876_100386642 | 221 |
| 185 | 3300025303 | Ga0209051_1000693 | Ga0209051_100069334 | 221 |
| 186 | 3300025303 | Ga0209051_1000725 | Ga0209051_100072535 | 221 |
| 187 | 3300025303 | Ga0209051_1034664 | Ga0209051_10346641 | 221 |
| 188 | 3300025899 | Ga0207642_10008059 | Ga0207642_100080591 | 221 |
| 189 | 3300025901 | Ga0207688_10035709 | Ga0207688_100357093 | 221 |
| 190 | 3300025904 | Ga0207647_10194870 | Ga0207647_101948702 | 221 |
| 191 | 3300025906 | Ga0207699_10115492 | Ga0207699_101154922 | 221 |
| 192 | 3300025907 | Ga0207645_10023312 | Ga0207645_100233124 | 221 |
| 193 | 3300025908 | Ga0207643_10127464 | Ga0207643_101274642 | 221 |
| 194 | 3300025921 | Ga0207652_10153880 | Ga0207652_101538803 | 221 |
| 195 | 3300025925 | Ga0207650_10281526 | Ga0207650_102815262 | 221 |
| 196 | 3300025931 | Ga0207644_10326542 | Ga0207644_103265421 | 221 |
| 197 | 3300025935 | Ga0207709_10245594 | Ga0207709_102455942 | 221 |
| 198 | 3300025938 | Ga0207704_10107520 | Ga0207704_101075203 | 221 |
| 199 | 3300025940 | Ga0207691_10168861 | Ga0207691_101688612 | 221 |
| 200 | 3300025941 | Ga0207711_10328192 | Ga0207711_103281923 | 221 |
| 201 | 3300025942 | Ga0207689_10005169 | Ga0207689_100051698 | 221 |
| 202 | 3300026023 | Ga0207677_10212658 | Ga0207677_102126582 | 221 |
| 203 | 3300026067 | Ga0207678_10070612 | Ga0207678_100706122 | 221 |
| 204 | 3300026075 | Ga0207708_10026337 | Ga0207708_100263372 | 221 |
| 205 | 3300026078 | Ga0207702_10632434 | Ga0207702_106324342 | 221 |
| 206 | 3300026088 | Ga0207641_10520735 | Ga0207641_105207351 | 221 |
| 207 | 3300026089 | Ga0207648_10118766 | Ga0207648_101187663 | 221 |
| 208 | 3300026116 | Ga0207674_10095233 | Ga0207674_100952332 | 221 |
| 209 | 3300026118 | Ga0207675_100035323 | Ga0207675_1000353233 | 221 |
| 210 | 3300026121 | Ga0207683_10037033 | Ga0207683_100370333 | 221 |
| 211 | 3300028380 | Ga0268265_10100729 | Ga0268265_101007293 | 221 |
| 212 | 3300031731 | Ga0307405_10058632 | Ga0307405_100586323 | 221 |
| 213 | 3300031824 | Ga0307413_10227624 | Ga0307413_102276243 | 221 |
| 214 | 3300032004 | Ga0307414_10375854 | Ga0307414_103758542 | 221 |
| 215 | 3300037471 | Ga0395905_0582312 | Ga0395905_0582312_127_819 | 221 |
| 216 | 3300039437 | Ga0436365_0252527 | Ga0436365_0252527_11086_11784 | 221 |
| 217 | 3300041411 | Ga0439466_0020509 | Ga0439466_0020509_967_1656 | 221 |
| 218 | 3300041411 | Ga0439466_0083293 | Ga0439466_0083293_235_924 | 221 |
| 219 | 3300041443 | Ga0451789_0844744 | Ga0451789_0844744_553_1233 | 221 |
| 220 | 3300041460 | Ga0451802_0474314 | Ga0451802_0474314_17_697 | 221 |
| 221 | 3300041997 | Ga0439431_0001990 | Ga0439431_0001990_548_1237 | 221 |
| 222 | 3300044658 | Ga0466972_0019669 | Ga0466972_0019669_1266_1979 | 221 |
| 223 | 3300044658 | Ga0466972_0076784 | Ga0466972_0076784_509_1198 | 221 |
| 224 | 3300046516 | Ga0495628_0401256 | Ga0495628_0401256_71_754 | 221 |
| 225 | 3300048905 | Ga0496102_0037224 | Ga0496102_0037224_2418_3107 | 221 |
| 226 | 3300048905 | Ga0496102_0039442 | Ga0496102_0039442_15_704 | 221 |
| 227 | 3300048907 | Ga0496104_0319430 | Ga0496104_0319430_776_1456 | 221 |
| 228 | 3300048910 | Ga0496107_0359836 | Ga0496107_0359836_325_1005 | 221 |
| 229 | 3300048912 | Ga0496109_0179896 | Ga0496109_0179896_751_1437 | 221 |
| 230 | 3300048913 | Ga0496110_0354055 | Ga0496110_0354055_460_1140 | 221 |
| 231 | 3300048921 | Ga0496118_0003028 | Ga0496118_0003028_17997_18686 | 221 |
| 232 | 3300049569 | Ga0501032_0011209 | Ga0501032_0011209_5670_6356 | 221 |
| 233 | 3300049571 | Ga0501034_0004055 | Ga0501034_0004055_1904_2590 | 221 |
| 234 | 3300049572 | Ga0501036_0110721 | Ga0501036_0110721_1592_2278 | 221 |
| 235 | 3300049573 | Ga0501037_0000292 | Ga0501037_0000292_32121_32807 | 221 |
| 236 | 3300049574 | Ga0501038_0002523 | Ga0501038_0002523_8092_8778 | 221 |
| 237 | 3300049575 | Ga0501039_0001880 | Ga0501039_0001880_4734_5420 | 221 |
| 238 | 3300049579 | Ga0501043_0001986 | Ga0501043_0001986_3604_4290 | 221 |
| 239 | 3300049586 | Ga0501070_0000383 | Ga0501070_0000383_13601_14287 | 221 |
| 240 | 3300049589 | Ga0501073_0024340 | Ga0501073_0024340_1696_2382 | 221 |
| 241 | 3300050513 | nmdc:mga0rr50_532174_c1 | nmdc:mga0rr50_532174_c1_55_738 | 221 |
| 242 | 3300050516 | nmdc:mga0sz30_33149_c2 | nmdc:mga0sz30_33149_c2_832_1533 | 221 |
| 243 | iso_pu_bacteria | 2868088558 | 2868091089 | 221 |
| 244 | iso_pu_bacteria | 2939582691 | 2939587781 | 221 |
| 245 | iso_pu_bacteria | 3002998708 | 3003001426 | 221 |
| 246 | 3300003792 | Ga0055540_1008491 | Ga0055540_10084913 | 222 |
| 247 | 3300005366 | Ga0070659_100573543 | Ga0070659_1005735431 | 222 |
| 248 | 3300005435 | Ga0070714_100066963 | Ga0070714_1000669634 | 222 |
| 249 | 3300005435 | Ga0070714_100198527 | Ga0070714_1001985272 | 222 |
| 250 | 3300005436 | Ga0070713_100278569 | Ga0070713_1002785692 | 222 |
| 251 | 3300005439 | Ga0070711_100057789 | Ga0070711_1000577891 | 222 |
| 252 | 3300005535 | Ga0070684_100677587 | Ga0070684_1006775871 | 222 |
| 253 | 3300005719 | Ga0068861_100769305 | Ga0068861_1007693051 | 222 |
| 254 | 3300006038 | Ga0075365_10043568 | Ga0075365_100435683 | 222 |
| 255 | 3300006038 | Ga0075365_10075228 | Ga0075365_100752282 | 222 |
| 256 | 3300006048 | Ga0075363_100113221 | Ga0075363_1001132213 | 222 |
| 257 | 3300006051 | Ga0075364_10167447 | Ga0075364_101674472 | 222 |
| 258 | 3300006175 | Ga0070712_100006524 | Ga0070712_1000065243 | 222 |
| 259 | 3300006177 | Ga0075362_10013160 | Ga0075362_100131603 | 222 |
| 260 | 3300006178 | Ga0075367_10025421 | Ga0075367_100254212 | 222 |
| 261 | 3300006186 | Ga0075369_10040153 | Ga0075369_100401532 | 222 |
| 262 | 3300006948 | Ga0099826_10086676 | Ga0099826_100866762 | 222 |
| 263 | 3300009098 | Ga0105245_10323041 | Ga0105245_103230411 | 222 |
| 264 | 3300009147 | Ga0114129_10014539 | Ga0114129_100145398 | 222 |
| 265 | 3300009147 | Ga0114129_10172432 | Ga0114129_101724322 | 222 |
| 266 | 3300010375 | Ga0105239_10849758 | Ga0105239_108497581 | 222 |
| 267 | 3300012515 | Ga0157338_1006467 | Ga0157338_10064671 | 222 |
| 268 | 3300013308 | Ga0157375_10715544 | Ga0157375_107155441 | 222 |
| 269 | 3300021388 | Ga0213875_10002224 | Ga0213875_1000222410 | 222 |
| 270 | 3300025273 | Ga0209673_1021879 | Ga0209673_10218793 | 222 |
| 271 | 3300025303 | Ga0209051_1002406 | Ga0209051_10024068 | 222 |
| 272 | 3300026067 | Ga0207678_10229847 | Ga0207678_102298472 | 222 |
| 273 | 3300026121 | Ga0207683_10959536 | Ga0207683_109595361 | 222 |
| 274 | 3300030521 | Ga0307511_10183889 | Ga0307511_101838891 | 222 |
| 275 | 3300032005 | Ga0307411_10090886 | Ga0307411_100908862 | 222 |
| 276 | 3300037853 | Ga0436364_1280826 | Ga0436364_1280826_83342_84028 | 222 |
| 277 | 3300041452 | Ga0451793_1697195 | Ga0451793_1697195_89_808 | 222 |
| 278 | 3300041456 | Ga0451795_1091017 | Ga0451795_1091017_137_823 | 222 |
| 279 | 3300041512 | Ga0451853_1208357 | Ga0451853_1208357_164_850 | 222 |
| 280 | 3300044658 | Ga0466972_0005782 | Ga0466972_0005782_5120_5830 | 222 |
| 281 | 3300044683 | Ga0466965_0018193 | Ga0466965_0018193_1740_2429 | 222 |
| 282 | 3300044842 | Ga0466957_0011403 | Ga0466957_0011403_2289_2999 | 222 |
| 283 | 3300045049 | Ga0466959_0025132 | Ga0466959_0025132_3086_3796 | 222 |
| 284 | 3300045976 | Ga0466967_0010866 | Ga0466967_0010866_5005_5715 | 222 |
| 285 | 3300046455 | Ga0495603_0006480 | Ga0495603_0006480_4667_5359 | 222 |
| 286 | 3300046459 | Ga0495629_0209506 | Ga0495629_0209506_632_1324 | 222 |
| 287 | 3300046474 | Ga0495605_0133463 | Ga0495605_0133463_305_997 | 222 |
| 288 | 3300046526 | Ga0495666_0052617 | Ga0495666_0052617_44_733 | 222 |
| 289 | 3300046529 | Ga0495652_0186198 | Ga0495652_0186198_486_1172 | 222 |
| 290 | 3300046616 | Ga0495668_0001279 | Ga0495668_0001279_170_856 | 222 |
| 291 | 3300046660 | Ga0495625_0001034 | Ga0495625_0001034_28993_29679 | 222 |
| 292 | 3300046678 | Ga0495599_0167394 | Ga0495599_0167394_645_1331 | 222 |
| 293 | 3300046691 | Ga0495670_0185363 | Ga0495670_0185363_324_1016 | 222 |
| 294 | 3300046794 | Ga0495589_0001435 | Ga0495589_0001435_8015_8707 | 222 |
| 295 | 3300046794 | Ga0495589_0039182 | Ga0495589_0039182_1576_2268 | 222 |
| 296 | 3300047321 | Ga0495676_0004801 | Ga0495676_0004801_291_983 | 222 |
| 297 | 3300047321 | Ga0495676_0068064 | Ga0495676_0068064_857_1549 | 222 |
| 298 | 3300047323 | Ga0495683_0037628 | Ga0495683_0037628_1653_2339 | 222 |
| 299 | 3300047447 | Ga0495685_003827 | Ga0495685_003827_155_847 | 222 |
| 300 | 3300047447 | Ga0495685_022095 | Ga0495685_022095_85_777 | 222 |
| 301 | 3300047472 | Ga0495686_0332197 | Ga0495686_0332197_13_708 | 222 |
| 302 | 3300048091 | Ga0495626_0000284 | Ga0495626_0000284_54431_55117 | 222 |
| 303 | 3300048912 | Ga0496109_1023840 | Ga0496109_1023840_33_716 | 222 |
| 304 | 3300048913 | Ga0496110_0523086 | Ga0496110_0523086_368_1051 | 222 |
| 305 | 3300048914 | Ga0496111_0156208 | Ga0496111_0156208_419_1102 | 222 |
| 306 | 3300048929 | Ga0496126_0095493 | Ga0496126_0095493_884_1570 | 222 |
| 307 | 3300049572 | Ga0501036_0004683 | Ga0501036_0004683_6667_7362 | 222 |
| 308 | 3300049574 | Ga0501038_0038291 | Ga0501038_0038291_2158_2853 | 222 |
| 309 | 3300049580 | Ga0501046_0398073 | Ga0501046_0398073_19_717 | 222 |
| 310 | 3300049581 | Ga0501047_0206095 | Ga0501047_0206095_1039_1725 | 222 |
| 311 | 3300050489 | nmdc:mga03683_48360_c1 | nmdc:mga03683_48360_c1_469_1155 | 222 |
| 312 | 3300050491 | nmdc:mga00v17_6949_c1 | nmdc:mga00v17_6949_c1_1071_1757 | 222 |
| 313 | 3300050492 | nmdc:mga0yw44_13651_c1 | nmdc:mga0yw44_13651_c1_967_1653 | 222 |
| 314 | 3300050492 | nmdc:mga0yw44_284096_c1 | nmdc:mga0yw44_284096_c1_91_774 | 222 |
| 315 | 3300050492 | nmdc:mga0yw44_35043_c1 | nmdc:mga0yw44_35043_c1_1745_2446 | 222 |
| 316 | 3300050494 | nmdc:mga06z11_54460_c1 | nmdc:mga06z11_54460_c1_876_1562 | 222 |
| 317 | 3300050495 | nmdc:mga04h51_26834_c1 | nmdc:mga04h51_26834_c1_1077_1763 | 222 |
| 318 | 3300050507 | nmdc:mga05p37_65844_c1 | nmdc:mga05p37_65844_c1_1201_1893 | 222 |
| 319 | 3300050508 | nmdc:mga09592_124470_c1 | nmdc:mga09592_124470_c1_250_942 | 222 |
| 320 | 3300050509 | nmdc:mga0qj67_138849_c1 | nmdc:mga0qj67_138849_c1_256_948 | 222 |
| 321 | 3300050509 | nmdc:mga0qj67_23836_c1 | nmdc:mga0qj67_23836_c1_3094_3786 | 222 |
| 322 | 3300053139 | Ga0500568_0000102 | Ga0500568_0000102_35728_36456 | 222 |
| 323 | 3300059505 | Ga0587083_0041907 | Ga0587083_0041907_242_937 | 222 |
| 324 | iso_pu_bacteria | 2883821847 | 2883824942 | 222 |
| 325 | 3300003792 | Ga0055540_1000082 | Ga0055540_100008229 | 223 |
| 326 | 3300005329 | Ga0070683_100505930 | Ga0070683_1005059301 | 223 |
| 327 | 3300005334 | Ga0068869_100759336 | Ga0068869_1007593361 | 223 |
| 328 | 3300005337 | Ga0070682_100002000 | Ga0070682_1000020003 | 223 |
| 329 | 3300005367 | Ga0070667_100001225 | Ga0070667_1000012253 | 223 |
| 330 | 3300005367 | Ga0070667_100023395 | Ga0070667_1000233952 | 223 |
| 331 | 3300005367 | Ga0070667_100446470 | Ga0070667_1004464702 | 223 |
| 332 | 3300005455 | Ga0070663_100426907 | Ga0070663_1004269072 | 223 |
| 333 | 3300005544 | Ga0070686_100189586 | Ga0070686_1001895862 | 223 |
| 334 | 3300005548 | Ga0070665_100002795 | Ga0070665_1000027957 | 223 |
| 335 | 3300005616 | Ga0068852_100145080 | Ga0068852_1001450802 | 223 |
| 336 | 3300005841 | Ga0068863_100361270 | Ga0068863_1003612702 | 223 |
| 337 | 3300005842 | Ga0068858_100694559 | Ga0068858_1006945592 | 223 |
| 338 | 3300005981 | Ga0081538_10166297 | Ga0081538_101662971 | 223 |
| 339 | 3300006048 | Ga0075363_100000340 | Ga0075363_1000003403 | 223 |
| 340 | 3300006177 | Ga0075362_10099848 | Ga0075362_100998481 | 223 |
| 341 | 3300006353 | Ga0075370_10042419 | Ga0075370_100424192 | 223 |
| 342 | 3300009036 | Ga0105244_10005185 | Ga0105244_100051857 | 223 |
| 343 | 3300009036 | Ga0105244_10015932 | Ga0105244_100159322 | 223 |
| 344 | 3300009098 | Ga0105245_10362002 | Ga0105245_103620022 | 223 |
| 345 | 3300009098 | Ga0105245_10891233 | Ga0105245_108912331 | 223 |
| 346 | 3300009148 | Ga0105243_10004529 | Ga0105243_100045297 | 223 |
| 347 | 3300009553 | Ga0105249_10361994 | Ga0105249_103619942 | 223 |
| 348 | 3300010375 | Ga0105239_10070022 | Ga0105239_100700226 | 223 |
| 349 | 3300010375 | Ga0105239_10541030 | Ga0105239_105410302 | 223 |
| 350 | 3300010375 | Ga0105239_10933318 | Ga0105239_109333182 | 223 |
| 351 | 3300013104 | Ga0157370_10200262 | Ga0157370_102002622 | 223 |
| 352 | 3300014325 | Ga0163163_10391011 | Ga0163163_103910112 | 223 |
| 353 | 3300014968 | Ga0157379_10689100 | Ga0157379_106891002 | 223 |
| 354 | 3300025303 | Ga0209051_1000190 | Ga0209051_100019081 | 223 |
| 355 | 3300025728 | Ga0207655_1007799 | Ga0207655_10077995 | 223 |
| 356 | 3300025728 | Ga0207655_1014667 | Ga0207655_10146676 | 223 |
| 357 | 3300025927 | Ga0207687_10181182 | Ga0207687_101811821 | 223 |
| 358 | 3300025931 | Ga0207644_10035065 | Ga0207644_100350654 | 223 |
| 359 | 3300025935 | Ga0207709_10003948 | Ga0207709_100039487 | 223 |
| 360 | 3300025945 | Ga0207679_10189497 | Ga0207679_101894972 | 223 |
| 361 | 3300025986 | Ga0207658_10005823 | Ga0207658_100058231 | 223 |
| 362 | 3300025986 | Ga0207658_10008274 | Ga0207658_100082743 | 223 |
| 363 | 3300026035 | Ga0207703_10220601 | Ga0207703_102206012 | 223 |
| 364 | 3300026035 | Ga0207703_10601643 | Ga0207703_106016432 | 223 |
| 365 | 3300026041 | Ga0207639_10472149 | Ga0207639_104721491 | 223 |
| 366 | 3300026067 | Ga0207678_10043730 | Ga0207678_100437303 | 223 |
| 367 | 3300028379 | Ga0268266_10042344 | Ga0268266_100423444 | 223 |
| 368 | 3300031251 | Ga0265327_10014002 | Ga0265327_100140025 | 223 |
| 369 | 3300031901 | Ga0307406_10009162 | Ga0307406_100091622 | 223 |
| 370 | 3300031911 | Ga0307412_10063159 | Ga0307412_100631592 | 223 |
| 371 | 3300032004 | Ga0307414_10268222 | Ga0307414_102682222 | 223 |
| 372 | 3300037853 | Ga0436364_1347497 | Ga0436364_1347497_178_870 | 223 |
| 373 | 3300041509 | Ga0451843_0980173 | Ga0451843_0980173_468_1163 | 223 |
| 374 | 3300044842 | Ga0466957_0348185 | Ga0466957_0348185_98_796 | 223 |
| 375 | 3300045976 | Ga0466967_0077103 | Ga0466967_0077103_1586_2293 | 223 |
| 376 | 3300045976 | Ga0466967_0107631 | Ga0466967_0107631_885_1592 | 223 |
| 377 | 3300046453 | Ga0495627_000998 | Ga0495627_000998_3630_4325 | 223 |
| 378 | 3300048903 | Ga0496100_0000165 | Ga0496100_0000165_25360_26067 | 223 |
| 379 | 3300048904 | Ga0496101_0000271 | Ga0496101_0000271_25356_26063 | 223 |
| 380 | 3300048905 | Ga0496102_0003984 | Ga0496102_0003984_1268_1975 | 223 |
| 381 | 3300048905 | Ga0496102_0481320 | Ga0496102_0481320_417_1103 | 223 |
| 382 | 3300048909 | Ga0496106_0001772 | Ga0496106_0001772_6873_7580 | 223 |
| 383 | 3300048909 | Ga0496106_0280136 | Ga0496106_0280136_363_1049 | 223 |
| 384 | 3300048910 | Ga0496107_0001116 | Ga0496107_0001116_12722_13429 | 223 |
| 385 | 3300048911 | Ga0496108_0012474 | Ga0496108_0012474_2899_3600 | 223 |
| 386 | 3300048911 | Ga0496108_0023886 | Ga0496108_0023886_2385_3071 | 223 |
| 387 | 3300048911 | Ga0496108_0029354 | Ga0496108_0029354_33_740 | 223 |
| 388 | 3300048912 | Ga0496109_0000622 | Ga0496109_0000622_10459_11166 | 223 |
| 389 | 3300048912 | Ga0496109_0005792 | Ga0496109_0005792_3460_4146 | 223 |
| 390 | 3300048913 | Ga0496110_0000274 | Ga0496110_0000274_10514_11221 | 223 |
| 391 | 3300048914 | Ga0496111_0007643 | Ga0496111_0007643_2818_3525 | 223 |
| 392 | 3300048915 | Ga0496112_0006061 | Ga0496112_0006061_3158_3844 | 223 |
| 393 | 3300048915 | Ga0496112_0047178 | Ga0496112_0047178_1169_1855 | 223 |
| 394 | 3300048917 | Ga0496114_0001560 | Ga0496114_0001560_6147_6854 | 223 |
| 395 | 3300048917 | Ga0496114_0674512 | Ga0496114_0674512_152_838 | 223 |
| 396 | 3300048922 | Ga0496119_0030607 | Ga0496119_0030607_1803_2510 | 223 |
| 397 | 3300048924 | Ga0496121_0000002 | Ga0496121_0000002_1038562_1039269 | 223 |
| 398 | 3300048925 | Ga0496122_0000141 | Ga0496122_0000141_54806_55513 | 223 |
| 399 | 3300048926 | Ga0496123_0010483 | Ga0496123_0010483_4748_5455 | 223 |
| 400 | 3300048927 | Ga0496124_0000002 | Ga0496124_0000002_455320_456027 | 223 |
| 401 | 3300048928 | Ga0496125_0000002 | Ga0496125_0000002_1038562_1039269 | 223 |
| 402 | 3300048928 | Ga0496125_0000550 | Ga0496125_0000550_46834_47526 | 223 |
| 403 | 3300048929 | Ga0496126_0000011 | Ga0496126_0000011_455320_456027 | 223 |
| 404 | 3300049586 | Ga0501070_0014417 | Ga0501070_0014417_2984_3685 | 223 |
| 405 | 3300050496 | nmdc:mga07m45_46292_c1 | nmdc:mga07m45_46292_c1_1702_2406 | 223 |
| 406 | 3300061734 | Ga0530510_0093912 | Ga0530510_0093912_1207_1896 | 223 |
| 407 | iso_pu_bacteria | 2929212328 | 2929214557 | 223 |
| 408 | 3300005435 | Ga0070714_100243408 | Ga0070714_1002434082 | 224 |
| 409 | 3300006028 | Ga0070717_10383315 | Ga0070717_103833152 | 224 |
| 410 | 3300006048 | Ga0075363_100001062 | Ga0075363_1000010626 | 224 |
| 411 | 3300006051 | Ga0075364_10018919 | Ga0075364_100189197 | 224 |
| 412 | 3300006051 | Ga0075364_10020145 | Ga0075364_100201454 | 224 |
| 413 | 3300006178 | Ga0075367_10048837 | Ga0075367_100488374 | 224 |
| 414 | 3300006186 | Ga0075369_10007791 | Ga0075369_100077914 | 224 |
| 415 | 3300013105 | Ga0157369_10134290 | Ga0157369_101342904 | 224 |
| 416 | 3300013307 | Ga0157372_10035687 | Ga0157372_100356875 | 224 |
| 417 | 3300028381 | Ga0268264_10094996 | Ga0268264_100949962 | 224 |
| 418 | 3300044658 | Ga0466972_0032942 | Ga0466972_0032942_253_942 | 224 |
| 419 | 3300044683 | Ga0466965_0041423 | Ga0466965_0041423_965_1654 | 224 |
| 420 | 3300044684 | Ga0466966_0062794 | Ga0466966_0062794_400_1089 | 224 |
| 421 | 3300044693 | Ga0466961_0039199 | Ga0466961_0039199_1769_2458 | 224 |
| 422 | 3300044694 | Ga0466963_0017958 | Ga0466963_0017958_1794_2501 | 224 |
| 423 | 3300044694 | Ga0466963_0073965 | Ga0466963_0073965_531_1355 | 224 |
| 424 | 3300044719 | Ga0466971_0001826 | Ga0466971_0001826_2675_3373 | 224 |
| 425 | 3300044719 | Ga0466971_0022328 | Ga0466971_0022328_1119_1808 | 224 |
| 426 | 3300044719 | Ga0466971_0118868 | Ga0466971_0118868_398_1105 | 224 |
| 427 | 3300044735 | Ga0466968_0017421 | Ga0466968_0017421_1273_1962 | 224 |
| 428 | 3300044765 | Ga0466970_0020001 | Ga0466970_0020001_696_1385 | 224 |
| 429 | 3300044842 | Ga0466957_0140131 | Ga0466957_0140131_371_1078 | 224 |
| 430 | 3300044842 | Ga0466957_0215489 | Ga0466957_0215489_208_969 | 224 |
| 431 | 3300044901 | Ga0466960_0001499 | Ga0466960_0001499_176_883 | 224 |
| 432 | 3300045049 | Ga0466959_0025884 | Ga0466959_0025884_2455_3219 | 224 |
| 433 | 3300045836 | Ga0466958_0001217 | Ga0466958_0001217_11301_11999 | 224 |
| 434 | 3300045836 | Ga0466958_0010486 | Ga0466958_0010486_4401_5090 | 224 |
| 435 | 3300045836 | Ga0466958_0132789 | Ga0466958_0132789_711_1409 | 224 |
| 436 | 3300045836 | Ga0466958_0161001 | Ga0466958_0161001_611_1318 | 224 |
| 437 | 3300045976 | Ga0466967_0014333 | Ga0466967_0014333_4618_5325 | 224 |
| 438 | 3300048903 | Ga0496100_0011906 | Ga0496100_0011906_323_1015 | 224 |
| 439 | 3300048904 | Ga0496101_0005019 | Ga0496101_0005019_3398_4090 | 224 |
| 440 | 3300048905 | Ga0496102_0058204 | Ga0496102_0058204_1844_2554 | 224 |
| 441 | 3300048908 | Ga0496105_0162916 | Ga0496105_0162916_36_728 | 224 |
| 442 | 3300048910 | Ga0496107_0011107 | Ga0496107_0011107_1300_1992 | 224 |
| 443 | 3300048911 | Ga0496108_0056365 | Ga0496108_0056365_16_708 | 224 |
| 444 | 3300048913 | Ga0496110_0095460 | Ga0496110_0095460_1583_2275 | 224 |
| 445 | 3300048914 | Ga0496111_0010637 | Ga0496111_0010637_3130_3822 | 224 |
| 446 | 3300048915 | Ga0496112_0087977 | Ga0496112_0087977_1633_2325 | 224 |
| 447 | 3300048916 | Ga0496113_0033135 | Ga0496113_0033135_2308_3000 | 224 |
| 448 | 3300048917 | Ga0496114_0096057 | Ga0496114_0096057_1569_2261 | 224 |
| 449 | 3300048922 | Ga0496119_0068491 | Ga0496119_0068491_948_1640 | 224 |
| 450 | 3300048929 | Ga0496126_0002515 | Ga0496126_0002515_19138_19830 | 224 |
| 451 | 3300049569 | Ga0501032_0097299 | Ga0501032_0097299_1223_1927 | 224 |
| 452 | 3300049571 | Ga0501034_0051939 | Ga0501034_0051939_818_1522 | 224 |
| 453 | 3300049580 | Ga0501046_0010652 | Ga0501046_0010652_974_1678 | 224 |
| 454 | 3300049581 | Ga0501047_0082890 | Ga0501047_0082890_658_1362 | 224 |
| 455 | 3300049586 | Ga0501070_0134080 | Ga0501070_0134080_829_1533 | 224 |
| 456 | 3300049822 | Ga0501035_0120182 | Ga0501035_0120182_1212_1916 | 224 |
| 457 | 3300049823 | Ga0501044_0062591 | Ga0501044_0062591_66_770 | 224 |
| 458 | 3300050491 | nmdc:mga00v17_1358_c1 | nmdc:mga00v17_1358_c1_11885_12583 | 224 |
| 459 | 3300050491 | nmdc:mga00v17_25421_c1 | nmdc:mga00v17_25421_c1_1793_2548 | 224 |
| 460 | 3300050496 | nmdc:mga07m45_57198_c1 | nmdc:mga07m45_57198_c1_710_1408 | 224 |
| 461 | 3300050516 | nmdc:mga0sz30_15423_c1 | nmdc:mga0sz30_15423_c1_2167_2871 | 224 |
| 462 | 3300061719 | Ga0466962_0034609 | Ga0466962_0034609_74_772 | 224 |
| 463 | 3300003373 | JGI25407J50210_10016053 | JGI25407J50210_100160532 | 225 |
| 464 | 3300005330 | Ga0070690_100162165 | Ga0070690_1001621652 | 225 |
| 465 | 3300005338 | Ga0068868_100499694 | Ga0068868_1004996941 | 225 |
| 466 | 3300005347 | Ga0070668_100004049 | Ga0070668_1000040494 | 225 |
| 467 | 3300005353 | Ga0070669_100006595 | Ga0070669_1000065957 | 225 |
| 468 | 3300005356 | Ga0070674_100441766 | Ga0070674_1004417661 | 225 |
| 469 | 3300005367 | Ga0070667_100000582 | Ga0070667_10000058220 | 225 |
| 470 | 3300005367 | Ga0070667_100143653 | Ga0070667_1001436532 | 225 |
| 471 | 3300005445 | Ga0070708_100533107 | Ga0070708_1005331072 | 225 |
| 472 | 3300005539 | Ga0068853_100034292 | Ga0068853_1000342924 | 225 |
| 473 | 3300005547 | Ga0070693_100242888 | Ga0070693_1002428882 | 225 |
| 474 | 3300005548 | Ga0070665_100011959 | Ga0070665_10001195910 | 225 |
| 475 | 3300005548 | Ga0070665_100756392 | Ga0070665_1007563922 | 225 |
| 476 | 3300005617 | Ga0068859_100000867 | Ga0068859_1000008675 | 225 |
| 477 | 3300005719 | Ga0068861_100095857 | Ga0068861_1000958572 | 225 |
| 478 | 3300005841 | Ga0068863_100001111 | Ga0068863_10000111126 | 225 |
| 479 | 3300005841 | Ga0068863_100509382 | Ga0068863_1005093822 | 225 |
| 480 | 3300005842 | Ga0068858_100003601 | Ga0068858_1000036013 | 225 |
| 481 | 3300005843 | Ga0068860_100000016 | Ga0068860_100000016215 | 225 |
| 482 | 3300005844 | Ga0068862_100000051 | Ga0068862_10000005162 | 225 |
| 483 | 3300005937 | Ga0081455_10006649 | Ga0081455_1000664911 | 225 |
| 484 | 3300005981 | Ga0081538_10006896 | Ga0081538_100068966 | 225 |
| 485 | 3300006048 | Ga0075363_100017372 | Ga0075363_1000173724 | 225 |
| 486 | 3300006048 | Ga0075363_100091027 | Ga0075363_1000910272 | 225 |
| 487 | 3300006048 | Ga0075363_100098165 | Ga0075363_1000981652 | 225 |
| 488 | 3300006051 | Ga0075364_10001139 | Ga0075364_100011397 | 225 |
| 489 | 3300006051 | Ga0075364_10047715 | Ga0075364_100477154 | 225 |
| 490 | 3300006177 | Ga0075362_10042239 | Ga0075362_100422393 | 225 |
| 491 | 3300006186 | Ga0075369_10000381 | Ga0075369_100003813 | 225 |
| 492 | 3300006186 | Ga0075369_10007067 | Ga0075369_100070674 | 225 |
| 493 | 3300006358 | Ga0068871_100006999 | Ga0068871_1000069998 | 225 |
| 494 | 3300006844 | Ga0075428_100002516 | Ga0075428_10000251619 | 225 |
| 495 | 3300006846 | Ga0075430_100020143 | Ga0075430_1000201434 | 225 |
| 496 | 3300006846 | Ga0075430_100035979 | Ga0075430_1000359793 | 225 |
| 497 | 3300006846 | Ga0075430_100151102 | Ga0075430_1001511022 | 225 |
| 498 | 3300006847 | Ga0075431_100427287 | Ga0075431_1004272873 | 225 |
| 499 | 3300006880 | Ga0075429_100466140 | Ga0075429_1004661403 | 225 |
| 500 | 3300006881 | Ga0068865_100083772 | Ga0068865_1000837722 | 225 |
| 501 | 3300006931 | Ga0097620_100000867 | Ga0097620_10000086731 | 225 |
| 502 | 3300009147 | Ga0114129_10004320 | Ga0114129_100043207 | 225 |
| 503 | 3300009147 | Ga0114129_10407995 | Ga0114129_104079952 | 225 |
| 504 | 3300009147 | Ga0114129_10614964 | Ga0114129_106149642 | 225 |
| 505 | 3300009148 | Ga0105243_10004323 | Ga0105243_100043236 | 225 |
| 506 | 3300009174 | Ga0105241_10104527 | Ga0105241_101045272 | 225 |
| 507 | 3300009176 | Ga0105242_10157271 | Ga0105242_101572712 | 225 |
| 508 | 3300009177 | Ga0105248_10000025 | Ga0105248_10000025167 | 225 |
| 509 | 3300009177 | Ga0105248_10003456 | Ga0105248_1000345615 | 225 |
| 510 | 3300009553 | Ga0105249_10000021 | Ga0105249_1000002187 | 225 |
| 511 | 3300009553 | Ga0105249_10077260 | Ga0105249_100772603 | 225 |
| 512 | 3300010375 | Ga0105239_10288452 | Ga0105239_102884523 | 225 |
| 513 | 3300013297 | Ga0157378_10014219 | Ga0157378_100142194 | 225 |
| 514 | 3300013306 | Ga0163162_10066721 | Ga0163162_100667213 | 225 |
| 515 | 3300013306 | Ga0163162_10110338 | Ga0163162_101103383 | 225 |
| 516 | 3300013306 | Ga0163162_10382545 | Ga0163162_103825452 | 225 |
| 517 | 3300014325 | Ga0163163_10018207 | Ga0163163_100182073 | 225 |
| 518 | 3300014325 | Ga0163163_10342123 | Ga0163163_103421233 | 225 |
| 519 | 3300014968 | Ga0157379_10001172 | Ga0157379_1000117220 | 225 |
| 520 | 3300014968 | Ga0157379_10124378 | Ga0157379_101243783 | 225 |
| 521 | 3300025900 | Ga0207710_10000033 | Ga0207710_1000003355 | 225 |
| 522 | 3300025900 | Ga0207710_10046464 | Ga0207710_100464642 | 225 |
| 523 | 3300025923 | Ga0207681_10002372 | Ga0207681_100023725 | 225 |
| 524 | 3300025935 | Ga0207709_10203748 | Ga0207709_102037482 | 225 |
| 525 | 3300025938 | Ga0207704_10431502 | Ga0207704_104315022 | 225 |
| 526 | 3300025941 | Ga0207711_10000191 | Ga0207711_100001915 | 225 |
| 527 | 3300025941 | Ga0207711_10029096 | Ga0207711_100290962 | 225 |
| 528 | 3300025961 | Ga0207712_10000005 | Ga0207712_10000005465 | 225 |
| 529 | 3300025961 | Ga0207712_10080141 | Ga0207712_100801412 | 225 |
| 530 | 3300025972 | Ga0207668_10001360 | Ga0207668_100013606 | 225 |
| 531 | 3300025972 | Ga0207668_10217045 | Ga0207668_102170452 | 225 |
| 532 | 3300025986 | Ga0207658_10001110 | Ga0207658_1000111021 | 225 |
| 533 | 3300025986 | Ga0207658_10061324 | Ga0207658_100613242 | 225 |
| 534 | 3300026023 | Ga0207677_10739125 | Ga0207677_107391251 | 225 |
| 535 | 3300026035 | Ga0207703_10053025 | Ga0207703_100530254 | 225 |
| 536 | 3300026035 | Ga0207703_10058209 | Ga0207703_100582093 | 225 |
| 537 | 3300026041 | Ga0207639_10102053 | Ga0207639_101020534 | 225 |
| 538 | 3300026088 | Ga0207641_10002206 | Ga0207641_1000220622 | 225 |
| 539 | 3300026088 | Ga0207641_10373045 | Ga0207641_103730452 | 225 |
| 540 | 3300026118 | Ga0207675_100063739 | Ga0207675_1000637394 | 225 |
| 541 | 3300026118 | Ga0207675_100327986 | Ga0207675_1003279862 | 225 |
| 542 | 3300026121 | Ga0207683_10000160 | Ga0207683_1000016047 | 225 |
| 543 | 3300028379 | Ga0268266_10040839 | Ga0268266_100408395 | 225 |
| 544 | 3300028379 | Ga0268266_10844151 | Ga0268266_108441511 | 225 |
| 545 | 3300028380 | Ga0268265_10000022 | Ga0268265_10000022211 | 225 |
| 546 | 3300028381 | Ga0268264_10000005 | Ga0268264_10000005460 | 225 |
| 547 | 3300031456 | Ga0307513_10001160 | Ga0307513_1000116012 | 225 |
| 548 | 3300031456 | Ga0307513_10060663 | Ga0307513_100606632 | 225 |
| 549 | 3300031852 | Ga0307410_10226850 | Ga0307410_102268502 | 225 |
| 550 | 3300031911 | Ga0307412_10392886 | Ga0307412_103928862 | 225 |
| 551 | 3300031995 | Ga0307409_100251289 | Ga0307409_1002512893 | 225 |
| 552 | 3300032005 | Ga0307411_10862146 | Ga0307411_108621461 | 225 |
| 553 | 3300041410 | Ga0439461_0007271 | Ga0439461_0007271_985_1689 | 225 |
| 554 | 3300041413 | Ga0439465_0005732 | Ga0439465_0005732_1860_2564 | 225 |
| 555 | 3300041452 | Ga0451793_0271601 | Ga0451793_0271601_100_822 | 225 |
| 556 | 3300041460 | Ga0451802_1512295 | Ga0451802_1512295_36_740 | 225 |
| 557 | 3300041486 | Ga0451807_2442734 | Ga0451807_2442734_85_816 | 225 |
| 558 | 3300041491 | Ga0451833_0770555 | Ga0451833_0770555_141_863 | 225 |
| 559 | 3300041512 | Ga0451853_1665339 | Ga0451853_1665339_3252_3956 | 225 |
| 560 | 3300041997 | Ga0439431_0017671 | Ga0439431_0017671_415_1119 | 225 |
| 561 | 3300044658 | Ga0466972_0104701 | Ga0466972_0104701_20_724 | 225 |
| 562 | 3300045976 | Ga0466967_0500853 | Ga0466967_0500853_348_1052 | 225 |
| 563 | 3300046460 | Ga0495638_0008424 | Ga0495638_0008424_1711_2418 | 225 |
| 564 | 3300046531 | Ga0495665_0298311 | Ga0495665_0298311_107_811 | 225 |
| 565 | 3300046674 | Ga0495588_0029968 | Ga0495588_0029968_143_847 | 225 |
| 566 | 3300047315 | Ga0495581_0030301 | Ga0495581_0030301_732_1436 | 225 |
| 567 | 3300047472 | Ga0495686_0002701 | Ga0495686_0002701_6239_6931 | 225 |
| 568 | 3300048903 | Ga0496100_0031590 | Ga0496100_0031590_1038_1808 | 225 |
| 569 | 3300048903 | Ga0496100_0083153 | Ga0496100_0083153_500_1219 | 225 |
| 570 | 3300048904 | Ga0496101_0012755 | Ga0496101_0012755_3794_4564 | 225 |
| 571 | 3300048905 | Ga0496102_0002051 | Ga0496102_0002051_6915_7685 | 225 |
| 572 | 3300048905 | Ga0496102_0075276 | Ga0496102_0075276_1205_1924 | 225 |
| 573 | 3300048905 | Ga0496102_0149807 | Ga0496102_0149807_593_1294 | 225 |
| 574 | 3300048905 | Ga0496102_0205063 | Ga0496102_0205063_381_1073 | 225 |
| 575 | 3300048906 | Ga0496103_0000448 | Ga0496103_0000448_29141_29911 | 225 |
| 576 | 3300048907 | Ga0496104_0010915 | Ga0496104_0010915_3808_4527 | 225 |
| 577 | 3300048909 | Ga0496106_0037062 | Ga0496106_0037062_1561_2280 | 225 |
| 578 | 3300048910 | Ga0496107_0010772 | Ga0496107_0010772_5304_6023 | 225 |
| 579 | 3300048910 | Ga0496107_0079939 | Ga0496107_0079939_748_1518 | 225 |
| 580 | 3300048915 | Ga0496112_0009499 | Ga0496112_0009499_7244_7948 | 225 |
| 581 | 3300048916 | Ga0496113_0058976 | Ga0496113_0058976_1078_1782 | 225 |
| 582 | 3300048917 | Ga0496114_0761232 | Ga0496114_0761232_33_803 | 225 |
| 583 | 3300048919 | Ga0496116_0203265 | Ga0496116_0203265_312_1016 | 225 |
| 584 | 3300048920 | Ga0496117_0000417 | Ga0496117_0000417_26071_26841 | 225 |
| 585 | 3300048921 | Ga0496118_0000350 | Ga0496118_0000350_61797_62567 | 225 |
| 586 | 3300048923 | Ga0496120_0062164 | Ga0496120_0062164_954_1724 | 225 |
| 587 | 3300048924 | Ga0496121_0011044 | Ga0496121_0011044_2011_2781 | 225 |
| 588 | 3300048927 | Ga0496124_0293149 | Ga0496124_0293149_19_723 | 225 |
| 589 | 3300048928 | Ga0496125_0066385 | Ga0496125_0066385_635_1405 | 225 |
| 590 | 3300049570 | Ga0501033_0075979 | Ga0501033_0075979_941_1633 | 225 |
| 591 | 3300049572 | Ga0501036_0123568 | Ga0501036_0123568_444_1136 | 225 |
| 592 | 3300049575 | Ga0501039_0162017 | Ga0501039_0162017_443_1135 | 225 |
| 593 | 3300049576 | Ga0501040_0155557 | Ga0501040_0155557_868_1560 | 225 |
| 594 | 3300049577 | Ga0501041_0158983 | Ga0501041_0158983_666_1358 | 225 |
| 595 | 3300049578 | Ga0501042_0122687 | Ga0501042_0122687_588_1280 | 225 |
| 596 | 3300049580 | Ga0501046_0340539 | Ga0501046_0340539_87_779 | 225 |
| 597 | 3300049582 | Ga0501048_0141360 | Ga0501048_0141360_703_1395 | 225 |
| 598 | 3300049588 | Ga0501072_0622375 | Ga0501072_0622375_135_827 | 225 |
| 599 | 3300049824 | Ga0501045_0050616 | Ga0501045_0050616_419_1111 | 225 |
| 600 | 3300050490 | nmdc:mga03n38_104587_c1 | nmdc:mga03n38_104587_c1_561_1265 | 225 |
| 601 | 3300050490 | nmdc:mga03n38_5399_c1 | nmdc:mga03n38_5399_c1_1469_2176 | 225 |
| 602 | 3300050491 | nmdc:mga00v17_614_c1 | nmdc:mga00v17_614_c1_12130_12834 | 225 |
| 603 | 3300050492 | nmdc:mga0yw44_327679_c1 | nmdc:mga0yw44_327679_c1_207_911 | 225 |
| 604 | 3300050507 | nmdc:mga05p37_30733_c1 | nmdc:mga05p37_30733_c1_5815_6513 | 225 |
| 605 | 3300050507 | nmdc:mga05p37_389200_c1 | nmdc:mga05p37_389200_c1_101_793 | 225 |
| 606 | 3300050507 | nmdc:mga05p37_632364_c1 | nmdc:mga05p37_632364_c1_162_854 | 225 |
| 607 | 3300050507 | nmdc:mga05p37_862331_c1 | nmdc:mga05p37_862331_c1_65_766 | 225 |
| 608 | 3300050508 | nmdc:mga09592_86349_c1 | nmdc:mga09592_86349_c1_354_1046 | 225 |
| 609 | 3300050509 | nmdc:mga0qj67_230485_c1 | nmdc:mga0qj67_230485_c1_271_963 | 225 |
| 610 | 3300050509 | nmdc:mga0qj67_24370_c1 | nmdc:mga0qj67_24370_c1_2724_3422 | 225 |
| 611 | 3300050509 | nmdc:mga0qj67_32097_c1 | nmdc:mga0qj67_32097_c1_2047_2751 | 225 |
| 612 | 3300050510 | nmdc:mga06r32_114004_c1 | nmdc:mga06r32_114004_c1_1951_2649 | 225 |
| 613 | 3300050510 | nmdc:mga06r32_227930_c1 | nmdc:mga06r32_227930_c1_1132_1833 | 225 |
| 614 | 3300050516 | nmdc:mga0sz30_343_c1 | nmdc:mga0sz30_343_c1_11173_11877 | 225 |
| 615 | 3300053104 | Ga0500556_0004900 | Ga0500556_0004900_2439_3146 | 225 |
| 616 | 3300053118 | Ga0500594_0080382 | Ga0500594_0080382_248_961 | 225 |
| 617 | 3300053153 | Ga0500616_0004909 | Ga0500616_0004909_4309_5004 | 225 |
| 618 | 3300061734 | Ga0530510_0257557 | Ga0530510_0257557_312_1004 | 225 |
| 619 | 3300005329 | Ga0070683_101124507 | Ga0070683_1011245071 | 226 |
| 620 | 3300005356 | Ga0070674_100407860 | Ga0070674_1004078602 | 226 |
| 621 | 3300005456 | Ga0070678_100065520 | Ga0070678_1000655202 | 226 |
| 622 | 3300005548 | Ga0070665_100354352 | Ga0070665_1003543521 | 226 |
| 623 | 3300005548 | Ga0070665_100543321 | Ga0070665_1005433211 | 226 |
| 624 | 3300006051 | Ga0075364_10006919 | Ga0075364_100069192 | 226 |
| 625 | 3300006175 | Ga0070712_100230725 | Ga0070712_1002307252 | 226 |
| 626 | 3300006177 | Ga0075362_10068268 | Ga0075362_100682682 | 226 |
| 627 | 3300006178 | Ga0075367_10255654 | Ga0075367_102556541 | 226 |
| 628 | 3300006353 | Ga0075370_10024235 | Ga0075370_100242353 | 226 |
| 629 | 3300009101 | Ga0105247_10101626 | Ga0105247_101016263 | 226 |
| 630 | 3300013297 | Ga0157378_10449107 | Ga0157378_104491071 | 226 |
| 631 | 3300014325 | Ga0163163_10479437 | Ga0163163_104794373 | 226 |
| 632 | 3300014326 | Ga0157380_10804225 | Ga0157380_108042251 | 226 |
| 633 | 3300014968 | Ga0157379_10438257 | Ga0157379_104382572 | 226 |
| 634 | 3300025900 | Ga0207710_10061099 | Ga0207710_100610993 | 226 |
| 635 | 3300025928 | Ga0207700_10615960 | Ga0207700_106159601 | 226 |
| 636 | 3300025937 | Ga0207669_10109831 | Ga0207669_101098312 | 226 |
| 637 | 3300026121 | Ga0207683_10063898 | Ga0207683_100638983 | 226 |
| 638 | 3300028379 | Ga0268266_10120064 | Ga0268266_101200642 | 226 |
| 639 | 3300048903 | Ga0496100_0000300 | Ga0496100_0000300_23136_23909 | 226 |
| 640 | 3300048904 | Ga0496101_0000907 | Ga0496101_0000907_15849_16556 | 226 |
| 641 | 3300048905 | Ga0496102_0156815 | Ga0496102_0156815_554_1261 | 226 |
| 642 | 3300048908 | Ga0496105_0030081 | Ga0496105_0030081_243_950 | 226 |
| 643 | 3300048910 | Ga0496107_0001983 | Ga0496107_0001983_7235_7942 | 226 |
| 644 | 3300048917 | Ga0496114_0000720 | Ga0496114_0000720_1124_1831 | 226 |
| 645 | 3300048918 | Ga0496115_0001133 | Ga0496115_0001133_2690_3397 | 226 |
| 646 | 3300053080 | Ga0500635_0000622 | Ga0500635_0000622_4326_5024 | 226 |
| 647 | 3300053131 | Ga0500652_002044 | Ga0500652_002044_3756_4454 | 226 |
| 648 | 3300053153 | Ga0500616_0004274 | Ga0500616_0004274_3765_4514 | 226 |
| 649 | 3300025937 | Ga0207669_10134380 | Ga0207669_101343802 | 227 |
| 650 | 3300045976 | Ga0466967_0537036 | Ga0466967_0537036_32_730 | 227 |
| 651 | 3300046462 | Ga0495651_0116691 | Ga0495651_0116691_1196_1906 | 227 |
| 652 | 3300046463 | Ga0495653_0156729 | Ga0495653_0156729_402_1106 | 227 |
| 653 | 3300046511 | Ga0495608_0070519 | Ga0495608_0070519_533_1243 | 227 |
| 654 | 3300047319 | Ga0495674_0195508 | Ga0495674_0195508_96_806 | 227 |
| 655 | 3300048922 | Ga0496119_0141334 | Ga0496119_0141334_579_1289 | 227 |
| 656 | 3300049568 | Ga0501031_0034909 | Ga0501031_0034909_2137_2856 | 227 |
| 657 | 3300049569 | Ga0501032_0338668 | Ga0501032_0338668_23_742 | 227 |
| 658 | 3300049570 | Ga0501033_0025362 | Ga0501033_0025362_1730_2449 | 227 |
| 659 | 3300049571 | Ga0501034_0310499 | Ga0501034_0310499_677_1396 | 227 |
| 660 | 3300049574 | Ga0501038_0000952 | Ga0501038_0000952_24865_25584 | 227 |
| 661 | 3300049579 | Ga0501043_0212618 | Ga0501043_0212618_64_783 | 227 |
| 662 | 3300049582 | Ga0501048_0000654 | Ga0501048_0000654_15095_15814 | 227 |
| 663 | 3300049586 | Ga0501070_0003679 | Ga0501070_0003679_229_948 | 227 |
| 664 | 3300049587 | Ga0501071_0134426 | Ga0501071_0134426_280_999 | 227 |
| 665 | 3300049589 | Ga0501073_0036944 | Ga0501073_0036944_2486_3205 | 227 |
| 666 | 3300049589 | Ga0501073_0101391 | Ga0501073_0101391_1190_1888 | 227 |
| 667 | 3300049741 | Ga0501079_0117676 | Ga0501079_0117676_390_1109 | 227 |
| 668 | 3300049742 | Ga0501080_0001246 | Ga0501080_0001246_15965_16684 | 227 |
| 669 | 3300054114 | Ga0501084_0008210 | Ga0501084_0008210_5941_6660 | 227 |
| 670 | 3300001991 | JGI24743J22301_10006994 | JGI24743J22301_100069942 | 228 |
| 671 | 3300002077 | JGI24744J21845_10018574 | JGI24744J21845_100185741 | 228 |
| 672 | 3300003203 | JGI25406J46586_10000381 | JGI25406J46586_100003812 | 228 |
| 673 | 3300005338 | Ga0068868_100011304 | Ga0068868_1000113043 | 228 |
| 674 | 3300005339 | Ga0070660_100484300 | Ga0070660_1004843001 | 228 |
| 675 | 3300005353 | Ga0070669_100236890 | Ga0070669_1002368902 | 228 |
| 676 | 3300005356 | Ga0070674_100375330 | Ga0070674_1003753301 | 228 |
| 677 | 3300005365 | Ga0070688_100077185 | Ga0070688_1000771853 | 228 |
| 678 | 3300005366 | Ga0070659_100070783 | Ga0070659_1000707833 | 228 |
| 679 | 3300005366 | Ga0070659_100260193 | Ga0070659_1002601932 | 228 |
| 680 | 3300005434 | Ga0070709_10054689 | Ga0070709_100546891 | 228 |
| 681 | 3300005438 | Ga0070701_10100733 | Ga0070701_101007332 | 228 |
| 682 | 3300005439 | Ga0070711_100036965 | Ga0070711_1000369652 | 228 |
| 683 | 3300005441 | Ga0070700_100224219 | Ga0070700_1002242193 | 228 |
| 684 | 3300005456 | Ga0070678_100057565 | Ga0070678_1000575652 | 228 |
| 685 | 3300005466 | Ga0070685_10046944 | Ga0070685_100469445 | 228 |
| 686 | 3300005546 | Ga0070696_100013172 | Ga0070696_1000131722 | 228 |
| 687 | 3300005548 | Ga0070665_100011884 | Ga0070665_1000118849 | 228 |
| 688 | 3300005548 | Ga0070665_100193762 | Ga0070665_1001937622 | 228 |
| 689 | 3300005563 | Ga0068855_100523066 | Ga0068855_1005230662 | 228 |
| 690 | 3300005578 | Ga0068854_100077827 | Ga0068854_1000778272 | 228 |
| 691 | 3300005616 | Ga0068852_100137297 | Ga0068852_1001372971 | 228 |
| 692 | 3300005617 | Ga0068859_100029066 | Ga0068859_1000290666 | 228 |
| 693 | 3300005617 | Ga0068859_100478646 | Ga0068859_1004786461 | 228 |
| 694 | 3300005840 | Ga0068870_10249795 | Ga0068870_102497952 | 228 |
| 695 | 3300005842 | Ga0068858_100010836 | Ga0068858_1000108366 | 228 |
| 696 | 3300005843 | Ga0068860_100039061 | Ga0068860_1000390615 | 228 |
| 697 | 3300005985 | Ga0081539_10001051 | Ga0081539_100010512 | 228 |
| 698 | 3300006038 | Ga0075365_10219492 | Ga0075365_102194921 | 228 |
| 699 | 3300006051 | Ga0075364_10269858 | Ga0075364_102698582 | 228 |
| 700 | 3300006051 | Ga0075364_10376045 | Ga0075364_103760451 | 228 |
| 701 | 3300006163 | Ga0070715_10016443 | Ga0070715_100164433 | 228 |
| 702 | 3300006175 | Ga0070712_100063839 | Ga0070712_1000638391 | 228 |
| 703 | 3300006186 | Ga0075369_10004737 | Ga0075369_100047373 | 228 |
| 704 | 3300006358 | Ga0068871_100392941 | Ga0068871_1003929412 | 228 |
| 705 | 3300006881 | Ga0068865_100180145 | Ga0068865_1001801452 | 228 |
| 706 | 3300006931 | Ga0097620_100029064 | Ga0097620_1000290646 | 228 |
| 707 | 3300006931 | Ga0097620_100478651 | Ga0097620_1004786511 | 228 |
| 708 | 3300009098 | Ga0105245_10009665 | Ga0105245_100096656 | 228 |
| 709 | 3300009148 | Ga0105243_10093141 | Ga0105243_100931412 | 228 |
| 710 | 3300009177 | Ga0105248_10528758 | Ga0105248_105287582 | 228 |
| 711 | 3300009545 | Ga0105237_10006529 | Ga0105237_100065292 | 228 |
| 712 | 3300009551 | Ga0105238_10265581 | Ga0105238_102655813 | 228 |
| 713 | 3300011119 | Ga0105246_10079010 | Ga0105246_100790102 | 228 |
| 714 | 3300013296 | Ga0157374_10111713 | Ga0157374_101117132 | 228 |
| 715 | 3300013306 | Ga0163162_10448563 | Ga0163162_104485633 | 228 |
| 716 | 3300013308 | Ga0157375_10003762 | Ga0157375_100037628 | 228 |
| 717 | 3300014326 | Ga0157380_10121192 | Ga0157380_101211923 | 228 |
| 718 | 3300014745 | Ga0157377_10022444 | Ga0157377_100224443 | 228 |
| 719 | 3300025898 | Ga0207692_10003418 | Ga0207692_100034186 | 228 |
| 720 | 3300025900 | Ga0207710_10113236 | Ga0207710_101132361 | 228 |
| 721 | 3300025901 | Ga0207688_10002229 | Ga0207688_100022292 | 228 |
| 722 | 3300025907 | Ga0207645_10086954 | Ga0207645_100869541 | 228 |
| 723 | 3300025914 | Ga0207671_10002173 | Ga0207671_1000217312 | 228 |
| 724 | 3300025915 | Ga0207693_10003117 | Ga0207693_1000311712 | 228 |
| 725 | 3300025916 | Ga0207663_10001631 | Ga0207663_100016312 | 228 |
| 726 | 3300025919 | Ga0207657_10123816 | Ga0207657_101238162 | 228 |
| 727 | 3300025923 | Ga0207681_10169727 | Ga0207681_101697273 | 228 |
| 728 | 3300025924 | Ga0207694_10218514 | Ga0207694_102185143 | 228 |
| 729 | 3300025932 | Ga0207690_10032403 | Ga0207690_100324032 | 228 |
| 730 | 3300025933 | Ga0207706_10100312 | Ga0207706_101003124 | 228 |
| 731 | 3300025939 | Ga0207665_10012984 | Ga0207665_100129842 | 228 |
| 732 | 3300025941 | Ga0207711_10233126 | Ga0207711_102331262 | 228 |
| 733 | 3300025961 | Ga0207712_10330612 | Ga0207712_103306121 | 228 |
| 734 | 3300025972 | Ga0207668_10633862 | Ga0207668_106338621 | 228 |
| 735 | 3300025981 | Ga0207640_10384887 | Ga0207640_103848871 | 228 |
| 736 | 3300026023 | Ga0207677_10009273 | Ga0207677_100092734 | 228 |
| 737 | 3300026023 | Ga0207677_10535593 | Ga0207677_105355931 | 228 |
| 738 | 3300026075 | Ga0207708_10429781 | Ga0207708_104297811 | 228 |
| 739 | 3300026095 | Ga0207676_10011210 | Ga0207676_100112105 | 228 |
| 740 | 3300026118 | Ga0207675_100091284 | Ga0207675_1000912845 | 228 |
| 741 | 3300026121 | Ga0207683_10007470 | Ga0207683_1000747010 | 228 |
| 742 | 3300026142 | Ga0207698_10319502 | Ga0207698_103195022 | 228 |
| 743 | 3300026142 | Ga0207698_11180228 | Ga0207698_111802281 | 228 |
| 744 | 3300039437 | Ga0436365_1856170 | Ga0436365_1856170_3618_4406 | 228 |
| 745 | 3300044765 | Ga0466970_0125340 | Ga0466970_0125340_319_1035 | 228 |
| 746 | 3300044842 | Ga0466957_0060934 | Ga0466957_0060934_458_1174 | 228 |
| 747 | 3300044901 | Ga0466960_0154651 | Ga0466960_0154651_65_781 | 228 |
| 748 | 3300046507 | Ga0495606_0053413 | Ga0495606_0053413_1356_2078 | 228 |
| 749 | 3300048904 | Ga0496101_0040163 | Ga0496101_0040163_1230_1949 | 228 |
| 750 | 3300048905 | Ga0496102_0000003 | Ga0496102_0000003_63699_64424 | 228 |
| 751 | 3300048905 | Ga0496102_0013106 | Ga0496102_0013106_6173_6874 | 228 |
| 752 | 3300048905 | Ga0496102_0021279 | Ga0496102_0021279_577_1296 | 228 |
| 753 | 3300048905 | Ga0496102_0062329 | Ga0496102_0062329_90_791 | 228 |
| 754 | 3300048906 | Ga0496103_0000014 | Ga0496103_0000014_226192_226917 | 228 |
| 755 | 3300048908 | Ga0496105_0048688 | Ga0496105_0048688_1112_1813 | 228 |
| 756 | 3300048909 | Ga0496106_0039676 | Ga0496106_0039676_1718_2419 | 228 |
| 757 | 3300048909 | Ga0496106_0048728 | Ga0496106_0048728_2352_3077 | 228 |
| 758 | 3300048909 | Ga0496106_0562750 | Ga0496106_0562750_19_738 | 228 |
| 759 | 3300048910 | Ga0496107_0271433 | Ga0496107_0271433_393_1118 | 228 |
| 760 | 3300048910 | Ga0496107_0294006 | Ga0496107_0294006_114_833 | 228 |
| 761 | 3300048911 | Ga0496108_0000189 | Ga0496108_0000189_51264_51965 | 228 |
| 762 | 3300048911 | Ga0496108_0068049 | Ga0496108_0068049_1868_2590 | 228 |
| 763 | 3300048912 | Ga0496109_0101201 | Ga0496109_0101201_837_1538 | 228 |
| 764 | 3300048913 | Ga0496110_0384138 | Ga0496110_0384138_269_991 | 228 |
| 765 | 3300048914 | Ga0496111_0050607 | Ga0496111_0050607_1040_1741 | 228 |
| 766 | 3300048915 | Ga0496112_0096296 | Ga0496112_0096296_1462_2163 | 228 |
| 767 | 3300048916 | Ga0496113_0114959 | Ga0496113_0114959_1276_1977 | 228 |
| 768 | 3300048917 | Ga0496114_0158285 | Ga0496114_0158285_194_895 | 228 |
| 769 | 3300048919 | Ga0496116_0000071 | Ga0496116_0000071_62834_63559 | 228 |
| 770 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_527840_528565 | 228 |
| 771 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_527843_528568 | 228 |
| 772 | 3300048922 | Ga0496119_0001317 | Ga0496119_0001317_21998_22723 | 228 |
| 773 | 3300048923 | Ga0496120_0000157 | Ga0496120_0000157_48244_48969 | 228 |
| 774 | 3300048924 | Ga0496121_0000019 | Ga0496121_0000019_73112_73837 | 228 |
| 775 | 3300048929 | Ga0496126_0000186 | Ga0496126_0000186_63717_64430 | 228 |
| 776 | 3300050516 | nmdc:mga0sz30_14113_c1 | nmdc:mga0sz30_14113_c1_1263_1976 | 228 |
| 777 | 3300053087 | Ga0500643_002664 | Ga0500643_002664_501_1214 | 228 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2h1a-assembly1.cif.gz_A | resa c74a variant | 0.7356 | 53 | 180 |
| 3drn-assembly2.cif.gz_B | the crystal structure of bcp1 from sulfolobus sulfataricus | 0.733 | 55 | 195 |
| 2pwj-assembly2.cif.gz_B | structure of a mitochondrial type ii peroxiredoxin from pisum sativum | 0.721 | 49 | 181 |
| 5epf-assembly1.cif.gz_A | crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis | 0.7168 | 49 | 195 |
| 2h1g-assembly1.cif.gz_A | resa c74a/c77a | 0.7161 | 53 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9D1A0_27_140_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7858 | 58 | 157 | 3.40.30.10 |
| af_Q5I0C9_376_611_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7554 | 161 | 183 | 2.130.10.10 |
| af_Q5A7P9_48_194_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7531 | 53 | 166 | 3.40.30.10 |
| af_O94561_50_193_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7432 | 55 | 167 | 3.40.30.10 |
| af_I1MS47_66_213_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7429 | 55 | 195 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K0V9M3-F1-model_v4 | DUF899 domain-containing protein | 0.9754 | 12 | 228 |
|
| AF-A0A7U5MKR8-F1-model_v4 | CalU12 protein | 0.9734 | 9 | 189 |
|
| AF-F5XQQ2-F1-model_v4 | Thioredoxin domain-containing protein | 0.9641 | 9 | 226 |
|
| AF-A0A1R0U0F4-F1-model_v4 | deleted | 0.9632 | 9 | 228 |
|
| AF-A0A6F8YNX2-F1-model_v4 | Thioredoxin domain-containing protein | 0.962 | 11 | 228 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar