F480319
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 776 | 324 | 1552 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300028573|Ga0265334_10119478|Ga0265334_101194782 |
| Length | 93 |
| Sequence | LRNLLGRWRVFQGMRTIREIHQEIDVKSAERVALWQRLSEEYDAGLVAEIRRRDAELDQLWGEHRALRARVRFGDRDSIVARARVEERLERAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 177 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 180 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 204 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 217 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 220 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 228 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 302 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 303 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 304 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 308 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 309 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 324 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.94 |
| Metatranscriptomes | 2.06 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.9 |
| Nodule | 0 |
| Rhizoplane | 8.76 |
| Rhizosphere | 90.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265334_10119478 | 3300028573 | Bacteria | 942 |
| 2 | JGI24748J21848_1032994 | 3300002074 | Bacteria | 644 |
| 3 | JGI24744J21845_10033267 | 3300002077 | Unclassified | 981 |
| 4 | Ga0070658_10010084 | 3300005327 | Bacteria | 7584 |
| 5 | Ga0070658_10274790 | 3300005327 | Bacteria | 1433 |
| 6 | Ga0070658_10504805 | 3300005327 | Bacteria | 1045 |
| 7 | Ga0070683_100012407 | 3300005329 | Bacteria | 7406 |
| 8 | Ga0070683_100493526 | 3300005329 | Bacteria | 1169 |
| 9 | Ga0070683_100585110 | 3300005329 | Bacteria | 1068 |
| 10 | Ga0070683_100777040 | 3300005329 | Bacteria | 918 |
| 11 | Ga0070690_100017901 | 3300005330 | Bacteria | 4272 |
| 12 | Ga0070680_100128506 | 3300005336 | Bacteria | 2118 |
| 13 | Ga0070680_100276784 | 3300005336 | Bacteria | 1421 |
| 14 | Ga0070680_100381830 | 3300005336 | Bacteria | 1199 |
| 15 | Ga0070682_100048657 | 3300005337 | Bacteria | 2640 |
| 16 | Ga0070682_100159448 | 3300005337 | Archaea | 1557 |
| 17 | Ga0070682_101566696 | 3300005337 | Unclassified | 569 |
| 18 | Ga0068868_100475539 | 3300005338 | Unclassified | 1091 |
| 19 | Ga0070660_100005534 | 3300005339 | Bacteria | 8751 |
| 20 | Ga0070660_100042939 | 3300005339 | Bacteria | 3453 |
| 21 | Ga0070660_100045840 | 3300005339 | Bacteria | 3349 |
| 22 | Ga0070660_100116276 | 3300005339 | Bacteria | 2133 |
| 23 | Ga0070660_100138026 | 3300005339 | Unclassified | 1954 |
| 24 | Ga0070689_101918447 | 3300005340 | Unclassified | 541 |
| 25 | Ga0070691_10324529 | 3300005341 | Unclassified | 848 |
| 26 | Ga0070661_100130537 | 3300005344 | Bacteria | 1887 |
| 27 | Ga0070661_100353922 | 3300005344 | Bacteria | 1153 |
| 28 | Ga0070661_100782340 | 3300005344 | Bacteria | 782 |
| 29 | Ga0070692_10038833 | 3300005345 | Bacteria | 2429 |
| 30 | Ga0070692_10058958 | 3300005345 | Bacteria | 2017 |
| 31 | Ga0070668_100193858 | 3300005347 | Unclassified | 1665 |
| 32 | Ga0070669_100444686 | 3300005353 | Unclassified | 1067 |
| 33 | Ga0070675_100306307 | 3300005354 | Bacteria | 1401 |
| 34 | Ga0070671_100038529 | 3300005355 | Bacteria | 3968 |
| 35 | Ga0070671_101275332 | 3300005355 | Bacteria | 648 |
| 36 | Ga0070674_100178742 | 3300005356 | Bacteria | 1623 |
| 37 | Ga0070673_102103731 | 3300005364 | Unclassified | 536 |
| 38 | Ga0070673_102154832 | 3300005364 | Bacteria | 530 |
| 39 | Ga0070688_100429519 | 3300005365 | Unclassified | 983 |
| 40 | Ga0070688_100741590 | 3300005365 | Bacteria | 764 |
| 41 | Ga0070659_100083980 | 3300005366 | Bacteria | 2546 |
| 42 | Ga0070659_100596461 | 3300005366 | Bacteria | 949 |
| 43 | Ga0070659_100715471 | 3300005366 | Bacteria | 867 |
| 44 | Ga0070703_10223095 | 3300005406 | Unclassified | 751 |
| 45 | Ga0070709_10149306 | 3300005434 | Bacteria | 1614 |
| 46 | Ga0070709_10167700 | 3300005434 | Bacteria | 1532 |
| 47 | Ga0070709_10532413 | 3300005434 | Bacteria | 897 |
| 48 | Ga0070709_10538873 | 3300005434 | Bacteria | 892 |
| 49 | Ga0070709_11312248 | 3300005434 | Bacteria | 584 |
| 50 | Ga0070709_11342589 | 3300005434 | Bacteria | 578 |
| 51 | Ga0070709_11493031 | 3300005434 | Bacteria | 549 |
| 52 | Ga0070714_100016102 | 3300005435 | Bacteria | 6029 |
| 53 | Ga0070714_100017564 | 3300005435 | Bacteria | 5798 |
| 54 | Ga0070714_100110377 | 3300005435 | Bacteria | 2435 |
| 55 | Ga0070714_100116653 | 3300005435 | Bacteria | 2370 |
| 56 | Ga0070714_100354897 | 3300005435 | Bacteria | 1377 |
| 57 | Ga0070714_100514384 | 3300005435 | Bacteria | 1143 |
| 58 | Ga0070714_100784288 | 3300005435 | Archaea | 922 |
| 59 | Ga0070714_101139547 | 3300005435 | Bacteria | 760 |
| 60 | Ga0070713_100021120 | 3300005436 | Bacteria | 5001 |
| 61 | Ga0070713_100120381 | 3300005436 | Bacteria | 2301 |
| 62 | Ga0070713_100209069 | 3300005436 | Bacteria | 1766 |
| 63 | Ga0070713_100598146 | 3300005436 | Bacteria | 1048 |
| 64 | Ga0070713_100734035 | 3300005436 | Bacteria | 944 |
| 65 | Ga0070713_100954142 | 3300005436 | Unclassified | 826 |
| 66 | Ga0070713_101385677 | 3300005436 | Bacteria | 682 |
| 67 | Ga0070713_101770175 | 3300005436 | Bacteria | 600 |
| 68 | Ga0070713_101887650 | 3300005436 | Bacteria | 580 |
| 69 | Ga0070710_10110163 | 3300005437 | Bacteria | 1653 |
| 70 | Ga0070710_10130334 | 3300005437 | Unclassified | 1533 |
| 71 | Ga0070710_10600896 | 3300005437 | Bacteria | 766 |
| 72 | Ga0070710_10887124 | 3300005437 | Bacteria | 643 |
| 73 | Ga0070701_10015114 | 3300005438 | Bacteria | 3557 |
| 74 | Ga0070701_10227535 | 3300005438 | Bacteria | 1115 |
| 75 | Ga0070711_100014047 | 3300005439 | Bacteria | 5038 |
| 76 | Ga0070711_100159588 | 3300005439 | Unclassified | 1708 |
| 77 | Ga0070711_100527417 | 3300005439 | Bacteria | 977 |
| 78 | Ga0070711_100833419 | 3300005439 | Bacteria | 784 |
| 79 | Ga0070711_100965038 | 3300005439 | Bacteria | 730 |
| 80 | Ga0070705_100173808 | 3300005440 | Unclassified | 1452 |
| 81 | Ga0070705_100192634 | 3300005440 | Bacteria | 1391 |
| 82 | Ga0070700_100031352 | 3300005441 | Bacteria | 3184 |
| 83 | Ga0070708_100204172 | 3300005445 | Bacteria | 1851 |
| 84 | Ga0070708_100285087 | 3300005445 | Bacteria | 1555 |
| 85 | Ga0070708_100735936 | 3300005445 | Unclassified | 928 |
| 86 | Ga0070663_100368980 | 3300005455 | Unclassified | 1166 |
| 87 | Ga0070678_100025637 | 3300005456 | Bacteria | 3971 |
| 88 | Ga0070662_100670816 | 3300005457 | Bacteria | 876 |
| 89 | Ga0070681_10011382 | 3300005458 | Bacteria | 8802 |
| 90 | Ga0070681_10072778 | 3300005458 | Bacteria | 3399 |
| 91 | Ga0070681_10102805 | 3300005458 | Bacteria | 2802 |
| 92 | Ga0070681_10176769 | 3300005458 | Bacteria | 2057 |
| 93 | Ga0070681_10330516 | 3300005458 | Unclassified | 1434 |
| 94 | Ga0070681_11839983 | 3300005458 | Bacteria | 533 |
| 95 | Ga0068867_100190648 | 3300005459 | Unclassified | 1636 |
| 96 | Ga0070685_10301658 | 3300005466 | Unclassified | 1080 |
| 97 | Ga0070706_100063585 | 3300005467 | Bacteria | 3410 |
| 98 | Ga0070706_100210509 | 3300005467 | Bacteria | 1816 |
| 99 | Ga0070706_100761941 | 3300005467 | Unclassified | 897 |
| 100 | Ga0070707_100424561 | 3300005468 | Bacteria | 1290 |
| 101 | Ga0070707_100479311 | 3300005468 | Bacteria | 1206 |
| 102 | Ga0070707_100580790 | 3300005468 | Unclassified | 1083 |
| 103 | Ga0070707_102155981 | 3300005468 | Unclassified | 525 |
| 104 | Ga0070698_100078846 | 3300005471 | Bacteria | 3291 |
| 105 | Ga0070698_100080378 | 3300005471 | Bacteria | 3255 |
| 106 | Ga0070698_100192854 | 3300005471 | Bacteria | 1974 |
| 107 | Ga0070698_100320877 | 3300005471 | Bacteria | 1480 |
| 108 | Ga0070698_100481227 | 3300005471 | Unclassified | 1178 |
| 109 | Ga0070698_100524912 | 3300005471 | Bacteria | 1122 |
| 110 | Ga0070699_100884454 | 3300005518 | Unclassified | 818 |
| 111 | Ga0070699_101042914 | 3300005518 | Unclassified | 750 |
| 112 | Ga0070699_101190492 | 3300005518 | Bacteria | 699 |
| 113 | Ga0070679_100064231 | 3300005530 | Bacteria | 3659 |
| 114 | Ga0070679_100225445 | 3300005530 | Bacteria | 1834 |
| 115 | Ga0070679_100283515 | 3300005530 | Unclassified | 1609 |
| 116 | Ga0070679_100420603 | 3300005530 | Bacteria | 1282 |
| 117 | Ga0070684_100061778 | 3300005535 | Bacteria | 3280 |
| 118 | Ga0070684_100239776 | 3300005535 | Bacteria | 1657 |
| 119 | Ga0070684_100472159 | 3300005535 | Bacteria | 1160 |
| 120 | Ga0070684_100955677 | 3300005535 | Bacteria | 804 |
| 121 | Ga0070697_101967653 | 3300005536 | Bacteria | 523 |
| 122 | Ga0068853_100055011 | 3300005539 | Bacteria | 3430 |
| 123 | Ga0068853_101159013 | 3300005539 | Bacteria | 746 |
| 124 | Ga0070672_100158494 | 3300005543 | Bacteria | 1876 |
| 125 | Ga0070686_100069779 | 3300005544 | Unclassified | 2296 |
| 126 | Ga0070696_100062017 | 3300005546 | Unclassified | 2616 |
| 127 | Ga0070693_100183857 | 3300005547 | Bacteria | 1347 |
| 128 | Ga0070693_100474424 | 3300005547 | Bacteria | 883 |
| 129 | Ga0070693_101213870 | 3300005547 | Bacteria | 580 |
| 130 | Ga0070693_101566850 | 3300005547 | Bacteria | 517 |
| 131 | Ga0070704_101426534 | 3300005549 | Bacteria | 635 |
| 132 | Ga0068855_100301406 | 3300005563 | Bacteria | 1774 |
| 133 | Ga0068855_100520047 | 3300005563 | Bacteria | 1291 |
| 134 | Ga0068855_100956884 | 3300005563 | Unclassified | 902 |
| 135 | Ga0070664_100687224 | 3300005564 | Bacteria | 953 |
| 136 | Ga0068857_100032695 | 3300005577 | Bacteria | 4599 |
| 137 | Ga0068857_101494197 | 3300005577 | Bacteria | 658 |
| 138 | Ga0068854_100166903 | 3300005578 | Bacteria | 1710 |
| 139 | Ga0068854_101480292 | 3300005578 | Unclassified | 616 |
| 140 | Ga0068856_100116642 | 3300005614 | Bacteria | 2670 |
| 141 | Ga0068856_100715456 | 3300005614 | Unclassified | 1022 |
| 142 | Ga0070702_100165774 | 3300005615 | Unclassified | 1432 |
| 143 | Ga0068852_100022075 | 3300005616 | Bacteria | 5096 |
| 144 | Ga0068852_100154397 | 3300005616 | Archaea | 2137 |
| 145 | Ga0068852_100467858 | 3300005616 | Bacteria | 1251 |
| 146 | Ga0068852_100924634 | 3300005616 | Bacteria | 890 |
| 147 | Ga0068852_101542595 | 3300005616 | Bacteria | 687 |
| 148 | Ga0068852_102564438 | 3300005616 | Bacteria | 530 |
| 149 | Ga0068859_100825667 | 3300005617 | Unclassified | 1014 |
| 150 | Ga0068866_10012223 | 3300005718 | Bacteria | 3739 |
| 151 | Ga0068861_101112844 | 3300005719 | Unclassified | 760 |
| 152 | Ga0068870_10688402 | 3300005840 | Unclassified | 704 |
| 153 | Ga0068858_100472121 | 3300005842 | Unclassified | 1210 |
| 154 | Ga0068860_100265867 | 3300005843 | Bacteria | 1673 |
| 155 | Ga0068862_101813724 | 3300005844 | Unclassified | 619 |
| 156 | Ga0070717_10012749 | 3300006028 | Bacteria | 6415 |
| 157 | Ga0070717_10062786 | 3300006028 | Bacteria | 3081 |
| 158 | Ga0070717_10106330 | 3300006028 | Bacteria | 2389 |
| 159 | Ga0070717_10117213 | 3300006028 | Bacteria | 2277 |
| 160 | Ga0070717_10685996 | 3300006028 | Bacteria | 930 |
| 161 | Ga0070717_11060955 | 3300006028 | Bacteria | 738 |
| 162 | Ga0075365_10260471 | 3300006038 | Bacteria | 1219 |
| 163 | Ga0075363_100508382 | 3300006048 | Unclassified | 716 |
| 164 | Ga0075363_100992109 | 3300006048 | Bacteria | 517 |
| 165 | Ga0075364_10938167 | 3300006051 | Bacteria | 589 |
| 166 | Ga0075432_10520095 | 3300006058 | Bacteria | 533 |
| 167 | Ga0070715_10070665 | 3300006163 | Bacteria | 1559 |
| 168 | Ga0070715_10212487 | 3300006163 | Bacteria | 990 |
| 169 | Ga0070716_100262994 | 3300006173 | Bacteria | 1181 |
| 170 | Ga0070716_100525006 | 3300006173 | Unclassified | 878 |
| 171 | Ga0070716_101405095 | 3300006173 | Bacteria | 568 |
| 172 | Ga0070716_101669052 | 3300006173 | Bacteria | 525 |
| 173 | Ga0070712_100060008 | 3300006175 | Bacteria | 2681 |
| 174 | Ga0070712_100153648 | 3300006175 | Bacteria | 1770 |
| 175 | Ga0070712_100259791 | 3300006175 | Bacteria | 1391 |
| 176 | Ga0070712_100318330 | 3300006175 | Archaea | 1264 |
| 177 | Ga0070712_102052891 | 3300006175 | Bacteria | 501 |
| 178 | Ga0097621_100226869 | 3300006237 | Unclassified | 1630 |
| 179 | Ga0097621_101706859 | 3300006237 | Bacteria | 600 |
| 180 | Ga0068871_100084801 | 3300006358 | Unclassified | 2629 |
| 181 | Ga0075431_100418609 | 3300006847 | Unclassified | 1339 |
| 182 | Ga0075434_100118064 | 3300006871 | Unclassified | 2666 |
| 183 | Ga0075434_100921293 | 3300006871 | Bacteria | 889 |
| 184 | Ga0068865_100240376 | 3300006881 | Unclassified | 1424 |
| 185 | Ga0075436_100095339 | 3300006914 | Bacteria | 2070 |
| 186 | Ga0097620_100825682 | 3300006931 | Unclassified | 1014 |
| 187 | Ga0099794_10498583 | 3300007265 | Unclassified | 641 |
| 188 | Ga0105240_10029146 | 3300009093 | Bacteria | 7198 |
| 189 | Ga0105240_10067436 | 3300009093 | Bacteria | 4435 |
| 190 | Ga0105240_10103092 | 3300009093 | Bacteria | 3467 |
| 191 | Ga0105240_11128530 | 3300009093 | Bacteria | 833 |
| 192 | Ga0111539_10161096 | 3300009094 | Bacteria | 2624 |
| 193 | Ga0105245_10143478 | 3300009098 | Bacteria | 2251 |
| 194 | Ga0105245_10225623 | 3300009098 | Bacteria | 1810 |
| 195 | Ga0105245_11361770 | 3300009098 | Bacteria | 759 |
| 196 | Ga0105245_12842408 | 3300009098 | Bacteria | 537 |
| 197 | Ga0105247_10104938 | 3300009101 | Unclassified | 1811 |
| 198 | Ga0114129_11130489 | 3300009147 | Bacteria | 979 |
| 199 | Ga0114129_12201004 | 3300009147 | Unclassified | 663 |
| 200 | Ga0105243_10157327 | 3300009148 | Unclassified | 1955 |
| 201 | Ga0105241_10018098 | 3300009174 | Bacteria | 5181 |
| 202 | Ga0105242_10253932 | 3300009176 | Unclassified | 1585 |
| 203 | Ga0105242_10789694 | 3300009176 | Bacteria | 939 |
| 204 | Ga0105248_10017831 | 3300009177 | Bacteria | 7836 |
| 205 | Ga0105248_10365527 | 3300009177 | Bacteria | 1624 |
| 206 | Ga0105237_10076340 | 3300009545 | Bacteria | 3341 |
| 207 | Ga0105237_10544673 | 3300009545 | Bacteria | 1167 |
| 208 | Ga0105238_10024715 | 3300009551 | Bacteria | 6124 |
| 209 | Ga0105238_10245388 | 3300009551 | Unclassified | 1768 |
| 210 | Ga0105238_12705159 | 3300009551 | Unclassified | 533 |
| 211 | Ga0105249_10258763 | 3300009553 | Unclassified | 1728 |
| 212 | Ga0099796_10031812 | 3300010159 | Bacteria | 1724 |
| 213 | Ga0105239_10762227 | 3300010375 | Unclassified | 1108 |
| 214 | Ga0105239_10826575 | 3300010375 | Bacteria | 1062 |
| 215 | Ga0105246_10035736 | 3300011119 | Bacteria | 3323 |
| 216 | Ga0157371_10174387 | 3300013102 | Bacteria | 1537 |
| 217 | Ga0157371_10254916 | 3300013102 | Bacteria | 1264 |
| 218 | Ga0157370_10022966 | 3300013104 | Bacteria | 6199 |
| 219 | Ga0157370_10096440 | 3300013104 | Bacteria | 2775 |
| 220 | Ga0157370_10299804 | 3300013104 | Bacteria | 1484 |
| 221 | Ga0157370_10659978 | 3300013104 | Bacteria | 956 |
| 222 | Ga0157370_10683390 | 3300013104 | Bacteria | 937 |
| 223 | Ga0157369_10061038 | 3300013105 | Bacteria | 4065 |
| 224 | Ga0157369_10123462 | 3300013105 | Bacteria | 2747 |
| 225 | Ga0157369_10204869 | 3300013105 | Bacteria | 2069 |
| 226 | Ga0157369_10581138 | 3300013105 | Bacteria | 1157 |
| 227 | Ga0157369_10642985 | 3300013105 | Bacteria | 1094 |
| 228 | Ga0157369_11136219 | 3300013105 | Unclassified | 798 |
| 229 | Ga0157374_10304377 | 3300013296 | Archaea | 1577 |
| 230 | Ga0157374_10923122 | 3300013296 | Bacteria | 891 |
| 231 | Ga0157378_10866661 | 3300013297 | Bacteria | 932 |
| 232 | Ga0163162_10103389 | 3300013306 | Bacteria | 2943 |
| 233 | Ga0157372_10095568 | 3300013307 | Bacteria | 3386 |
| 234 | Ga0157372_10329807 | 3300013307 | Unclassified | 1777 |
| 235 | Ga0157372_10424545 | 3300013307 | Bacteria | 1549 |
| 236 | Ga0157372_10824456 | 3300013307 | Bacteria | 1077 |
| 237 | Ga0157372_10920493 | 3300013307 | Bacteria | 1014 |
| 238 | Ga0157372_10943528 | 3300013307 | Bacteria | 1000 |
| 239 | Ga0157372_11062819 | 3300013307 | Bacteria | 937 |
| 240 | Ga0157372_11861127 | 3300013307 | Bacteria | 692 |
| 241 | Ga0157372_12681141 | 3300013307 | Bacteria | 572 |
| 242 | Ga0157375_10074773 | 3300013308 | Bacteria | 3410 |
| 243 | Ga0163163_11882382 | 3300014325 | Unclassified | 658 |
| 244 | Ga0157380_10023312 | 3300014326 | Bacteria | 4668 |
| 245 | Ga0182008_10002788 | 3300014497 | Bacteria | 10824 |
| 246 | Ga0182008_10090894 | 3300014497 | Bacteria | 1505 |
| 247 | Ga0157377_10109910 | 3300014745 | Unclassified | 1655 |
| 248 | Ga0157377_10507692 | 3300014745 | Unclassified | 844 |
| 249 | Ga0157379_10677192 | 3300014968 | Archaea | 967 |
| 250 | Ga0157376_11786906 | 3300014969 | Bacteria | 651 |
| 251 | Ga0157376_13086489 | 3300014969 | Bacteria | 504 |
| 252 | Ga0182006_1025712 | 3300015261 | Bacteria | 2416 |
| 253 | Ga0182007_10174586 | 3300015262 | Bacteria | 740 |
| 254 | Ga0197907_10443636 | 3300020069 | Unclassified | 528 |
| 255 | Ga0197907_11304884 | 3300020069 | Bacteria | 1014 |
| 256 | Ga0206356_10501020 | 3300020070 | Bacteria | 913 |
| 257 | Ga0206356_10554009 | 3300020070 | Bacteria | 1934 |
| 258 | Ga0206349_1665945 | 3300020075 | Bacteria | 782 |
| 259 | Ga0206354_10306743 | 3300020081 | Bacteria | 1525 |
| 260 | Ga0206354_11403241 | 3300020081 | Unclassified | 978 |
| 261 | Ga0206353_10603087 | 3300020082 | Bacteria | 2797 |
| 262 | Ga0206353_11078404 | 3300020082 | Bacteria | 954 |
| 263 | Ga0154015_1320522 | 3300020610 | Bacteria | 628 |
| 264 | Ga0224712_10050023 | 3300022467 | Bacteria | 1622 |
| 265 | Ga0207653_10129551 | 3300025885 | Unclassified | 915 |
| 266 | Ga0207692_10074375 | 3300025898 | Unclassified | 1800 |
| 267 | Ga0207692_10266122 | 3300025898 | Bacteria | 1032 |
| 268 | Ga0207692_11073790 | 3300025898 | Bacteria | 533 |
| 269 | Ga0207642_10085810 | 3300025899 | Unclassified | 1541 |
| 270 | Ga0207710_10105403 | 3300025900 | Unclassified | 1334 |
| 271 | Ga0207688_10066058 | 3300025901 | Archaea | 2045 |
| 272 | Ga0207680_10061931 | 3300025903 | Bacteria | 2284 |
| 273 | Ga0207647_10219885 | 3300025904 | Unclassified | 1095 |
| 274 | Ga0207685_10023009 | 3300025905 | Archaea | 2115 |
| 275 | Ga0207699_10224172 | 3300025906 | Bacteria | 1285 |
| 276 | Ga0207699_10312379 | 3300025906 | Bacteria | 1100 |
| 277 | Ga0207699_10424904 | 3300025906 | Bacteria | 950 |
| 278 | Ga0207699_10739724 | 3300025906 | Bacteria | 721 |
| 279 | Ga0207699_10902534 | 3300025906 | Bacteria | 652 |
| 280 | Ga0207705_10030566 | 3300025909 | Bacteria | 3843 |
| 281 | Ga0207705_10200859 | 3300025909 | Bacteria | 1510 |
| 282 | Ga0207705_10258031 | 3300025909 | Bacteria | 1330 |
| 283 | Ga0207705_10915489 | 3300025909 | Bacteria | 679 |
| 284 | Ga0207684_10617350 | 3300025910 | Bacteria | 925 |
| 285 | Ga0207684_10986808 | 3300025910 | Unclassified | 705 |
| 286 | Ga0207707_10005030 | 3300025912 | Bacteria | 11611 |
| 287 | Ga0207707_10241498 | 3300025912 | Bacteria | 1570 |
| 288 | Ga0207707_10362911 | 3300025912 | Bacteria | 1247 |
| 289 | Ga0207707_10440694 | 3300025912 | Bacteria | 1115 |
| 290 | Ga0207707_10690003 | 3300025912 | Bacteria | 858 |
| 291 | Ga0207707_11084553 | 3300025912 | Unclassified | 653 |
| 292 | Ga0207695_10059936 | 3300025913 | Bacteria | 3944 |
| 293 | Ga0207695_10383164 | 3300025913 | Bacteria | 1292 |
| 294 | Ga0207695_10699981 | 3300025913 | Bacteria | 894 |
| 295 | Ga0207693_10003568 | 3300025915 | Bacteria | 13297 |
| 296 | Ga0207693_10148989 | 3300025915 | Bacteria | 1840 |
| 297 | Ga0207693_10191469 | 3300025915 | Bacteria | 1609 |
| 298 | Ga0207693_10764891 | 3300025915 | Bacteria | 746 |
| 299 | Ga0207693_10808627 | 3300025915 | Bacteria | 722 |
| 300 | Ga0207663_10188030 | 3300025916 | Bacteria | 1481 |
| 301 | Ga0207663_10364831 | 3300025916 | Bacteria | 1097 |
| 302 | Ga0207663_10624627 | 3300025916 | Bacteria | 848 |
| 303 | Ga0207663_10632709 | 3300025916 | Bacteria | 843 |
| 304 | Ga0207663_10687920 | 3300025916 | Bacteria | 809 |
| 305 | Ga0207663_10821251 | 3300025916 | Bacteria | 741 |
| 306 | Ga0207660_10012122 | 3300025917 | Bacteria | 5635 |
| 307 | Ga0207660_10046233 | 3300025917 | Bacteria | 3071 |
| 308 | Ga0207660_10585689 | 3300025917 | Bacteria | 908 |
| 309 | Ga0207660_10610672 | 3300025917 | Bacteria | 888 |
| 310 | Ga0207662_10106962 | 3300025918 | Bacteria | 1740 |
| 311 | Ga0207657_10001701 | 3300025919 | Bacteria | 23714 |
| 312 | Ga0207657_10006734 | 3300025919 | Bacteria | 11862 |
| 313 | Ga0207657_10013597 | 3300025919 | Bacteria | 7983 |
| 314 | Ga0207657_10085860 | 3300025919 | Bacteria | 2635 |
| 315 | Ga0207657_10169514 | 3300025919 | Bacteria | 1769 |
| 316 | Ga0207657_10225829 | 3300025919 | Bacteria | 1499 |
| 317 | Ga0207649_10586764 | 3300025920 | Bacteria | 856 |
| 318 | Ga0207649_10649596 | 3300025920 | Bacteria | 815 |
| 319 | Ga0207649_11253414 | 3300025920 | Bacteria | 586 |
| 320 | Ga0207652_10009207 | 3300025921 | Bacteria | 7947 |
| 321 | Ga0207652_10680909 | 3300025921 | Bacteria | 918 |
| 322 | Ga0207652_11152309 | 3300025921 | Bacteria | 676 |
| 323 | Ga0207652_11160657 | 3300025921 | Bacteria | 674 |
| 324 | Ga0207652_11188629 | 3300025921 | Bacteria | 664 |
| 325 | Ga0207652_11401908 | 3300025921 | Bacteria | 602 |
| 326 | Ga0207646_10153643 | 3300025922 | Bacteria | 2075 |
| 327 | Ga0207646_10468425 | 3300025922 | Bacteria | 1136 |
| 328 | Ga0207646_11557704 | 3300025922 | Bacteria | 571 |
| 329 | Ga0207646_11906686 | 3300025922 | Unclassified | 506 |
| 330 | Ga0207681_11220499 | 3300025923 | Bacteria | 632 |
| 331 | Ga0207694_10455667 | 3300025924 | Unclassified | 1068 |
| 332 | Ga0207694_11738903 | 3300025924 | Unclassified | 524 |
| 333 | Ga0207659_10507470 | 3300025926 | Bacteria | 1021 |
| 334 | Ga0207687_10060671 | 3300025927 | Bacteria | 2668 |
| 335 | Ga0207687_10103225 | 3300025927 | Bacteria | 2102 |
| 336 | Ga0207700_10081675 | 3300025928 | Bacteria | 2525 |
| 337 | Ga0207700_10137983 | 3300025928 | Bacteria | 2000 |
| 338 | Ga0207700_10188926 | 3300025928 | Bacteria | 1730 |
| 339 | Ga0207700_11122960 | 3300025928 | Bacteria | 703 |
| 340 | Ga0207700_11296700 | 3300025928 | Archaea | 649 |
| 341 | Ga0207664_10122399 | 3300025929 | Bacteria | 2179 |
| 342 | Ga0207664_10132145 | 3300025929 | Bacteria | 2102 |
| 343 | Ga0207664_10133736 | 3300025929 | Bacteria | 2090 |
| 344 | Ga0207664_10141222 | 3300025929 | Bacteria | 2037 |
| 345 | Ga0207664_10181768 | 3300025929 | Bacteria | 1806 |
| 346 | Ga0207664_10568429 | 3300025929 | Bacteria | 1018 |
| 347 | Ga0207664_10585067 | 3300025929 | Bacteria | 1002 |
| 348 | Ga0207664_10824292 | 3300025929 | Bacteria | 834 |
| 349 | Ga0207664_11502357 | 3300025929 | Bacteria | 595 |
| 350 | Ga0207644_10111179 | 3300025931 | Unclassified | 2072 |
| 351 | Ga0207644_11346620 | 3300025931 | Bacteria | 600 |
| 352 | Ga0207690_10846364 | 3300025932 | Bacteria | 757 |
| 353 | Ga0207686_10055195 | 3300025934 | Bacteria | 2491 |
| 354 | Ga0207686_10797638 | 3300025934 | Unclassified | 757 |
| 355 | Ga0207709_10098065 | 3300025935 | Bacteria | 1932 |
| 356 | Ga0207670_10219582 | 3300025936 | Bacteria | 1454 |
| 357 | Ga0207669_10359827 | 3300025937 | Unclassified | 1127 |
| 358 | Ga0207704_10036215 | 3300025938 | Bacteria | 2837 |
| 359 | Ga0207665_10224095 | 3300025939 | Bacteria | 1379 |
| 360 | Ga0207665_10245146 | 3300025939 | Unclassified | 1322 |
| 361 | Ga0207665_10344451 | 3300025939 | Bacteria | 1124 |
| 362 | Ga0207665_10418533 | 3300025939 | Bacteria | 1023 |
| 363 | Ga0207665_10731447 | 3300025939 | Bacteria | 779 |
| 364 | Ga0207691_10066817 | 3300025940 | Bacteria | 3252 |
| 365 | Ga0207711_10112245 | 3300025941 | Bacteria | 2425 |
| 366 | Ga0207711_10201178 | 3300025941 | Bacteria | 1817 |
| 367 | Ga0207661_10015417 | 3300025944 | Bacteria | 5623 |
| 368 | Ga0207661_10580839 | 3300025944 | Bacteria | 1028 |
| 369 | Ga0207679_10895735 | 3300025945 | Bacteria | 811 |
| 370 | Ga0207667_10010589 | 3300025949 | Bacteria | 10770 |
| 371 | Ga0207667_10337773 | 3300025949 | Unclassified | 1537 |
| 372 | Ga0207667_10491727 | 3300025949 | Bacteria | 1245 |
| 373 | Ga0207667_10831270 | 3300025949 | Bacteria | 919 |
| 374 | Ga0207667_10859236 | 3300025949 | Bacteria | 901 |
| 375 | Ga0207651_10247816 | 3300025960 | Bacteria | 1456 |
| 376 | Ga0207651_11432816 | 3300025960 | Unclassified | 622 |
| 377 | Ga0207712_10388673 | 3300025961 | Unclassified | 1170 |
| 378 | Ga0207668_10249702 | 3300025972 | Bacteria | 1440 |
| 379 | Ga0207640_11526839 | 3300025981 | Bacteria | 600 |
| 380 | Ga0207677_10155482 | 3300026023 | Archaea | 1770 |
| 381 | Ga0207677_10532673 | 3300026023 | Unclassified | 1021 |
| 382 | Ga0207703_10367659 | 3300026035 | Unclassified | 1328 |
| 383 | Ga0207639_10516708 | 3300026041 | Unclassified | 1093 |
| 384 | Ga0207639_10561340 | 3300026041 | Bacteria | 1049 |
| 385 | Ga0207639_11326222 | 3300026041 | Unclassified | 675 |
| 386 | Ga0207678_10142755 | 3300026067 | Bacteria | 2044 |
| 387 | Ga0207708_10015144 | 3300026075 | Bacteria | 5778 |
| 388 | Ga0207702_10076767 | 3300026078 | Bacteria | 2888 |
| 389 | Ga0207702_10438485 | 3300026078 | Bacteria | 1266 |
| 390 | Ga0207702_11307080 | 3300026078 | Unclassified | 719 |
| 391 | Ga0207648_10000150 | 3300026089 | Bacteria | 70019 |
| 392 | Ga0207674_10144166 | 3300026116 | Bacteria | 2341 |
| 393 | Ga0207674_11625728 | 3300026116 | Unclassified | 615 |
| 394 | Ga0207675_100030408 | 3300026118 | Bacteria | 5030 |
| 395 | Ga0207683_10000131 | 3300026121 | Bacteria | 61423 |
| 396 | Ga0207698_10042404 | 3300026142 | Bacteria | 3399 |
| 397 | Ga0207698_10586766 | 3300026142 | Bacteria | 1097 |
| 398 | Ga0265337_1034415 | 3300028556 | Bacteria | 1490 |
| 399 | Ga0265337_1143805 | 3300028556 | Unclassified | 646 |
| 400 | Ga0265326_10010223 | 3300028558 | Bacteria | 2789 |
| 401 | Ga0265319_1004104 | 3300028563 | Bacteria | 7329 |
| 402 | Ga0265318_10000220 | 3300028577 | Bacteria | 49763 |
| 403 | Ga0265323_10102314 | 3300028653 | Unclassified | 947 |
| 404 | Ga0265323_10112529 | 3300028653 | Unclassified | 892 |
| 405 | Ga0265336_10198396 | 3300028666 | Unclassified | 596 |
| 406 | Ga0265338_10003129 | 3300028800 | Bacteria | 23635 |
| 407 | Ga0265338_10155536 | 3300028800 | Bacteria | 1771 |
| 408 | Ga0265338_10250383 | 3300028800 | Bacteria | 1307 |
| 409 | Ga0265338_10313820 | 3300028800 | Bacteria | 1136 |
| 410 | Ga0265338_10542850 | 3300028800 | Unclassified | 814 |
| 411 | Ga0265324_10084124 | 3300029957 | Unclassified | 1082 |
| 412 | Ga0265324_10089711 | 3300029957 | Bacteria | 1046 |
| 413 | Ga0265330_10002778 | 3300031235 | Bacteria | 9395 |
| 414 | Ga0265330_10028319 | 3300031235 | Bacteria | 2526 |
| 415 | Ga0265332_10003330 | 3300031238 | Bacteria | 7794 |
| 416 | Ga0265328_10029907 | 3300031239 | Bacteria | 2031 |
| 417 | Ga0265328_10420006 | 3300031239 | Bacteria | 526 |
| 418 | Ga0265320_10004689 | 3300031240 | Bacteria | 8920 |
| 419 | Ga0265325_10002188 | 3300031241 | Bacteria | 13300 |
| 420 | Ga0265329_10008893 | 3300031242 | Bacteria | 3782 |
| 421 | Ga0265340_10015147 | 3300031247 | Bacteria | 4011 |
| 422 | Ga0265339_10037888 | 3300031249 | Bacteria | 2692 |
| 423 | Ga0265339_10095216 | 3300031249 | Bacteria | 1555 |
| 424 | Ga0265331_10004398 | 3300031250 | Bacteria | 8807 |
| 425 | Ga0265331_10044454 | 3300031250 | Bacteria | 2148 |
| 426 | Ga0265331_10505844 | 3300031250 | Unclassified | 544 |
| 427 | Ga0265327_10005502 | 3300031251 | Bacteria | 10536 |
| 428 | Ga0265327_10032367 | 3300031251 | Bacteria | 2927 |
| 429 | Ga0265316_10039633 | 3300031344 | Bacteria | 3782 |
| 430 | Ga0265313_10019248 | 3300031595 | Bacteria | 3806 |
| 431 | Ga0265313_10115353 | 3300031595 | Unclassified | 1177 |
| 432 | Ga0265313_10141634 | 3300031595 | Bacteria | 1033 |
| 433 | Ga0265314_10004402 | 3300031711 | Bacteria | 13086 |
| 434 | Ga0265342_10122444 | 3300031712 | Bacteria | 1463 |
| 435 | Ga0265342_10165146 | 3300031712 | Bacteria | 1222 |
| 436 | Ga0316583_10009886 | 3300032133 | Bacteria | 3436 |
| 437 | Ga0316583_10027481 | 3300032133 | Bacteria | 2031 |
| 438 | Ga0373934_0097428 | 3300035086 | Bacteria | 1188 |
| 439 | Ga0373923_0543436 | 3300035111 | Unclassified | 569 |
| 440 | Ga0373932_0457922 | 3300035112 | Unclassified | 502 |
| 441 | Ga0373954_0535627 | 3300035118 | Bacteria | 580 |
| 442 | Ga0373956_0352166 | 3300035119 | Bacteria | 702 |
| 443 | Ga0373957_0077003 | 3300035120 | Bacteria | 1312 |
| 444 | Ga0373957_0170716 | 3300035120 | Bacteria | 899 |
| 445 | Ga0373946_0240574 | 3300035171 | Unclassified | 880 |
| 446 | Ga0373955_0211653 | 3300035172 | Bacteria | 1156 |
| 447 | Ga0373955_0437764 | 3300035172 | Bacteria | 796 |
| 448 | Ga0373955_0740109 | 3300035172 | Bacteria | 604 |
| 449 | Ga0373924_0235485 | 3300035410 | Archaea | 810 |
| 450 | Ga0373924_0302367 | 3300035410 | Bacteria | 710 |
| 451 | Ga0373924_0326533 | 3300035410 | Bacteria | 683 |
| 452 | Ga0373935_0245010 | 3300035692 | Bacteria | 1253 |
| 453 | Ga0373933_0320091 | 3300035724 | Bacteria | 1006 |
| 454 | Ga0373933_1135586 | 3300035724 | Bacteria | 515 |
| 455 | Ga0373947_1186966 | 3300035725 | Bacteria | 520 |
| 456 | Ga0373937_0204408 | 3300036401 | Bacteria | 1857 |
| 457 | Ga0373937_0291766 | 3300036401 | Bacteria | 1541 |
| 458 | Ga0373937_0302790 | 3300036401 | Bacteria | 1511 |
| 459 | Ga0395899_0009695 | 3300037312 | Bacteria | 7390 |
| 460 | Ga0395899_0041286 | 3300037312 | Bacteria | 3447 |
| 461 | Ga0395899_0066149 | 3300037312 | Bacteria | 2654 |
| 462 | Ga0395899_0103805 | 3300037312 | Bacteria | 2050 |
| 463 | Ga0395899_0106272 | 3300037312 | Bacteria | 2021 |
| 464 | Ga0395899_0116877 | 3300037312 | Bacteria | 1913 |
| 465 | Ga0395899_0172008 | 3300037312 | Unclassified | 1525 |
| 466 | Ga0395899_0177146 | 3300037312 | Bacteria | 1499 |
| 467 | Ga0395899_0197834 | 3300037312 | Bacteria | 1403 |
| 468 | Ga0395899_0304804 | 3300037312 | Bacteria | 1077 |
| 469 | Ga0395900_0001301 | 3300037418 | Bacteria | 30379 |
| 470 | Ga0395900_0015827 | 3300037418 | Bacteria | 7687 |
| 471 | Ga0395900_0076742 | 3300037418 | Bacteria | 3433 |
| 472 | Ga0395900_0129346 | 3300037418 | Bacteria | 2588 |
| 473 | Ga0395900_0213946 | 3300037418 | Bacteria | 1945 |
| 474 | Ga0395900_0231489 | 3300037418 | Bacteria | 1858 |
| 475 | Ga0395900_0314181 | 3300037418 | Bacteria | 1549 |
| 476 | Ga0395900_0436852 | 3300037418 | Bacteria | 1267 |
| 477 | Ga0395900_1099330 | 3300037418 | Bacteria | 712 |
| 478 | Ga0395900_1113240 | 3300037418 | Bacteria | 707 |
| 479 | Ga0395898_0001676 | 3300037466 | Bacteria | 29679 |
| 480 | Ga0395898_0012323 | 3300037466 | Bacteria | 8841 |
| 481 | Ga0395898_0073500 | 3300037466 | Bacteria | 3303 |
| 482 | Ga0395898_0085549 | 3300037466 | Bacteria | 3039 |
| 483 | Ga0395898_0108142 | 3300037466 | Bacteria | 2666 |
| 484 | Ga0395898_0189810 | 3300037466 | Bacteria | 1963 |
| 485 | Ga0395898_0227179 | 3300037466 | Bacteria | 1780 |
| 486 | Ga0395898_0331263 | 3300037466 | Bacteria | 1452 |
| 487 | Ga0395898_0379374 | 3300037466 | Bacteria | 1348 |
| 488 | Ga0395898_0396698 | 3300037466 | Bacteria | 1315 |
| 489 | Ga0395898_0589754 | 3300037466 | Bacteria | 1054 |
| 490 | Ga0395905_0000645 | 3300037471 | Bacteria | 46528 |
| 491 | Ga0395905_0014353 | 3300037471 | Bacteria | 7569 |
| 492 | Ga0395905_0054210 | 3300037471 | Bacteria | 3752 |
| 493 | Ga0395905_0059707 | 3300037471 | Bacteria | 3565 |
| 494 | Ga0395905_0079869 | 3300037471 | Bacteria | 3066 |
| 495 | Ga0395905_0110755 | 3300037471 | Bacteria | 2578 |
| 496 | Ga0395905_0118504 | 3300037471 | Bacteria | 2488 |
| 497 | Ga0395905_0465502 | 3300037471 | Bacteria | 1163 |
| 498 | Ga0395905_0546378 | 3300037471 | Bacteria | 1060 |
| 499 | Ga0395905_0681400 | 3300037471 | Bacteria | 930 |
| 500 | Ga0395905_0894160 | 3300037471 | Bacteria | 791 |
| 501 | Ga0395905_1097242 | 3300037471 | Bacteria | 699 |
| 502 | Ga0395905_1563624 | 3300037471 | Bacteria | 564 |
| 503 | Ga0395901_0002541 | 3300038443 | Bacteria | 18492 |
| 504 | Ga0395901_0015504 | 3300038443 | Archaea | 7760 |
| 505 | Ga0395901_0034536 | 3300038443 | Bacteria | 5222 |
| 506 | Ga0395901_0039749 | 3300038443 | Bacteria | 4869 |
| 507 | Ga0395901_0206688 | 3300038443 | Bacteria | 2056 |
| 508 | Ga0395901_0212046 | 3300038443 | Bacteria | 2027 |
| 509 | Ga0395901_0213143 | 3300038443 | Bacteria | 2021 |
| 510 | Ga0395901_0225731 | 3300038443 | Bacteria | 1956 |
| 511 | Ga0395901_0308481 | 3300038443 | Bacteria | 1639 |
| 512 | Ga0395901_0363321 | 3300038443 | Bacteria | 1492 |
| 513 | Ga0395901_0624959 | 3300038443 | Bacteria | 1083 |
| 514 | Ga0395901_0754568 | 3300038443 | Bacteria | 966 |
| 515 | Ga0395901_0939055 | 3300038443 | Bacteria | 844 |
| 516 | Ga0395901_1696609 | 3300038443 | Unclassified | 583 |
| 517 | Ga0436360_0169204 | 3300039438 | Bacteria | 1407 |
| 518 | Ga0436360_1041188 | 3300039438 | Bacteria | 4057 |
| 519 | Ga0451800_0859415 | 3300041459 | Unclassified | 658 |
| 520 | Ga0451804_0921018 | 3300041463 | Bacteria | 515 |
| 521 | Ga0451835_1135819 | 3300041492 | Unclassified | 715 |
| 522 | Ga0451853_0721965 | 3300041512 | Bacteria | 1293 |
| 523 | Ga0466961_0385487 | 3300044693 | Bacteria | 851 |
| 524 | Ga0466963_0015074 | 3300044694 | Bacteria | 4778 |
| 525 | Ga0466963_0023249 | 3300044694 | Bacteria | 3933 |
| 526 | Ga0466963_0113355 | 3300044694 | Bacteria | 1862 |
| 527 | Ga0466963_0224944 | 3300044694 | Bacteria | 1314 |
| 528 | Ga0466963_0268589 | 3300044694 | Bacteria | 1198 |
| 529 | Ga0466964_0492994 | 3300044706 | Unclassified | 657 |
| 530 | Ga0466968_0411902 | 3300044735 | Unclassified | 664 |
| 531 | Ga0466968_0689198 | 3300044735 | Unclassified | 521 |
| 532 | Ga0466970_0259553 | 3300044765 | Bacteria | 975 |
| 533 | Ga0466957_0018097 | 3300044842 | Bacteria | 4133 |
| 534 | Ga0466957_0086957 | 3300044842 | Bacteria | 1954 |
| 535 | Ga0466957_0353557 | 3300044842 | Bacteria | 997 |
| 536 | Ga0466959_0514290 | 3300045049 | Bacteria | 809 |
| 537 | Ga0466958_0001705 | 3300045836 | Bacteria | 10603 |
| 538 | Ga0466958_0169699 | 3300045836 | Bacteria | 1381 |
| 539 | Ga0466958_0217375 | 3300045836 | Bacteria | 1219 |
| 540 | Ga0466958_1144045 | 3300045836 | Unclassified | 508 |
| 541 | Ga0466967_0011667 | 3300045976 | Bacteria | 6675 |
| 542 | Ga0466967_0021475 | 3300045976 | Bacteria | 5245 |
| 543 | Ga0466967_0040977 | 3300045976 | Bacteria | 3989 |
| 544 | Ga0466967_0102507 | 3300045976 | Bacteria | 2618 |
| 545 | Ga0466967_0135755 | 3300045976 | Bacteria | 2287 |
| 546 | Ga0466967_0498449 | 3300045976 | Bacteria | 1195 |
| 547 | Ga0466967_0588628 | 3300045976 | Bacteria | 1097 |
| 548 | Ga0466967_0589400 | 3300045976 | Bacteria | 1096 |
| 549 | Ga0466967_0669390 | 3300045976 | Bacteria | 1027 |
| 550 | Ga0466967_1380446 | 3300045976 | Bacteria | 702 |
| 551 | Ga0466967_2546532 | 3300045976 | Bacteria | 506 |
| 552 | Ga0495592_0003067 | 3300046454 | Bacteria | 11918 |
| 553 | Ga0495592_0117853 | 3300046454 | Bacteria | 1871 |
| 554 | Ga0495592_0595818 | 3300046454 | Bacteria | 675 |
| 555 | Ga0495603_0026640 | 3300046455 | Bacteria | 3492 |
| 556 | Ga0495603_0035444 | 3300046455 | Bacteria | 2997 |
| 557 | Ga0495629_0030326 | 3300046459 | Bacteria | 3835 |
| 558 | Ga0495629_0080434 | 3300046459 | Bacteria | 2275 |
| 559 | Ga0495629_0286685 | 3300046459 | Bacteria | 1129 |
| 560 | Ga0495629_0310439 | 3300046459 | Bacteria | 1079 |
| 561 | Ga0495641_0216685 | 3300046461 | Unclassified | 858 |
| 562 | Ga0495641_0240906 | 3300046461 | Bacteria | 813 |
| 563 | Ga0495641_0297689 | 3300046461 | Bacteria | 727 |
| 564 | Ga0495651_0057019 | 3300046462 | Bacteria | 2999 |
| 565 | Ga0495651_0509298 | 3300046462 | Bacteria | 769 |
| 566 | Ga0495653_0044743 | 3300046463 | Bacteria | 3435 |
| 567 | Ga0495653_0092550 | 3300046463 | Bacteria | 2207 |
| 568 | Ga0495653_0244193 | 3300046463 | Bacteria | 1195 |
| 569 | Ga0495653_0720456 | 3300046463 | Bacteria | 605 |
| 570 | Ga0495580_0531362 | 3300046472 | Bacteria | 783 |
| 571 | Ga0495582_0002417 | 3300046473 | Bacteria | 10426 |
| 572 | Ga0495582_0073639 | 3300046473 | Bacteria | 1891 |
| 573 | Ga0495639_0019332 | 3300046475 | Bacteria | 2973 |
| 574 | Ga0495662_0293830 | 3300046476 | Bacteria | 799 |
| 575 | Ga0495664_0111262 | 3300046477 | Bacteria | 1653 |
| 576 | Ga0495584_0039143 | 3300046491 | Bacteria | 2396 |
| 577 | Ga0495584_0116914 | 3300046491 | Bacteria | 1350 |
| 578 | Ga0495584_0579712 | 3300046491 | Unclassified | 572 |
| 579 | Ga0495594_0276168 | 3300046499 | Bacteria | 957 |
| 580 | Ga0495594_0298017 | 3300046499 | Unclassified | 919 |
| 581 | Ga0495608_0065843 | 3300046511 | Bacteria | 2373 |
| 582 | Ga0495608_0547983 | 3300046511 | Bacteria | 697 |
| 583 | Ga0495618_0138147 | 3300046514 | Bacteria | 1559 |
| 584 | Ga0495618_0371982 | 3300046514 | Bacteria | 878 |
| 585 | Ga0495628_0035383 | 3300046516 | Bacteria | 4013 |
| 586 | Ga0495628_0111221 | 3300046516 | Bacteria | 2106 |
| 587 | Ga0495630_0026483 | 3300046517 | Bacteria | 4293 |
| 588 | Ga0495630_0829925 | 3300046517 | Unclassified | 705 |
| 589 | Ga0495631_0045482 | 3300046518 | Unclassified | 1933 |
| 590 | Ga0495631_0245322 | 3300046518 | Bacteria | 764 |
| 591 | Ga0495637_0154557 | 3300046520 | Bacteria | 864 |
| 592 | Ga0495644_0200164 | 3300046523 | Bacteria | 770 |
| 593 | Ga0495663_0007640 | 3300046525 | Bacteria | 2991 |
| 594 | Ga0495666_0573451 | 3300046526 | Bacteria | 503 |
| 595 | Ga0495652_0028133 | 3300046529 | Bacteria | 4950 |
| 596 | Ga0495652_0063334 | 3300046529 | Bacteria | 3114 |
| 597 | Ga0495652_0088340 | 3300046529 | Bacteria | 2540 |
| 598 | Ga0495652_0159377 | 3300046529 | Bacteria | 1754 |
| 599 | Ga0495652_0287294 | 3300046529 | Bacteria | 1202 |
| 600 | Ga0495665_0091785 | 3300046531 | Archaea | 1596 |
| 601 | Ga0495640_0144595 | 3300046533 | Bacteria | 1530 |
| 602 | Ga0495586_0093732 | 3300046535 | Bacteria | 1661 |
| 603 | Ga0495587_0077386 | 3300046536 | Bacteria | 1931 |
| 604 | Ga0495587_0234195 | 3300046536 | Bacteria | 1034 |
| 605 | Ga0495587_0297646 | 3300046536 | Bacteria | 903 |
| 606 | Ga0495609_0120534 | 3300046538 | Bacteria | 1128 |
| 607 | Ga0495609_0160907 | 3300046538 | Bacteria | 952 |
| 608 | Ga0495645_0079763 | 3300046543 | Bacteria | 2350 |
| 609 | Ga0495645_0152855 | 3300046543 | Bacteria | 1601 |
| 610 | Ga0495645_0698214 | 3300046543 | Unclassified | 616 |
| 611 | Ga0495667_0128319 | 3300046559 | Bacteria | 1636 |
| 612 | Ga0495667_0192443 | 3300046559 | Bacteria | 1307 |
| 613 | Ga0495656_0777045 | 3300046615 | Bacteria | 517 |
| 614 | Ga0495634_0180624 | 3300046642 | Bacteria | 1321 |
| 615 | Ga0495634_0551217 | 3300046642 | Bacteria | 672 |
| 616 | Ga0495634_0745773 | 3300046642 | Bacteria | 561 |
| 617 | Ga0495635_0074497 | 3300046663 | Bacteria | 2326 |
| 618 | Ga0495635_0369840 | 3300046663 | Bacteria | 955 |
| 619 | Ga0495659_0039876 | 3300046664 | Bacteria | 1671 |
| 620 | Ga0495659_0400421 | 3300046664 | Unclassified | 592 |
| 621 | Ga0495588_0157071 | 3300046674 | Unclassified | 1202 |
| 622 | Ga0495588_0210483 | 3300046674 | Bacteria | 1027 |
| 623 | Ga0495657_0079999 | 3300046675 | Bacteria | 2116 |
| 624 | Ga0495599_0011709 | 3300046678 | Bacteria | 5392 |
| 625 | Ga0495599_0069334 | 3300046678 | Bacteria | 2200 |
| 626 | Ga0495623_0020975 | 3300046679 | Bacteria | 4222 |
| 627 | Ga0495623_0129812 | 3300046679 | Bacteria | 1510 |
| 628 | Ga0495623_0298735 | 3300046679 | Bacteria | 890 |
| 629 | Ga0495646_0059867 | 3300046680 | Bacteria | 2273 |
| 630 | Ga0495646_0067013 | 3300046680 | Bacteria | 2123 |
| 631 | Ga0495647_0034967 | 3300046681 | Bacteria | 1885 |
| 632 | Ga0495647_0051096 | 3300046681 | Bacteria | 1606 |
| 633 | Ga0495658_0009277 | 3300046683 | Bacteria | 4895 |
| 634 | Ga0495658_0078990 | 3300046683 | Archaea | 1927 |
| 635 | Ga0495669_0504097 | 3300046684 | Bacteria | 589 |
| 636 | Ga0495613_0017517 | 3300046689 | Bacteria | 5333 |
| 637 | Ga0495613_0059054 | 3300046689 | Bacteria | 2813 |
| 638 | Ga0495613_0085425 | 3300046689 | Bacteria | 2290 |
| 639 | Ga0495613_0942489 | 3300046689 | Bacteria | 557 |
| 640 | Ga0495624_0966978 | 3300046690 | Bacteria | 500 |
| 641 | Ga0495670_0664938 | 3300046691 | Unclassified | 568 |
| 642 | Ga0495589_0251198 | 3300046794 | Unclassified | 826 |
| 643 | Ga0495600_0227803 | 3300046809 | Bacteria | 1191 |
| 644 | Ga0495600_0255065 | 3300046809 | Bacteria | 1115 |
| 645 | Ga0495600_0370497 | 3300046809 | Bacteria | 895 |
| 646 | Ga0495600_0441099 | 3300046809 | Bacteria | 806 |
| 647 | Ga0495581_0105887 | 3300047315 | Archaea | 1634 |
| 648 | Ga0495581_0456626 | 3300047315 | Bacteria | 744 |
| 649 | Ga0495604_0019807 | 3300047317 | Bacteria | 5382 |
| 650 | Ga0495604_0156189 | 3300047317 | Bacteria | 1616 |
| 651 | Ga0495604_0501238 | 3300047317 | Bacteria | 787 |
| 652 | Ga0495674_0026158 | 3300047319 | Bacteria | 5342 |
| 653 | Ga0495674_0325428 | 3300047319 | Bacteria | 1251 |
| 654 | Ga0495674_0468621 | 3300047319 | Bacteria | 1010 |
| 655 | Ga0495676_0525401 | 3300047321 | Bacteria | 775 |
| 656 | Ga0495676_0725411 | 3300047321 | Unclassified | 642 |
| 657 | Ga0495680_0037683 | 3300047322 | Bacteria | 3872 |
| 658 | Ga0495680_0102933 | 3300047322 | Bacteria | 2126 |
| 659 | Ga0495680_0809632 | 3300047322 | Bacteria | 611 |
| 660 | Ga0495683_0460501 | 3300047323 | Unclassified | 521 |
| 661 | Ga0495675_0251350 | 3300047444 | Unclassified | 1062 |
| 662 | Ga0495675_0270261 | 3300047444 | Bacteria | 1016 |
| 663 | Ga0495677_0103701 | 3300047445 | Unclassified | 1078 |
| 664 | Ga0495684_0070376 | 3300047471 | Bacteria | 2660 |
| 665 | Ga0495684_0262920 | 3300047471 | Bacteria | 1251 |
| 666 | Ga0495684_0518728 | 3300047471 | Bacteria | 816 |
| 667 | Ga0495602_0034514 | 3300048088 | Bacteria | 4731 |
| 668 | Ga0495602_0120997 | 3300048088 | Bacteria | 2106 |
| 669 | Ga0495602_0202207 | 3300048088 | Bacteria | 1515 |
| 670 | Ga0495602_0449905 | 3300048088 | Bacteria | 909 |
| 671 | Ga0495602_0515027 | 3300048088 | Bacteria | 834 |
| 672 | Ga0495614_0093309 | 3300048089 | Bacteria | 1311 |
| 673 | Ga0495614_0555628 | 3300048089 | Bacteria | 549 |
| 674 | Ga0496100_0086860 | 3300048903 | Bacteria | 2125 |
| 675 | Ga0496100_0154649 | 3300048903 | Bacteria | 1639 |
| 676 | Ga0496100_0405175 | 3300048903 | Bacteria | 1039 |
| 677 | Ga0496100_0621617 | 3300048903 | Bacteria | 840 |
| 678 | Ga0496100_0925300 | 3300048903 | Bacteria | 685 |
| 679 | Ga0496101_0050877 | 3300048904 | Bacteria | 2984 |
| 680 | Ga0496101_0106921 | 3300048904 | Unclassified | 2101 |
| 681 | Ga0496101_0875332 | 3300048904 | Bacteria | 707 |
| 682 | Ga0496101_0959269 | 3300048904 | Bacteria | 673 |
| 683 | Ga0496101_1357109 | 3300048904 | Bacteria | 555 |
| 684 | Ga0496102_0407614 | 3300048905 | Unclassified | 1277 |
| 685 | Ga0496102_0493244 | 3300048905 | Bacteria | 1146 |
| 686 | Ga0496102_0672011 | 3300048905 | Bacteria | 959 |
| 687 | Ga0496102_1275017 | 3300048905 | Bacteria | 654 |
| 688 | Ga0496103_0084138 | 3300048906 | Bacteria | 2003 |
| 689 | Ga0496104_0003847 | 3300048907 | Bacteria | 12992 |
| 690 | Ga0496104_0008113 | 3300048907 | Bacteria | 9317 |
| 691 | Ga0496104_0020197 | 3300048907 | Bacteria | 6103 |
| 692 | Ga0496104_0235600 | 3300048907 | Archaea | 1742 |
| 693 | Ga0496105_0002860 | 3300048908 | Bacteria | 12640 |
| 694 | Ga0496105_0004890 | 3300048908 | Bacteria | 10128 |
| 695 | Ga0496105_0060838 | 3300048908 | Bacteria | 3116 |
| 696 | Ga0496105_0322146 | 3300048908 | Bacteria | 1239 |
| 697 | Ga0496106_0192389 | 3300048909 | Bacteria | 1622 |
| 698 | Ga0496106_0423104 | 3300048909 | Bacteria | 1070 |
| 699 | Ga0496106_0869940 | 3300048909 | Bacteria | 713 |
| 700 | Ga0496107_0080423 | 3300048910 | Unclassified | 2376 |
| 701 | Ga0496107_0546288 | 3300048910 | Bacteria | 858 |
| 702 | Ga0496107_1185809 | 3300048910 | Bacteria | 549 |
| 703 | Ga0496108_0002097 | 3300048911 | Bacteria | 15958 |
| 704 | Ga0496108_0025760 | 3300048911 | Bacteria | 4849 |
| 705 | Ga0496108_0174513 | 3300048911 | Bacteria | 1860 |
| 706 | Ga0496108_0185095 | 3300048911 | Bacteria | 1804 |
| 707 | Ga0496108_0223980 | 3300048911 | Bacteria | 1634 |
| 708 | Ga0496109_0001717 | 3300048912 | Bacteria | 18268 |
| 709 | Ga0496109_0002279 | 3300048912 | Bacteria | 15952 |
| 710 | Ga0496109_0016974 | 3300048912 | Bacteria | 6373 |
| 711 | Ga0496109_0217454 | 3300048912 | Bacteria | 1797 |
| 712 | Ga0496109_0276115 | 3300048912 | Bacteria | 1583 |
| 713 | Ga0496109_0341408 | 3300048912 | Archaea | 1414 |
| 714 | Ga0496109_0705204 | 3300048912 | Bacteria | 947 |
| 715 | Ga0496110_0131435 | 3300048913 | Bacteria | 2261 |
| 716 | Ga0496110_0732105 | 3300048913 | Unclassified | 892 |
| 717 | Ga0496111_0016275 | 3300048914 | Bacteria | 5122 |
| 718 | Ga0496111_0120668 | 3300048914 | Bacteria | 1936 |
| 719 | Ga0496111_0184952 | 3300048914 | Bacteria | 1549 |
| 720 | Ga0496111_0363359 | 3300048914 | Bacteria | 1071 |
| 721 | Ga0496111_0495052 | 3300048914 | Bacteria | 900 |
| 722 | Ga0496112_0059292 | 3300048915 | Bacteria | 3771 |
| 723 | Ga0496112_0147583 | 3300048915 | Bacteria | 2320 |
| 724 | Ga0496112_0247228 | 3300048915 | Bacteria | 1735 |
| 725 | Ga0496112_0288451 | 3300048915 | Bacteria | 1587 |
| 726 | Ga0496112_0497766 | 3300048915 | Bacteria | 1154 |
| 727 | Ga0496113_0049821 | 3300048916 | Bacteria | 3120 |
| 728 | Ga0496113_0128035 | 3300048916 | Unclassified | 1990 |
| 729 | Ga0496113_0201297 | 3300048916 | Bacteria | 1583 |
| 730 | Ga0496113_1321642 | 3300048916 | Bacteria | 560 |
| 731 | Ga0496113_1407010 | 3300048916 | Bacteria | 540 |
| 732 | Ga0496114_0008003 | 3300048917 | Bacteria | 8364 |
| 733 | Ga0496114_0085165 | 3300048917 | Bacteria | 2677 |
| 734 | Ga0496114_0212560 | 3300048917 | Bacteria | 1697 |
| 735 | Ga0496114_0236486 | 3300048917 | Unclassified | 1605 |
| 736 | Ga0496115_0052315 | 3300048918 | Bacteria | 3276 |
| 737 | Ga0496115_0057605 | 3300048918 | Bacteria | 3125 |
| 738 | Ga0496115_0367907 | 3300048918 | Bacteria | 1170 |
| 739 | Ga0496115_0515569 | 3300048918 | Bacteria | 959 |
| 740 | Ga0501067_0005982 | 3300049583 | Bacteria | 6745 |
| 741 | Ga0501067_0047221 | 3300049583 | Bacteria | 2388 |
| 742 | Ga0501069_0035739 | 3300049585 | Bacteria | 2738 |
| 743 | Ga0501069_0048362 | 3300049585 | Bacteria | 2361 |
| 744 | Ga0501069_0110880 | 3300049585 | Bacteria | 1562 |
| 745 | nmdc:mga00v17_830124_c1 | 3300050491 | Bacteria | 588 |
| 746 | nmdc:mga0yw44_52642_c1 | 3300050492 | Bacteria | 2469 |
| 747 | nmdc:mga06z11_187406_c1 | 3300050494 | Bacteria | 1196 |
| 748 | nmdc:mga05p37_1235753_c1 | 3300050507 | Bacteria | 768 |
| 749 | nmdc:mga05p37_1715523_c1 | 3300050507 | Bacteria | 611 |
| 750 | nmdc:mga05p37_745573_c1 | 3300050507 | Bacteria | 1080 |
| 751 | nmdc:mga06r32_368799_c1 | 3300050510 | Unclassified | 1419 |
| 752 | nmdc:mga0n895_161095_c1 | 3300050512 | Unclassified | 2275 |
| 753 | nmdc:mga0n895_818594_c1 | 3300050512 | Bacteria | 921 |
| 754 | nmdc:mga08x19_162694_c1 | 3300050514 | Bacteria | 1516 |
| 755 | nmdc:mga08x19_821699_c1 | 3300050514 | Bacteria | 660 |
| 756 | Ga0495601_0023236 | 3300053077 | Bacteria | 3809 |
| 757 | Ga0495601_0282877 | 3300053077 | Bacteria | 1081 |
| 758 | Ga0495601_0313016 | 3300053077 | Bacteria | 1022 |
| 759 | Ga0495601_0417175 | 3300053077 | Bacteria | 869 |
| 760 | Ga0495601_0533377 | 3300053077 | Bacteria | 756 |
| 761 | Ga0495612_0024559 | 3300053078 | Bacteria | 2419 |
| 762 | Ga0495612_0373078 | 3300053078 | Bacteria | 646 |
| 763 | Ga0495655_0096186 | 3300053083 | Bacteria | 870 |
| 764 | Ga0495595_0148733 | 3300053084 | Bacteria | 1152 |
| 765 | Ga0495619_0057013 | 3300053085 | Bacteria | 2591 |
| 766 | Ga0495619_0091342 | 3300053085 | Bacteria | 2061 |
| 767 | Ga0495619_0769606 | 3300053085 | Bacteria | 652 |
| 768 | Ga0495619_0917033 | 3300053085 | Bacteria | 589 |
| 769 | Ga0587073_0117180 | 3300059492 | Bacteria | 714 |
| 770 | Ga0587094_064838 | 3300059513 | Bacteria | 646 |
| 771 | Ga0587128_031899 | 3300059630 | Bacteria | 878 |
| 772 | Ga0587069_089673 | 3300059642 | Bacteria | 613 |
| 773 | Ga0587075_027207 | 3300059644 | Bacteria | 889 |
| 774 | Ga0466962_0042647 | 3300061719 | Bacteria | 2172 |
| 775 | Ga0466962_0179260 | 3300061719 | Bacteria | 1033 |
| 776 | Ga0530510_0756761 | 3300061734 | Bacteria | 741 |
| 777 | Ga0265334_10119478 | |||
| 778 | JGI24748J21848_1032994 | |||
| 779 | JGI24744J21845_10033267 | |||
| 780 | Ga0070658_10010084 | |||
| 781 | Ga0070658_10274790 | |||
| 782 | Ga0070658_10504805 | |||
| 783 | Ga0070683_100012407 | |||
| 784 | Ga0070683_100493526 | |||
| 785 | Ga0070683_100585110 | |||
| 786 | Ga0070683_100777040 | |||
| 787 | Ga0070690_100017901 | |||
| 788 | Ga0070680_100128506 | |||
| 789 | Ga0070680_100276784 | |||
| 790 | Ga0070680_100381830 | |||
| 791 | Ga0070682_100048657 | |||
| 792 | Ga0070682_100159448 | |||
| 793 | Ga0070682_101566696 | |||
| 794 | Ga0068868_100475539 | |||
| 795 | Ga0070660_100005534 | |||
| 796 | Ga0070660_100042939 | |||
| 797 | Ga0070660_100045840 | |||
| 798 | Ga0070660_100116276 | |||
| 799 | Ga0070660_100138026 | |||
| 800 | Ga0070689_101918447 | |||
| 801 | Ga0070691_10324529 | |||
| 802 | Ga0070661_100130537 | |||
| 803 | Ga0070661_100353922 | |||
| 804 | Ga0070661_100782340 | |||
| 805 | Ga0070692_10038833 | |||
| 806 | Ga0070692_10058958 | |||
| 807 | Ga0070668_100193858 | |||
| 808 | Ga0070669_100444686 | |||
| 809 | Ga0070675_100306307 | |||
| 810 | Ga0070671_100038529 | |||
| 811 | Ga0070671_101275332 | |||
| 812 | Ga0070674_100178742 | |||
| 813 | Ga0070673_102103731 | |||
| 814 | Ga0070673_102154832 | |||
| 815 | Ga0070688_100429519 | |||
| 816 | Ga0070688_100741590 | |||
| 817 | Ga0070659_100083980 | |||
| 818 | Ga0070659_100596461 | |||
| 819 | Ga0070659_100715471 | |||
| 820 | Ga0070703_10223095 | |||
| 821 | Ga0070709_10149306 | |||
| 822 | Ga0070709_10167700 | |||
| 823 | Ga0070709_10532413 | |||
| 824 | Ga0070709_10538873 | |||
| 825 | Ga0070709_11312248 | |||
| 826 | Ga0070709_11342589 | |||
| 827 | Ga0070709_11493031 | |||
| 828 | Ga0070714_100016102 | |||
| 829 | Ga0070714_100017564 | |||
| 830 | Ga0070714_100110377 | |||
| 831 | Ga0070714_100116653 | |||
| 832 | Ga0070714_100354897 | |||
| 833 | Ga0070714_100514384 | |||
| 834 | Ga0070714_100784288 | |||
| 835 | Ga0070714_101139547 | |||
| 836 | Ga0070713_100021120 | |||
| 837 | Ga0070713_100120381 | |||
| 838 | Ga0070713_100209069 | |||
| 839 | Ga0070713_100598146 | |||
| 840 | Ga0070713_100734035 | |||
| 841 | Ga0070713_100954142 | |||
| 842 | Ga0070713_101385677 | |||
| 843 | Ga0070713_101770175 | |||
| 844 | Ga0070713_101887650 | |||
| 845 | Ga0070710_10110163 | |||
| 846 | Ga0070710_10130334 | |||
| 847 | Ga0070710_10600896 | |||
| 848 | Ga0070710_10887124 | |||
| 849 | Ga0070701_10015114 | |||
| 850 | Ga0070701_10227535 | |||
| 851 | Ga0070711_100014047 | |||
| 852 | Ga0070711_100159588 | |||
| 853 | Ga0070711_100527417 | |||
| 854 | Ga0070711_100833419 | |||
| 855 | Ga0070711_100965038 | |||
| 856 | Ga0070705_100173808 | |||
| 857 | Ga0070705_100192634 | |||
| 858 | Ga0070700_100031352 | |||
| 859 | Ga0070708_100204172 | |||
| 860 | Ga0070708_100285087 | |||
| 861 | Ga0070708_100735936 | |||
| 862 | Ga0070663_100368980 | |||
| 863 | Ga0070678_100025637 | |||
| 864 | Ga0070662_100670816 | |||
| 865 | Ga0070681_10011382 | |||
| 866 | Ga0070681_10072778 | |||
| 867 | Ga0070681_10102805 | |||
| 868 | Ga0070681_10176769 | |||
| 869 | Ga0070681_10330516 | |||
| 870 | Ga0070681_11839983 | |||
| 871 | Ga0068867_100190648 | |||
| 872 | Ga0070685_10301658 | |||
| 873 | Ga0070706_100063585 | |||
| 874 | Ga0070706_100210509 | |||
| 875 | Ga0070706_100761941 | |||
| 876 | Ga0070707_100424561 | |||
| 877 | Ga0070707_100479311 | |||
| 878 | Ga0070707_100580790 | |||
| 879 | Ga0070707_102155981 | |||
| 880 | Ga0070698_100078846 | |||
| 881 | Ga0070698_100080378 | |||
| 882 | Ga0070698_100192854 | |||
| 883 | Ga0070698_100320877 | |||
| 884 | Ga0070698_100481227 | |||
| 885 | Ga0070698_100524912 | |||
| 886 | Ga0070699_100884454 | |||
| 887 | Ga0070699_101042914 | |||
| 888 | Ga0070699_101190492 | |||
| 889 | Ga0070679_100064231 | |||
| 890 | Ga0070679_100225445 | |||
| 891 | Ga0070679_100283515 | |||
| 892 | Ga0070679_100420603 | |||
| 893 | Ga0070684_100061778 | |||
| 894 | Ga0070684_100239776 | |||
| 895 | Ga0070684_100472159 | |||
| 896 | Ga0070684_100955677 | |||
| 897 | Ga0070697_101967653 | |||
| 898 | Ga0068853_100055011 | |||
| 899 | Ga0068853_101159013 | |||
| 900 | Ga0070672_100158494 | |||
| 901 | Ga0070686_100069779 | |||
| 902 | Ga0070696_100062017 | |||
| 903 | Ga0070693_100183857 | |||
| 904 | Ga0070693_100474424 | |||
| 905 | Ga0070693_101213870 | |||
| 906 | Ga0070693_101566850 | |||
| 907 | Ga0070704_101426534 | |||
| 908 | Ga0068855_100301406 | |||
| 909 | Ga0068855_100520047 | |||
| 910 | Ga0068855_100956884 | |||
| 911 | Ga0070664_100687224 | |||
| 912 | Ga0068857_100032695 | |||
| 913 | Ga0068857_101494197 | |||
| 914 | Ga0068854_100166903 | |||
| 915 | Ga0068854_101480292 | |||
| 916 | Ga0068856_100116642 | |||
| 917 | Ga0068856_100715456 | |||
| 918 | Ga0070702_100165774 | |||
| 919 | Ga0068852_100022075 | |||
| 920 | Ga0068852_100154397 | |||
| 921 | Ga0068852_100467858 | |||
| 922 | Ga0068852_100924634 | |||
| 923 | Ga0068852_101542595 | |||
| 924 | Ga0068852_102564438 | |||
| 925 | Ga0068859_100825667 | |||
| 926 | Ga0068866_10012223 | |||
| 927 | Ga0068861_101112844 | |||
| 928 | Ga0068870_10688402 | |||
| 929 | Ga0068858_100472121 | |||
| 930 | Ga0068860_100265867 | |||
| 931 | Ga0068862_101813724 | |||
| 932 | Ga0070717_10012749 | |||
| 933 | Ga0070717_10062786 | |||
| 934 | Ga0070717_10106330 | |||
| 935 | Ga0070717_10117213 | |||
| 936 | Ga0070717_10685996 | |||
| 937 | Ga0070717_11060955 | |||
| 938 | Ga0075365_10260471 | |||
| 939 | Ga0075363_100508382 | |||
| 940 | Ga0075363_100992109 | |||
| 941 | Ga0075364_10938167 | |||
| 942 | Ga0075432_10520095 | |||
| 943 | Ga0070715_10070665 | |||
| 944 | Ga0070715_10212487 | |||
| 945 | Ga0070716_100262994 | |||
| 946 | Ga0070716_100525006 | |||
| 947 | Ga0070716_101405095 | |||
| 948 | Ga0070716_101669052 | |||
| 949 | Ga0070712_100060008 | |||
| 950 | Ga0070712_100153648 | |||
| 951 | Ga0070712_100259791 | |||
| 952 | Ga0070712_100318330 | |||
| 953 | Ga0070712_102052891 | |||
| 954 | Ga0097621_100226869 | |||
| 955 | Ga0097621_101706859 | |||
| 956 | Ga0068871_100084801 | |||
| 957 | Ga0075431_100418609 | |||
| 958 | Ga0075434_100118064 | |||
| 959 | Ga0075434_100921293 | |||
| 960 | Ga0068865_100240376 | |||
| 961 | Ga0075436_100095339 | |||
| 962 | Ga0097620_100825682 | |||
| 963 | Ga0099794_10498583 | |||
| 964 | Ga0105240_10029146 | |||
| 965 | Ga0105240_10067436 | |||
| 966 | Ga0105240_10103092 | |||
| 967 | Ga0105240_11128530 | |||
| 968 | Ga0111539_10161096 | |||
| 969 | Ga0105245_10143478 | |||
| 970 | Ga0105245_10225623 | |||
| 971 | Ga0105245_11361770 | |||
| 972 | Ga0105245_12842408 | |||
| 973 | Ga0105247_10104938 | |||
| 974 | Ga0114129_11130489 | |||
| 975 | Ga0114129_12201004 | |||
| 976 | Ga0105243_10157327 | |||
| 977 | Ga0105241_10018098 | |||
| 978 | Ga0105242_10253932 | |||
| 979 | Ga0105242_10789694 | |||
| 980 | Ga0105248_10017831 | |||
| 981 | Ga0105248_10365527 | |||
| 982 | Ga0105237_10076340 | |||
| 983 | Ga0105237_10544673 | |||
| 984 | Ga0105238_10024715 | |||
| 985 | Ga0105238_10245388 | |||
| 986 | Ga0105238_12705159 | |||
| 987 | Ga0105249_10258763 | |||
| 988 | Ga0099796_10031812 | |||
| 989 | Ga0105239_10762227 | |||
| 990 | Ga0105239_10826575 | |||
| 991 | Ga0105246_10035736 | |||
| 992 | Ga0157371_10174387 | |||
| 993 | Ga0157371_10254916 | |||
| 994 | Ga0157370_10022966 | |||
| 995 | Ga0157370_10096440 | |||
| 996 | Ga0157370_10299804 | |||
| 997 | Ga0157370_10659978 | |||
| 998 | Ga0157370_10683390 | |||
| 999 | Ga0157369_10061038 | |||
| 1000 | Ga0157369_10123462 | |||
| 1001 | Ga0157369_10204869 | |||
| 1002 | Ga0157369_10581138 | |||
| 1003 | Ga0157369_10642985 | |||
| 1004 | Ga0157369_11136219 | |||
| 1005 | Ga0157374_10304377 | |||
| 1006 | Ga0157374_10923122 | |||
| 1007 | Ga0157378_10866661 | |||
| 1008 | Ga0163162_10103389 | |||
| 1009 | Ga0157372_10095568 | |||
| 1010 | Ga0157372_10329807 | |||
| 1011 | Ga0157372_10424545 | |||
| 1012 | Ga0157372_10824456 | |||
| 1013 | Ga0157372_10920493 | |||
| 1014 | Ga0157372_10943528 | |||
| 1015 | Ga0157372_11062819 | |||
| 1016 | Ga0157372_11861127 | |||
| 1017 | Ga0157372_12681141 | |||
| 1018 | Ga0157375_10074773 | |||
| 1019 | Ga0163163_11882382 | |||
| 1020 | Ga0157380_10023312 | |||
| 1021 | Ga0182008_10002788 | |||
| 1022 | Ga0182008_10090894 | |||
| 1023 | Ga0157377_10109910 | |||
| 1024 | Ga0157377_10507692 | |||
| 1025 | Ga0157379_10677192 | |||
| 1026 | Ga0157376_11786906 | |||
| 1027 | Ga0157376_13086489 | |||
| 1028 | Ga0182006_1025712 | |||
| 1029 | Ga0182007_10174586 | |||
| 1030 | Ga0197907_10443636 | |||
| 1031 | Ga0197907_11304884 | |||
| 1032 | Ga0206356_10501020 | |||
| 1033 | Ga0206356_10554009 | |||
| 1034 | Ga0206349_1665945 | |||
| 1035 | Ga0206354_10306743 | |||
| 1036 | Ga0206354_11403241 | |||
| 1037 | Ga0206353_10603087 | |||
| 1038 | Ga0206353_11078404 | |||
| 1039 | Ga0154015_1320522 | |||
| 1040 | Ga0224712_10050023 | |||
| 1041 | Ga0207653_10129551 | |||
| 1042 | Ga0207692_10074375 | |||
| 1043 | Ga0207692_10266122 | |||
| 1044 | Ga0207692_11073790 | |||
| 1045 | Ga0207642_10085810 | |||
| 1046 | Ga0207710_10105403 | |||
| 1047 | Ga0207688_10066058 | |||
| 1048 | Ga0207680_10061931 | |||
| 1049 | Ga0207647_10219885 | |||
| 1050 | Ga0207685_10023009 | |||
| 1051 | Ga0207699_10224172 | |||
| 1052 | Ga0207699_10312379 | |||
| 1053 | Ga0207699_10424904 | |||
| 1054 | Ga0207699_10739724 | |||
| 1055 | Ga0207699_10902534 | |||
| 1056 | Ga0207705_10030566 | |||
| 1057 | Ga0207705_10200859 | |||
| 1058 | Ga0207705_10258031 | |||
| 1059 | Ga0207705_10915489 | |||
| 1060 | Ga0207684_10617350 | |||
| 1061 | Ga0207684_10986808 | |||
| 1062 | Ga0207707_10005030 | |||
| 1063 | Ga0207707_10241498 | |||
| 1064 | Ga0207707_10362911 | |||
| 1065 | Ga0207707_10440694 | |||
| 1066 | Ga0207707_10690003 | |||
| 1067 | Ga0207707_11084553 | |||
| 1068 | Ga0207695_10059936 | |||
| 1069 | Ga0207695_10383164 | |||
| 1070 | Ga0207695_10699981 | |||
| 1071 | Ga0207693_10003568 | |||
| 1072 | Ga0207693_10148989 | |||
| 1073 | Ga0207693_10191469 | |||
| 1074 | Ga0207693_10764891 | |||
| 1075 | Ga0207693_10808627 | |||
| 1076 | Ga0207663_10188030 | |||
| 1077 | Ga0207663_10364831 | |||
| 1078 | Ga0207663_10624627 | |||
| 1079 | Ga0207663_10632709 | |||
| 1080 | Ga0207663_10687920 | |||
| 1081 | Ga0207663_10821251 | |||
| 1082 | Ga0207660_10012122 | |||
| 1083 | Ga0207660_10046233 | |||
| 1084 | Ga0207660_10585689 | |||
| 1085 | Ga0207660_10610672 | |||
| 1086 | Ga0207662_10106962 | |||
| 1087 | Ga0207657_10001701 | |||
| 1088 | Ga0207657_10006734 | |||
| 1089 | Ga0207657_10013597 | |||
| 1090 | Ga0207657_10085860 | |||
| 1091 | Ga0207657_10169514 | |||
| 1092 | Ga0207657_10225829 | |||
| 1093 | Ga0207649_10586764 | |||
| 1094 | Ga0207649_10649596 | |||
| 1095 | Ga0207649_11253414 | |||
| 1096 | Ga0207652_10009207 | |||
| 1097 | Ga0207652_10680909 | |||
| 1098 | Ga0207652_11152309 | |||
| 1099 | Ga0207652_11160657 | |||
| 1100 | Ga0207652_11188629 | |||
| 1101 | Ga0207652_11401908 | |||
| 1102 | Ga0207646_10153643 | |||
| 1103 | Ga0207646_10468425 | |||
| 1104 | Ga0207646_11557704 | |||
| 1105 | Ga0207646_11906686 | |||
| 1106 | Ga0207681_11220499 | |||
| 1107 | Ga0207694_10455667 | |||
| 1108 | Ga0207694_11738903 | |||
| 1109 | Ga0207659_10507470 | |||
| 1110 | Ga0207687_10060671 | |||
| 1111 | Ga0207687_10103225 | |||
| 1112 | Ga0207700_10081675 | |||
| 1113 | Ga0207700_10137983 | |||
| 1114 | Ga0207700_10188926 | |||
| 1115 | Ga0207700_11122960 | |||
| 1116 | Ga0207700_11296700 | |||
| 1117 | Ga0207664_10122399 | |||
| 1118 | Ga0207664_10132145 | |||
| 1119 | Ga0207664_10133736 | |||
| 1120 | Ga0207664_10141222 | |||
| 1121 | Ga0207664_10181768 | |||
| 1122 | Ga0207664_10568429 | |||
| 1123 | Ga0207664_10585067 | |||
| 1124 | Ga0207664_10824292 | |||
| 1125 | Ga0207664_11502357 | |||
| 1126 | Ga0207644_10111179 | |||
| 1127 | Ga0207644_11346620 | |||
| 1128 | Ga0207690_10846364 | |||
| 1129 | Ga0207686_10055195 | |||
| 1130 | Ga0207686_10797638 | |||
| 1131 | Ga0207709_10098065 | |||
| 1132 | Ga0207670_10219582 | |||
| 1133 | Ga0207669_10359827 | |||
| 1134 | Ga0207704_10036215 | |||
| 1135 | Ga0207665_10224095 | |||
| 1136 | Ga0207665_10245146 | |||
| 1137 | Ga0207665_10344451 | |||
| 1138 | Ga0207665_10418533 | |||
| 1139 | Ga0207665_10731447 | |||
| 1140 | Ga0207691_10066817 | |||
| 1141 | Ga0207711_10112245 | |||
| 1142 | Ga0207711_10201178 | |||
| 1143 | Ga0207661_10015417 | |||
| 1144 | Ga0207661_10580839 | |||
| 1145 | Ga0207679_10895735 | |||
| 1146 | Ga0207667_10010589 | |||
| 1147 | Ga0207667_10337773 | |||
| 1148 | Ga0207667_10491727 | |||
| 1149 | Ga0207667_10831270 | |||
| 1150 | Ga0207667_10859236 | |||
| 1151 | Ga0207651_10247816 | |||
| 1152 | Ga0207651_11432816 | |||
| 1153 | Ga0207712_10388673 | |||
| 1154 | Ga0207668_10249702 | |||
| 1155 | Ga0207640_11526839 | |||
| 1156 | Ga0207677_10155482 | |||
| 1157 | Ga0207677_10532673 | |||
| 1158 | Ga0207703_10367659 | |||
| 1159 | Ga0207639_10516708 | |||
| 1160 | Ga0207639_10561340 | |||
| 1161 | Ga0207639_11326222 | |||
| 1162 | Ga0207678_10142755 | |||
| 1163 | Ga0207708_10015144 | |||
| 1164 | Ga0207702_10076767 | |||
| 1165 | Ga0207702_10438485 | |||
| 1166 | Ga0207702_11307080 | |||
| 1167 | Ga0207648_10000150 | |||
| 1168 | Ga0207674_10144166 | |||
| 1169 | Ga0207674_11625728 | |||
| 1170 | Ga0207675_100030408 | |||
| 1171 | Ga0207683_10000131 | |||
| 1172 | Ga0207698_10042404 | |||
| 1173 | Ga0207698_10586766 | |||
| 1174 | Ga0265337_1034415 | |||
| 1175 | Ga0265337_1143805 | |||
| 1176 | Ga0265326_10010223 | |||
| 1177 | Ga0265319_1004104 | |||
| 1178 | Ga0265318_10000220 | |||
| 1179 | Ga0265323_10102314 | |||
| 1180 | Ga0265323_10112529 | |||
| 1181 | Ga0265336_10198396 | |||
| 1182 | Ga0265338_10003129 | |||
| 1183 | Ga0265338_10155536 | |||
| 1184 | Ga0265338_10250383 | |||
| 1185 | Ga0265338_10313820 | |||
| 1186 | Ga0265338_10542850 | |||
| 1187 | Ga0265324_10084124 | |||
| 1188 | Ga0265324_10089711 | |||
| 1189 | Ga0265330_10002778 | |||
| 1190 | Ga0265330_10028319 | |||
| 1191 | Ga0265332_10003330 | |||
| 1192 | Ga0265328_10029907 | |||
| 1193 | Ga0265328_10420006 | |||
| 1194 | Ga0265320_10004689 | |||
| 1195 | Ga0265325_10002188 | |||
| 1196 | Ga0265329_10008893 | |||
| 1197 | Ga0265340_10015147 | |||
| 1198 | Ga0265339_10037888 | |||
| 1199 | Ga0265339_10095216 | |||
| 1200 | Ga0265331_10004398 | |||
| 1201 | Ga0265331_10044454 | |||
| 1202 | Ga0265331_10505844 | |||
| 1203 | Ga0265327_10005502 | |||
| 1204 | Ga0265327_10032367 | |||
| 1205 | Ga0265316_10039633 | |||
| 1206 | Ga0265313_10019248 | |||
| 1207 | Ga0265313_10115353 | |||
| 1208 | Ga0265313_10141634 | |||
| 1209 | Ga0265314_10004402 | |||
| 1210 | Ga0265342_10122444 | |||
| 1211 | Ga0265342_10165146 | |||
| 1212 | Ga0316583_10009886 | |||
| 1213 | Ga0316583_10027481 | |||
| 1214 | Ga0373934_0097428 | |||
| 1215 | Ga0373923_0543436 | |||
| 1216 | Ga0373932_0457922 | |||
| 1217 | Ga0373954_0535627 | |||
| 1218 | Ga0373956_0352166 | |||
| 1219 | Ga0373957_0077003 | |||
| 1220 | Ga0373957_0170716 | |||
| 1221 | Ga0373946_0240574 | |||
| 1222 | Ga0373955_0211653 | |||
| 1223 | Ga0373955_0437764 | |||
| 1224 | Ga0373955_0740109 | |||
| 1225 | Ga0373924_0235485 | |||
| 1226 | Ga0373924_0302367 | |||
| 1227 | Ga0373924_0326533 | |||
| 1228 | Ga0373935_0245010 | |||
| 1229 | Ga0373933_0320091 | |||
| 1230 | Ga0373933_1135586 | |||
| 1231 | Ga0373947_1186966 | |||
| 1232 | Ga0373937_0204408 | |||
| 1233 | Ga0373937_0291766 | |||
| 1234 | Ga0373937_0302790 | |||
| 1235 | Ga0395899_0009695 | |||
| 1236 | Ga0395899_0041286 | |||
| 1237 | Ga0395899_0066149 | |||
| 1238 | Ga0395899_0103805 | |||
| 1239 | Ga0395899_0106272 | |||
| 1240 | Ga0395899_0116877 | |||
| 1241 | Ga0395899_0172008 | |||
| 1242 | Ga0395899_0177146 | |||
| 1243 | Ga0395899_0197834 | |||
| 1244 | Ga0395899_0304804 | |||
| 1245 | Ga0395900_0001301 | |||
| 1246 | Ga0395900_0015827 | |||
| 1247 | Ga0395900_0076742 | |||
| 1248 | Ga0395900_0129346 | |||
| 1249 | Ga0395900_0213946 | |||
| 1250 | Ga0395900_0231489 | |||
| 1251 | Ga0395900_0314181 | |||
| 1252 | Ga0395900_0436852 | |||
| 1253 | Ga0395900_1099330 | |||
| 1254 | Ga0395900_1113240 | |||
| 1255 | Ga0395898_0001676 | |||
| 1256 | Ga0395898_0012323 | |||
| 1257 | Ga0395898_0073500 | |||
| 1258 | Ga0395898_0085549 | |||
| 1259 | Ga0395898_0108142 | |||
| 1260 | Ga0395898_0189810 | |||
| 1261 | Ga0395898_0227179 | |||
| 1262 | Ga0395898_0331263 | |||
| 1263 | Ga0395898_0379374 | |||
| 1264 | Ga0395898_0396698 | |||
| 1265 | Ga0395898_0589754 | |||
| 1266 | Ga0395905_0000645 | |||
| 1267 | Ga0395905_0014353 | |||
| 1268 | Ga0395905_0054210 | |||
| 1269 | Ga0395905_0059707 | |||
| 1270 | Ga0395905_0079869 | |||
| 1271 | Ga0395905_0110755 | |||
| 1272 | Ga0395905_0118504 | |||
| 1273 | Ga0395905_0465502 | |||
| 1274 | Ga0395905_0546378 | |||
| 1275 | Ga0395905_0681400 | |||
| 1276 | Ga0395905_0894160 | |||
| 1277 | Ga0395905_1097242 | |||
| 1278 | Ga0395905_1563624 | |||
| 1279 | Ga0395901_0002541 | |||
| 1280 | Ga0395901_0015504 | |||
| 1281 | Ga0395901_0034536 | |||
| 1282 | Ga0395901_0039749 | |||
| 1283 | Ga0395901_0206688 | |||
| 1284 | Ga0395901_0212046 | |||
| 1285 | Ga0395901_0213143 | |||
| 1286 | Ga0395901_0225731 | |||
| 1287 | Ga0395901_0308481 | |||
| 1288 | Ga0395901_0363321 | |||
| 1289 | Ga0395901_0624959 | |||
| 1290 | Ga0395901_0754568 | |||
| 1291 | Ga0395901_0939055 | |||
| 1292 | Ga0395901_1696609 | |||
| 1293 | Ga0436360_0169204 | |||
| 1294 | Ga0436360_1041188 | |||
| 1295 | Ga0451800_0859415 | |||
| 1296 | Ga0451804_0921018 | |||
| 1297 | Ga0451835_1135819 | |||
| 1298 | Ga0451853_0721965 | |||
| 1299 | Ga0466961_0385487 | |||
| 1300 | Ga0466963_0015074 | |||
| 1301 | Ga0466963_0023249 | |||
| 1302 | Ga0466963_0113355 | |||
| 1303 | Ga0466963_0224944 | |||
| 1304 | Ga0466963_0268589 | |||
| 1305 | Ga0466964_0492994 | |||
| 1306 | Ga0466968_0411902 | |||
| 1307 | Ga0466968_0689198 | |||
| 1308 | Ga0466970_0259553 | |||
| 1309 | Ga0466957_0018097 | |||
| 1310 | Ga0466957_0086957 | |||
| 1311 | Ga0466957_0353557 | |||
| 1312 | Ga0466959_0514290 | |||
| 1313 | Ga0466958_0001705 | |||
| 1314 | Ga0466958_0169699 | |||
| 1315 | Ga0466958_0217375 | |||
| 1316 | Ga0466958_1144045 | |||
| 1317 | Ga0466967_0011667 | |||
| 1318 | Ga0466967_0021475 | |||
| 1319 | Ga0466967_0040977 | |||
| 1320 | Ga0466967_0102507 | |||
| 1321 | Ga0466967_0135755 | |||
| 1322 | Ga0466967_0498449 | |||
| 1323 | Ga0466967_0588628 | |||
| 1324 | Ga0466967_0589400 | |||
| 1325 | Ga0466967_0669390 | |||
| 1326 | Ga0466967_1380446 | |||
| 1327 | Ga0466967_2546532 | |||
| 1328 | Ga0495592_0003067 | |||
| 1329 | Ga0495592_0117853 | |||
| 1330 | Ga0495592_0595818 | |||
| 1331 | Ga0495603_0026640 | |||
| 1332 | Ga0495603_0035444 | |||
| 1333 | Ga0495629_0030326 | |||
| 1334 | Ga0495629_0080434 | |||
| 1335 | Ga0495629_0286685 | |||
| 1336 | Ga0495629_0310439 | |||
| 1337 | Ga0495641_0216685 | |||
| 1338 | Ga0495641_0240906 | |||
| 1339 | Ga0495641_0297689 | |||
| 1340 | Ga0495651_0057019 | |||
| 1341 | Ga0495651_0509298 | |||
| 1342 | Ga0495653_0044743 | |||
| 1343 | Ga0495653_0092550 | |||
| 1344 | Ga0495653_0244193 | |||
| 1345 | Ga0495653_0720456 | |||
| 1346 | Ga0495580_0531362 | |||
| 1347 | Ga0495582_0002417 | |||
| 1348 | Ga0495582_0073639 | |||
| 1349 | Ga0495639_0019332 | |||
| 1350 | Ga0495662_0293830 | |||
| 1351 | Ga0495664_0111262 | |||
| 1352 | Ga0495584_0039143 | |||
| 1353 | Ga0495584_0116914 | |||
| 1354 | Ga0495584_0579712 | |||
| 1355 | Ga0495594_0276168 | |||
| 1356 | Ga0495594_0298017 | |||
| 1357 | Ga0495608_0065843 | |||
| 1358 | Ga0495608_0547983 | |||
| 1359 | Ga0495618_0138147 | |||
| 1360 | Ga0495618_0371982 | |||
| 1361 | Ga0495628_0035383 | |||
| 1362 | Ga0495628_0111221 | |||
| 1363 | Ga0495630_0026483 | |||
| 1364 | Ga0495630_0829925 | |||
| 1365 | Ga0495631_0045482 | |||
| 1366 | Ga0495631_0245322 | |||
| 1367 | Ga0495637_0154557 | |||
| 1368 | Ga0495644_0200164 | |||
| 1369 | Ga0495663_0007640 | |||
| 1370 | Ga0495666_0573451 | |||
| 1371 | Ga0495652_0028133 | |||
| 1372 | Ga0495652_0063334 | |||
| 1373 | Ga0495652_0088340 | |||
| 1374 | Ga0495652_0159377 | |||
| 1375 | Ga0495652_0287294 | |||
| 1376 | Ga0495665_0091785 | |||
| 1377 | Ga0495640_0144595 | |||
| 1378 | Ga0495586_0093732 | |||
| 1379 | Ga0495587_0077386 | |||
| 1380 | Ga0495587_0234195 | |||
| 1381 | Ga0495587_0297646 | |||
| 1382 | Ga0495609_0120534 | |||
| 1383 | Ga0495609_0160907 | |||
| 1384 | Ga0495645_0079763 | |||
| 1385 | Ga0495645_0152855 | |||
| 1386 | Ga0495645_0698214 | |||
| 1387 | Ga0495667_0128319 | |||
| 1388 | Ga0495667_0192443 | |||
| 1389 | Ga0495656_0777045 | |||
| 1390 | Ga0495634_0180624 | |||
| 1391 | Ga0495634_0551217 | |||
| 1392 | Ga0495634_0745773 | |||
| 1393 | Ga0495635_0074497 | |||
| 1394 | Ga0495635_0369840 | |||
| 1395 | Ga0495659_0039876 | |||
| 1396 | Ga0495659_0400421 | |||
| 1397 | Ga0495588_0157071 | |||
| 1398 | Ga0495588_0210483 | |||
| 1399 | Ga0495657_0079999 | |||
| 1400 | Ga0495599_0011709 | |||
| 1401 | Ga0495599_0069334 | |||
| 1402 | Ga0495623_0020975 | |||
| 1403 | Ga0495623_0129812 | |||
| 1404 | Ga0495623_0298735 | |||
| 1405 | Ga0495646_0059867 | |||
| 1406 | Ga0495646_0067013 | |||
| 1407 | Ga0495647_0034967 | |||
| 1408 | Ga0495647_0051096 | |||
| 1409 | Ga0495658_0009277 | |||
| 1410 | Ga0495658_0078990 | |||
| 1411 | Ga0495669_0504097 | |||
| 1412 | Ga0495613_0017517 | |||
| 1413 | Ga0495613_0059054 | |||
| 1414 | Ga0495613_0085425 | |||
| 1415 | Ga0495613_0942489 | |||
| 1416 | Ga0495624_0966978 | |||
| 1417 | Ga0495670_0664938 | |||
| 1418 | Ga0495589_0251198 | |||
| 1419 | Ga0495600_0227803 | |||
| 1420 | Ga0495600_0255065 | |||
| 1421 | Ga0495600_0370497 | |||
| 1422 | Ga0495600_0441099 | |||
| 1423 | Ga0495581_0105887 | |||
| 1424 | Ga0495581_0456626 | |||
| 1425 | Ga0495604_0019807 | |||
| 1426 | Ga0495604_0156189 | |||
| 1427 | Ga0495604_0501238 | |||
| 1428 | Ga0495674_0026158 | |||
| 1429 | Ga0495674_0325428 | |||
| 1430 | Ga0495674_0468621 | |||
| 1431 | Ga0495676_0525401 | |||
| 1432 | Ga0495676_0725411 | |||
| 1433 | Ga0495680_0037683 | |||
| 1434 | Ga0495680_0102933 | |||
| 1435 | Ga0495680_0809632 | |||
| 1436 | Ga0495683_0460501 | |||
| 1437 | Ga0495675_0251350 | |||
| 1438 | Ga0495675_0270261 | |||
| 1439 | Ga0495677_0103701 | |||
| 1440 | Ga0495684_0070376 | |||
| 1441 | Ga0495684_0262920 | |||
| 1442 | Ga0495684_0518728 | |||
| 1443 | Ga0495602_0034514 | |||
| 1444 | Ga0495602_0120997 | |||
| 1445 | Ga0495602_0202207 | |||
| 1446 | Ga0495602_0449905 | |||
| 1447 | Ga0495602_0515027 | |||
| 1448 | Ga0495614_0093309 | |||
| 1449 | Ga0495614_0555628 | |||
| 1450 | Ga0496100_0086860 | |||
| 1451 | Ga0496100_0154649 | |||
| 1452 | Ga0496100_0405175 | |||
| 1453 | Ga0496100_0621617 | |||
| 1454 | Ga0496100_0925300 | |||
| 1455 | Ga0496101_0050877 | |||
| 1456 | Ga0496101_0106921 | |||
| 1457 | Ga0496101_0875332 | |||
| 1458 | Ga0496101_0959269 | |||
| 1459 | Ga0496101_1357109 | |||
| 1460 | Ga0496102_0407614 | |||
| 1461 | Ga0496102_0493244 | |||
| 1462 | Ga0496102_0672011 | |||
| 1463 | Ga0496102_1275017 | |||
| 1464 | Ga0496103_0084138 | |||
| 1465 | Ga0496104_0003847 | |||
| 1466 | Ga0496104_0008113 | |||
| 1467 | Ga0496104_0020197 | |||
| 1468 | Ga0496104_0235600 | |||
| 1469 | Ga0496105_0002860 | |||
| 1470 | Ga0496105_0004890 | |||
| 1471 | Ga0496105_0060838 | |||
| 1472 | Ga0496105_0322146 | |||
| 1473 | Ga0496106_0192389 | |||
| 1474 | Ga0496106_0423104 | |||
| 1475 | Ga0496106_0869940 | |||
| 1476 | Ga0496107_0080423 | |||
| 1477 | Ga0496107_0546288 | |||
| 1478 | Ga0496107_1185809 | |||
| 1479 | Ga0496108_0002097 | |||
| 1480 | Ga0496108_0025760 | |||
| 1481 | Ga0496108_0174513 | |||
| 1482 | Ga0496108_0185095 | |||
| 1483 | Ga0496108_0223980 | |||
| 1484 | Ga0496109_0001717 | |||
| 1485 | Ga0496109_0002279 | |||
| 1486 | Ga0496109_0016974 | |||
| 1487 | Ga0496109_0217454 | |||
| 1488 | Ga0496109_0276115 | |||
| 1489 | Ga0496109_0341408 | |||
| 1490 | Ga0496109_0705204 | |||
| 1491 | Ga0496110_0131435 | |||
| 1492 | Ga0496110_0732105 | |||
| 1493 | Ga0496111_0016275 | |||
| 1494 | Ga0496111_0120668 | |||
| 1495 | Ga0496111_0184952 | |||
| 1496 | Ga0496111_0363359 | |||
| 1497 | Ga0496111_0495052 | |||
| 1498 | Ga0496112_0059292 | |||
| 1499 | Ga0496112_0147583 | |||
| 1500 | Ga0496112_0247228 | |||
| 1501 | Ga0496112_0288451 | |||
| 1502 | Ga0496112_0497766 | |||
| 1503 | Ga0496113_0049821 | |||
| 1504 | Ga0496113_0128035 | |||
| 1505 | Ga0496113_0201297 | |||
| 1506 | Ga0496113_1321642 | |||
| 1507 | Ga0496113_1407010 | |||
| 1508 | Ga0496114_0008003 | |||
| 1509 | Ga0496114_0085165 | |||
| 1510 | Ga0496114_0212560 | |||
| 1511 | Ga0496114_0236486 | |||
| 1512 | Ga0496115_0052315 | |||
| 1513 | Ga0496115_0057605 | |||
| 1514 | Ga0496115_0367907 | |||
| 1515 | Ga0496115_0515569 | |||
| 1516 | Ga0501067_0005982 | |||
| 1517 | Ga0501067_0047221 | |||
| 1518 | Ga0501069_0035739 | |||
| 1519 | Ga0501069_0048362 | |||
| 1520 | Ga0501069_0110880 | |||
| 1521 | nmdc:mga00v17_830124_c1 | |||
| 1522 | nmdc:mga0yw44_52642_c1 | |||
| 1523 | nmdc:mga06z11_187406_c1 | |||
| 1524 | nmdc:mga05p37_1235753_c1 | |||
| 1525 | nmdc:mga05p37_1715523_c1 | |||
| 1526 | nmdc:mga05p37_745573_c1 | |||
| 1527 | nmdc:mga06r32_368799_c1 | |||
| 1528 | nmdc:mga0n895_161095_c1 | |||
| 1529 | nmdc:mga0n895_818594_c1 | |||
| 1530 | nmdc:mga08x19_162694_c1 | |||
| 1531 | nmdc:mga08x19_821699_c1 | |||
| 1532 | Ga0495601_0023236 | |||
| 1533 | Ga0495601_0282877 | |||
| 1534 | Ga0495601_0313016 | |||
| 1535 | Ga0495601_0417175 | |||
| 1536 | Ga0495601_0533377 | |||
| 1537 | Ga0495612_0024559 | |||
| 1538 | Ga0495612_0373078 | |||
| 1539 | Ga0495655_0096186 | |||
| 1540 | Ga0495595_0148733 | |||
| 1541 | Ga0495619_0057013 | |||
| 1542 | Ga0495619_0091342 | |||
| 1543 | Ga0495619_0769606 | |||
| 1544 | Ga0495619_0917033 | |||
| 1545 | Ga0587073_0117180 | |||
| 1546 | Ga0587094_064838 | |||
| 1547 | Ga0587128_031899 | |||
| 1548 | Ga0587069_089673 | |||
| 1549 | Ga0587075_027207 | |||
| 1550 | Ga0466962_0042647 | |||
| 1551 | Ga0466962_0179260 | |||
| 1552 | Ga0530510_0756761 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1lt1-assembly1.cif.gz_A | sliding helix induced change of coordination geometry in a model di-mn(ii) protein | 0.9838 | 5 | 48 |
| 1lt1-assembly1.cif.gz_B | sliding helix induced change of coordination geometry in a model di-mn(ii) protein | 0.9777 | 5 | 48 |
| 1jmb-assembly2.cif.gz_C | crystal structure of four-helix bundle model | 0.9723 | 5 | 48 |
| 5ee1-assembly1.cif.gz_A | crystal structure of osychf1 at ph 7.85 | 0.9703 | 6 | 48 |
| 1jm0-assembly1.cif.gz_B | crystal structure of four-helix bundle model | 0.9678 | 5 | 48 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1lt1A00 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C | 0.9838 | 5 | 48 | 1.20.5.420 |
| 1ovrA00 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C | 0.982 | 5 | 48 | 1.20.5.420 |
| af_K7K3W2_1_119_1.10.287.370 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.98 | 6 | 57 | 1.10.287.370 |
| 1lt1B00 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C | 0.9777 | 5 | 48 | 1.20.5.420 |
| 1ovvC00 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C | 0.9746 | 5 | 48 | 1.20.5.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W9H1J8-F1-model_v4 | KfrA N-terminal DNA-binding domain-containing protein | 0.995 | 3 | 56 |
|
| AF-A0A1V5L6L3-F1-model_v4 | Putative ABC transporter ATP-binding protein YheS | 0.994 | 2 | 54 |
GO:0005524
GO:0016887 |
| AF-A0A4P5Y8X8-F1-model_v4 | ABC transporter ATP-binding protein | 0.992 | 3 | 55 |
GO:0005524
GO:0016887 |
| AF-A0A6P9EGH6-F1-model_v4 | Uncharacterized protein LOC118348628 | 0.9906 | 6 | 57 |
|
| AF-A0A6P9E0Z5-F1-model_v4 | Uncharacterized protein LOC118344702 | 0.9904 | 6 | 57 |
|