F480369

General Info

Members Datasets Scaffolds Average Seq Length
777 322 1554 141

Family's Representative Sequence

Representative Sequence 3300025898|Ga0207692_10310725|Ga0207692_103107252
Length 153
Sequence MRDTKDQHQHHLPAEPEKIVSIDAEYLSGRRFSYQENIGEVEDIDLMAATPGPDLNWLEDVELLEEEGTPAVFDRYSNSFIKIYFQIPQGRENEIARKVLIKHLQSGNSYGIALKERHCKFPQPELGPWVEGSRTVGTDWKPPVLEGWEPPLH

Samples

Sample ID Description Type Environment
1 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
202 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
203 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
204 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
205 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
206 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
207 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
225 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
226 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
233 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
234 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
243 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
248 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
303 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
318 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
319 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
322 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 1.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.88
Rhizosphere 89.96
Stem 0
Stem Tuber 0
Unclassified 2.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207692_10310725 3300025898 Bacteria 962
2 JGI25406J46586_10059266 3300003203 Bacteria 1244
3 JGI25407J50210_10002159 3300003373 Bacteria 4595
4 JGI25407J50210_10002944 3300003373 Bacteria 4063
5 JGI25407J50210_10021302 3300003373 Bacteria 1686
6 JGI25407J50210_10025127 3300003373 Bacteria 1545
7 JGI25407J50210_10027536 3300003373 Bacteria 1474
8 JGI25407J50210_10051231 3300003373 Bacteria 1046
9 JGI25404J52841_10134229 3300003659 Bacteria 524
10 Ga0058860_12028200 3300004801 Bacteria 746
11 Ga0058862_12754142 3300004803 Bacteria 1103
12 Ga0070658_10525032 3300005327 Bacteria 1024
13 Ga0070658_11001035 3300005327 Bacteria 727
14 Ga0070676_10385468 3300005328 Bacteria 971
15 Ga0070683_100049255 3300005329 Bacteria 3896
16 Ga0070683_100060005 3300005329 Bacteria 3534
17 Ga0070683_100756997 3300005329 Bacteria 931
18 Ga0070690_100374847 3300005330 Bacteria 1039
19 Ga0070670_101300681 3300005331 Bacteria 666
20 Ga0068869_100212239 3300005334 Bacteria 1531
21 Ga0068869_100337064 3300005334 Bacteria 1226
22 Ga0070680_100104340 3300005336 Bacteria 2355
23 Ga0070680_100124370 3300005336 Bacteria 2154
24 Ga0070680_100407952 3300005336 Bacteria 1159
25 Ga0070682_100522195 3300005337 Bacteria 924
26 Ga0068868_100221130 3300005338 Bacteria 1585
27 Ga0068868_100987243 3300005338 Bacteria 770
28 Ga0070660_100039827 3300005339 Bacteria 3573
29 Ga0070660_100626186 3300005339 Bacteria 900
30 Ga0070660_101340248 3300005339 Bacteria 608
31 Ga0070660_101501908 3300005339 Bacteria 573
32 Ga0070689_100872769 3300005340 Bacteria 795
33 Ga0070689_100886775 3300005340 Bacteria 789
34 Ga0070689_100896217 3300005340 Bacteria 785
35 Ga0070691_10127730 3300005341 Bacteria 1285
36 Ga0070687_100172548 3300005343 Bacteria 1288
37 Ga0070687_100813718 3300005343 Bacteria 663
38 Ga0070661_100221677 3300005344 Bacteria 1451
39 Ga0070661_100334152 3300005344 Bacteria 1186
40 Ga0070692_10104927 3300005345 Bacteria 1555
41 Ga0070692_10153948 3300005345 Bacteria 1312
42 Ga0070692_10167308 3300005345 Bacteria 1265
43 Ga0070692_10246915 3300005345 Bacteria 1066
44 Ga0070668_100107412 3300005347 Bacteria 2218
45 Ga0070668_100467885 3300005347 Bacteria 1087
46 Ga0070675_101179711 3300005354 Bacteria 705
47 Ga0070674_100176909 3300005356 Bacteria 1631
48 Ga0070674_100189300 3300005356 Bacteria 1582
49 Ga0070674_100217550 3300005356 Bacteria 1484
50 Ga0070674_100240674 3300005356 Bacteria 1417
51 Ga0070673_100992031 3300005364 Bacteria 782
52 Ga0070688_100078229 3300005365 Bacteria 2133
53 Ga0070688_100214260 3300005365 Bacteria 1354
54 Ga0070688_101109944 3300005365 Bacteria 633
55 Ga0070659_100031781 3300005366 Bacteria 4090
56 Ga0070659_100666781 3300005366 Bacteria 898
57 Ga0070659_100899145 3300005366 Bacteria 774
58 Ga0070667_100094094 3300005367 Bacteria 2581
59 Ga0070667_100485202 3300005367 Bacteria 1132
60 Ga0070667_100536382 3300005367 Bacteria 1074
61 Ga0070709_10486296 3300005434 Unclassified 935
62 Ga0070714_100039831 3300005435 Bacteria 3958
63 Ga0070713_100581623 3300005436 Bacteria 1062
64 Ga0070710_10047865 3300005437 Bacteria 2387
65 Ga0070701_10079301 3300005438 Bacteria 1773
66 Ga0070701_10330577 3300005438 Bacteria 946
67 Ga0070701_10449512 3300005438 Bacteria 827
68 Ga0070711_100029514 3300005439 Bacteria 3620
69 Ga0070711_100524293 3300005439 Bacteria 980
70 Ga0070705_100229500 3300005440 Bacteria 1290
71 Ga0070705_101540001 3300005440 Bacteria 558
72 Ga0070700_100033149 3300005441 Bacteria 3109
73 Ga0070700_100071050 3300005441 Bacteria 2221
74 Ga0070700_100522928 3300005441 Bacteria 917
75 Ga0070694_100385667 3300005444 Bacteria 1094
76 Ga0070694_100695904 3300005444 Unclassified 826
77 Ga0070694_100713072 3300005444 Bacteria 816
78 Ga0070663_101446107 3300005455 Bacteria 610
79 Ga0070678_100027290 3300005456 Bacteria 3876
80 Ga0070678_101876403 3300005456 Bacteria 566
81 Ga0070662_100480875 3300005457 Unclassified 1034
82 Ga0070662_100542749 3300005457 Bacteria 973
83 Ga0070662_100710336 3300005457 Bacteria 851
84 Ga0070681_10028469 3300005458 Bacteria 5617
85 Ga0070681_10774459 3300005458 Bacteria 876
86 Ga0068867_100156753 3300005459 Bacteria 1793
87 Ga0068867_100197830 3300005459 Bacteria 1607
88 Ga0068867_100808395 3300005459 Bacteria 837
89 Ga0068867_100872200 3300005459 Bacteria 808
90 Ga0070685_10201194 3300005466 Bacteria 1295
91 Ga0070698_100736165 3300005471 Bacteria 929
92 Ga0070679_100017355 3300005530 Bacteria 6968
93 Ga0070684_100013395 3300005535 Bacteria 6611
94 Ga0070684_100190323 3300005535 Bacteria 1867
95 Ga0070697_100249425 3300005536 Bacteria 1518
96 Ga0070697_101659533 3300005536 Bacteria 572
97 Ga0068853_100443989 3300005539 Bacteria 1219
98 Ga0070672_100064357 3300005543 Bacteria 2897
99 Ga0070672_100102794 3300005543 Bacteria 2320
100 Ga0070672_101056831 3300005543 Bacteria 721
101 Ga0070672_101136052 3300005543 Bacteria 695
102 Ga0070686_100163363 3300005544 Bacteria 1570
103 Ga0070686_100253550 3300005544 Bacteria 1286
104 Ga0070686_100330927 3300005544 Bacteria 1139
105 Ga0070695_100695291 3300005545 Bacteria 807
106 Ga0070695_101588333 3300005545 Unclassified 546
107 Ga0070696_100273819 3300005546 Bacteria 1284
108 Ga0070696_100583044 3300005546 Bacteria 900
109 Ga0070693_100073605 3300005547 Bacteria 2018
110 Ga0070693_100182545 3300005547 Bacteria 1352
111 Ga0070693_100205945 3300005547 Bacteria 1281
112 Ga0070693_100414731 3300005547 Bacteria 937
113 Ga0070704_100374702 3300005549 Bacteria 1208
114 Ga0070704_100431994 3300005549 Bacteria 1130
115 Ga0070704_101229960 3300005549 Bacteria 684
116 Ga0070704_101360324 3300005549 Unclassified 651
117 Ga0068855_100835715 3300005563 Bacteria 977
118 Ga0068855_101254361 3300005563 Bacteria 769
119 Ga0070664_100228285 3300005564 Bacteria 1668
120 Ga0070664_100314568 3300005564 Bacteria 1417
121 Ga0070664_100446074 3300005564 Bacteria 1187
122 Ga0070664_100539837 3300005564 Bacteria 1078
123 Ga0068857_100061966 3300005577 Bacteria 3324
124 Ga0068857_100674458 3300005577 Unclassified 981
125 Ga0068857_101577262 3300005577 Bacteria 641
126 Ga0068854_100286618 3300005578 Bacteria 1328
127 Ga0068854_100343536 3300005578 Bacteria 1219
128 Ga0068854_100478865 3300005578 Bacteria 1045
129 Ga0068856_100095535 3300005614 Bacteria 2960
130 Ga0068856_100887340 3300005614 Bacteria 911
131 Ga0068856_100935390 3300005614 Bacteria 885
132 Ga0070702_100010571 3300005615 Bacteria 4552
133 Ga0070702_100024997 3300005615 Bacteria 3195
134 Ga0070702_100045716 3300005615 Bacteria 2478
135 Ga0070702_100119079 3300005615 Bacteria 1650
136 Ga0068852_100018502 3300005616 Bacteria 5490
137 Ga0068852_100524706 3300005616 Bacteria 1182
138 Ga0068859_100442070 3300005617 Bacteria 1397
139 Ga0068859_100477154 3300005617 Bacteria 1343
140 Ga0068864_100404515 3300005618 Bacteria 1298
141 Ga0068866_10010222 3300005718 Bacteria 4015
142 Ga0068866_10023976 3300005718 Bacteria 2845
143 Ga0068866_10161257 3300005718 Bacteria 1308
144 Ga0068866_10799230 3300005718 Bacteria 656
145 Ga0068861_100372701 3300005719 Bacteria 1259
146 Ga0068870_10182901 3300005840 Bacteria 1259
147 Ga0068870_10213812 3300005840 Bacteria 1176
148 Ga0068870_10332781 3300005840 Bacteria 969
149 Ga0068863_100558673 3300005841 Bacteria 1130
150 Ga0068858_100080297 3300005842 Bacteria 3031
151 Ga0068858_100239965 3300005842 Bacteria 1720
152 Ga0068858_100537943 3300005842 Bacteria 1131
153 Ga0068860_100010313 3300005843 Bacteria 9239
154 Ga0068860_101770357 3300005843 Bacteria 640
155 Ga0068862_100114212 3300005844 Bacteria 2373
156 Ga0068862_100212363 3300005844 Bacteria 1749
157 Ga0081455_10066007 3300005937 Bacteria 3024
158 Ga0081455_10138487 3300005937 Bacteria 1893
159 Ga0081538_10000042 3300005981 Bacteria 115656
160 Ga0081538_10000122 3300005981 Bacteria 78780
161 Ga0081538_10001386 3300005981 Bacteria 24850
162 Ga0081538_10002404 3300005981 Bacteria 18376
163 Ga0081538_10006596 3300005981 Bacteria 10187
164 Ga0081538_10007617 3300005981 Bacteria 9334
165 Ga0081538_10007718 3300005981 Bacteria 9269
166 Ga0081538_10018668 3300005981 Bacteria 5195
167 Ga0081538_10027157 3300005981 Bacteria 3977
168 Ga0081538_10033602 3300005981 Bacteria 3411
169 Ga0081538_10039259 3300005981 Bacteria 3039
170 Ga0081538_10051330 3300005981 Bacteria 2478
171 Ga0081538_10080430 3300005981 Bacteria 1739
172 Ga0081538_10145543 3300005981 Bacteria 1084
173 Ga0081538_10200911 3300005981 Unclassified 819
174 Ga0081540_1064330 3300005983 Bacteria 1731
175 Ga0081539_10000294 3300005985 Bacteria 112974
176 Ga0081539_10002271 3300005985 Bacteria 27870
177 Ga0075432_10022513 3300006058 Bacteria 2155
178 Ga0070716_100041740 3300006173 Bacteria 2558
179 Ga0070712_100017836 3300006175 Bacteria 4599
180 Ga0097621_100081461 3300006237 Bacteria 2694
181 Ga0097621_100726498 3300006237 Bacteria 916
182 Ga0097621_101022415 3300006237 Bacteria 774
183 Ga0097621_101148116 3300006237 Bacteria 731
184 Ga0068871_100069244 3300006358 Bacteria 2897
185 Ga0068871_100563868 3300006358 Bacteria 1033
186 Ga0068871_100670593 3300006358 Bacteria 948
187 Ga0075428_100900193 3300006844 Bacteria 938
188 Ga0075428_101190204 3300006844 Bacteria 803
189 Ga0075430_100251128 3300006846 Bacteria 1465
190 Ga0075430_100274036 3300006846 Bacteria 1396
191 Ga0075430_100791198 3300006846 Bacteria 782
192 Ga0075431_100055316 3300006847 Bacteria 4093
193 Ga0075431_100594412 3300006847 Bacteria 1091
194 Ga0075433_10581499 3300006852 Bacteria 984
195 Ga0075434_100000786 3300006871 Bacteria 25115
196 Ga0075434_100516683 3300006871 Bacteria 1215
197 Ga0075434_101944936 3300006871 Bacteria 594
198 Ga0075429_100018599 3300006880 Bacteria 6018
199 Ga0068865_100067297 3300006881 Bacteria 2530
200 Ga0068865_100221774 3300006881 Bacteria 1479
201 Ga0068865_100373817 3300006881 Bacteria 1161
202 Ga0097620_100442088 3300006931 Bacteria 1397
203 Ga0097620_100477171 3300006931 Bacteria 1343
204 Ga0075435_100299169 3300007076 Bacteria 1376
205 Ga0075435_100882298 3300007076 Bacteria 780
206 Ga0105240_10670777 3300009093 Bacteria 1134
207 Ga0111539_10002146 3300009094 Bacteria 26383
208 Ga0111539_10022440 3300009094 Bacteria 7755
209 Ga0111539_10191789 3300009094 Bacteria 2384
210 Ga0105245_10201229 3300009098 Bacteria 1913
211 Ga0105245_10402884 3300009098 Bacteria 1368
212 Ga0105245_10474307 3300009098 Bacteria 1263
213 Ga0105245_10966606 3300009098 Bacteria 895
214 Ga0105245_12300497 3300009098 Bacteria 593
215 Ga0105247_10105674 3300009101 Bacteria 1805
216 Ga0105247_10404701 3300009101 Bacteria 973
217 Ga0114129_10032662 3300009147 Bacteria 7354
218 Ga0114129_10390242 3300009147 Bacteria 1836
219 Ga0105243_10003165 3300009148 Bacteria 13503
220 Ga0105243_10131313 3300009148 Bacteria 2125
221 Ga0105243_10666312 3300009148 Bacteria 1010
222 Ga0105243_10927599 3300009148 Bacteria 868
223 Ga0105243_11054363 3300009148 Bacteria 819
224 Ga0105243_11904318 3300009148 Bacteria 627
225 Ga0105241_10272074 3300009174 Bacteria 1443
226 Ga0105241_10413135 3300009174 Bacteria 1186
227 Ga0105242_10164853 3300009176 Bacteria 1943
228 Ga0105242_10398357 3300009176 Bacteria 1284
229 Ga0105242_10442874 3300009176 Bacteria 1223
230 Ga0105242_10477917 3300009176 Bacteria 1180
231 Ga0105242_10578403 3300009176 Bacteria 1081
232 Ga0105242_10773100 3300009176 Bacteria 948
233 Ga0105248_10078077 3300009177 Bacteria 3723
234 Ga0105248_10107501 3300009177 Bacteria 3146
235 Ga0105248_10432580 3300009177 Bacteria 1482
236 Ga0105248_10716572 3300009177 Bacteria 1129
237 Ga0105237_10106390 3300009545 Bacteria 2797
238 Ga0105237_10300843 3300009545 Bacteria 1607
239 Ga0105237_10739637 3300009545 Bacteria 990
240 Ga0105237_11341922 3300009545 Bacteria 721
241 Ga0105238_10123787 3300009551 Bacteria 2565
242 Ga0105238_12473612 3300009551 Bacteria 555
243 Ga0105249_10134506 3300009553 Bacteria 2364
244 Ga0105249_10288494 3300009553 Bacteria 1642
245 Ga0105249_10580696 3300009553 Bacteria 1174
246 Ga0105239_10212552 3300010375 Bacteria 2168
247 Ga0105239_10608596 3300010375 Bacteria 1247
248 Ga0105246_10184866 3300011119 Bacteria 1608
249 Ga0105246_10510445 3300011119 Bacteria 1023
250 Ga0157371_10103463 3300013102 Bacteria 2020
251 Ga0157370_10044206 3300013104 Bacteria 4283
252 Ga0157370_10430618 3300013104 Bacteria 1213
253 Ga0157369_10294155 3300013105 Bacteria 1690
254 Ga0157369_10308969 3300013105 Bacteria 1644
255 Ga0157374_10231986 3300013296 Bacteria 1813
256 Ga0157378_10042614 3300013297 Bacteria 4029
257 Ga0157378_10581176 3300013297 Bacteria 1129
258 Ga0157378_10816044 3300013297 Bacteria 959
259 Ga0157378_11217169 3300013297 Bacteria 793
260 Ga0163162_10116460 3300013306 Bacteria 2773
261 Ga0163162_10413980 3300013306 Bacteria 1480
262 Ga0163162_12408439 3300013306 Archaea 605
263 Ga0157372_10070816 3300013307 Bacteria 3925
264 Ga0157375_10109222 3300013308 Bacteria 2862
265 Ga0157375_10639901 3300013308 Bacteria 1220
266 Ga0157375_10757102 3300013308 Bacteria 1122
267 Ga0157375_11330107 3300013308 Bacteria 845
268 Ga0163163_11327939 3300014325 Bacteria 781
269 Ga0157380_10562925 3300014326 Bacteria 1120
270 Ga0157380_10823176 3300014326 Bacteria 948
271 Ga0157380_10925194 3300014326 Bacteria 900
272 Ga0157379_10007153 3300014968 Bacteria 9652
273 Ga0157379_10088025 3300014968 Bacteria 2784
274 Ga0157379_10253182 3300014968 Bacteria 1599
275 Ga0157376_10509778 3300014969 Bacteria 1184
276 Ga0157376_10827267 3300014969 Bacteria 940
277 Ga0157376_11795424 3300014969 Unclassified 649
278 Ga0157376_12021568 3300014969 Bacteria 614
279 Ga0163161_10180242 3300017792 Bacteria 1619
280 Ga0163161_10556826 3300017792 Bacteria 940
281 Ga0163161_10696024 3300017792 Bacteria 846
282 Ga0197907_11139921 3300020069 Bacteria 1075
283 Ga0206355_1498590 3300020076 Bacteria 594
284 Ga0206353_10037253 3300020082 Bacteria 5104
285 Ga0206353_11855795 3300020082 Bacteria 744
286 Ga0213874_10000742 3300021377 Bacteria 6614
287 Ga0224712_10493983 3300022467 Bacteria 591
288 Ga0224712_10559146 3300022467 Bacteria 556
289 Ga0207642_10027423 3300025899 Bacteria 2331
290 Ga0207642_10031521 3300025899 Bacteria 2221
291 Ga0207642_10050846 3300025899 Bacteria 1872
292 Ga0207642_10215693 3300025899 Bacteria 1069
293 Ga0207642_10372260 3300025899 Bacteria 848
294 Ga0207710_10268915 3300025900 Bacteria 856
295 Ga0207680_10074461 3300025903 Bacteria 2114
296 Ga0207680_10628216 3300025903 Bacteria 769
297 Ga0207680_11184430 3300025903 Bacteria 545
298 Ga0207645_10101757 3300025907 Bacteria 1854
299 Ga0207643_10049548 3300025908 Bacteria 2380
300 Ga0207705_10201819 3300025909 Bacteria 1507
301 Ga0207654_10232379 3300025911 Bacteria 1229
302 Ga0207654_10269917 3300025911 Bacteria 1147
303 Ga0207707_10079522 3300025912 Bacteria 2862
304 Ga0207707_11057458 3300025912 Bacteria 663
305 Ga0207695_10266081 3300025913 Bacteria 1611
306 Ga0207671_10743789 3300025914 Bacteria 779
307 Ga0207671_11182257 3300025914 Bacteria 599
308 Ga0207693_10002111 3300025915 Bacteria 17348
309 Ga0207693_11028962 3300025915 Bacteria 628
310 Ga0207660_10060043 3300025917 Bacteria 2732
311 Ga0207662_10036305 3300025918 Bacteria 2880
312 Ga0207662_10436137 3300025918 Bacteria 894
313 Ga0207657_10063513 3300025919 Bacteria 3156
314 Ga0207657_10240100 3300025919 Bacteria 1447
315 Ga0207657_10273269 3300025919 Bacteria 1343
316 Ga0207657_10475898 3300025919 Bacteria 979
317 Ga0207657_10954064 3300025919 Unclassified 659
318 Ga0207649_10185099 3300025920 Bacteria 1461
319 Ga0207649_10209184 3300025920 Bacteria 1383
320 Ga0207652_10130709 3300025921 Bacteria 2239
321 Ga0207652_10689921 3300025921 Bacteria 912
322 Ga0207694_10180235 3300025924 Bacteria 1713
323 Ga0207694_10391799 3300025924 Bacteria 1154
324 Ga0207659_10195733 3300025926 Bacteria 1611
325 Ga0207659_10556074 3300025926 Bacteria 976
326 Ga0207687_10051939 3300025927 Bacteria 2859
327 Ga0207687_10126402 3300025927 Bacteria 1920
328 Ga0207687_10161905 3300025927 Bacteria 1718
329 Ga0207687_10445780 3300025927 Bacteria 1073
330 Ga0207687_11114617 3300025927 Unclassified 678
331 Ga0207700_10534789 3300025928 Bacteria 1039
332 Ga0207644_10508492 3300025931 Bacteria 994
333 Ga0207690_10020430 3300025932 Bacteria 4092
334 Ga0207690_10183837 3300025932 Bacteria 1576
335 Ga0207690_10591336 3300025932 Bacteria 905
336 Ga0207706_10179311 3300025933 Bacteria 1861
337 Ga0207706_10277314 3300025933 Bacteria 1463
338 Ga0207706_10292489 3300025933 Unclassified 1420
339 Ga0207706_10469818 3300025933 Bacteria 1087
340 Ga0207686_10032621 3300025934 Bacteria 3101
341 Ga0207686_10313477 3300025934 Bacteria 1169
342 Ga0207686_10333573 3300025934 Bacteria 1137
343 Ga0207686_10480492 3300025934 Bacteria 961
344 Ga0207686_10618347 3300025934 Bacteria 854
345 Ga0207709_10087130 3300025935 Bacteria 2029
346 Ga0207709_10124891 3300025935 Bacteria 1744
347 Ga0207709_10176952 3300025935 Bacteria 1503
348 Ga0207709_10303829 3300025935 Bacteria 1188
349 Ga0207709_11316387 3300025935 Bacteria 597
350 Ga0207670_10141350 3300025936 Bacteria 1776
351 Ga0207670_10216938 3300025936 Bacteria 1462
352 Ga0207670_10381661 3300025936 Bacteria 1122
353 Ga0207670_10674171 3300025936 Bacteria 854
354 Ga0207669_10089011 3300025937 Bacteria 2004
355 Ga0207669_10197803 3300025937 Bacteria 1456
356 Ga0207704_10137454 3300025938 Bacteria 1703
357 Ga0207704_10511555 3300025938 Bacteria 970
358 Ga0207665_10172371 3300025939 Bacteria 1563
359 Ga0207665_10570998 3300025939 Bacteria 881
360 Ga0207691_10162263 3300025940 Bacteria 1960
361 Ga0207691_10916530 3300025940 Bacteria 733
362 Ga0207711_10260298 3300025941 Bacteria 1594
363 Ga0207711_10507833 3300025941 Bacteria 1124
364 Ga0207711_10717710 3300025941 Bacteria 932
365 Ga0207689_10282541 3300025942 Bacteria 1374
366 Ga0207689_10330995 3300025942 Bacteria 1265
367 Ga0207661_10021516 3300025944 Bacteria 4832
368 Ga0207661_10049387 3300025944 Bacteria 3349
369 Ga0207661_10114652 3300025944 Bacteria 2285
370 Ga0207661_12037704 3300025944 Unclassified 520
371 Ga0207679_10218078 3300025945 Bacteria 1604
372 Ga0207679_10908547 3300025945 Bacteria 805
373 Ga0207667_10323446 3300025949 Bacteria 1575
374 Ga0207651_10964039 3300025960 Bacteria 761
375 Ga0207712_10084100 3300025961 Bacteria 2324
376 Ga0207712_10259909 3300025961 Bacteria 1408
377 Ga0207668_10613497 3300025972 Bacteria 949
378 Ga0207668_12058372 3300025972 Bacteria 514
379 Ga0207640_10150422 3300025981 Bacteria 1710
380 Ga0207640_10864806 3300025981 Bacteria 787
381 Ga0207658_10999558 3300025986 Bacteria 763
382 Ga0207658_11256059 3300025986 Bacteria 677
383 Ga0207677_10635340 3300026023 Bacteria 941
384 Ga0207703_10020737 3300026035 Bacteria 5142
385 Ga0207703_10144273 3300026035 Bacteria 2069
386 Ga0207703_10836826 3300026035 Bacteria 880
387 Ga0207639_10116867 3300026041 Bacteria 2185
388 Ga0207639_12235384 3300026041 Bacteria 508
389 Ga0207678_10159765 3300026067 Bacteria 1925
390 Ga0207678_10256737 3300026067 Bacteria 1497
391 Ga0207678_10528664 3300026067 Bacteria 1030
392 Ga0207708_10011966 3300026075 Bacteria 6463
393 Ga0207708_10192159 3300026075 Bacteria 1625
394 Ga0207702_10112043 3300026078 Bacteria 2428
395 Ga0207702_10447598 3300026078 Bacteria 1253
396 Ga0207702_10919582 3300026078 Bacteria 867
397 Ga0207648_10013997 3300026089 Bacteria 7434
398 Ga0207648_10254154 3300026089 Bacteria 1567
399 Ga0207648_10275261 3300026089 Bacteria 1504
400 Ga0207648_10301708 3300026089 Bacteria 1436
401 Ga0207676_10265688 3300026095 Bacteria 1551
402 Ga0207674_10007320 3300026116 Bacteria 12857
403 Ga0207674_10067212 3300026116 Bacteria 3609
404 Ga0207674_11149333 3300026116 Bacteria 746
405 Ga0207674_11340511 3300026116 Bacteria 685
406 Ga0207675_100532269 3300026118 Bacteria 1173
407 Ga0207675_100648255 3300026118 Bacteria 1062
408 Ga0207683_10014854 3300026121 Bacteria 6630
409 Ga0207683_10209069 3300026121 Bacteria 1775
410 Ga0207683_10665181 3300026121 Bacteria 965
411 Ga0207698_10046377 3300026142 Bacteria 3281
412 Ga0207698_10155328 3300026142 Bacteria 1992
413 Ga0207428_10362862 3300027907 Bacteria 1065
414 Ga0207428_10964025 3300027907 Bacteria 600
415 Ga0268266_10353810 3300028379 Bacteria 1381
416 Ga0268265_10321629 3300028380 Bacteria 1401
417 Ga0268265_10501309 3300028380 Bacteria 1144
418 Ga0268264_10025249 3300028381 Bacteria 4853
419 Ga0268264_10144333 3300028381 Bacteria 2126
420 Ga0268264_11386887 3300028381 Unclassified 713
421 Ga0307408_100029387 3300031548 Bacteria 3808
422 Ga0307405_10001616 3300031731 Bacteria 9585
423 Ga0307405_11440754 3300031731 Bacteria 603
424 Ga0307413_10000425 3300031824 Bacteria 13666
425 Ga0307410_10055743 3300031852 Bacteria 2684
426 Ga0307410_10170084 3300031852 Bacteria 1641
427 Ga0307406_10042715 3300031901 Bacteria 2831
428 Ga0307406_10067425 3300031901 Bacteria 2333
429 Ga0307406_10380590 3300031901 Bacteria 1113
430 Ga0307407_10007563 3300031903 Bacteria 4927
431 Ga0307412_10025594 3300031911 Bacteria 3656
432 Ga0307412_10027656 3300031911 Bacteria 3539
433 Ga0307412_10459724 3300031911 Unclassified 1051
434 Ga0307409_100010588 3300031995 Bacteria 5747
435 Ga0307409_100176257 3300031995 Bacteria 1887
436 Ga0307409_102105006 3300031995 Unclassified 594
437 Ga0307416_100001434 3300032002 Bacteria 12951
438 Ga0307416_100092970 3300032002 Bacteria 2596
439 Ga0307414_10270241 3300032004 Bacteria 1423
440 Ga0307414_11767850 3300032004 Bacteria 577
441 Ga0307411_10009082 3300032005 Bacteria 5202
442 Ga0307411_10049512 3300032005 Bacteria 2731
443 Ga0307415_100000579 3300032126 Bacteria 16085
444 Ga0307415_100046886 3300032126 Bacteria 2906
445 Ga0307415_100064978 3300032126 Bacteria 2541
446 Ga0307415_100243395 3300032126 Bacteria 1456
447 Ga0307415_102531482 3300032126 Bacteria 506
448 Ga0373939_0268965 3300035114 Bacteria 669
449 Ga0373941_0029909 3300035115 Bacteria 1611
450 Ga0373960_0036961 3300035121 Bacteria 1394
451 Ga0373924_0092405 3300035410 Bacteria 1296
452 Ga0373947_0467808 3300035725 Bacteria 855
453 Ga0395899_0354606 3300037312 Bacteria 980
454 Ga0395899_0433746 3300037312 Bacteria 863
455 Ga0395900_0024273 3300037418 Bacteria 6208
456 Ga0395898_0002944 3300037466 Bacteria 19369
457 Ga0395898_0319969 3300037466 Bacteria 1480
458 Ga0395898_0763375 3300037466 Bacteria 908
459 Ga0395905_0154109 3300037471 Bacteria 2161
460 Ga0395905_0234601 3300037471 Bacteria 1715
461 Ga0395901_0013902 3300038443 Bacteria 8190
462 Ga0395901_0104247 3300038443 Bacteria 2976
463 Ga0395901_0959828 3300038443 Bacteria 833
464 Ga0436365_0221202 3300039437 Bacteria 1724
465 Ga0436365_0998727 3300039437 Unclassified 593
466 Ga0436365_1475474 3300039437 Bacteria 10212
467 Ga0436363_0932759 3300039450 Bacteria 40920
468 Ga0436362_0729634 3300039453 Bacteria 3004
469 Ga0436362_0821543 3300039453 Bacteria 1269
470 Ga0436362_1149174 3300039453 Bacteria 791
471 Ga0451807_0812175 3300041486 Bacteria 849
472 Ga0451839_0594227 3300041496 Bacteria 1246
473 Ga0451851_0500192 3300041507 Bacteria 752
474 Ga0451843_0511931 3300041509 Bacteria 565
475 Ga0439448_0094173 3300042005 Bacteria 1014
476 Ga0450907_047591 3300042146 Bacteria 736
477 Ga0439464_0072396 3300042439 Bacteria 1021
478 Ga0466965_0081191 3300044683 Bacteria 1639
479 Ga0466966_0041563 3300044684 Bacteria 2954
480 Ga0466963_0003321 3300044694 Bacteria 9179
481 Ga0466963_0167117 3300044694 Bacteria 1532
482 Ga0466968_0031881 3300044735 Bacteria 2189
483 Ga0466970_0097779 3300044765 Bacteria 1597
484 Ga0466957_0028536 3300044842 Bacteria 3324
485 Ga0466957_0305796 3300044842 Bacteria 1069
486 Ga0466957_0622643 3300044842 Bacteria 757
487 Ga0466960_0319120 3300044901 Bacteria 879
488 Ga0466959_0045119 3300045049 Bacteria 3247
489 Ga0466959_0286488 3300045049 Bacteria 1130
490 Ga0451576_0328694 3300045051 Bacteria 1600
491 Ga0466958_0003202 3300045836 Bacteria 8446
492 Ga0466958_0046480 3300045836 Bacteria 2619
493 Ga0466967_0027629 3300045976 Bacteria 4722
494 Ga0466967_0032544 3300045976 Bacteria 4403
495 Ga0466967_1688110 3300045976 Bacteria 631
496 Ga0495617_062345 3300046452 Bacteria 1232
497 Ga0495592_0792248 3300046454 Bacteria 564
498 Ga0495605_0046202 3300046474 Bacteria 2142
499 Ga0495584_0085733 3300046491 Bacteria 1587
500 Ga0495596_0104554 3300046500 Bacteria 1100
501 Ga0495596_0319756 3300046500 Bacteria 603
502 Ga0495607_0430714 3300046501 Unclassified 595
503 Ga0495583_0227894 3300046506 Bacteria 752
504 Ga0495608_0438266 3300046511 Bacteria 796
505 Ga0495616_0080053 3300046513 Bacteria 1565
506 Ga0495628_0062768 3300046516 Bacteria 2912
507 Ga0495630_0092942 3300046517 Bacteria 2280
508 Ga0495630_0785507 3300046517 Bacteria 727
509 Ga0495631_0024361 3300046518 Bacteria 2794
510 Ga0495631_0121450 3300046518 Bacteria 1124
511 Ga0495637_0123264 3300046520 Bacteria 995
512 Ga0495644_0141722 3300046523 Bacteria 918
513 Ga0495642_0158839 3300046528 Bacteria 980
514 Ga0495642_0195355 3300046528 Bacteria 882
515 Ga0495652_0870714 3300046529 Bacteria 596
516 Ga0495654_0360717 3300046530 Bacteria 583
517 Ga0495640_0116756 3300046533 Bacteria 1738
518 Ga0495640_0445066 3300046533 Bacteria 792
519 Ga0495586_0484579 3300046535 Bacteria 713
520 Ga0495621_0138546 3300046539 Bacteria 951
521 Ga0495597_0093486 3300046542 Bacteria 1274
522 Ga0495668_0420288 3300046616 Bacteria 735
523 Ga0495659_0230047 3300046664 Bacteria 768
524 Ga0495661_0362729 3300046665 Bacteria 711
525 Ga0495599_0379234 3300046678 Bacteria 844
526 Ga0495669_0237321 3300046684 Bacteria 875
527 Ga0495670_0134124 3300046691 Bacteria 1292
528 Ga0495671_0095193 3300046692 Bacteria 1457
529 Ga0495589_0049988 3300046794 Bacteria 2069
530 Ga0495589_0055282 3300046794 Bacteria 1956
531 Ga0495600_0466041 3300046809 Bacteria 780
532 Ga0495660_0217363 3300046810 Bacteria 903
533 Ga0495604_0538545 3300047317 Bacteria 754
534 Ga0495636_0245468 3300047318 Bacteria 827
535 Ga0495674_0316623 3300047319 Bacteria 1272
536 Ga0495674_0340887 3300047319 Bacteria 1218
537 Ga0495680_0162453 3300047322 Bacteria 1621
538 Ga0495684_0040398 3300047471 Bacteria 3577
539 Ga0495686_0332096 3300047472 Bacteria 831
540 Ga0495626_0131403 3300048091 Bacteria 1069
541 Ga0496100_0013520 3300048903 Bacteria 4711
542 Ga0496100_0079696 3300048903 Bacteria 2207
543 Ga0496100_0133948 3300048903 Bacteria 1748
544 Ga0496100_0311682 3300048903 Bacteria 1180
545 Ga0496101_0082036 3300048904 Bacteria 2386
546 Ga0496101_0219980 3300048904 Bacteria 1473
547 Ga0496101_0333050 3300048904 Bacteria 1192
548 Ga0496101_0555569 3300048904 Bacteria 908
549 Ga0496102_0035022 3300048905 Bacteria 4518
550 Ga0496102_0257120 3300048905 Bacteria 1646
551 Ga0496102_0278573 3300048905 Bacteria 1576
552 Ga0496102_0527759 3300048905 Bacteria 1103
553 Ga0496103_0098972 3300048906 Bacteria 1845
554 Ga0496103_0202885 3300048906 Bacteria 1275
555 Ga0496103_0211899 3300048906 Bacteria 1246
556 Ga0496103_0219385 3300048906 Bacteria 1223
557 Ga0496103_0304401 3300048906 Bacteria 1025
558 Ga0496104_0055370 3300048907 Bacteria 3750
559 Ga0496104_0062138 3300048907 Bacteria 3541
560 Ga0496104_0146930 3300048907 Bacteria 2264
561 Ga0496104_0730021 3300048907 Bacteria 898
562 Ga0496104_0778170 3300048907 Bacteria 863
563 Ga0496104_1244609 3300048907 Bacteria 647
564 Ga0496105_0013430 3300048908 Bacteria 6501
565 Ga0496105_0014694 3300048908 Bacteria 6233
566 Ga0496105_0138994 3300048908 Bacteria 2000
567 Ga0496105_0669575 3300048908 Bacteria 799
568 Ga0496105_1201554 3300048908 Bacteria 558
569 Ga0496106_0000345 3300048909 Bacteria 32805
570 Ga0496106_0026528 3300048909 Bacteria 4314
571 Ga0496106_0130241 3300048909 Bacteria 1972
572 Ga0496106_0146525 3300048909 Bacteria 1860
573 Ga0496106_0245679 3300048909 Bacteria 1430
574 Ga0496106_0833406 3300048909 Bacteria 730
575 Ga0496107_0005250 3300048910 Bacteria 8841
576 Ga0496107_0038229 3300048910 Bacteria 3444
577 Ga0496107_0132931 3300048910 Bacteria 1837
578 Ga0496108_0054584 3300048911 Bacteria 3353
579 Ga0496108_0187598 3300048911 Bacteria 1791
580 Ga0496108_0295022 3300048911 Bacteria 1412
581 Ga0496108_0490140 3300048911 Bacteria 1073
582 Ga0496109_0001854 3300048912 Bacteria 17506
583 Ga0496109_0011279 3300048912 Bacteria 7676
584 Ga0496109_0113960 3300048912 Bacteria 2515
585 Ga0496109_0364335 3300048912 Bacteria 1365
586 Ga0496109_0623984 3300048912 Bacteria 1014
587 Ga0496109_0760415 3300048912 Bacteria 907
588 Ga0496109_0887453 3300048912 Bacteria 829
589 Ga0496110_0000112 3300048913 Bacteria 44496
590 Ga0496110_0136402 3300048913 Bacteria 2217
591 Ga0496110_0417462 3300048913 Bacteria 1223
592 Ga0496110_0540907 3300048913 Bacteria 1059
593 Ga0496111_0000091 3300048914 Bacteria 38326
594 Ga0496111_0004683 3300048914 Bacteria 8673
595 Ga0496111_0126425 3300048914 Bacteria 1890
596 Ga0496111_0321822 3300048914 Bacteria 1145
597 Ga0496112_0139005 3300048915 Bacteria 2398
598 Ga0496112_0448438 3300048915 Bacteria 1228
599 Ga0496112_1005554 3300048915 Bacteria 754
600 Ga0496113_0117001 3300048916 Bacteria 2080
601 Ga0496113_0276033 3300048916 Bacteria 1344
602 Ga0496113_0523800 3300048916 Bacteria 951
603 Ga0496114_0004472 3300048917 Bacteria 10852
604 Ga0496114_0031545 3300048917 Bacteria 4360
605 Ga0496114_0149403 3300048917 Bacteria 2026
606 Ga0496114_0328426 3300048917 Bacteria 1352
607 Ga0496115_0145861 3300048918 Bacteria 1953
608 Ga0496115_0847027 3300048918 Bacteria 708
609 Ga0501031_0000336 3300049568 Bacteria 27217
610 Ga0501031_0001206 3300049568 Bacteria 15783
611 Ga0501031_0042611 3300049568 Bacteria 2962
612 Ga0501031_0107878 3300049568 Bacteria 1818
613 Ga0501031_0338036 3300049568 Bacteria 975
614 Ga0501031_0824913 3300049568 Bacteria 594
615 Ga0501032_0000805 3300049569 Bacteria 25528
616 Ga0501032_0057417 3300049569 Bacteria 2615
617 Ga0501032_0266765 3300049569 Bacteria 1110
618 Ga0501033_0000239 3300049570 Bacteria 52812
619 Ga0501033_0018600 3300049570 Bacteria 5252
620 Ga0501034_0025606 3300049571 Bacteria 6007
621 Ga0501034_0028808 3300049571 Bacteria 5650
622 Ga0501034_0454910 3300049571 Bacteria 1198
623 Ga0501036_0000107 3300049572 Bacteria 51071
624 Ga0501036_0004032 3300049572 Bacteria 11810
625 Ga0501036_0135529 3300049572 Bacteria 2078
626 Ga0501036_0410056 3300049572 Bacteria 1130
627 Ga0501036_0509083 3300049572 Bacteria 1001
628 Ga0501036_1090431 3300049572 Bacteria 652
629 Ga0501037_0001895 3300049573 Bacteria 15212
630 Ga0501037_0003172 3300049573 Bacteria 11938
631 Ga0501038_0000367 3300049574 Bacteria 39046
632 Ga0501038_0016761 3300049574 Bacteria 6635
633 Ga0501038_0159603 3300049574 Bacteria 1833
634 Ga0501038_0205362 3300049574 Unclassified 1579
635 Ga0501039_0001144 3300049575 Bacteria 19565
636 Ga0501039_0002766 3300049575 Bacteria 13085
637 Ga0501039_0074914 3300049575 Bacteria 2631
638 Ga0501039_0743593 3300049575 Bacteria 766
639 Ga0501040_0000890 3300049576 Bacteria 18762
640 Ga0501040_0001961 3300049576 Bacteria 13251
641 Ga0501040_0006892 3300049576 Bacteria 7360
642 Ga0501040_0057791 3300049576 Bacteria 2664
643 Ga0501041_0000011 3300049577 Bacteria 58729
644 Ga0501041_0000539 3300049577 Bacteria 19566
645 Ga0501041_0003697 3300049577 Bacteria 8794
646 Ga0501042_0000775 3300049578 Bacteria 17432
647 Ga0501042_0003214 3300049578 Bacteria 10208
648 Ga0501042_0024506 3300049578 Bacteria 4232
649 Ga0501042_0132795 3300049578 Bacteria 1794
650 Ga0501042_0310657 3300049578 Bacteria 1139
651 Ga0501042_0380038 3300049578 Bacteria 1022
652 Ga0501042_0748798 3300049578 Bacteria 711
653 Ga0501043_0000477 3300049579 Bacteria 35754
654 Ga0501043_0006617 3300049579 Bacteria 9272
655 Ga0501043_0688785 3300049579 Bacteria 747
656 Ga0501046_0001077 3300049580 Bacteria 26750
657 Ga0501046_0002122 3300049580 Bacteria 18762
658 Ga0501046_0159484 3300049580 Bacteria 1697
659 Ga0501046_1073971 3300049580 Bacteria 557
660 Ga0501047_0000743 3300049581 Bacteria 33980
661 Ga0501047_0005763 3300049581 Bacteria 11662
662 Ga0501048_0000339 3300049582 Bacteria 32273
663 Ga0501048_0004066 3300049582 Bacteria 11135
664 Ga0501048_0165010 3300049582 Bacteria 1568
665 Ga0501067_0000018 3300049583 Bacteria 101701
666 Ga0501067_0035330 3300049583 Bacteria 2775
667 Ga0501067_0081340 3300049583 Bacteria 1796
668 Ga0501067_0109330 3300049583 Bacteria 1537
669 Ga0501068_0000241 3300049584 Bacteria 26764
670 Ga0501068_0000484 3300049584 Bacteria 20122
671 Ga0501068_0001711 3300049584 Bacteria 11682
672 Ga0501068_0012126 3300049584 Bacteria 4876
673 Ga0501068_0021163 3300049584 Bacteria 3796
674 Ga0501068_0482866 3300049584 Unclassified 803
675 Ga0501069_0000087 3300049585 Bacteria 44347
676 Ga0501069_0002001 3300049585 Bacteria 10203
677 Ga0501069_0016414 3300049585 Bacteria 3978
678 Ga0501069_0113529 3300049585 Bacteria 1544
679 Ga0501069_0243350 3300049585 Bacteria 1048
680 Ga0501070_0005743 3300049586 Bacteria 10578
681 Ga0501070_0006181 3300049586 Bacteria 10203
682 Ga0501070_0124212 3300049586 Bacteria 2133
683 Ga0501071_0000208 3300049587 Bacteria 26807
684 Ga0501071_0000718 3300049587 Bacteria 17432
685 Ga0501071_0015079 3300049587 Bacteria 5298
686 Ga0501071_0035104 3300049587 Bacteria 3571
687 Ga0501071_0059246 3300049587 Bacteria 2770
688 Ga0501071_0083080 3300049587 Bacteria 2346
689 Ga0501071_0321644 3300049587 Bacteria 1175
690 Ga0501072_0000561 3300049588 Bacteria 26764
691 Ga0501072_0000698 3300049588 Bacteria 24299
692 Ga0501072_0003450 3300049588 Bacteria 11907
693 Ga0501072_0406339 3300049588 Bacteria 1080
694 Ga0501072_0494648 3300049588 Bacteria 967
695 Ga0501072_1316856 3300049588 Bacteria 560
696 Ga0501073_0001339 3300049589 Bacteria 18158
697 Ga0501073_0002471 3300049589 Bacteria 13808
698 Ga0501074_0000158 3300049590 Bacteria 35682
699 Ga0501074_0003135 3300049590 Bacteria 11662
700 Ga0501074_0122176 3300049590 Bacteria 1862
701 Ga0501075_0000556 3300049591 Bacteria 22580
702 Ga0501075_0000906 3300049591 Bacteria 18762
703 Ga0501075_0014968 3300049591 Bacteria 5564
704 Ga0501075_0236035 3300049591 Unclassified 1394
705 Ga0501076_0000289 3300049592 Bacteria 31371
706 Ga0501076_0000972 3300049592 Bacteria 18762
707 Ga0501076_0029691 3300049592 Bacteria 4253
708 Ga0501076_0060130 3300049592 Bacteria 3022
709 Ga0501076_0223061 3300049592 Bacteria 1540
710 Ga0501076_1349139 3300049592 Bacteria 586
711 Ga0501077_0000371 3300049593 Bacteria 26807
712 Ga0501077_0010113 3300049593 Bacteria 5873
713 Ga0501077_0010383 3300049593 Bacteria 5792
714 Ga0501077_0601796 3300049593 Bacteria 706
715 Ga0501079_0000053 3300049741 Bacteria 51071
716 Ga0501079_0001559 3300049741 Bacteria 16252
717 Ga0501079_0038743 3300049741 Bacteria 3675
718 Ga0501079_0150202 3300049741 Bacteria 1816
719 Ga0501080_0000136 3300049742 Bacteria 52047
720 Ga0501080_0027868 3300049742 Bacteria 5252
721 Ga0501080_0206225 3300049742 Bacteria 1803
722 Ga0501081_0000025 3300049743 Bacteria 54545
723 Ga0501081_0000896 3300049743 Bacteria 17655
724 Ga0501081_0133761 3300049743 Bacteria 1773
725 Ga0501081_0995506 3300049743 Bacteria 633
726 Ga0501083_0000234 3300049744 Bacteria 35676
727 Ga0501083_0016002 3300049744 Bacteria 5252
728 Ga0501083_0198550 3300049744 Bacteria 1309
729 Ga0501035_0002153 3300049822 Bacteria 19556
730 Ga0501035_0094345 3300049822 Bacteria 2631
731 Ga0501044_0035109 3300049823 Bacteria 5252
732 Ga0501044_0237779 3300049823 Bacteria 1766
733 Ga0501045_0000035 3300049824 Bacteria 58729
734 Ga0501045_0001138 3300049824 Bacteria 17612
735 Ga0501045_0004139 3300049824 Bacteria 10020
736 Ga0501045_0481142 3300049824 Bacteria 922
737 Ga0501045_0519031 3300049824 Bacteria 884
738 Ga0501045_0571292 3300049824 Bacteria 838
739 nmdc:mga05p37_5607_c1 3300050507 Bacteria 14753
740 nmdc:mga05p37_84091_c1 3300050507 Bacteria 3921
741 nmdc:mga05p37_995322_c1 3300050507 Bacteria 891
742 nmdc:mga09592_12624_c1 3300050508 Bacteria 6887
743 nmdc:mga09592_312246_c1 3300050508 Bacteria 1362
744 nmdc:mga0qj67_1514824_c1 3300050509 Bacteria 516
745 nmdc:mga0qj67_225222_c1 3300050509 Bacteria 1522
746 nmdc:mga06r32_463284_c1 3300050510 Bacteria 1246
747 nmdc:mga06r32_808394_c1 3300050510 Bacteria 898
748 nmdc:mga08y16_29853_c1 3300050511 Bacteria 5742
749 nmdc:mga08y16_409466_c1 3300050511 Bacteria 1387
750 nmdc:mga08y16_91012_c1 3300050511 Bacteria 3180
751 nmdc:mga0n895_1008705_c1 3300050512 Bacteria 813
752 nmdc:mga0n895_19443_c1 3300050512 Bacteria 6314
753 nmdc:mga0rr50_344713_c1 3300050513 Bacteria 1252
754 nmdc:mga0rr50_40348_c1 3300050513 Bacteria 3393
755 nmdc:mga0rr50_411112_c1 3300050513 Bacteria 1144
756 nmdc:mga0a205_134102_c1 3300050515 Bacteria 2377
757 nmdc:mga0a205_336575_c1 3300050515 Bacteria 1378
758 Ga0495655_0047704 3300053083 Bacteria 1122
759 Ga0495595_0021868 3300053084 Bacteria 2800
760 Ga0501084_0000336 3300054114 Bacteria 35754
761 Ga0501084_0001449 3300054114 Bacteria 18819
762 Ga0501084_0029370 3300054114 Bacteria 4599
763 Ga0501084_0735248 3300054114 Bacteria 831
764 Ga0590075_037004 3300059424 Bacteria 1244
765 Ga0590077_009333 3300059426 Bacteria 2010
766 Ga0501082_0001222 3300060353 Bacteria 22580
767 Ga0501082_0001990 3300060353 Bacteria 17951
768 Ga0501082_0270372 3300060353 Unclassified 1479
769 Ga0501082_0313168 3300060353 Bacteria 1367
770 Ga0501082_0431268 3300060353 Bacteria 1151
771 Ga0466962_0047557 3300061719 Bacteria 2050
772 Ga0530510_0000445 3300061734 Bacteria 26717
773 Ga0530510_0001100 3300061734 Bacteria 17951
774 Ga0530510_0002147 3300061734 Bacteria 13539
775 Ga0530510_0003302 3300061734 Bacteria 11108
776 Ga0530510_0098712 3300061734 Bacteria 2135
777 Ga0530510_0963441 3300061734 Bacteria 652
778 Ga0207692_10310725
779 JGI25406J46586_10059266
780 JGI25407J50210_10002159
781 JGI25407J50210_10002944
782 JGI25407J50210_10021302
783 JGI25407J50210_10025127
784 JGI25407J50210_10027536
785 JGI25407J50210_10051231
786 JGI25404J52841_10134229
787 Ga0058860_12028200
788 Ga0058862_12754142
789 Ga0070658_10525032
790 Ga0070658_11001035
791 Ga0070676_10385468
792 Ga0070683_100049255
793 Ga0070683_100060005
794 Ga0070683_100756997
795 Ga0070690_100374847
796 Ga0070670_101300681
797 Ga0068869_100212239
798 Ga0068869_100337064
799 Ga0070680_100104340
800 Ga0070680_100124370
801 Ga0070680_100407952
802 Ga0070682_100522195
803 Ga0068868_100221130
804 Ga0068868_100987243
805 Ga0070660_100039827
806 Ga0070660_100626186
807 Ga0070660_101340248
808 Ga0070660_101501908
809 Ga0070689_100872769
810 Ga0070689_100886775
811 Ga0070689_100896217
812 Ga0070691_10127730
813 Ga0070687_100172548
814 Ga0070687_100813718
815 Ga0070661_100221677
816 Ga0070661_100334152
817 Ga0070692_10104927
818 Ga0070692_10153948
819 Ga0070692_10167308
820 Ga0070692_10246915
821 Ga0070668_100107412
822 Ga0070668_100467885
823 Ga0070675_101179711
824 Ga0070674_100176909
825 Ga0070674_100189300
826 Ga0070674_100217550
827 Ga0070674_100240674
828 Ga0070673_100992031
829 Ga0070688_100078229
830 Ga0070688_100214260
831 Ga0070688_101109944
832 Ga0070659_100031781
833 Ga0070659_100666781
834 Ga0070659_100899145
835 Ga0070667_100094094
836 Ga0070667_100485202
837 Ga0070667_100536382
838 Ga0070709_10486296
839 Ga0070714_100039831
840 Ga0070713_100581623
841 Ga0070710_10047865
842 Ga0070701_10079301
843 Ga0070701_10330577
844 Ga0070701_10449512
845 Ga0070711_100029514
846 Ga0070711_100524293
847 Ga0070705_100229500
848 Ga0070705_101540001
849 Ga0070700_100033149
850 Ga0070700_100071050
851 Ga0070700_100522928
852 Ga0070694_100385667
853 Ga0070694_100695904
854 Ga0070694_100713072
855 Ga0070663_101446107
856 Ga0070678_100027290
857 Ga0070678_101876403
858 Ga0070662_100480875
859 Ga0070662_100542749
860 Ga0070662_100710336
861 Ga0070681_10028469
862 Ga0070681_10774459
863 Ga0068867_100156753
864 Ga0068867_100197830
865 Ga0068867_100808395
866 Ga0068867_100872200
867 Ga0070685_10201194
868 Ga0070698_100736165
869 Ga0070679_100017355
870 Ga0070684_100013395
871 Ga0070684_100190323
872 Ga0070697_100249425
873 Ga0070697_101659533
874 Ga0068853_100443989
875 Ga0070672_100064357
876 Ga0070672_100102794
877 Ga0070672_101056831
878 Ga0070672_101136052
879 Ga0070686_100163363
880 Ga0070686_100253550
881 Ga0070686_100330927
882 Ga0070695_100695291
883 Ga0070695_101588333
884 Ga0070696_100273819
885 Ga0070696_100583044
886 Ga0070693_100073605
887 Ga0070693_100182545
888 Ga0070693_100205945
889 Ga0070693_100414731
890 Ga0070704_100374702
891 Ga0070704_100431994
892 Ga0070704_101229960
893 Ga0070704_101360324
894 Ga0068855_100835715
895 Ga0068855_101254361
896 Ga0070664_100228285
897 Ga0070664_100314568
898 Ga0070664_100446074
899 Ga0070664_100539837
900 Ga0068857_100061966
901 Ga0068857_100674458
902 Ga0068857_101577262
903 Ga0068854_100286618
904 Ga0068854_100343536
905 Ga0068854_100478865
906 Ga0068856_100095535
907 Ga0068856_100887340
908 Ga0068856_100935390
909 Ga0070702_100010571
910 Ga0070702_100024997
911 Ga0070702_100045716
912 Ga0070702_100119079
913 Ga0068852_100018502
914 Ga0068852_100524706
915 Ga0068859_100442070
916 Ga0068859_100477154
917 Ga0068864_100404515
918 Ga0068866_10010222
919 Ga0068866_10023976
920 Ga0068866_10161257
921 Ga0068866_10799230
922 Ga0068861_100372701
923 Ga0068870_10182901
924 Ga0068870_10213812
925 Ga0068870_10332781
926 Ga0068863_100558673
927 Ga0068858_100080297
928 Ga0068858_100239965
929 Ga0068858_100537943
930 Ga0068860_100010313
931 Ga0068860_101770357
932 Ga0068862_100114212
933 Ga0068862_100212363
934 Ga0081455_10066007
935 Ga0081455_10138487
936 Ga0081538_10000042
937 Ga0081538_10000122
938 Ga0081538_10001386
939 Ga0081538_10002404
940 Ga0081538_10006596
941 Ga0081538_10007617
942 Ga0081538_10007718
943 Ga0081538_10018668
944 Ga0081538_10027157
945 Ga0081538_10033602
946 Ga0081538_10039259
947 Ga0081538_10051330
948 Ga0081538_10080430
949 Ga0081538_10145543
950 Ga0081538_10200911
951 Ga0081540_1064330
952 Ga0081539_10000294
953 Ga0081539_10002271
954 Ga0075432_10022513
955 Ga0070716_100041740
956 Ga0070712_100017836
957 Ga0097621_100081461
958 Ga0097621_100726498
959 Ga0097621_101022415
960 Ga0097621_101148116
961 Ga0068871_100069244
962 Ga0068871_100563868
963 Ga0068871_100670593
964 Ga0075428_100900193
965 Ga0075428_101190204
966 Ga0075430_100251128
967 Ga0075430_100274036
968 Ga0075430_100791198
969 Ga0075431_100055316
970 Ga0075431_100594412
971 Ga0075433_10581499
972 Ga0075434_100000786
973 Ga0075434_100516683
974 Ga0075434_101944936
975 Ga0075429_100018599
976 Ga0068865_100067297
977 Ga0068865_100221774
978 Ga0068865_100373817
979 Ga0097620_100442088
980 Ga0097620_100477171
981 Ga0075435_100299169
982 Ga0075435_100882298
983 Ga0105240_10670777
984 Ga0111539_10002146
985 Ga0111539_10022440
986 Ga0111539_10191789
987 Ga0105245_10201229
988 Ga0105245_10402884
989 Ga0105245_10474307
990 Ga0105245_10966606
991 Ga0105245_12300497
992 Ga0105247_10105674
993 Ga0105247_10404701
994 Ga0114129_10032662
995 Ga0114129_10390242
996 Ga0105243_10003165
997 Ga0105243_10131313
998 Ga0105243_10666312
999 Ga0105243_10927599
1000 Ga0105243_11054363
1001 Ga0105243_11904318
1002 Ga0105241_10272074
1003 Ga0105241_10413135
1004 Ga0105242_10164853
1005 Ga0105242_10398357
1006 Ga0105242_10442874
1007 Ga0105242_10477917
1008 Ga0105242_10578403
1009 Ga0105242_10773100
1010 Ga0105248_10078077
1011 Ga0105248_10107501
1012 Ga0105248_10432580
1013 Ga0105248_10716572
1014 Ga0105237_10106390
1015 Ga0105237_10300843
1016 Ga0105237_10739637
1017 Ga0105237_11341922
1018 Ga0105238_10123787
1019 Ga0105238_12473612
1020 Ga0105249_10134506
1021 Ga0105249_10288494
1022 Ga0105249_10580696
1023 Ga0105239_10212552
1024 Ga0105239_10608596
1025 Ga0105246_10184866
1026 Ga0105246_10510445
1027 Ga0157371_10103463
1028 Ga0157370_10044206
1029 Ga0157370_10430618
1030 Ga0157369_10294155
1031 Ga0157369_10308969
1032 Ga0157374_10231986
1033 Ga0157378_10042614
1034 Ga0157378_10581176
1035 Ga0157378_10816044
1036 Ga0157378_11217169
1037 Ga0163162_10116460
1038 Ga0163162_10413980
1039 Ga0163162_12408439
1040 Ga0157372_10070816
1041 Ga0157375_10109222
1042 Ga0157375_10639901
1043 Ga0157375_10757102
1044 Ga0157375_11330107
1045 Ga0163163_11327939
1046 Ga0157380_10562925
1047 Ga0157380_10823176
1048 Ga0157380_10925194
1049 Ga0157379_10007153
1050 Ga0157379_10088025
1051 Ga0157379_10253182
1052 Ga0157376_10509778
1053 Ga0157376_10827267
1054 Ga0157376_11795424
1055 Ga0157376_12021568
1056 Ga0163161_10180242
1057 Ga0163161_10556826
1058 Ga0163161_10696024
1059 Ga0197907_11139921
1060 Ga0206355_1498590
1061 Ga0206353_10037253
1062 Ga0206353_11855795
1063 Ga0213874_10000742
1064 Ga0224712_10493983
1065 Ga0224712_10559146
1066 Ga0207642_10027423
1067 Ga0207642_10031521
1068 Ga0207642_10050846
1069 Ga0207642_10215693
1070 Ga0207642_10372260
1071 Ga0207710_10268915
1072 Ga0207680_10074461
1073 Ga0207680_10628216
1074 Ga0207680_11184430
1075 Ga0207645_10101757
1076 Ga0207643_10049548
1077 Ga0207705_10201819
1078 Ga0207654_10232379
1079 Ga0207654_10269917
1080 Ga0207707_10079522
1081 Ga0207707_11057458
1082 Ga0207695_10266081
1083 Ga0207671_10743789
1084 Ga0207671_11182257
1085 Ga0207693_10002111
1086 Ga0207693_11028962
1087 Ga0207660_10060043
1088 Ga0207662_10036305
1089 Ga0207662_10436137
1090 Ga0207657_10063513
1091 Ga0207657_10240100
1092 Ga0207657_10273269
1093 Ga0207657_10475898
1094 Ga0207657_10954064
1095 Ga0207649_10185099
1096 Ga0207649_10209184
1097 Ga0207652_10130709
1098 Ga0207652_10689921
1099 Ga0207694_10180235
1100 Ga0207694_10391799
1101 Ga0207659_10195733
1102 Ga0207659_10556074
1103 Ga0207687_10051939
1104 Ga0207687_10126402
1105 Ga0207687_10161905
1106 Ga0207687_10445780
1107 Ga0207687_11114617
1108 Ga0207700_10534789
1109 Ga0207644_10508492
1110 Ga0207690_10020430
1111 Ga0207690_10183837
1112 Ga0207690_10591336
1113 Ga0207706_10179311
1114 Ga0207706_10277314
1115 Ga0207706_10292489
1116 Ga0207706_10469818
1117 Ga0207686_10032621
1118 Ga0207686_10313477
1119 Ga0207686_10333573
1120 Ga0207686_10480492
1121 Ga0207686_10618347
1122 Ga0207709_10087130
1123 Ga0207709_10124891
1124 Ga0207709_10176952
1125 Ga0207709_10303829
1126 Ga0207709_11316387
1127 Ga0207670_10141350
1128 Ga0207670_10216938
1129 Ga0207670_10381661
1130 Ga0207670_10674171
1131 Ga0207669_10089011
1132 Ga0207669_10197803
1133 Ga0207704_10137454
1134 Ga0207704_10511555
1135 Ga0207665_10172371
1136 Ga0207665_10570998
1137 Ga0207691_10162263
1138 Ga0207691_10916530
1139 Ga0207711_10260298
1140 Ga0207711_10507833
1141 Ga0207711_10717710
1142 Ga0207689_10282541
1143 Ga0207689_10330995
1144 Ga0207661_10021516
1145 Ga0207661_10049387
1146 Ga0207661_10114652
1147 Ga0207661_12037704
1148 Ga0207679_10218078
1149 Ga0207679_10908547
1150 Ga0207667_10323446
1151 Ga0207651_10964039
1152 Ga0207712_10084100
1153 Ga0207712_10259909
1154 Ga0207668_10613497
1155 Ga0207668_12058372
1156 Ga0207640_10150422
1157 Ga0207640_10864806
1158 Ga0207658_10999558
1159 Ga0207658_11256059
1160 Ga0207677_10635340
1161 Ga0207703_10020737
1162 Ga0207703_10144273
1163 Ga0207703_10836826
1164 Ga0207639_10116867
1165 Ga0207639_12235384
1166 Ga0207678_10159765
1167 Ga0207678_10256737
1168 Ga0207678_10528664
1169 Ga0207708_10011966
1170 Ga0207708_10192159
1171 Ga0207702_10112043
1172 Ga0207702_10447598
1173 Ga0207702_10919582
1174 Ga0207648_10013997
1175 Ga0207648_10254154
1176 Ga0207648_10275261
1177 Ga0207648_10301708
1178 Ga0207676_10265688
1179 Ga0207674_10007320
1180 Ga0207674_10067212
1181 Ga0207674_11149333
1182 Ga0207674_11340511
1183 Ga0207675_100532269
1184 Ga0207675_100648255
1185 Ga0207683_10014854
1186 Ga0207683_10209069
1187 Ga0207683_10665181
1188 Ga0207698_10046377
1189 Ga0207698_10155328
1190 Ga0207428_10362862
1191 Ga0207428_10964025
1192 Ga0268266_10353810
1193 Ga0268265_10321629
1194 Ga0268265_10501309
1195 Ga0268264_10025249
1196 Ga0268264_10144333
1197 Ga0268264_11386887
1198 Ga0307408_100029387
1199 Ga0307405_10001616
1200 Ga0307405_11440754
1201 Ga0307413_10000425
1202 Ga0307410_10055743
1203 Ga0307410_10170084
1204 Ga0307406_10042715
1205 Ga0307406_10067425
1206 Ga0307406_10380590
1207 Ga0307407_10007563
1208 Ga0307412_10025594
1209 Ga0307412_10027656
1210 Ga0307412_10459724
1211 Ga0307409_100010588
1212 Ga0307409_100176257
1213 Ga0307409_102105006
1214 Ga0307416_100001434
1215 Ga0307416_100092970
1216 Ga0307414_10270241
1217 Ga0307414_11767850
1218 Ga0307411_10009082
1219 Ga0307411_10049512
1220 Ga0307415_100000579
1221 Ga0307415_100046886
1222 Ga0307415_100064978
1223 Ga0307415_100243395
1224 Ga0307415_102531482
1225 Ga0373939_0268965
1226 Ga0373941_0029909
1227 Ga0373960_0036961
1228 Ga0373924_0092405
1229 Ga0373947_0467808
1230 Ga0395899_0354606
1231 Ga0395899_0433746
1232 Ga0395900_0024273
1233 Ga0395898_0002944
1234 Ga0395898_0319969
1235 Ga0395898_0763375
1236 Ga0395905_0154109
1237 Ga0395905_0234601
1238 Ga0395901_0013902
1239 Ga0395901_0104247
1240 Ga0395901_0959828
1241 Ga0436365_0221202
1242 Ga0436365_0998727
1243 Ga0436365_1475474
1244 Ga0436363_0932759
1245 Ga0436362_0729634
1246 Ga0436362_0821543
1247 Ga0436362_1149174
1248 Ga0451807_0812175
1249 Ga0451839_0594227
1250 Ga0451851_0500192
1251 Ga0451843_0511931
1252 Ga0439448_0094173
1253 Ga0450907_047591
1254 Ga0439464_0072396
1255 Ga0466965_0081191
1256 Ga0466966_0041563
1257 Ga0466963_0003321
1258 Ga0466963_0167117
1259 Ga0466968_0031881
1260 Ga0466970_0097779
1261 Ga0466957_0028536
1262 Ga0466957_0305796
1263 Ga0466957_0622643
1264 Ga0466960_0319120
1265 Ga0466959_0045119
1266 Ga0466959_0286488
1267 Ga0451576_0328694
1268 Ga0466958_0003202
1269 Ga0466958_0046480
1270 Ga0466967_0027629
1271 Ga0466967_0032544
1272 Ga0466967_1688110
1273 Ga0495617_062345
1274 Ga0495592_0792248
1275 Ga0495605_0046202
1276 Ga0495584_0085733
1277 Ga0495596_0104554
1278 Ga0495596_0319756
1279 Ga0495607_0430714
1280 Ga0495583_0227894
1281 Ga0495608_0438266
1282 Ga0495616_0080053
1283 Ga0495628_0062768
1284 Ga0495630_0092942
1285 Ga0495630_0785507
1286 Ga0495631_0024361
1287 Ga0495631_0121450
1288 Ga0495637_0123264
1289 Ga0495644_0141722
1290 Ga0495642_0158839
1291 Ga0495642_0195355
1292 Ga0495652_0870714
1293 Ga0495654_0360717
1294 Ga0495640_0116756
1295 Ga0495640_0445066
1296 Ga0495586_0484579
1297 Ga0495621_0138546
1298 Ga0495597_0093486
1299 Ga0495668_0420288
1300 Ga0495659_0230047
1301 Ga0495661_0362729
1302 Ga0495599_0379234
1303 Ga0495669_0237321
1304 Ga0495670_0134124
1305 Ga0495671_0095193
1306 Ga0495589_0049988
1307 Ga0495589_0055282
1308 Ga0495600_0466041
1309 Ga0495660_0217363
1310 Ga0495604_0538545
1311 Ga0495636_0245468
1312 Ga0495674_0316623
1313 Ga0495674_0340887
1314 Ga0495680_0162453
1315 Ga0495684_0040398
1316 Ga0495686_0332096
1317 Ga0495626_0131403
1318 Ga0496100_0013520
1319 Ga0496100_0079696
1320 Ga0496100_0133948
1321 Ga0496100_0311682
1322 Ga0496101_0082036
1323 Ga0496101_0219980
1324 Ga0496101_0333050
1325 Ga0496101_0555569
1326 Ga0496102_0035022
1327 Ga0496102_0257120
1328 Ga0496102_0278573
1329 Ga0496102_0527759
1330 Ga0496103_0098972
1331 Ga0496103_0202885
1332 Ga0496103_0211899
1333 Ga0496103_0219385
1334 Ga0496103_0304401
1335 Ga0496104_0055370
1336 Ga0496104_0062138
1337 Ga0496104_0146930
1338 Ga0496104_0730021
1339 Ga0496104_0778170
1340 Ga0496104_1244609
1341 Ga0496105_0013430
1342 Ga0496105_0014694
1343 Ga0496105_0138994
1344 Ga0496105_0669575
1345 Ga0496105_1201554
1346 Ga0496106_0000345
1347 Ga0496106_0026528
1348 Ga0496106_0130241
1349 Ga0496106_0146525
1350 Ga0496106_0245679
1351 Ga0496106_0833406
1352 Ga0496107_0005250
1353 Ga0496107_0038229
1354 Ga0496107_0132931
1355 Ga0496108_0054584
1356 Ga0496108_0187598
1357 Ga0496108_0295022
1358 Ga0496108_0490140
1359 Ga0496109_0001854
1360 Ga0496109_0011279
1361 Ga0496109_0113960
1362 Ga0496109_0364335
1363 Ga0496109_0623984
1364 Ga0496109_0760415
1365 Ga0496109_0887453
1366 Ga0496110_0000112
1367 Ga0496110_0136402
1368 Ga0496110_0417462
1369 Ga0496110_0540907
1370 Ga0496111_0000091
1371 Ga0496111_0004683
1372 Ga0496111_0126425
1373 Ga0496111_0321822
1374 Ga0496112_0139005
1375 Ga0496112_0448438
1376 Ga0496112_1005554
1377 Ga0496113_0117001
1378 Ga0496113_0276033
1379 Ga0496113_0523800
1380 Ga0496114_0004472
1381 Ga0496114_0031545
1382 Ga0496114_0149403
1383 Ga0496114_0328426
1384 Ga0496115_0145861
1385 Ga0496115_0847027
1386 Ga0501031_0000336
1387 Ga0501031_0001206
1388 Ga0501031_0042611
1389 Ga0501031_0107878
1390 Ga0501031_0338036
1391 Ga0501031_0824913
1392 Ga0501032_0000805
1393 Ga0501032_0057417
1394 Ga0501032_0266765
1395 Ga0501033_0000239
1396 Ga0501033_0018600
1397 Ga0501034_0025606
1398 Ga0501034_0028808
1399 Ga0501034_0454910
1400 Ga0501036_0000107
1401 Ga0501036_0004032
1402 Ga0501036_0135529
1403 Ga0501036_0410056
1404 Ga0501036_0509083
1405 Ga0501036_1090431
1406 Ga0501037_0001895
1407 Ga0501037_0003172
1408 Ga0501038_0000367
1409 Ga0501038_0016761
1410 Ga0501038_0159603
1411 Ga0501038_0205362
1412 Ga0501039_0001144
1413 Ga0501039_0002766
1414 Ga0501039_0074914
1415 Ga0501039_0743593
1416 Ga0501040_0000890
1417 Ga0501040_0001961
1418 Ga0501040_0006892
1419 Ga0501040_0057791
1420 Ga0501041_0000011
1421 Ga0501041_0000539
1422 Ga0501041_0003697
1423 Ga0501042_0000775
1424 Ga0501042_0003214
1425 Ga0501042_0024506
1426 Ga0501042_0132795
1427 Ga0501042_0310657
1428 Ga0501042_0380038
1429 Ga0501042_0748798
1430 Ga0501043_0000477
1431 Ga0501043_0006617
1432 Ga0501043_0688785
1433 Ga0501046_0001077
1434 Ga0501046_0002122
1435 Ga0501046_0159484
1436 Ga0501046_1073971
1437 Ga0501047_0000743
1438 Ga0501047_0005763
1439 Ga0501048_0000339
1440 Ga0501048_0004066
1441 Ga0501048_0165010
1442 Ga0501067_0000018
1443 Ga0501067_0035330
1444 Ga0501067_0081340
1445 Ga0501067_0109330
1446 Ga0501068_0000241
1447 Ga0501068_0000484
1448 Ga0501068_0001711
1449 Ga0501068_0012126
1450 Ga0501068_0021163
1451 Ga0501068_0482866
1452 Ga0501069_0000087
1453 Ga0501069_0002001
1454 Ga0501069_0016414
1455 Ga0501069_0113529
1456 Ga0501069_0243350
1457 Ga0501070_0005743
1458 Ga0501070_0006181
1459 Ga0501070_0124212
1460 Ga0501071_0000208
1461 Ga0501071_0000718
1462 Ga0501071_0015079
1463 Ga0501071_0035104
1464 Ga0501071_0059246
1465 Ga0501071_0083080
1466 Ga0501071_0321644
1467 Ga0501072_0000561
1468 Ga0501072_0000698
1469 Ga0501072_0003450
1470 Ga0501072_0406339
1471 Ga0501072_0494648
1472 Ga0501072_1316856
1473 Ga0501073_0001339
1474 Ga0501073_0002471
1475 Ga0501074_0000158
1476 Ga0501074_0003135
1477 Ga0501074_0122176
1478 Ga0501075_0000556
1479 Ga0501075_0000906
1480 Ga0501075_0014968
1481 Ga0501075_0236035
1482 Ga0501076_0000289
1483 Ga0501076_0000972
1484 Ga0501076_0029691
1485 Ga0501076_0060130
1486 Ga0501076_0223061
1487 Ga0501076_1349139
1488 Ga0501077_0000371
1489 Ga0501077_0010113
1490 Ga0501077_0010383
1491 Ga0501077_0601796
1492 Ga0501079_0000053
1493 Ga0501079_0001559
1494 Ga0501079_0038743
1495 Ga0501079_0150202
1496 Ga0501080_0000136
1497 Ga0501080_0027868
1498 Ga0501080_0206225
1499 Ga0501081_0000025
1500 Ga0501081_0000896
1501 Ga0501081_0133761
1502 Ga0501081_0995506
1503 Ga0501083_0000234
1504 Ga0501083_0016002
1505 Ga0501083_0198550
1506 Ga0501035_0002153
1507 Ga0501035_0094345
1508 Ga0501044_0035109
1509 Ga0501044_0237779
1510 Ga0501045_0000035
1511 Ga0501045_0001138
1512 Ga0501045_0004139
1513 Ga0501045_0481142
1514 Ga0501045_0519031
1515 Ga0501045_0571292
1516 nmdc:mga05p37_5607_c1
1517 nmdc:mga05p37_84091_c1
1518 nmdc:mga05p37_995322_c1
1519 nmdc:mga09592_12624_c1
1520 nmdc:mga09592_312246_c1
1521 nmdc:mga0qj67_1514824_c1
1522 nmdc:mga0qj67_225222_c1
1523 nmdc:mga06r32_463284_c1
1524 nmdc:mga06r32_808394_c1
1525 nmdc:mga08y16_29853_c1
1526 nmdc:mga08y16_409466_c1
1527 nmdc:mga08y16_91012_c1
1528 nmdc:mga0n895_1008705_c1
1529 nmdc:mga0n895_19443_c1
1530 nmdc:mga0rr50_344713_c1
1531 nmdc:mga0rr50_40348_c1
1532 nmdc:mga0rr50_411112_c1
1533 nmdc:mga0a205_134102_c1
1534 nmdc:mga0a205_336575_c1
1535 Ga0495655_0047704
1536 Ga0495595_0021868
1537 Ga0501084_0000336
1538 Ga0501084_0001449
1539 Ga0501084_0029370
1540 Ga0501084_0735248
1541 Ga0590075_037004
1542 Ga0590077_009333
1543 Ga0501082_0001222
1544 Ga0501082_0001990
1545 Ga0501082_0270372
1546 Ga0501082_0313168
1547 Ga0501082_0431268
1548 Ga0466962_0047557
1549 Ga0530510_0000445
1550 Ga0530510_0001100
1551 Ga0530510_0002147
1552 Ga0530510_0003302
1553 Ga0530510_0098712
1554 Ga0530510_0963441

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v72-assembly1.cif.gz_AG e. coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre-translocation state (pre4) 0.441 49 86
6vq7-assembly1.cif.gz_e error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.4297 66 107
6wm3-assembly1.cif.gz_S human v-atpase in state 2 with sidk and adp 0.4127 65 107
2jvf-assembly1.cif.gz_A solution structure of m7, a computationally-designed artificial protein 0.3971 49 89
6hv8-assembly1.cif.gz_B cryo-em structure of s. cerevisiae polymerase epsilon deltacat mutant 0.36 49 102
ID Description Score Start End Superfamily
af_A0A0P0VZA9_26_74_3.30.160.60 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.5055 47 74 3.30.160.60
2w57B02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Ferric-uptake regulator, C-terminal dimerisarion domain 0.4981 49 79 3.30.1490.190
af_P53972_227_490_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.4876 63 96 3.40.50.150
2jvfA00 Alpha Beta;2-Layer Sandwich;top7, de novo designed protein;top7, de novo designed protein 0.3971 49 89 3.30.1710.10
1ynrB00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.3963 50 80 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A7V9HF84-F1-model_v4 Uncharacterized protein 0.6499 49 133
AF-A0A7V9HF84-F1-model_v4 Uncharacterized protein 0.6366 49 133
AF-A0A382AIL4-F1-model_v4 Uncharacterized protein 0.4974 10 133
AF-A0A7W1RLL5-F1-model_v4 deleted 0.4699 4 133
AF-A0A6J6A4N8-F1-model_v4 Unannotated protein 0.4645 1 133

Map