F480306

General Info

Members Datasets Scaffolds Average Seq Length
776 360 1552 235

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10211036|Ga0105241_102110361
Length 278
Sequence LPFWRGVEPVVPVERRTGCWTWDEGQEGQVSVRVDVSTIFPAYLDALRQSLPGKAIDAGLVDLGVHDLRRWTHDVHRSVDDAPYGGGPGMVMRAPVWGEALDEICSEQTLLVVPTPAGRLFDQPTAARWTGEEHLVFACGRYEGIDQRVVDDAAARMPVEEVSIGDYVLVGGEAAVLVIVEAVARLLPGVLGNPDSAEQDSFSDGLLEGPAYTRPEVWRDRPVPAVLRSGNHAAIARWRRDRALERTAARRPELLAALPDGALDAADRAVLANRHDEG

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
172 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
173 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
174 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
175 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
176 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
203 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
204 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
205 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
206 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
207 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
210 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
219 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
279 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
299 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
300 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
301 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
302 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
303 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
304 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
305 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
306 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
307 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
308 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
311 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
312 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
314 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
315 2547132424 Nocardia nova SH22a Isolate Unclassified
316 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
317 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
318 2558860280 Kutzneria sp. 744 Isolate Unclassified
319 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
320 2582580736 Prauserella sp. Am3 Isolate Unclassified
321 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
322 2643221692 Nocardia sp. Root136 Isolate Unclassified
323 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
324 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
325 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
326 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
327 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
328 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
329 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
330 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
331 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
332 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
333 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
334 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
335 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
336 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
337 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
338 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
339 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
340 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
341 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
342 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
343 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
344 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
345 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
346 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
347 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
348 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
349 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
350 2922554459 Rhodococcus sp. 66b Isolate Unclassified
351 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
352 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
353 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
354 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
355 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
356 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
357 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
358 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
359 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
360 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.81
Metatranscriptomes 0.13
Isolates 6.06

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 10.44
Nodule 0
Rhizoplane 9.15
Rhizosphere 70.1
Stem 0
Stem Tuber 0.13
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10211036 3300009174 Bacteria 1627
2 CNXas_1000536 3300000545 Bacteria 2548
3 JGI24746J21847_1004021 3300001977 Bacteria 2324
4 JGI24735J21928_10023223 3300002067 Bacteria 1882
5 JGI24750J21931_1016477 3300002070 Bacteria 1003
6 JGI24745J21846_1001114 3300002073 Bacteria 2545
7 JGI24745J21846_1004008 3300002073 Bacteria 1562
8 JGI24744J21845_10006632 3300002077 Bacteria 2399
9 JGI24034J26672_10005404 3300002239 Bacteria 1831
10 JGI24742J22300_10003132 3300002244 Bacteria 2675
11 JGI24751J29686_10005463 3300002459 Bacteria 2587
12 JGI25406J46586_10000557 3300003203 Bacteria 17606
13 Ga0055540_1002431 3300003792 Bacteria 9835
14 Ga0055540_1005569 3300003792 Bacteria 5253
15 Ga0055540_1009773 3300003792 Bacteria 3270
16 Ga0070658_10308331 3300005327 Bacteria 1350
17 Ga0070676_10041597 3300005328 Bacteria 2665
18 Ga0070676_10080723 3300005328 Bacteria 1972
19 Ga0070683_100123341 3300005329 Bacteria 2448
20 Ga0070683_100147531 3300005329 Bacteria 2230
21 Ga0070690_100004656 3300005330 Bacteria 7640
22 Ga0068869_100035072 3300005334 Bacteria 3554
23 Ga0068869_100077846 3300005334 Bacteria 2468
24 Ga0070666_10173181 3300005335 Bacteria 1512
25 Ga0070682_100033809 3300005337 Bacteria 3109
26 Ga0070682_100319447 3300005337 Bacteria 1146
27 Ga0068868_100033397 3300005338 Bacteria 3965
28 Ga0068868_100065385 3300005338 Bacteria 2889
29 Ga0068868_100208636 3300005338 Bacteria 1632
30 Ga0070689_100028370 3300005340 Bacteria 4230
31 Ga0070689_100062364 3300005340 Bacteria 2901
32 Ga0070689_100122073 3300005340 Bacteria 2082
33 Ga0070661_100584590 3300005344 Bacteria 901
34 Ga0070668_100000449 3300005347 Bacteria 27220
35 Ga0070668_100059966 3300005347 Bacteria 2946
36 Ga0070668_100107435 3300005347 Bacteria 2218
37 Ga0070668_100440497 3300005347 Bacteria 1118
38 Ga0070669_100028340 3300005353 Bacteria 4033
39 Ga0070669_100312037 3300005353 Bacteria 1268
40 Ga0070669_100607627 3300005353 Bacteria 917
41 Ga0070675_100207422 3300005354 Bacteria 1702
42 Ga0070671_100002308 3300005355 Bacteria 14722
43 Ga0070671_100005597 3300005355 Bacteria 10004
44 Ga0070671_100096819 3300005355 Bacteria 2475
45 Ga0070674_100041361 3300005356 Bacteria 3123
46 Ga0070674_100075059 3300005356 Bacteria 2400
47 Ga0070688_100073075 3300005365 Bacteria 2199
48 Ga0070688_100179536 3300005365 Bacteria 1467
49 Ga0070659_100036934 3300005366 Bacteria 3808
50 Ga0070659_100495173 3300005366 Bacteria 1041
51 Ga0070667_100016599 3300005367 Bacteria 6093
52 Ga0070667_100019725 3300005367 Bacteria 5593
53 Ga0070667_100036663 3300005367 Bacteria 4112
54 Ga0070667_100180096 3300005367 Bacteria 1869
55 Ga0070709_10014526 3300005434 Bacteria 4454
56 Ga0070714_100009393 3300005435 Bacteria 7687
57 Ga0070714_100195712 3300005435 Bacteria 1847
58 Ga0070713_100033202 3300005436 Bacteria 4131
59 Ga0070713_100064828 3300005436 Bacteria 3067
60 Ga0070710_10000364 3300005437 Bacteria 21235
61 Ga0070710_10000468 3300005437 Bacteria 18998
62 Ga0070710_10010481 3300005437 Bacteria 4554
63 Ga0070711_100002851 3300005439 Bacteria 9944
64 Ga0070711_100006539 3300005439 Bacteria 7029
65 Ga0070705_100103279 3300005440 Bacteria 1804
66 Ga0070705_100217623 3300005440 Bacteria 1320
67 Ga0070700_100002039 3300005441 Bacteria 10272
68 Ga0070700_100282794 3300005441 Bacteria 1203
69 Ga0070694_100063135 3300005444 Bacteria 2532
70 Ga0070663_100002335 3300005455 Bacteria 10658
71 Ga0070663_100005380 3300005455 Bacteria 7604
72 Ga0070663_100020149 3300005455 Bacteria 4412
73 Ga0070663_100080988 3300005455 Bacteria 2386
74 Ga0070663_100392682 3300005455 Bacteria 1132
75 Ga0070663_100595055 3300005455 Bacteria 929
76 Ga0070678_100042939 3300005456 Bacteria 3217
77 Ga0070678_100063119 3300005456 Bacteria 2739
78 Ga0070678_100114047 3300005456 Bacteria 2119
79 Ga0070662_100151909 3300005457 Bacteria 1804
80 Ga0068867_100003379 3300005459 Bacteria 11233
81 Ga0068867_100066793 3300005459 Bacteria 2679
82 Ga0068867_100242322 3300005459 Bacteria 1463
83 Ga0070685_10057572 3300005466 Bacteria 2263
84 Ga0070684_100307871 3300005535 Bacteria 1454
85 Ga0068853_100035399 3300005539 Bacteria 4241
86 Ga0068853_100060121 3300005539 Bacteria 3282
87 Ga0068853_100139386 3300005539 Bacteria 2176
88 Ga0070672_100087530 3300005543 Bacteria 2507
89 Ga0070672_100112923 3300005543 Bacteria 2217
90 Ga0070686_100076990 3300005544 Bacteria 2198
91 Ga0070695_100182829 3300005545 Bacteria 1487
92 Ga0070696_100003196 3300005546 Bacteria 10910
93 Ga0070696_100015832 3300005546 Bacteria 5070
94 Ga0070693_100031943 3300005547 Bacteria 2891
95 Ga0070693_100054076 3300005547 Bacteria 2307
96 Ga0070693_100226567 3300005547 Bacteria 1228
97 Ga0070665_100001944 3300005548 Bacteria 23298
98 Ga0070665_100010428 3300005548 Bacteria 9403
99 Ga0070665_100062380 3300005548 Bacteria 3737
100 Ga0070665_100120159 3300005548 Bacteria 2629
101 Ga0070704_100006793 3300005549 Bacteria 6776
102 Ga0070704_100087587 3300005549 Bacteria 2311
103 Ga0068855_100112475 3300005563 Bacteria 3125
104 Ga0068855_100119110 3300005563 Bacteria 3023
105 Ga0070664_100215535 3300005564 Bacteria 1716
106 Ga0070664_100375057 3300005564 Bacteria 1298
107 Ga0070664_100598656 3300005564 Bacteria 1022
108 Ga0068857_100698424 3300005577 Bacteria 964
109 Ga0068854_100074267 3300005578 Bacteria 2494
110 Ga0068854_100091265 3300005578 Bacteria 2266
111 Ga0068854_100117114 3300005578 Bacteria 2017
112 Ga0068854_100277929 3300005578 Bacteria 1347
113 Ga0068854_100383703 3300005578 Bacteria 1158
114 Ga0068854_100598498 3300005578 Bacteria 941
115 Ga0068856_100518728 3300005614 Bacteria 1213
116 Ga0068856_100661005 3300005614 Bacteria 1066
117 Ga0070702_100034338 3300005615 Bacteria 2795
118 Ga0070702_100057911 3300005615 Bacteria 2242
119 Ga0068852_100058603 3300005616 Bacteria 3337
120 Ga0068852_100095343 3300005616 Bacteria 2672
121 Ga0068859_100042229 3300005617 Bacteria 4580
122 Ga0068859_100166645 3300005617 Bacteria 2283
123 Ga0068859_100268433 3300005617 Bacteria 1798
124 Ga0068859_100322249 3300005617 Bacteria 1639
125 Ga0068859_100463888 3300005617 Bacteria 1362
126 Ga0068864_100366505 3300005618 Bacteria 1362
127 Ga0068866_10000223 3300005718 Bacteria 26905
128 Ga0068866_10009759 3300005718 Bacteria 4088
129 Ga0068861_100000566 3300005719 Bacteria 21970
130 Ga0068870_10068146 3300005840 Bacteria 1932
131 Ga0068870_10297777 3300005840 Bacteria 1017
132 Ga0068863_100014660 3300005841 Bacteria 7545
133 Ga0068863_100048888 3300005841 Bacteria 4010
134 Ga0068858_100000340 3300005842 Bacteria 49532
135 Ga0068858_100044837 3300005842 Bacteria 4098
136 Ga0068858_100281567 3300005842 Bacteria 1583
137 Ga0068860_100014701 3300005843 Bacteria 7656
138 Ga0068862_100035998 3300005844 Bacteria 4193
139 Ga0068862_100170978 3300005844 Bacteria 1945
140 Ga0068862_100323844 3300005844 Bacteria 1423
141 Ga0081455_10000011 3300005937 Bacteria 203132
142 Ga0081455_10015862 3300005937 Bacteria 7295
143 Ga0081455_10074855 3300005937 Bacteria 2795
144 Ga0081539_10000680 3300005985 Bacteria 68157
145 Ga0070717_10131172 3300006028 Bacteria 2155
146 Ga0070717_10245861 3300006028 Bacteria 1579
147 Ga0075365_10044901 3300006038 Bacteria 2897
148 Ga0075365_10464728 3300006038 Bacteria 894
149 Ga0075363_100003786 3300006048 Bacteria 6520
150 Ga0075363_100023765 3300006048 Bacteria 3111
151 Ga0075363_100029456 3300006048 Bacteria 2834
152 Ga0075363_100032237 3300006048 Bacteria 2720
153 Ga0075363_100048365 3300006048 Bacteria 2261
154 Ga0075363_100076645 3300006048 Bacteria 1823
155 Ga0075364_10000301 3300006051 Bacteria 24078
156 Ga0075364_10023127 3300006051 Bacteria 3932
157 Ga0075364_10025162 3300006051 Bacteria 3787
158 Ga0075364_10034918 3300006051 Bacteria 3247
159 Ga0075364_10055801 3300006051 Bacteria 2585
160 Ga0075364_10094611 3300006051 Bacteria 1985
161 Ga0070715_10037612 3300006163 Bacteria 2004
162 Ga0070715_10058405 3300006163 Bacteria 1684
163 Ga0070716_100061059 3300006173 Bacteria 2180
164 Ga0070716_100064518 3300006173 Bacteria 2130
165 Ga0070712_100023175 3300006175 Bacteria 4097
166 Ga0070712_100305496 3300006175 Bacteria 1289
167 Ga0075362_10073010 3300006177 Bacteria 1570
168 Ga0075369_10001858 3300006186 Bacteria 7371
169 Ga0075369_10003549 3300006186 Bacteria 5681
170 Ga0075369_10017703 3300006186 Bacteria 2893
171 Ga0075369_10018933 3300006186 Bacteria 2808
172 Ga0075369_10032296 3300006186 Bacteria 2214
173 Ga0075369_10088538 3300006186 Bacteria 1379
174 Ga0075369_10093603 3300006186 Bacteria 1343
175 Ga0075369_10108956 3300006186 Bacteria 1247
176 Ga0075369_10154566 3300006186 Bacteria 1050
177 Ga0075369_10182403 3300006186 Bacteria 966
178 Ga0097621_100098979 3300006237 Bacteria 2450
179 Ga0097621_100284549 3300006237 Bacteria 1456
180 Ga0097621_100365570 3300006237 Bacteria 1286
181 Ga0075370_10001488 3300006353 Bacteria 10203
182 Ga0075370_10099283 3300006353 Bacteria 1684
183 Ga0075370_10107238 3300006353 Bacteria 1620
184 Ga0075370_10163736 3300006353 Bacteria 1306
185 Ga0075370_10249562 3300006353 Bacteria 1052
186 Ga0068871_100305608 3300006358 Bacteria 1397
187 Ga0075428_100001695 3300006844 Bacteria 23510
188 Ga0075430_100029765 3300006846 Bacteria 4635
189 Ga0075430_100286610 3300006846 Bacteria 1362
190 Ga0075430_100490123 3300006846 Bacteria 1014
191 Ga0075431_100056933 3300006847 Bacteria 4032
192 Ga0075429_100289645 3300006880 Bacteria 1434
193 Ga0097620_100042230 3300006931 Bacteria 4580
194 Ga0097620_100166642 3300006931 Bacteria 2283
195 Ga0097620_100268422 3300006931 Bacteria 1798
196 Ga0097620_100322256 3300006931 Bacteria 1639
197 Ga0097620_100463885 3300006931 Bacteria 1362
198 Ga0105250_10008866 3300009092 Bacteria 4257
199 Ga0105240_10342809 3300009093 Bacteria 1697
200 Ga0111539_10058897 3300009094 Bacteria 4556
201 Ga0111539_10327525 3300009094 Bacteria 1783
202 Ga0111539_10503063 3300009094 Bacteria 1411
203 Ga0105245_10017295 3300009098 Bacteria 6291
204 Ga0105245_10160233 3300009098 Bacteria 2135
205 Ga0105245_10212999 3300009098 Bacteria 1861
206 Ga0105247_10034066 3300009101 Bacteria 3102
207 Ga0105247_10142010 3300009101 Bacteria 1574
208 Ga0105243_10000749 3300009148 Bacteria 31120
209 Ga0105243_10008122 3300009148 Bacteria 8057
210 Ga0105243_10093391 3300009148 Bacteria 2483
211 Ga0105241_10065259 3300009174 Bacteria 2813
212 Ga0105241_10227533 3300009174 Bacteria 1571
213 Ga0105242_10082815 3300009176 Bacteria 2686
214 Ga0105242_10159894 3300009176 Bacteria 1971
215 Ga0105242_10250278 3300009176 Bacteria 1596
216 Ga0105242_10429682 3300009176 Bacteria 1240
217 Ga0105248_10001981 3300009177 Bacteria 22755
218 Ga0105248_10073208 3300009177 Bacteria 3850
219 Ga0105248_10207833 3300009177 Bacteria 2206
220 Ga0105237_10001244 3300009545 Bacteria 33989
221 Ga0105237_10084464 3300009545 Bacteria 3165
222 Ga0105237_10106964 3300009545 Bacteria 2789
223 Ga0105237_10190690 3300009545 Bacteria 2050
224 Ga0105237_10844646 3300009545 Bacteria 922
225 Ga0105238_10166291 3300009551 Bacteria 2181
226 Ga0105238_10190217 3300009551 Bacteria 2029
227 Ga0105238_10373725 3300009551 Bacteria 1416
228 Ga0105249_10007116 3300009553 Bacteria 9767
229 Ga0105249_10087761 3300009553 Bacteria 2903
230 Ga0105249_11022543 3300009553 Bacteria 895
231 Ga0105239_10027785 3300010375 Bacteria 6225
232 Ga0105239_10181177 3300010375 Bacteria 2357
233 Ga0105239_10749887 3300010375 Bacteria 1117
234 Ga0105239_11156193 3300010375 Bacteria 891
235 Ga0105246_10048993 3300011119 Bacteria 2891
236 Ga0105246_10234856 3300011119 Bacteria 1446
237 Ga0105246_10728266 3300011119 Bacteria 872
238 Ga0157369_10143259 3300013105 Bacteria 2528
239 Ga0157369_10331122 3300013105 Bacteria 1582
240 Ga0157374_10095524 3300013296 Bacteria 2842
241 Ga0157378_10013565 3300013297 Bacteria 7129
242 Ga0157378_10162000 3300013297 Bacteria 2092
243 Ga0163162_10017533 3300013306 Bacteria 7006
244 Ga0163162_10144715 3300013306 Bacteria 2492
245 Ga0163162_10146816 3300013306 Bacteria 2475
246 Ga0163162_10998409 3300013306 Bacteria 946
247 Ga0157372_10004262 3300013307 Bacteria 15291
248 Ga0157372_10068538 3300013307 Bacteria 3989
249 Ga0157372_10720054 3300013307 Bacteria 1161
250 Ga0157375_10012997 3300013308 Bacteria 7396
251 Ga0157375_10195655 3300013308 Bacteria 2177
252 Ga0157375_10315824 3300013308 Bacteria 1727
253 Ga0157375_11284474 3300013308 Bacteria 860
254 Ga0163163_10028842 3300014325 Bacteria 5334
255 Ga0163163_10485283 3300014325 Bacteria 1297
256 Ga0157380_10028021 3300014326 Bacteria 4291
257 Ga0157380_10651699 3300014326 Bacteria 1050
258 Ga0157377_10019339 3300014745 Bacteria 3557
259 Ga0157379_10025793 3300014968 Bacteria 5225
260 Ga0157379_10041285 3300014968 Bacteria 4119
261 Ga0157379_10194244 3300014968 Bacteria 1834
262 Ga0157376_10296353 3300014969 Bacteria 1529
263 Ga0163161_10002626 3300017792 Bacteria 12794
264 Ga0163161_10119025 3300017792 Bacteria 1983
265 Ga0213873_10000144 3300021358 Bacteria 13528
266 Ga0213876_10088490 3300021384 Bacteria 1640
267 Ga0213875_10002351 3300021388 Bacteria 11419
268 Ga0213875_10005039 3300021388 Bacteria 7156
269 Ga0213875_10010251 3300021388 Bacteria 4701
270 Ga0209051_1002711 3300025303 Bacteria 12317
271 Ga0209051_1003201 3300025303 Bacteria 10927
272 Ga0209051_1008910 3300025303 Bacteria 5242
273 Ga0207692_10028384 3300025898 Bacteria 2646
274 Ga0207692_10054993 3300025898 Bacteria 2035
275 Ga0207642_10005556 3300025899 Bacteria 4123
276 Ga0207642_10224600 3300025899 Bacteria 1051
277 Ga0207710_10182685 3300025900 Bacteria 1030
278 Ga0207688_10004235 3300025901 Bacteria 7820
279 Ga0207688_10027373 3300025901 Bacteria 3136
280 Ga0207688_10037263 3300025901 Bacteria 2696
281 Ga0207688_10119972 3300025901 Bacteria 1534
282 Ga0207680_10151079 3300025903 Bacteria 1548
283 Ga0207647_10081601 3300025904 Bacteria 1938
284 Ga0207685_10003898 3300025905 Bacteria 3702
285 Ga0207645_10044272 3300025907 Bacteria 2849
286 Ga0207643_10018147 3300025908 Bacteria 3854
287 Ga0207643_10023514 3300025908 Bacteria 3397
288 Ga0207654_10078235 3300025911 Bacteria 1984
289 Ga0207671_10020624 3300025914 Bacteria 5013
290 Ga0207671_10050415 3300025914 Bacteria 3082
291 Ga0207693_10000292 3300025915 Bacteria 46487
292 Ga0207693_10007534 3300025915 Bacteria 8942
293 Ga0207693_10203637 3300025915 Bacteria 1556
294 Ga0207663_10027939 3300025916 Bacteria 3295
295 Ga0207663_10089161 3300025916 Bacteria 2042
296 Ga0207662_10101704 3300025918 Bacteria 1781
297 Ga0207657_10031065 3300025919 Bacteria 4842
298 Ga0207649_10270877 3300025920 Bacteria 1231
299 Ga0207681_10099859 3300025923 Bacteria 2091
300 Ga0207694_10117129 3300025924 Bacteria 2124
301 Ga0207694_10156351 3300025924 Bacteria 1839
302 Ga0207694_10243532 3300025924 Bacteria 1470
303 Ga0207694_10450338 3300025924 Bacteria 1074
304 Ga0207687_10026753 3300025927 Bacteria 3865
305 Ga0207687_10114586 3300025927 Bacteria 2007
306 Ga0207687_10215503 3300025927 Bacteria 1508
307 Ga0207687_10298606 3300025927 Bacteria 1297
308 Ga0207700_10146347 3300025928 Bacteria 1947
309 Ga0207664_10008573 3300025929 Bacteria 7142
310 Ga0207664_10293728 3300025929 Bacteria 1429
311 Ga0207644_10003294 3300025931 Bacteria 10437
312 Ga0207706_10018893 3300025933 Bacteria 6199
313 Ga0207706_10103808 3300025933 Bacteria 2501
314 Ga0207706_10533736 3300025933 Bacteria 1011
315 Ga0207686_10015437 3300025934 Bacteria 4270
316 Ga0207709_10003971 3300025935 Bacteria 8628
317 Ga0207709_10061384 3300025935 Bacteria 2349
318 Ga0207670_10083226 3300025936 Bacteria 2244
319 Ga0207670_10172894 3300025936 Bacteria 1621
320 Ga0207670_10181647 3300025936 Bacteria 1585
321 Ga0207669_10048549 3300025937 Bacteria 2522
322 Ga0207669_10223818 3300025937 Bacteria 1383
323 Ga0207704_10046986 3300025938 Bacteria 2577
324 Ga0207704_10132461 3300025938 Bacteria 1729
325 Ga0207704_10209793 3300025938 Bacteria 1432
326 Ga0207704_10258197 3300025938 Bacteria 1312
327 Ga0207665_10019007 3300025939 Bacteria 4514
328 Ga0207665_10051332 3300025939 Bacteria 2775
329 Ga0207665_10100463 3300025939 Bacteria 2019
330 Ga0207691_10109842 3300025940 Bacteria 2453
331 Ga0207691_10111791 3300025940 Bacteria 2429
332 Ga0207691_10112815 3300025940 Bacteria 2416
333 Ga0207711_10043412 3300025941 Bacteria 3835
334 Ga0207711_10228878 3300025941 Bacteria 1702
335 Ga0207689_10009983 3300025942 Bacteria 8185
336 Ga0207689_10015374 3300025942 Bacteria 6478
337 Ga0207689_10060615 3300025942 Bacteria 3111
338 Ga0207689_10258938 3300025942 Bacteria 1439
339 Ga0207689_10433187 3300025942 Bacteria 1098
340 Ga0207661_10130627 3300025944 Bacteria 2151
341 Ga0207661_10314112 3300025944 Bacteria 1407
342 Ga0207661_10325267 3300025944 Bacteria 1383
343 Ga0207679_10130883 3300025945 Bacteria 2013
344 Ga0207651_10434446 3300025960 Bacteria 1123
345 Ga0207651_10513830 3300025960 Bacteria 1037
346 Ga0207712_10069390 3300025961 Bacteria 2529
347 Ga0207712_10891243 3300025961 Bacteria 786
348 Ga0207668_10000521 3300025972 Bacteria 24086
349 Ga0207668_10030372 3300025972 Bacteria 3551
350 Ga0207668_10030679 3300025972 Bacteria 3534
351 Ga0207640_10028647 3300025981 Bacteria 3407
352 Ga0207640_10121031 3300025981 Bacteria 1875
353 Ga0207640_10180786 3300025981 Bacteria 1581
354 Ga0207640_10244464 3300025981 Bacteria 1389
355 Ga0207658_10010530 3300025986 Bacteria 6283
356 Ga0207658_10119701 3300025986 Bacteria 2097
357 Ga0207658_10140555 3300025986 Bacteria 1953
358 Ga0207677_10012418 3300026023 Bacteria 4896
359 Ga0207677_10018253 3300026023 Bacteria 4206
360 Ga0207677_10093410 3300026023 Bacteria 2193
361 Ga0207639_10026057 3300026041 Bacteria 4246
362 Ga0207639_11086141 3300026041 Bacteria 750
363 Ga0207678_10000168 3300026067 Bacteria 55114
364 Ga0207678_10022948 3300026067 Bacteria 5460
365 Ga0207678_10024700 3300026067 Bacteria 5247
366 Ga0207678_10054163 3300026067 Bacteria 3455
367 Ga0207678_10064377 3300026067 Bacteria 3150
368 Ga0207678_10117554 3300026067 Bacteria 2269
369 Ga0207678_10247801 3300026067 Bacteria 1526
370 Ga0207708_10003716 3300026075 Bacteria 11270
371 Ga0207708_10005971 3300026075 Bacteria 9018
372 Ga0207708_10007355 3300026075 Bacteria 8136
373 Ga0207708_10018785 3300026075 Bacteria 5207
374 Ga0207708_10363859 3300026075 Bacteria 1189
375 Ga0207641_10001754 3300026088 Bacteria 20888
376 Ga0207641_10003490 3300026088 Bacteria 13924
377 Ga0207648_10000187 3300026089 Bacteria 65094
378 Ga0207648_10071311 3300026089 Bacteria 3027
379 Ga0207648_10145768 3300026089 Bacteria 2088
380 Ga0207648_10320131 3300026089 Bacteria 1394
381 Ga0207676_10164493 3300026095 Bacteria 1926
382 Ga0207676_10349199 3300026095 Bacteria 1367
383 Ga0207674_10261755 3300026116 Bacteria 1677
384 Ga0207675_100000390 3300026118 Bacteria 42092
385 Ga0207675_100008670 3300026118 Bacteria 9559
386 Ga0207675_100029830 3300026118 Bacteria 5078
387 Ga0207675_100097498 3300026118 Bacteria 2768
388 Ga0207675_100654724 3300026118 Bacteria 1057
389 Ga0207683_10000197 3300026121 Bacteria 52074
390 Ga0207683_10087037 3300026121 Bacteria 2778
391 Ga0207683_10291408 3300026121 Bacteria 1492
392 Ga0207683_10326918 3300026121 Bacteria 1405
393 Ga0207683_10412062 3300026121 Bacteria 1244
394 Ga0207698_10284204 3300026142 Bacteria 1532
395 Ga0207698_10442513 3300026142 Bacteria 1252
396 Ga0207698_10780698 3300026142 Bacteria 956
397 Ga0207428_10205272 3300027907 Bacteria 1482
398 Ga0207428_10379220 3300027907 Bacteria 1037
399 Ga0268266_10026545 3300028379 Bacteria 4928
400 Ga0268266_10361866 3300028379 Bacteria 1365
401 Ga0268265_10045976 3300028380 Bacteria 3261
402 Ga0268265_10060154 3300028380 Bacteria 2910
403 Ga0268264_10004226 3300028381 Bacteria 12258
404 Ga0307511_10000158 3300030521 Bacteria 65261
405 Ga0307511_10072092 3300030521 Bacteria 2512
406 Ga0307512_10045645 3300030522 Bacteria 3583
407 Ga0316177_1183914 3300030731 Bacteria 1641
408 Ga0314311_1066462 3300030733 Bacteria 2232
409 Ga0316180_1112152 3300030736 Bacteria 1431
410 Ga0265320_10124250 3300031240 Bacteria 1175
411 Ga0265327_10024751 3300031251 Bacteria 3516
412 Ga0307513_10007005 3300031456 Bacteria 14667
413 Ga0307513_10018515 3300031456 Bacteria 8317
414 Ga0307513_10035387 3300031456 Bacteria 5587
415 Ga0307509_10107461 3300031507 Bacteria 2806
416 Ga0307413_10001285 3300031824 Bacteria 9353
417 Ga0307413_10026643 3300031824 Bacteria 3189
418 Ga0307413_10316748 3300031824 Bacteria 1190
419 Ga0307518_10000495 3300031838 Bacteria 30033
420 Ga0307518_10012772 3300031838 Bacteria 5996
421 Ga0307410_10130379 3300031852 Bacteria 1846
422 Ga0307410_10428778 3300031852 Bacteria 1074
423 Ga0307410_10480862 3300031852 Bacteria 1019
424 Ga0307410_10492007 3300031852 Bacteria 1008
425 Ga0326468_10002032 3300031889 Bacteria 1691
426 Ga0307406_10046861 3300031901 Bacteria 2721
427 Ga0307406_10394093 3300031901 Bacteria 1096
428 Ga0307407_10072975 3300031903 Bacteria 2049
429 Ga0307407_10203282 3300031903 Bacteria 1329
430 Ga0307409_100042235 3300031995 Bacteria 3413
431 Ga0307409_100314742 3300031995 Bacteria 1462
432 Ga0307409_100599106 3300031995 Bacteria 1089
433 Ga0307416_100259922 3300032002 Bacteria 1696
434 Ga0307416_100316623 3300032002 Bacteria 1560
435 Ga0307411_10003408 3300032005 Bacteria 7371
436 Ga0307415_100134727 3300032126 Bacteria 1876
437 Ga0307415_100262868 3300032126 Bacteria 1409
438 Ga0307415_100315005 3300032126 Bacteria 1302
439 Ga0307507_10019835 3300033179 Bacteria 7553
440 Ga0307507_10039301 3300033179 Bacteria 4778
441 Ga0307507_10191908 3300033179 Bacteria 1434
442 Ga0307510_10041428 3300033180 Bacteria 5034
443 Ga0373949_0080094 3300035090 Bacteria 869
444 Ga0373956_0003096 3300035119 Bacteria 6729
445 Ga0373960_0044193 3300035121 Bacteria 1300
446 Ga0373931_0020857 3300035691 Bacteria 3282
447 Ga0373925_0367964 3300037068 Bacteria 1169
448 Ga0395900_0041501 3300037418 Bacteria 4743
449 Ga0436364_0290389 3300037853 Bacteria 159315
450 Ga0436364_0624094 3300037853 Bacteria 124588
451 Ga0436364_1364710 3300037853 Bacteria 19673
452 Ga0436365_0373159 3300039437 Bacteria 5503
453 Ga0436365_0667812 3300039437 Bacteria 2145
454 Ga0436365_1125927 3300039437 Bacteria 7423
455 Ga0436363_1485375 3300039450 Bacteria 800
456 Ga0436363_1630246 3300039450 Bacteria 7061
457 Ga0436362_0543778 3300039453 Bacteria 67112
458 Ga0439465_0003864 3300041413 Bacteria 4887
459 Ga0439465_0050446 3300041413 Bacteria 1361
460 Ga0451787_473958 3300041441 Bacteria 828
461 Ga0451789_0499532 3300041443 Bacteria 820
462 Ga0451793_1455051 3300041452 Bacteria 885
463 Ga0451795_0390405 3300041456 Bacteria 2481
464 Ga0451847_0509683 3300041503 Bacteria 1357
465 Ga0451853_3838303 3300041512 Bacteria 1382
466 Ga0439442_002363 3300042002 Bacteria 3701
467 Ga0439434_0001333 3300042435 Bacteria 7118
468 Ga0466969_0009005 3300044656 Bacteria 5290
469 Ga0466969_0020898 3300044656 Bacteria 3386
470 Ga0466969_0022487 3300044656 Bacteria 3254
471 Ga0466969_0084380 3300044656 Bacteria 1512
472 Ga0466972_0015752 3300044658 Bacteria 3780
473 Ga0466972_0017424 3300044658 Bacteria 3595
474 Ga0466972_0020429 3300044658 Bacteria 3309
475 Ga0466972_0051868 3300044658 Bacteria 1978
476 Ga0466972_0052770 3300044658 Bacteria 1958
477 Ga0466972_0055314 3300044658 Bacteria 1908
478 Ga0466972_0081147 3300044658 Bacteria 1544
479 Ga0466965_0000951 3300044683 Bacteria 11161
480 Ga0466965_0001005 3300044683 Bacteria 10920
481 Ga0466965_0006905 3300044683 Bacteria 5193
482 Ga0466965_0009663 3300044683 Bacteria 4485
483 Ga0466965_0010481 3300044683 Bacteria 4325
484 Ga0466965_0012711 3300044683 Bacteria 3965
485 Ga0466965_0030672 3300044683 Bacteria 2620
486 Ga0466965_0091766 3300044683 Bacteria 1546
487 Ga0466966_0001132 3300044684 Bacteria 17127
488 Ga0466966_0004920 3300044684 Bacteria 8784
489 Ga0466966_0010384 3300044684 Bacteria 6182
490 Ga0466966_0018541 3300044684 Bacteria 4589
491 Ga0466966_0018676 3300044684 Bacteria 4570
492 Ga0466966_0026070 3300044684 Bacteria 3817
493 Ga0466966_0180035 3300044684 Bacteria 1283
494 Ga0466966_0212407 3300044684 Bacteria 1169
495 Ga0466961_0000624 3300044693 Bacteria 22156
496 Ga0466961_0003917 3300044693 Bacteria 9309
497 Ga0466961_0039410 3300044693 Bacteria 3028
498 Ga0466963_0001389 3300044694 Bacteria 12982
499 Ga0466963_0180155 3300044694 Bacteria 1475
500 Ga0466964_0094578 3300044706 Bacteria 1306
501 Ga0466971_0001403 3300044719 Bacteria 10117
502 Ga0466971_0074589 3300044719 Bacteria 1542
503 Ga0466971_0118430 3300044719 Bacteria 1225
504 Ga0466968_0000337 3300044735 Bacteria 15138
505 Ga0466968_0001457 3300044735 Bacteria 8493
506 Ga0466968_0010117 3300044735 Bacteria 3647
507 Ga0466968_0015930 3300044735 Bacteria 2986
508 Ga0466970_0005494 3300044765 Bacteria 6292
509 Ga0466970_0014465 3300044765 Bacteria 4051
510 Ga0466970_0014651 3300044765 Bacteria 4026
511 Ga0466970_0023618 3300044765 Bacteria 3212
512 Ga0466970_0023791 3300044765 Bacteria 3202
513 Ga0466970_0043391 3300044765 Bacteria 2392
514 Ga0466970_0049075 3300044765 Bacteria 2251
515 Ga0466957_0003161 3300044842 Bacteria 8982
516 Ga0466957_0010912 3300044842 Bacteria 5225
517 Ga0466957_0105502 3300044842 Bacteria 1781
518 Ga0466960_0001845 3300044901 Bacteria 7776
519 Ga0466960_0014957 3300044901 Bacteria 3335
520 Ga0466960_0017713 3300044901 Bacteria 3111
521 Ga0466960_0028126 3300044901 Bacteria 2571
522 Ga0466960_0030685 3300044901 Bacteria 2475
523 Ga0466960_0051144 3300044901 Bacteria 1995
524 Ga0466959_0003933 3300045049 Bacteria 9865
525 Ga0466959_0009913 3300045049 Bacteria 6790
526 Ga0466959_0013848 3300045049 Bacteria 5855
527 Ga0466959_0014815 3300045049 Bacteria 5676
528 Ga0466959_0020245 3300045049 Bacteria 4899
529 Ga0466959_0037459 3300045049 Bacteria 3583
530 Ga0466959_0162533 3300045049 Bacteria 1569
531 Ga0466958_0001216 3300045836 Bacteria 12032
532 Ga0466958_0021385 3300045836 Bacteria 3780
533 Ga0466958_0029701 3300045836 Bacteria 3244
534 Ga0466958_0040492 3300045836 Bacteria 2800
535 Ga0466967_0000901 3300045976 Bacteria 15900
536 Ga0466967_0002000 3300045976 Bacteria 12400
537 Ga0466967_0018137 3300045976 Bacteria 5615
538 Ga0466967_0052834 3300045976 Bacteria 3569
539 Ga0466967_0408514 3300045976 Bacteria 1322
540 Ga0466967_0473002 3300045976 Bacteria 1227
541 Ga0466967_0568425 3300045976 Bacteria 1117
542 Ga0466967_0665595 3300045976 Bacteria 1030
543 Ga0495580_0443932 3300046472 Bacteria 871
544 Ga0495582_0046296 3300046473 Bacteria 2396
545 Ga0495607_0023749 3300046501 Bacteria 3833
546 Ga0495583_0010752 3300046506 Bacteria 5307
547 Ga0495648_0011128 3300046524 Bacteria 6805
548 Ga0495665_0018154 3300046531 Bacteria 3781
549 Ga0495586_0284924 3300046535 Bacteria 946
550 Ga0495668_0000573 3300046616 Bacteria 45058
551 Ga0495658_0280192 3300046683 Bacteria 1052
552 Ga0495613_0197696 3300046689 Bacteria 1419
553 Ga0495581_0002987 3300047315 Bacteria 9689
554 Ga0495672_0001067 3300047320 Bacteria 27912
555 Ga0495676_0128136 3300047321 Bacteria 1836
556 Ga0495683_0001077 3300047323 Bacteria 18893
557 Ga0495683_0177814 3300047323 Bacteria 974
558 Ga0495673_0001125 3300047469 Bacteria 22914
559 Ga0495686_0060496 3300047472 Bacteria 2354
560 Ga0495593_0036340 3300047673 Bacteria 2671
561 Ga0495602_0501130 3300048088 Bacteria 849
562 Ga0496100_0005813 3300048903 Bacteria 6673
563 Ga0496100_0020039 3300048903 Bacteria 4003
564 Ga0496100_0022490 3300048903 Bacteria 3815
565 Ga0496100_0037901 3300048903 Bacteria 3052
566 Ga0496101_0000102 3300048904 Bacteria 88779
567 Ga0496101_0000923 3300048904 Bacteria 17335
568 Ga0496101_0005872 3300048904 Bacteria 7860
569 Ga0496101_0082733 3300048904 Bacteria 2376
570 Ga0496101_0335344 3300048904 Bacteria 1187
571 Ga0496102_0000037 3300048905 Bacteria 199368
572 Ga0496102_0000042 3300048905 Bacteria 196538
573 Ga0496102_0066174 3300048905 Bacteria 3312
574 Ga0496102_0120454 3300048905 Bacteria 2450
575 Ga0496102_0123669 3300048905 Bacteria 2417
576 Ga0496102_0165009 3300048905 Bacteria 2084
577 Ga0496102_0507960 3300048905 Bacteria 1128
578 Ga0496103_0000004 3300048906 Bacteria 510080
579 Ga0496103_0000194 3300048906 Bacteria 60666
580 Ga0496103_0094561 3300048906 Bacteria 1888
581 Ga0496103_0138638 3300048906 Bacteria 1555
582 Ga0496104_0041842 3300048907 Bacteria 4297
583 Ga0496104_0658910 3300048907 Bacteria 956
584 Ga0496104_0686361 3300048907 Bacteria 932
585 Ga0496105_0010731 3300048908 Bacteria 7211
586 Ga0496105_0012835 3300048908 Bacteria 6639
587 Ga0496105_0044370 3300048908 Bacteria 3667
588 Ga0496105_0128433 3300048908 Bacteria 2090
589 Ga0496106_0001446 3300048909 Bacteria 17814
590 Ga0496106_0001888 3300048909 Bacteria 15700
591 Ga0496106_0149874 3300048909 Bacteria 1839
592 Ga0496106_0187282 3300048909 Bacteria 1644
593 Ga0496107_0000421 3300048910 Bacteria 22921
594 Ga0496107_0000619 3300048910 Bacteria 19912
595 Ga0496107_0008362 3300048910 Bacteria 7159
596 Ga0496107_0419425 3300048910 Bacteria 995
597 Ga0496108_0000503 3300048911 Bacteria 30879
598 Ga0496108_0030122 3300048911 Bacteria 4498
599 Ga0496108_0042500 3300048911 Bacteria 3795
600 Ga0496108_0270422 3300048911 Bacteria 1479
601 Ga0496108_0587806 3300048911 Bacteria 970
602 Ga0496108_0588753 3300048911 Bacteria 970
603 Ga0496109_0003492 3300048912 Bacteria 13132
604 Ga0496109_0030858 3300048912 Bacteria 4805
605 Ga0496109_0139662 3300048912 Bacteria 2265
606 Ga0496109_0155936 3300048912 Bacteria 2139
607 Ga0496109_0166860 3300048912 Bacteria 2064
608 Ga0496109_0211324 3300048912 Bacteria 1824
609 Ga0496109_0234468 3300048912 Bacteria 1727
610 Ga0496109_0725642 3300048912 Bacteria 931
611 Ga0496110_0002133 3300048913 Bacteria 14776
612 Ga0496110_0081739 3300048913 Bacteria 2881
613 Ga0496110_0087928 3300048913 Bacteria 2775
614 Ga0496110_0104966 3300048913 Bacteria 2535
615 Ga0496110_0121251 3300048913 Bacteria 2356
616 Ga0496110_0259945 3300048913 Bacteria 1580
617 Ga0496111_0005087 3300048914 Bacteria 8367
618 Ga0496111_0043427 3300048914 Bacteria 3231
619 Ga0496111_0056038 3300048914 Bacteria 2851
620 Ga0496112_0002560 3300048915 Bacteria 14689
621 Ga0496112_0006323 3300048915 Bacteria 10401
622 Ga0496112_0153860 3300048915 Bacteria 2267
623 Ga0496113_0263946 3300048916 Bacteria 1376
624 Ga0496114_0000108 3300048917 Bacteria 59737
625 Ga0496114_0001286 3300048917 Bacteria 18965
626 Ga0496114_0239638 3300048917 Bacteria 1595
627 Ga0496115_0002120 3300048918 Bacteria 14181
628 Ga0496115_0002657 3300048918 Bacteria 12836
629 Ga0496116_0000276 3300048919 Bacteria 89506
630 Ga0496116_0000464 3300048919 Bacteria 56167
631 Ga0496117_0000003 3300048920 Bacteria 1881097
632 Ga0496117_0000339 3300048920 Bacteria 82597
633 Ga0496118_0000001 3300048921 Bacteria 1881100
634 Ga0496118_0000241 3300048921 Bacteria 96484
635 Ga0496119_0006204 3300048922 Bacteria 11177
636 Ga0496119_0190165 3300048922 Bacteria 1070
637 Ga0496120_0009654 3300048923 Bacteria 6813
638 Ga0496120_0025940 3300048923 Bacteria 3629
639 Ga0496120_0066814 3300048923 Bacteria 1987
640 Ga0496121_0000338 3300048924 Bacteria 97703
641 Ga0496121_0004853 3300048924 Bacteria 17673
642 Ga0496121_0207228 3300048924 Bacteria 1392
643 Ga0496122_0014665 3300048925 Bacteria 7557
644 Ga0496125_0020171 3300048928 Bacteria 6264
645 Ga0496125_0029988 3300048928 Bacteria 4874
646 Ga0496125_0090141 3300048928 Bacteria 2303
647 Ga0496125_0430899 3300048928 Bacteria 761
648 Ga0496126_0000551 3300048929 Bacteria 72093
649 Ga0496126_0001408 3300048929 Bacteria 38053
650 Ga0496126_0005413 3300048929 Bacteria 14564
651 Ga0496126_0132182 3300048929 Bacteria 2156
652 Ga0501323_007713 3300049539 Bacteria 1235
653 Ga0501032_0003747 3300049569 Bacteria 11530
654 Ga0501034_0010132 3300049571 Bacteria 9833
655 Ga0501034_0357975 3300049571 Bacteria 1387
656 Ga0501034_0408933 3300049571 Bacteria 1279
657 Ga0501036_0020079 3300049572 Bacteria 5610
658 Ga0501037_0003118 3300049573 Bacteria 12016
659 Ga0501038_0013261 3300049574 Bacteria 7515
660 Ga0501039_0004952 3300049575 Bacteria 10100
661 Ga0501043_0000411 3300049579 Bacteria 38553
662 Ga0501047_0051724 3300049581 Bacteria 3970
663 Ga0501067_0169989 3300049583 Bacteria 1214
664 Ga0501068_0196361 3300049584 Bacteria 1279
665 Ga0501070_0000614 3300049586 Bacteria 32686
666 Ga0501071_0055114 3300049587 Bacteria 2870
667 Ga0501073_0041110 3300049589 Bacteria 3267
668 Ga0501075_0223706 3300049591 Bacteria 1436
669 Ga0501076_0571253 3300049592 Bacteria 933
670 Ga0501077_0169483 3300049593 Bacteria 1387
671 Ga0501079_0287235 3300049741 Bacteria 1286
672 Ga0501080_0404955 3300049742 Bacteria 1227
673 Ga0501044_0132344 3300049823 Bacteria 2487
674 nmdc:mga03683_63843_c1 3300050489 Bacteria 1561
675 nmdc:mga03n38_13056_c2 3300050490 Bacteria 2216
676 nmdc:mga03n38_22356_c1 3300050490 Bacteria 2558
677 nmdc:mga03n38_286877_c1 3300050490 Bacteria 880
678 nmdc:mga03n38_3780_c1 3300050490 Bacteria 4913
679 nmdc:mga03n38_38539_c1 3300050490 Bacteria 2068
680 nmdc:mga03n38_821_c1 3300050490 Bacteria 8320
681 nmdc:mga00v17_209296_c1 3300050491 Bacteria 1262
682 nmdc:mga00v17_27231_c1 3300050491 Bacteria 3336
683 nmdc:mga00v17_28138_c1 3300050491 Bacteria 3290
684 nmdc:mga00v17_33451_c1 3300050491 Bacteria 3046
685 nmdc:mga00v17_721_c1 3300050491 Bacteria 18067
686 nmdc:mga0yw44_1318_c1 3300050492 Bacteria 7392
687 nmdc:mga0yw44_240021_c1 3300050492 Bacteria 1204
688 nmdc:mga0yw44_392639_c1 3300050492 Bacteria 937
689 nmdc:mga0yw44_41158_c1 3300050492 Bacteria 2749
690 nmdc:mga0yw44_6798_c1 3300050492 Bacteria 5560
691 nmdc:mga07m45_107212_c1 3300050496 Bacteria 1607
692 nmdc:mga07m45_124658_c1 3300050496 Bacteria 1489
693 nmdc:mga07m45_138721_c1 3300050496 Bacteria 1408
694 nmdc:mga07m45_162330_c1 3300050496 Bacteria 1297
695 nmdc:mga07m45_352395_c1 3300050496 Bacteria 855
696 nmdc:mga07m45_50346_c1 3300050496 Bacteria 2347
697 nmdc:mga09592_280967_c1 3300050508 Bacteria 1444
698 nmdc:mga0qj67_16695_c1 3300050509 Bacteria 5572
699 nmdc:mga0qj67_194194_c1 3300050509 Bacteria 1649
700 nmdc:mga0qj67_467975_c1 3300050509 Bacteria 1015
701 nmdc:mga06r32_117_c5 3300050510 Bacteria 10449
702 nmdc:mga06r32_17373_c2 3300050510 Bacteria 4784
703 nmdc:mga08y16_43822_c1 3300050511 Bacteria 3767
704 nmdc:mga08y16_559411_c1 3300050511 Bacteria 1157
705 nmdc:mga0sz30_122136_c1 3300050516 Bacteria 1145
706 nmdc:mga0sz30_377_c1 3300050516 Bacteria 17040
707 nmdc:mga0sz30_642_c1 3300050516 Bacteria 12927
708 nmdc:mga0sz30_77257_c1 3300050516 Bacteria 1438
709 nmdc:mga0sz30_88991_c1 3300050516 Bacteria 1342
710 Ga0500610_0008219 3300053079 Bacteria 4530
711 Ga0500635_0000607 3300053080 Bacteria 9400
712 Ga0500643_023377 3300053087 Bacteria 1975
713 Ga0500643_035599 3300053087 Bacteria 1491
714 Ga0500556_0003107 3300053104 Bacteria 4955
715 Ga0500562_034019 3300053108 Bacteria 1348
716 Ga0500572_065475 3300053111 Bacteria 1113
717 Ga0500652_005412 3300053131 Bacteria 4017
718 Ga0500652_009681 3300053131 Bacteria 3271
719 Ga0500658_0159404 3300053134 Bacteria 1021
720 Ga0500559_0002526 3300053136 Bacteria 9400
721 Ga0500589_129723 3300053147 Bacteria 1055
722 Ga0500616_0024990 3300053153 Bacteria 3315
723 Ga0500616_0079747 3300053153 Bacteria 1647
724 Ga0500620_101342 3300053155 Bacteria 1007
725 Ga0500627_0028398 3300053158 Bacteria 2324
726 Ga0500645_000668 3300053730 Bacteria 21553
727 Ga0466962_0001545 3300061719 Bacteria 10751
728 Ga0466962_0033283 3300061719 Bacteria 2466
729 Ga0466962_0039089 3300061719 Bacteria 2272
730 2523382799 2523231044 Bacteria 6434991
731 2548697863 2547132424 Bacteria 8348532
732 2552109519 2551306166 Bacteria 9731570
733 2558910906 2558860112 Bacteria 9931328
734 2559429635 2558860280 Bacteria 11429938
735 2566993084 2565956761 Bacteria 6601618
736 2583150443 2582580736 Bacteria 5325865
737 2586059312 2585427649 Bacteria 9053857
738 2644513017 2643221692 Bacteria 7282860
739 2738706084 2738541274 Bacteria 6909446
740 2739238719 2738543011 Bacteria 5731169
741 2739333016 2738543028 Bacteria 6917070
742 2739362202 2738543034 Bacteria 6084756
743 2744957122 2744054611 Bacteria 5611514
744 2753035251 2751185725 Bacteria 5740550
745 2753070750 2751185734 Bacteria 8863695
746 2753323768 2751185792 Bacteria 5739090
747 2791915385 2791354901 Bacteria 8322202
748 2795783479 2795385470 Bacteria 8317180
749 2809591930 2808606522 Bacteria 9488490
750 2816504643 2816332139 Bacteria 9138787
751 2863071070 2863067949 Bacteria 8541735
752 2866552670 2866552031 Bacteria 5824618
753 2866616852 2866612099 Bacteria 7543886
754 2870726680 2870721527 Bacteria 9689237
755 2870789101 2870782633 Bacteria 9624083
756 2889300992 2889300758 Bacteria 5690814
757 2891327591 2891326441 Bacteria 6439512
758 2899364137 2899359706 Bacteria 10940472
759 2899373305 2899370129 Bacteria 6781179
760 2902801619 2902799365 Bacteria 5419524
761 2904538922 2904535858 Bacteria 6308016
762 2915361595 2915358134 Bacteria 6050864
763 2915773338 2915768154 Bacteria 8424322
764 2917738936 2917736166 Bacteria 9690793
765 2919715962 2919713450 Bacteria 7431245
766 2922556780 2922554459 Bacteria 6683962
767 2939587262 2939582691 Bacteria 7088898
768 2939744511 2939743619 Bacteria 5762299
769 2956940445 2956939328 Bacteria 3474458
770 2974317259 2974315732 Bacteria 4602776
771 2984525464 2984523437 Bacteria 4508481
772 3001121870 3001119090 Bacteria 3449530
773 8003322504 8003314358 Bacteria 10575343
774 8047718035 8047710418 Bacteria 11023148
775 8054474295 8054472261 Bacteria 7464355
776 8056212007 8056207758 Bacteria 8639239
777 Ga0105241_10211036
778 CNXas_1000536
779 JGI24746J21847_1004021
780 JGI24735J21928_10023223
781 JGI24750J21931_1016477
782 JGI24745J21846_1001114
783 JGI24745J21846_1004008
784 JGI24744J21845_10006632
785 JGI24034J26672_10005404
786 JGI24742J22300_10003132
787 JGI24751J29686_10005463
788 JGI25406J46586_10000557
789 Ga0055540_1002431
790 Ga0055540_1005569
791 Ga0055540_1009773
792 Ga0070658_10308331
793 Ga0070676_10041597
794 Ga0070676_10080723
795 Ga0070683_100123341
796 Ga0070683_100147531
797 Ga0070690_100004656
798 Ga0068869_100035072
799 Ga0068869_100077846
800 Ga0070666_10173181
801 Ga0070682_100033809
802 Ga0070682_100319447
803 Ga0068868_100033397
804 Ga0068868_100065385
805 Ga0068868_100208636
806 Ga0070689_100028370
807 Ga0070689_100062364
808 Ga0070689_100122073
809 Ga0070661_100584590
810 Ga0070668_100000449
811 Ga0070668_100059966
812 Ga0070668_100107435
813 Ga0070668_100440497
814 Ga0070669_100028340
815 Ga0070669_100312037
816 Ga0070669_100607627
817 Ga0070675_100207422
818 Ga0070671_100002308
819 Ga0070671_100005597
820 Ga0070671_100096819
821 Ga0070674_100041361
822 Ga0070674_100075059
823 Ga0070688_100073075
824 Ga0070688_100179536
825 Ga0070659_100036934
826 Ga0070659_100495173
827 Ga0070667_100016599
828 Ga0070667_100019725
829 Ga0070667_100036663
830 Ga0070667_100180096
831 Ga0070709_10014526
832 Ga0070714_100009393
833 Ga0070714_100195712
834 Ga0070713_100033202
835 Ga0070713_100064828
836 Ga0070710_10000364
837 Ga0070710_10000468
838 Ga0070710_10010481
839 Ga0070711_100002851
840 Ga0070711_100006539
841 Ga0070705_100103279
842 Ga0070705_100217623
843 Ga0070700_100002039
844 Ga0070700_100282794
845 Ga0070694_100063135
846 Ga0070663_100002335
847 Ga0070663_100005380
848 Ga0070663_100020149
849 Ga0070663_100080988
850 Ga0070663_100392682
851 Ga0070663_100595055
852 Ga0070678_100042939
853 Ga0070678_100063119
854 Ga0070678_100114047
855 Ga0070662_100151909
856 Ga0068867_100003379
857 Ga0068867_100066793
858 Ga0068867_100242322
859 Ga0070685_10057572
860 Ga0070684_100307871
861 Ga0068853_100035399
862 Ga0068853_100060121
863 Ga0068853_100139386
864 Ga0070672_100087530
865 Ga0070672_100112923
866 Ga0070686_100076990
867 Ga0070695_100182829
868 Ga0070696_100003196
869 Ga0070696_100015832
870 Ga0070693_100031943
871 Ga0070693_100054076
872 Ga0070693_100226567
873 Ga0070665_100001944
874 Ga0070665_100010428
875 Ga0070665_100062380
876 Ga0070665_100120159
877 Ga0070704_100006793
878 Ga0070704_100087587
879 Ga0068855_100112475
880 Ga0068855_100119110
881 Ga0070664_100215535
882 Ga0070664_100375057
883 Ga0070664_100598656
884 Ga0068857_100698424
885 Ga0068854_100074267
886 Ga0068854_100091265
887 Ga0068854_100117114
888 Ga0068854_100277929
889 Ga0068854_100383703
890 Ga0068854_100598498
891 Ga0068856_100518728
892 Ga0068856_100661005
893 Ga0070702_100034338
894 Ga0070702_100057911
895 Ga0068852_100058603
896 Ga0068852_100095343
897 Ga0068859_100042229
898 Ga0068859_100166645
899 Ga0068859_100268433
900 Ga0068859_100322249
901 Ga0068859_100463888
902 Ga0068864_100366505
903 Ga0068866_10000223
904 Ga0068866_10009759
905 Ga0068861_100000566
906 Ga0068870_10068146
907 Ga0068870_10297777
908 Ga0068863_100014660
909 Ga0068863_100048888
910 Ga0068858_100000340
911 Ga0068858_100044837
912 Ga0068858_100281567
913 Ga0068860_100014701
914 Ga0068862_100035998
915 Ga0068862_100170978
916 Ga0068862_100323844
917 Ga0081455_10000011
918 Ga0081455_10015862
919 Ga0081455_10074855
920 Ga0081539_10000680
921 Ga0070717_10131172
922 Ga0070717_10245861
923 Ga0075365_10044901
924 Ga0075365_10464728
925 Ga0075363_100003786
926 Ga0075363_100023765
927 Ga0075363_100029456
928 Ga0075363_100032237
929 Ga0075363_100048365
930 Ga0075363_100076645
931 Ga0075364_10000301
932 Ga0075364_10023127
933 Ga0075364_10025162
934 Ga0075364_10034918
935 Ga0075364_10055801
936 Ga0075364_10094611
937 Ga0070715_10037612
938 Ga0070715_10058405
939 Ga0070716_100061059
940 Ga0070716_100064518
941 Ga0070712_100023175
942 Ga0070712_100305496
943 Ga0075362_10073010
944 Ga0075369_10001858
945 Ga0075369_10003549
946 Ga0075369_10017703
947 Ga0075369_10018933
948 Ga0075369_10032296
949 Ga0075369_10088538
950 Ga0075369_10093603
951 Ga0075369_10108956
952 Ga0075369_10154566
953 Ga0075369_10182403
954 Ga0097621_100098979
955 Ga0097621_100284549
956 Ga0097621_100365570
957 Ga0075370_10001488
958 Ga0075370_10099283
959 Ga0075370_10107238
960 Ga0075370_10163736
961 Ga0075370_10249562
962 Ga0068871_100305608
963 Ga0075428_100001695
964 Ga0075430_100029765
965 Ga0075430_100286610
966 Ga0075430_100490123
967 Ga0075431_100056933
968 Ga0075429_100289645
969 Ga0097620_100042230
970 Ga0097620_100166642
971 Ga0097620_100268422
972 Ga0097620_100322256
973 Ga0097620_100463885
974 Ga0105250_10008866
975 Ga0105240_10342809
976 Ga0111539_10058897
977 Ga0111539_10327525
978 Ga0111539_10503063
979 Ga0105245_10017295
980 Ga0105245_10160233
981 Ga0105245_10212999
982 Ga0105247_10034066
983 Ga0105247_10142010
984 Ga0105243_10000749
985 Ga0105243_10008122
986 Ga0105243_10093391
987 Ga0105241_10065259
988 Ga0105241_10227533
989 Ga0105242_10082815
990 Ga0105242_10159894
991 Ga0105242_10250278
992 Ga0105242_10429682
993 Ga0105248_10001981
994 Ga0105248_10073208
995 Ga0105248_10207833
996 Ga0105237_10001244
997 Ga0105237_10084464
998 Ga0105237_10106964
999 Ga0105237_10190690
1000 Ga0105237_10844646
1001 Ga0105238_10166291
1002 Ga0105238_10190217
1003 Ga0105238_10373725
1004 Ga0105249_10007116
1005 Ga0105249_10087761
1006 Ga0105249_11022543
1007 Ga0105239_10027785
1008 Ga0105239_10181177
1009 Ga0105239_10749887
1010 Ga0105239_11156193
1011 Ga0105246_10048993
1012 Ga0105246_10234856
1013 Ga0105246_10728266
1014 Ga0157369_10143259
1015 Ga0157369_10331122
1016 Ga0157374_10095524
1017 Ga0157378_10013565
1018 Ga0157378_10162000
1019 Ga0163162_10017533
1020 Ga0163162_10144715
1021 Ga0163162_10146816
1022 Ga0163162_10998409
1023 Ga0157372_10004262
1024 Ga0157372_10068538
1025 Ga0157372_10720054
1026 Ga0157375_10012997
1027 Ga0157375_10195655
1028 Ga0157375_10315824
1029 Ga0157375_11284474
1030 Ga0163163_10028842
1031 Ga0163163_10485283
1032 Ga0157380_10028021
1033 Ga0157380_10651699
1034 Ga0157377_10019339
1035 Ga0157379_10025793
1036 Ga0157379_10041285
1037 Ga0157379_10194244
1038 Ga0157376_10296353
1039 Ga0163161_10002626
1040 Ga0163161_10119025
1041 Ga0213873_10000144
1042 Ga0213876_10088490
1043 Ga0213875_10002351
1044 Ga0213875_10005039
1045 Ga0213875_10010251
1046 Ga0209051_1002711
1047 Ga0209051_1003201
1048 Ga0209051_1008910
1049 Ga0207692_10028384
1050 Ga0207692_10054993
1051 Ga0207642_10005556
1052 Ga0207642_10224600
1053 Ga0207710_10182685
1054 Ga0207688_10004235
1055 Ga0207688_10027373
1056 Ga0207688_10037263
1057 Ga0207688_10119972
1058 Ga0207680_10151079
1059 Ga0207647_10081601
1060 Ga0207685_10003898
1061 Ga0207645_10044272
1062 Ga0207643_10018147
1063 Ga0207643_10023514
1064 Ga0207654_10078235
1065 Ga0207671_10020624
1066 Ga0207671_10050415
1067 Ga0207693_10000292
1068 Ga0207693_10007534
1069 Ga0207693_10203637
1070 Ga0207663_10027939
1071 Ga0207663_10089161
1072 Ga0207662_10101704
1073 Ga0207657_10031065
1074 Ga0207649_10270877
1075 Ga0207681_10099859
1076 Ga0207694_10117129
1077 Ga0207694_10156351
1078 Ga0207694_10243532
1079 Ga0207694_10450338
1080 Ga0207687_10026753
1081 Ga0207687_10114586
1082 Ga0207687_10215503
1083 Ga0207687_10298606
1084 Ga0207700_10146347
1085 Ga0207664_10008573
1086 Ga0207664_10293728
1087 Ga0207644_10003294
1088 Ga0207706_10018893
1089 Ga0207706_10103808
1090 Ga0207706_10533736
1091 Ga0207686_10015437
1092 Ga0207709_10003971
1093 Ga0207709_10061384
1094 Ga0207670_10083226
1095 Ga0207670_10172894
1096 Ga0207670_10181647
1097 Ga0207669_10048549
1098 Ga0207669_10223818
1099 Ga0207704_10046986
1100 Ga0207704_10132461
1101 Ga0207704_10209793
1102 Ga0207704_10258197
1103 Ga0207665_10019007
1104 Ga0207665_10051332
1105 Ga0207665_10100463
1106 Ga0207691_10109842
1107 Ga0207691_10111791
1108 Ga0207691_10112815
1109 Ga0207711_10043412
1110 Ga0207711_10228878
1111 Ga0207689_10009983
1112 Ga0207689_10015374
1113 Ga0207689_10060615
1114 Ga0207689_10258938
1115 Ga0207689_10433187
1116 Ga0207661_10130627
1117 Ga0207661_10314112
1118 Ga0207661_10325267
1119 Ga0207679_10130883
1120 Ga0207651_10434446
1121 Ga0207651_10513830
1122 Ga0207712_10069390
1123 Ga0207712_10891243
1124 Ga0207668_10000521
1125 Ga0207668_10030372
1126 Ga0207668_10030679
1127 Ga0207640_10028647
1128 Ga0207640_10121031
1129 Ga0207640_10180786
1130 Ga0207640_10244464
1131 Ga0207658_10010530
1132 Ga0207658_10119701
1133 Ga0207658_10140555
1134 Ga0207677_10012418
1135 Ga0207677_10018253
1136 Ga0207677_10093410
1137 Ga0207639_10026057
1138 Ga0207639_11086141
1139 Ga0207678_10000168
1140 Ga0207678_10022948
1141 Ga0207678_10024700
1142 Ga0207678_10054163
1143 Ga0207678_10064377
1144 Ga0207678_10117554
1145 Ga0207678_10247801
1146 Ga0207708_10003716
1147 Ga0207708_10005971
1148 Ga0207708_10007355
1149 Ga0207708_10018785
1150 Ga0207708_10363859
1151 Ga0207641_10001754
1152 Ga0207641_10003490
1153 Ga0207648_10000187
1154 Ga0207648_10071311
1155 Ga0207648_10145768
1156 Ga0207648_10320131
1157 Ga0207676_10164493
1158 Ga0207676_10349199
1159 Ga0207674_10261755
1160 Ga0207675_100000390
1161 Ga0207675_100008670
1162 Ga0207675_100029830
1163 Ga0207675_100097498
1164 Ga0207675_100654724
1165 Ga0207683_10000197
1166 Ga0207683_10087037
1167 Ga0207683_10291408
1168 Ga0207683_10326918
1169 Ga0207683_10412062
1170 Ga0207698_10284204
1171 Ga0207698_10442513
1172 Ga0207698_10780698
1173 Ga0207428_10205272
1174 Ga0207428_10379220
1175 Ga0268266_10026545
1176 Ga0268266_10361866
1177 Ga0268265_10045976
1178 Ga0268265_10060154
1179 Ga0268264_10004226
1180 Ga0307511_10000158
1181 Ga0307511_10072092
1182 Ga0307512_10045645
1183 Ga0316177_1183914
1184 Ga0314311_1066462
1185 Ga0316180_1112152
1186 Ga0265320_10124250
1187 Ga0265327_10024751
1188 Ga0307513_10007005
1189 Ga0307513_10018515
1190 Ga0307513_10035387
1191 Ga0307509_10107461
1192 Ga0307413_10001285
1193 Ga0307413_10026643
1194 Ga0307413_10316748
1195 Ga0307518_10000495
1196 Ga0307518_10012772
1197 Ga0307410_10130379
1198 Ga0307410_10428778
1199 Ga0307410_10480862
1200 Ga0307410_10492007
1201 Ga0326468_10002032
1202 Ga0307406_10046861
1203 Ga0307406_10394093
1204 Ga0307407_10072975
1205 Ga0307407_10203282
1206 Ga0307409_100042235
1207 Ga0307409_100314742
1208 Ga0307409_100599106
1209 Ga0307416_100259922
1210 Ga0307416_100316623
1211 Ga0307411_10003408
1212 Ga0307415_100134727
1213 Ga0307415_100262868
1214 Ga0307415_100315005
1215 Ga0307507_10019835
1216 Ga0307507_10039301
1217 Ga0307507_10191908
1218 Ga0307510_10041428
1219 Ga0373949_0080094
1220 Ga0373956_0003096
1221 Ga0373960_0044193
1222 Ga0373931_0020857
1223 Ga0373925_0367964
1224 Ga0395900_0041501
1225 Ga0436364_0290389
1226 Ga0436364_0624094
1227 Ga0436364_1364710
1228 Ga0436365_0373159
1229 Ga0436365_0667812
1230 Ga0436365_1125927
1231 Ga0436363_1485375
1232 Ga0436363_1630246
1233 Ga0436362_0543778
1234 Ga0439465_0003864
1235 Ga0439465_0050446
1236 Ga0451787_473958
1237 Ga0451789_0499532
1238 Ga0451793_1455051
1239 Ga0451795_0390405
1240 Ga0451847_0509683
1241 Ga0451853_3838303
1242 Ga0439442_002363
1243 Ga0439434_0001333
1244 Ga0466969_0009005
1245 Ga0466969_0020898
1246 Ga0466969_0022487
1247 Ga0466969_0084380
1248 Ga0466972_0015752
1249 Ga0466972_0017424
1250 Ga0466972_0020429
1251 Ga0466972_0051868
1252 Ga0466972_0052770
1253 Ga0466972_0055314
1254 Ga0466972_0081147
1255 Ga0466965_0000951
1256 Ga0466965_0001005
1257 Ga0466965_0006905
1258 Ga0466965_0009663
1259 Ga0466965_0010481
1260 Ga0466965_0012711
1261 Ga0466965_0030672
1262 Ga0466965_0091766
1263 Ga0466966_0001132
1264 Ga0466966_0004920
1265 Ga0466966_0010384
1266 Ga0466966_0018541
1267 Ga0466966_0018676
1268 Ga0466966_0026070
1269 Ga0466966_0180035
1270 Ga0466966_0212407
1271 Ga0466961_0000624
1272 Ga0466961_0003917
1273 Ga0466961_0039410
1274 Ga0466963_0001389
1275 Ga0466963_0180155
1276 Ga0466964_0094578
1277 Ga0466971_0001403
1278 Ga0466971_0074589
1279 Ga0466971_0118430
1280 Ga0466968_0000337
1281 Ga0466968_0001457
1282 Ga0466968_0010117
1283 Ga0466968_0015930
1284 Ga0466970_0005494
1285 Ga0466970_0014465
1286 Ga0466970_0014651
1287 Ga0466970_0023618
1288 Ga0466970_0023791
1289 Ga0466970_0043391
1290 Ga0466970_0049075
1291 Ga0466957_0003161
1292 Ga0466957_0010912
1293 Ga0466957_0105502
1294 Ga0466960_0001845
1295 Ga0466960_0014957
1296 Ga0466960_0017713
1297 Ga0466960_0028126
1298 Ga0466960_0030685
1299 Ga0466960_0051144
1300 Ga0466959_0003933
1301 Ga0466959_0009913
1302 Ga0466959_0013848
1303 Ga0466959_0014815
1304 Ga0466959_0020245
1305 Ga0466959_0037459
1306 Ga0466959_0162533
1307 Ga0466958_0001216
1308 Ga0466958_0021385
1309 Ga0466958_0029701
1310 Ga0466958_0040492
1311 Ga0466967_0000901
1312 Ga0466967_0002000
1313 Ga0466967_0018137
1314 Ga0466967_0052834
1315 Ga0466967_0408514
1316 Ga0466967_0473002
1317 Ga0466967_0568425
1318 Ga0466967_0665595
1319 Ga0495580_0443932
1320 Ga0495582_0046296
1321 Ga0495607_0023749
1322 Ga0495583_0010752
1323 Ga0495648_0011128
1324 Ga0495665_0018154
1325 Ga0495586_0284924
1326 Ga0495668_0000573
1327 Ga0495658_0280192
1328 Ga0495613_0197696
1329 Ga0495581_0002987
1330 Ga0495672_0001067
1331 Ga0495676_0128136
1332 Ga0495683_0001077
1333 Ga0495683_0177814
1334 Ga0495673_0001125
1335 Ga0495686_0060496
1336 Ga0495593_0036340
1337 Ga0495602_0501130
1338 Ga0496100_0005813
1339 Ga0496100_0020039
1340 Ga0496100_0022490
1341 Ga0496100_0037901
1342 Ga0496101_0000102
1343 Ga0496101_0000923
1344 Ga0496101_0005872
1345 Ga0496101_0082733
1346 Ga0496101_0335344
1347 Ga0496102_0000037
1348 Ga0496102_0000042
1349 Ga0496102_0066174
1350 Ga0496102_0120454
1351 Ga0496102_0123669
1352 Ga0496102_0165009
1353 Ga0496102_0507960
1354 Ga0496103_0000004
1355 Ga0496103_0000194
1356 Ga0496103_0094561
1357 Ga0496103_0138638
1358 Ga0496104_0041842
1359 Ga0496104_0658910
1360 Ga0496104_0686361
1361 Ga0496105_0010731
1362 Ga0496105_0012835
1363 Ga0496105_0044370
1364 Ga0496105_0128433
1365 Ga0496106_0001446
1366 Ga0496106_0001888
1367 Ga0496106_0149874
1368 Ga0496106_0187282
1369 Ga0496107_0000421
1370 Ga0496107_0000619
1371 Ga0496107_0008362
1372 Ga0496107_0419425
1373 Ga0496108_0000503
1374 Ga0496108_0030122
1375 Ga0496108_0042500
1376 Ga0496108_0270422
1377 Ga0496108_0587806
1378 Ga0496108_0588753
1379 Ga0496109_0003492
1380 Ga0496109_0030858
1381 Ga0496109_0139662
1382 Ga0496109_0155936
1383 Ga0496109_0166860
1384 Ga0496109_0211324
1385 Ga0496109_0234468
1386 Ga0496109_0725642
1387 Ga0496110_0002133
1388 Ga0496110_0081739
1389 Ga0496110_0087928
1390 Ga0496110_0104966
1391 Ga0496110_0121251
1392 Ga0496110_0259945
1393 Ga0496111_0005087
1394 Ga0496111_0043427
1395 Ga0496111_0056038
1396 Ga0496112_0002560
1397 Ga0496112_0006323
1398 Ga0496112_0153860
1399 Ga0496113_0263946
1400 Ga0496114_0000108
1401 Ga0496114_0001286
1402 Ga0496114_0239638
1403 Ga0496115_0002120
1404 Ga0496115_0002657
1405 Ga0496116_0000276
1406 Ga0496116_0000464
1407 Ga0496117_0000003
1408 Ga0496117_0000339
1409 Ga0496118_0000001
1410 Ga0496118_0000241
1411 Ga0496119_0006204
1412 Ga0496119_0190165
1413 Ga0496120_0009654
1414 Ga0496120_0025940
1415 Ga0496120_0066814
1416 Ga0496121_0000338
1417 Ga0496121_0004853
1418 Ga0496121_0207228
1419 Ga0496122_0014665
1420 Ga0496125_0020171
1421 Ga0496125_0029988
1422 Ga0496125_0090141
1423 Ga0496125_0430899
1424 Ga0496126_0000551
1425 Ga0496126_0001408
1426 Ga0496126_0005413
1427 Ga0496126_0132182
1428 Ga0501323_007713
1429 Ga0501032_0003747
1430 Ga0501034_0010132
1431 Ga0501034_0357975
1432 Ga0501034_0408933
1433 Ga0501036_0020079
1434 Ga0501037_0003118
1435 Ga0501038_0013261
1436 Ga0501039_0004952
1437 Ga0501043_0000411
1438 Ga0501047_0051724
1439 Ga0501067_0169989
1440 Ga0501068_0196361
1441 Ga0501070_0000614
1442 Ga0501071_0055114
1443 Ga0501073_0041110
1444 Ga0501075_0223706
1445 Ga0501076_0571253
1446 Ga0501077_0169483
1447 Ga0501079_0287235
1448 Ga0501080_0404955
1449 Ga0501044_0132344
1450 nmdc:mga03683_63843_c1
1451 nmdc:mga03n38_13056_c2
1452 nmdc:mga03n38_22356_c1
1453 nmdc:mga03n38_286877_c1
1454 nmdc:mga03n38_3780_c1
1455 nmdc:mga03n38_38539_c1
1456 nmdc:mga03n38_821_c1
1457 nmdc:mga00v17_209296_c1
1458 nmdc:mga00v17_27231_c1
1459 nmdc:mga00v17_28138_c1
1460 nmdc:mga00v17_33451_c1
1461 nmdc:mga00v17_721_c1
1462 nmdc:mga0yw44_1318_c1
1463 nmdc:mga0yw44_240021_c1
1464 nmdc:mga0yw44_392639_c1
1465 nmdc:mga0yw44_41158_c1
1466 nmdc:mga0yw44_6798_c1
1467 nmdc:mga07m45_107212_c1
1468 nmdc:mga07m45_124658_c1
1469 nmdc:mga07m45_138721_c1
1470 nmdc:mga07m45_162330_c1
1471 nmdc:mga07m45_352395_c1
1472 nmdc:mga07m45_50346_c1
1473 nmdc:mga09592_280967_c1
1474 nmdc:mga0qj67_16695_c1
1475 nmdc:mga0qj67_194194_c1
1476 nmdc:mga0qj67_467975_c1
1477 nmdc:mga06r32_117_c5
1478 nmdc:mga06r32_17373_c2
1479 nmdc:mga08y16_43822_c1
1480 nmdc:mga08y16_559411_c1
1481 nmdc:mga0sz30_122136_c1
1482 nmdc:mga0sz30_377_c1
1483 nmdc:mga0sz30_642_c1
1484 nmdc:mga0sz30_77257_c1
1485 nmdc:mga0sz30_88991_c1
1486 Ga0500610_0008219
1487 Ga0500635_0000607
1488 Ga0500643_023377
1489 Ga0500643_035599
1490 Ga0500556_0003107
1491 Ga0500562_034019
1492 Ga0500572_065475
1493 Ga0500652_005412
1494 Ga0500652_009681
1495 Ga0500658_0159404
1496 Ga0500559_0002526
1497 Ga0500589_129723
1498 Ga0500616_0024990
1499 Ga0500616_0079747
1500 Ga0500620_101342
1501 Ga0500627_0028398
1502 Ga0500645_000668
1503 Ga0466962_0001545
1504 Ga0466962_0033283
1505 Ga0466962_0039089
1506 2523382799
1507 2548697863
1508 2552109519
1509 2558910906
1510 2559429635
1511 2566993084
1512 2583150443
1513 2586059312
1514 2644513017
1515 2738706084
1516 2739238719
1517 2739333016
1518 2739362202
1519 2744957122
1520 2753035251
1521 2753070750
1522 2753323768
1523 2791915385
1524 2795783479
1525 2809591930
1526 2816504643
1527 2863071070
1528 2866552670
1529 2866616852
1530 2870726680
1531 2870789101
1532 2889300992
1533 2891327591
1534 2899364137
1535 2899373305
1536 2902801619
1537 2904538922
1538 2915361595
1539 2915773338
1540 2917738936
1541 2919715962
1542 2922556780
1543 2939587262
1544 2939744511
1545 2956940445
1546 2974317259
1547 2984525464
1548 3001121870
1549 8003322504
1550 8047718035
1551 8054474295
1552 8056212007

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

52

252

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jof-assembly1.cif.gz_A-2 crystal structure of trmd from mycobacterium tuberculosis in complex with active-site inhibitor 0.9443 1 222
5zhj-assembly1.cif.gz_A-2 crystal structure of trmd from mycobacterium tuberculosis in complex with s-adenosyl homocysteine (sah) 0.9435 1 222
5zhi-assembly1.cif.gz_A apo crystal structure of trmd from mycobacterium tuberculosis 0.9419 1 222
6qr5-assembly1.cif.gz_B crystal structure of trmd, a trna-(n1g37) methyltransferase, from mycobacterium abscessus in complex with inhibitor 0.9401 1 224
6qqs-assembly1.cif.gz_B crystal structure of trmd, a trna-(n1g37) methyltransferase, from mycobacterium abscessus in complex with inhibitor 0.9396 1 224
ID Description Score Start End Superfamily
5zhkA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9958 175 223 1.10.1270.20
3quvB02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9925 174 224 1.10.1270.20
5zhlA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9925 175 223 1.10.1270.20
1uajA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9839 175 225 1.10.1270.20
4yq2A02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9813 174 224 1.10.1270.20
ID Description Score Start End GO Terms
AF-A0A2S9F6U5-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9984 1 103 GO:0002939
GO:0005829
GO:0052906
AF-A0A2S9F6U5-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9888 1 103 GO:0002939
GO:0005829
GO:0052906
AF-A0A810MMS7-F1-model_v4 deleted 0.9853 1 134
AF-A0A2W4J503-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9794 1 125 GO:0002939
GO:0005829
GO:0052906
AF-A0A7K1CTM7-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD (EC 2.1.1.228) 0.9764 1 171 GO:0002939
GO:0005829
GO:0052906

Map