F480306
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 776 | 360 | 1552 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10211036|Ga0105241_102110361 |
| Length | 278 |
| Sequence | LPFWRGVEPVVPVERRTGCWTWDEGQEGQVSVRVDVSTIFPAYLDALRQSLPGKAIDAGLVDLGVHDLRRWTHDVHRSVDDAPYGGGPGMVMRAPVWGEALDEICSEQTLLVVPTPAGRLFDQPTAARWTGEEHLVFACGRYEGIDQRVVDDAAARMPVEEVSIGDYVLVGGEAAVLVIVEAVARLLPGVLGNPDSAEQDSFSDGLLEGPAYTRPEVWRDRPVPAVLRSGNHAAIARWRRDRALERTAARRPELLAALPDGALDAADRAVLANRHDEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 116 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 172 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 173 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 174 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 175 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 176 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 191 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 192 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 202 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 203 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 208 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 209 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 210 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 211 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 212 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 213 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 214 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 218 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 219 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 220 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 247 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 248 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 249 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 250 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 251 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 252 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 255 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 258 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 259 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 260 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 261 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 262 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 263 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 264 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 265 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 266 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 267 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 290 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 291 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 292 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 293 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 300 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 301 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 302 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 303 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 304 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 305 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 306 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 308 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 309 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 310 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 311 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 313 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 314 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 315 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 316 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 317 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 318 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 319 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 320 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 321 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 322 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 323 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 324 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 325 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 326 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 327 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 328 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 329 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 330 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 331 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 332 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 333 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 334 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 335 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 336 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 337 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 338 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 339 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 340 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 341 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 342 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 343 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 344 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 345 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 346 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 347 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 348 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 349 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 350 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 351 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 352 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 353 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 354 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 355 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 356 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 357 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 358 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 359 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 360 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.81 |
| Metatranscriptomes | 0.13 |
| Isolates | 6.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.13 |
| Bulb | 0 |
| Endosphere | 10.44 |
| Nodule | 0 |
| Rhizoplane | 9.15 |
| Rhizosphere | 70.1 |
| Stem | 0 |
| Stem Tuber | 0.13 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105241_10211036 | 3300009174 | Bacteria | 1627 |
| 2 | CNXas_1000536 | 3300000545 | Bacteria | 2548 |
| 3 | JGI24746J21847_1004021 | 3300001977 | Bacteria | 2324 |
| 4 | JGI24735J21928_10023223 | 3300002067 | Bacteria | 1882 |
| 5 | JGI24750J21931_1016477 | 3300002070 | Bacteria | 1003 |
| 6 | JGI24745J21846_1001114 | 3300002073 | Bacteria | 2545 |
| 7 | JGI24745J21846_1004008 | 3300002073 | Bacteria | 1562 |
| 8 | JGI24744J21845_10006632 | 3300002077 | Bacteria | 2399 |
| 9 | JGI24034J26672_10005404 | 3300002239 | Bacteria | 1831 |
| 10 | JGI24742J22300_10003132 | 3300002244 | Bacteria | 2675 |
| 11 | JGI24751J29686_10005463 | 3300002459 | Bacteria | 2587 |
| 12 | JGI25406J46586_10000557 | 3300003203 | Bacteria | 17606 |
| 13 | Ga0055540_1002431 | 3300003792 | Bacteria | 9835 |
| 14 | Ga0055540_1005569 | 3300003792 | Bacteria | 5253 |
| 15 | Ga0055540_1009773 | 3300003792 | Bacteria | 3270 |
| 16 | Ga0070658_10308331 | 3300005327 | Bacteria | 1350 |
| 17 | Ga0070676_10041597 | 3300005328 | Bacteria | 2665 |
| 18 | Ga0070676_10080723 | 3300005328 | Bacteria | 1972 |
| 19 | Ga0070683_100123341 | 3300005329 | Bacteria | 2448 |
| 20 | Ga0070683_100147531 | 3300005329 | Bacteria | 2230 |
| 21 | Ga0070690_100004656 | 3300005330 | Bacteria | 7640 |
| 22 | Ga0068869_100035072 | 3300005334 | Bacteria | 3554 |
| 23 | Ga0068869_100077846 | 3300005334 | Bacteria | 2468 |
| 24 | Ga0070666_10173181 | 3300005335 | Bacteria | 1512 |
| 25 | Ga0070682_100033809 | 3300005337 | Bacteria | 3109 |
| 26 | Ga0070682_100319447 | 3300005337 | Bacteria | 1146 |
| 27 | Ga0068868_100033397 | 3300005338 | Bacteria | 3965 |
| 28 | Ga0068868_100065385 | 3300005338 | Bacteria | 2889 |
| 29 | Ga0068868_100208636 | 3300005338 | Bacteria | 1632 |
| 30 | Ga0070689_100028370 | 3300005340 | Bacteria | 4230 |
| 31 | Ga0070689_100062364 | 3300005340 | Bacteria | 2901 |
| 32 | Ga0070689_100122073 | 3300005340 | Bacteria | 2082 |
| 33 | Ga0070661_100584590 | 3300005344 | Bacteria | 901 |
| 34 | Ga0070668_100000449 | 3300005347 | Bacteria | 27220 |
| 35 | Ga0070668_100059966 | 3300005347 | Bacteria | 2946 |
| 36 | Ga0070668_100107435 | 3300005347 | Bacteria | 2218 |
| 37 | Ga0070668_100440497 | 3300005347 | Bacteria | 1118 |
| 38 | Ga0070669_100028340 | 3300005353 | Bacteria | 4033 |
| 39 | Ga0070669_100312037 | 3300005353 | Bacteria | 1268 |
| 40 | Ga0070669_100607627 | 3300005353 | Bacteria | 917 |
| 41 | Ga0070675_100207422 | 3300005354 | Bacteria | 1702 |
| 42 | Ga0070671_100002308 | 3300005355 | Bacteria | 14722 |
| 43 | Ga0070671_100005597 | 3300005355 | Bacteria | 10004 |
| 44 | Ga0070671_100096819 | 3300005355 | Bacteria | 2475 |
| 45 | Ga0070674_100041361 | 3300005356 | Bacteria | 3123 |
| 46 | Ga0070674_100075059 | 3300005356 | Bacteria | 2400 |
| 47 | Ga0070688_100073075 | 3300005365 | Bacteria | 2199 |
| 48 | Ga0070688_100179536 | 3300005365 | Bacteria | 1467 |
| 49 | Ga0070659_100036934 | 3300005366 | Bacteria | 3808 |
| 50 | Ga0070659_100495173 | 3300005366 | Bacteria | 1041 |
| 51 | Ga0070667_100016599 | 3300005367 | Bacteria | 6093 |
| 52 | Ga0070667_100019725 | 3300005367 | Bacteria | 5593 |
| 53 | Ga0070667_100036663 | 3300005367 | Bacteria | 4112 |
| 54 | Ga0070667_100180096 | 3300005367 | Bacteria | 1869 |
| 55 | Ga0070709_10014526 | 3300005434 | Bacteria | 4454 |
| 56 | Ga0070714_100009393 | 3300005435 | Bacteria | 7687 |
| 57 | Ga0070714_100195712 | 3300005435 | Bacteria | 1847 |
| 58 | Ga0070713_100033202 | 3300005436 | Bacteria | 4131 |
| 59 | Ga0070713_100064828 | 3300005436 | Bacteria | 3067 |
| 60 | Ga0070710_10000364 | 3300005437 | Bacteria | 21235 |
| 61 | Ga0070710_10000468 | 3300005437 | Bacteria | 18998 |
| 62 | Ga0070710_10010481 | 3300005437 | Bacteria | 4554 |
| 63 | Ga0070711_100002851 | 3300005439 | Bacteria | 9944 |
| 64 | Ga0070711_100006539 | 3300005439 | Bacteria | 7029 |
| 65 | Ga0070705_100103279 | 3300005440 | Bacteria | 1804 |
| 66 | Ga0070705_100217623 | 3300005440 | Bacteria | 1320 |
| 67 | Ga0070700_100002039 | 3300005441 | Bacteria | 10272 |
| 68 | Ga0070700_100282794 | 3300005441 | Bacteria | 1203 |
| 69 | Ga0070694_100063135 | 3300005444 | Bacteria | 2532 |
| 70 | Ga0070663_100002335 | 3300005455 | Bacteria | 10658 |
| 71 | Ga0070663_100005380 | 3300005455 | Bacteria | 7604 |
| 72 | Ga0070663_100020149 | 3300005455 | Bacteria | 4412 |
| 73 | Ga0070663_100080988 | 3300005455 | Bacteria | 2386 |
| 74 | Ga0070663_100392682 | 3300005455 | Bacteria | 1132 |
| 75 | Ga0070663_100595055 | 3300005455 | Bacteria | 929 |
| 76 | Ga0070678_100042939 | 3300005456 | Bacteria | 3217 |
| 77 | Ga0070678_100063119 | 3300005456 | Bacteria | 2739 |
| 78 | Ga0070678_100114047 | 3300005456 | Bacteria | 2119 |
| 79 | Ga0070662_100151909 | 3300005457 | Bacteria | 1804 |
| 80 | Ga0068867_100003379 | 3300005459 | Bacteria | 11233 |
| 81 | Ga0068867_100066793 | 3300005459 | Bacteria | 2679 |
| 82 | Ga0068867_100242322 | 3300005459 | Bacteria | 1463 |
| 83 | Ga0070685_10057572 | 3300005466 | Bacteria | 2263 |
| 84 | Ga0070684_100307871 | 3300005535 | Bacteria | 1454 |
| 85 | Ga0068853_100035399 | 3300005539 | Bacteria | 4241 |
| 86 | Ga0068853_100060121 | 3300005539 | Bacteria | 3282 |
| 87 | Ga0068853_100139386 | 3300005539 | Bacteria | 2176 |
| 88 | Ga0070672_100087530 | 3300005543 | Bacteria | 2507 |
| 89 | Ga0070672_100112923 | 3300005543 | Bacteria | 2217 |
| 90 | Ga0070686_100076990 | 3300005544 | Bacteria | 2198 |
| 91 | Ga0070695_100182829 | 3300005545 | Bacteria | 1487 |
| 92 | Ga0070696_100003196 | 3300005546 | Bacteria | 10910 |
| 93 | Ga0070696_100015832 | 3300005546 | Bacteria | 5070 |
| 94 | Ga0070693_100031943 | 3300005547 | Bacteria | 2891 |
| 95 | Ga0070693_100054076 | 3300005547 | Bacteria | 2307 |
| 96 | Ga0070693_100226567 | 3300005547 | Bacteria | 1228 |
| 97 | Ga0070665_100001944 | 3300005548 | Bacteria | 23298 |
| 98 | Ga0070665_100010428 | 3300005548 | Bacteria | 9403 |
| 99 | Ga0070665_100062380 | 3300005548 | Bacteria | 3737 |
| 100 | Ga0070665_100120159 | 3300005548 | Bacteria | 2629 |
| 101 | Ga0070704_100006793 | 3300005549 | Bacteria | 6776 |
| 102 | Ga0070704_100087587 | 3300005549 | Bacteria | 2311 |
| 103 | Ga0068855_100112475 | 3300005563 | Bacteria | 3125 |
| 104 | Ga0068855_100119110 | 3300005563 | Bacteria | 3023 |
| 105 | Ga0070664_100215535 | 3300005564 | Bacteria | 1716 |
| 106 | Ga0070664_100375057 | 3300005564 | Bacteria | 1298 |
| 107 | Ga0070664_100598656 | 3300005564 | Bacteria | 1022 |
| 108 | Ga0068857_100698424 | 3300005577 | Bacteria | 964 |
| 109 | Ga0068854_100074267 | 3300005578 | Bacteria | 2494 |
| 110 | Ga0068854_100091265 | 3300005578 | Bacteria | 2266 |
| 111 | Ga0068854_100117114 | 3300005578 | Bacteria | 2017 |
| 112 | Ga0068854_100277929 | 3300005578 | Bacteria | 1347 |
| 113 | Ga0068854_100383703 | 3300005578 | Bacteria | 1158 |
| 114 | Ga0068854_100598498 | 3300005578 | Bacteria | 941 |
| 115 | Ga0068856_100518728 | 3300005614 | Bacteria | 1213 |
| 116 | Ga0068856_100661005 | 3300005614 | Bacteria | 1066 |
| 117 | Ga0070702_100034338 | 3300005615 | Bacteria | 2795 |
| 118 | Ga0070702_100057911 | 3300005615 | Bacteria | 2242 |
| 119 | Ga0068852_100058603 | 3300005616 | Bacteria | 3337 |
| 120 | Ga0068852_100095343 | 3300005616 | Bacteria | 2672 |
| 121 | Ga0068859_100042229 | 3300005617 | Bacteria | 4580 |
| 122 | Ga0068859_100166645 | 3300005617 | Bacteria | 2283 |
| 123 | Ga0068859_100268433 | 3300005617 | Bacteria | 1798 |
| 124 | Ga0068859_100322249 | 3300005617 | Bacteria | 1639 |
| 125 | Ga0068859_100463888 | 3300005617 | Bacteria | 1362 |
| 126 | Ga0068864_100366505 | 3300005618 | Bacteria | 1362 |
| 127 | Ga0068866_10000223 | 3300005718 | Bacteria | 26905 |
| 128 | Ga0068866_10009759 | 3300005718 | Bacteria | 4088 |
| 129 | Ga0068861_100000566 | 3300005719 | Bacteria | 21970 |
| 130 | Ga0068870_10068146 | 3300005840 | Bacteria | 1932 |
| 131 | Ga0068870_10297777 | 3300005840 | Bacteria | 1017 |
| 132 | Ga0068863_100014660 | 3300005841 | Bacteria | 7545 |
| 133 | Ga0068863_100048888 | 3300005841 | Bacteria | 4010 |
| 134 | Ga0068858_100000340 | 3300005842 | Bacteria | 49532 |
| 135 | Ga0068858_100044837 | 3300005842 | Bacteria | 4098 |
| 136 | Ga0068858_100281567 | 3300005842 | Bacteria | 1583 |
| 137 | Ga0068860_100014701 | 3300005843 | Bacteria | 7656 |
| 138 | Ga0068862_100035998 | 3300005844 | Bacteria | 4193 |
| 139 | Ga0068862_100170978 | 3300005844 | Bacteria | 1945 |
| 140 | Ga0068862_100323844 | 3300005844 | Bacteria | 1423 |
| 141 | Ga0081455_10000011 | 3300005937 | Bacteria | 203132 |
| 142 | Ga0081455_10015862 | 3300005937 | Bacteria | 7295 |
| 143 | Ga0081455_10074855 | 3300005937 | Bacteria | 2795 |
| 144 | Ga0081539_10000680 | 3300005985 | Bacteria | 68157 |
| 145 | Ga0070717_10131172 | 3300006028 | Bacteria | 2155 |
| 146 | Ga0070717_10245861 | 3300006028 | Bacteria | 1579 |
| 147 | Ga0075365_10044901 | 3300006038 | Bacteria | 2897 |
| 148 | Ga0075365_10464728 | 3300006038 | Bacteria | 894 |
| 149 | Ga0075363_100003786 | 3300006048 | Bacteria | 6520 |
| 150 | Ga0075363_100023765 | 3300006048 | Bacteria | 3111 |
| 151 | Ga0075363_100029456 | 3300006048 | Bacteria | 2834 |
| 152 | Ga0075363_100032237 | 3300006048 | Bacteria | 2720 |
| 153 | Ga0075363_100048365 | 3300006048 | Bacteria | 2261 |
| 154 | Ga0075363_100076645 | 3300006048 | Bacteria | 1823 |
| 155 | Ga0075364_10000301 | 3300006051 | Bacteria | 24078 |
| 156 | Ga0075364_10023127 | 3300006051 | Bacteria | 3932 |
| 157 | Ga0075364_10025162 | 3300006051 | Bacteria | 3787 |
| 158 | Ga0075364_10034918 | 3300006051 | Bacteria | 3247 |
| 159 | Ga0075364_10055801 | 3300006051 | Bacteria | 2585 |
| 160 | Ga0075364_10094611 | 3300006051 | Bacteria | 1985 |
| 161 | Ga0070715_10037612 | 3300006163 | Bacteria | 2004 |
| 162 | Ga0070715_10058405 | 3300006163 | Bacteria | 1684 |
| 163 | Ga0070716_100061059 | 3300006173 | Bacteria | 2180 |
| 164 | Ga0070716_100064518 | 3300006173 | Bacteria | 2130 |
| 165 | Ga0070712_100023175 | 3300006175 | Bacteria | 4097 |
| 166 | Ga0070712_100305496 | 3300006175 | Bacteria | 1289 |
| 167 | Ga0075362_10073010 | 3300006177 | Bacteria | 1570 |
| 168 | Ga0075369_10001858 | 3300006186 | Bacteria | 7371 |
| 169 | Ga0075369_10003549 | 3300006186 | Bacteria | 5681 |
| 170 | Ga0075369_10017703 | 3300006186 | Bacteria | 2893 |
| 171 | Ga0075369_10018933 | 3300006186 | Bacteria | 2808 |
| 172 | Ga0075369_10032296 | 3300006186 | Bacteria | 2214 |
| 173 | Ga0075369_10088538 | 3300006186 | Bacteria | 1379 |
| 174 | Ga0075369_10093603 | 3300006186 | Bacteria | 1343 |
| 175 | Ga0075369_10108956 | 3300006186 | Bacteria | 1247 |
| 176 | Ga0075369_10154566 | 3300006186 | Bacteria | 1050 |
| 177 | Ga0075369_10182403 | 3300006186 | Bacteria | 966 |
| 178 | Ga0097621_100098979 | 3300006237 | Bacteria | 2450 |
| 179 | Ga0097621_100284549 | 3300006237 | Bacteria | 1456 |
| 180 | Ga0097621_100365570 | 3300006237 | Bacteria | 1286 |
| 181 | Ga0075370_10001488 | 3300006353 | Bacteria | 10203 |
| 182 | Ga0075370_10099283 | 3300006353 | Bacteria | 1684 |
| 183 | Ga0075370_10107238 | 3300006353 | Bacteria | 1620 |
| 184 | Ga0075370_10163736 | 3300006353 | Bacteria | 1306 |
| 185 | Ga0075370_10249562 | 3300006353 | Bacteria | 1052 |
| 186 | Ga0068871_100305608 | 3300006358 | Bacteria | 1397 |
| 187 | Ga0075428_100001695 | 3300006844 | Bacteria | 23510 |
| 188 | Ga0075430_100029765 | 3300006846 | Bacteria | 4635 |
| 189 | Ga0075430_100286610 | 3300006846 | Bacteria | 1362 |
| 190 | Ga0075430_100490123 | 3300006846 | Bacteria | 1014 |
| 191 | Ga0075431_100056933 | 3300006847 | Bacteria | 4032 |
| 192 | Ga0075429_100289645 | 3300006880 | Bacteria | 1434 |
| 193 | Ga0097620_100042230 | 3300006931 | Bacteria | 4580 |
| 194 | Ga0097620_100166642 | 3300006931 | Bacteria | 2283 |
| 195 | Ga0097620_100268422 | 3300006931 | Bacteria | 1798 |
| 196 | Ga0097620_100322256 | 3300006931 | Bacteria | 1639 |
| 197 | Ga0097620_100463885 | 3300006931 | Bacteria | 1362 |
| 198 | Ga0105250_10008866 | 3300009092 | Bacteria | 4257 |
| 199 | Ga0105240_10342809 | 3300009093 | Bacteria | 1697 |
| 200 | Ga0111539_10058897 | 3300009094 | Bacteria | 4556 |
| 201 | Ga0111539_10327525 | 3300009094 | Bacteria | 1783 |
| 202 | Ga0111539_10503063 | 3300009094 | Bacteria | 1411 |
| 203 | Ga0105245_10017295 | 3300009098 | Bacteria | 6291 |
| 204 | Ga0105245_10160233 | 3300009098 | Bacteria | 2135 |
| 205 | Ga0105245_10212999 | 3300009098 | Bacteria | 1861 |
| 206 | Ga0105247_10034066 | 3300009101 | Bacteria | 3102 |
| 207 | Ga0105247_10142010 | 3300009101 | Bacteria | 1574 |
| 208 | Ga0105243_10000749 | 3300009148 | Bacteria | 31120 |
| 209 | Ga0105243_10008122 | 3300009148 | Bacteria | 8057 |
| 210 | Ga0105243_10093391 | 3300009148 | Bacteria | 2483 |
| 211 | Ga0105241_10065259 | 3300009174 | Bacteria | 2813 |
| 212 | Ga0105241_10227533 | 3300009174 | Bacteria | 1571 |
| 213 | Ga0105242_10082815 | 3300009176 | Bacteria | 2686 |
| 214 | Ga0105242_10159894 | 3300009176 | Bacteria | 1971 |
| 215 | Ga0105242_10250278 | 3300009176 | Bacteria | 1596 |
| 216 | Ga0105242_10429682 | 3300009176 | Bacteria | 1240 |
| 217 | Ga0105248_10001981 | 3300009177 | Bacteria | 22755 |
| 218 | Ga0105248_10073208 | 3300009177 | Bacteria | 3850 |
| 219 | Ga0105248_10207833 | 3300009177 | Bacteria | 2206 |
| 220 | Ga0105237_10001244 | 3300009545 | Bacteria | 33989 |
| 221 | Ga0105237_10084464 | 3300009545 | Bacteria | 3165 |
| 222 | Ga0105237_10106964 | 3300009545 | Bacteria | 2789 |
| 223 | Ga0105237_10190690 | 3300009545 | Bacteria | 2050 |
| 224 | Ga0105237_10844646 | 3300009545 | Bacteria | 922 |
| 225 | Ga0105238_10166291 | 3300009551 | Bacteria | 2181 |
| 226 | Ga0105238_10190217 | 3300009551 | Bacteria | 2029 |
| 227 | Ga0105238_10373725 | 3300009551 | Bacteria | 1416 |
| 228 | Ga0105249_10007116 | 3300009553 | Bacteria | 9767 |
| 229 | Ga0105249_10087761 | 3300009553 | Bacteria | 2903 |
| 230 | Ga0105249_11022543 | 3300009553 | Bacteria | 895 |
| 231 | Ga0105239_10027785 | 3300010375 | Bacteria | 6225 |
| 232 | Ga0105239_10181177 | 3300010375 | Bacteria | 2357 |
| 233 | Ga0105239_10749887 | 3300010375 | Bacteria | 1117 |
| 234 | Ga0105239_11156193 | 3300010375 | Bacteria | 891 |
| 235 | Ga0105246_10048993 | 3300011119 | Bacteria | 2891 |
| 236 | Ga0105246_10234856 | 3300011119 | Bacteria | 1446 |
| 237 | Ga0105246_10728266 | 3300011119 | Bacteria | 872 |
| 238 | Ga0157369_10143259 | 3300013105 | Bacteria | 2528 |
| 239 | Ga0157369_10331122 | 3300013105 | Bacteria | 1582 |
| 240 | Ga0157374_10095524 | 3300013296 | Bacteria | 2842 |
| 241 | Ga0157378_10013565 | 3300013297 | Bacteria | 7129 |
| 242 | Ga0157378_10162000 | 3300013297 | Bacteria | 2092 |
| 243 | Ga0163162_10017533 | 3300013306 | Bacteria | 7006 |
| 244 | Ga0163162_10144715 | 3300013306 | Bacteria | 2492 |
| 245 | Ga0163162_10146816 | 3300013306 | Bacteria | 2475 |
| 246 | Ga0163162_10998409 | 3300013306 | Bacteria | 946 |
| 247 | Ga0157372_10004262 | 3300013307 | Bacteria | 15291 |
| 248 | Ga0157372_10068538 | 3300013307 | Bacteria | 3989 |
| 249 | Ga0157372_10720054 | 3300013307 | Bacteria | 1161 |
| 250 | Ga0157375_10012997 | 3300013308 | Bacteria | 7396 |
| 251 | Ga0157375_10195655 | 3300013308 | Bacteria | 2177 |
| 252 | Ga0157375_10315824 | 3300013308 | Bacteria | 1727 |
| 253 | Ga0157375_11284474 | 3300013308 | Bacteria | 860 |
| 254 | Ga0163163_10028842 | 3300014325 | Bacteria | 5334 |
| 255 | Ga0163163_10485283 | 3300014325 | Bacteria | 1297 |
| 256 | Ga0157380_10028021 | 3300014326 | Bacteria | 4291 |
| 257 | Ga0157380_10651699 | 3300014326 | Bacteria | 1050 |
| 258 | Ga0157377_10019339 | 3300014745 | Bacteria | 3557 |
| 259 | Ga0157379_10025793 | 3300014968 | Bacteria | 5225 |
| 260 | Ga0157379_10041285 | 3300014968 | Bacteria | 4119 |
| 261 | Ga0157379_10194244 | 3300014968 | Bacteria | 1834 |
| 262 | Ga0157376_10296353 | 3300014969 | Bacteria | 1529 |
| 263 | Ga0163161_10002626 | 3300017792 | Bacteria | 12794 |
| 264 | Ga0163161_10119025 | 3300017792 | Bacteria | 1983 |
| 265 | Ga0213873_10000144 | 3300021358 | Bacteria | 13528 |
| 266 | Ga0213876_10088490 | 3300021384 | Bacteria | 1640 |
| 267 | Ga0213875_10002351 | 3300021388 | Bacteria | 11419 |
| 268 | Ga0213875_10005039 | 3300021388 | Bacteria | 7156 |
| 269 | Ga0213875_10010251 | 3300021388 | Bacteria | 4701 |
| 270 | Ga0209051_1002711 | 3300025303 | Bacteria | 12317 |
| 271 | Ga0209051_1003201 | 3300025303 | Bacteria | 10927 |
| 272 | Ga0209051_1008910 | 3300025303 | Bacteria | 5242 |
| 273 | Ga0207692_10028384 | 3300025898 | Bacteria | 2646 |
| 274 | Ga0207692_10054993 | 3300025898 | Bacteria | 2035 |
| 275 | Ga0207642_10005556 | 3300025899 | Bacteria | 4123 |
| 276 | Ga0207642_10224600 | 3300025899 | Bacteria | 1051 |
| 277 | Ga0207710_10182685 | 3300025900 | Bacteria | 1030 |
| 278 | Ga0207688_10004235 | 3300025901 | Bacteria | 7820 |
| 279 | Ga0207688_10027373 | 3300025901 | Bacteria | 3136 |
| 280 | Ga0207688_10037263 | 3300025901 | Bacteria | 2696 |
| 281 | Ga0207688_10119972 | 3300025901 | Bacteria | 1534 |
| 282 | Ga0207680_10151079 | 3300025903 | Bacteria | 1548 |
| 283 | Ga0207647_10081601 | 3300025904 | Bacteria | 1938 |
| 284 | Ga0207685_10003898 | 3300025905 | Bacteria | 3702 |
| 285 | Ga0207645_10044272 | 3300025907 | Bacteria | 2849 |
| 286 | Ga0207643_10018147 | 3300025908 | Bacteria | 3854 |
| 287 | Ga0207643_10023514 | 3300025908 | Bacteria | 3397 |
| 288 | Ga0207654_10078235 | 3300025911 | Bacteria | 1984 |
| 289 | Ga0207671_10020624 | 3300025914 | Bacteria | 5013 |
| 290 | Ga0207671_10050415 | 3300025914 | Bacteria | 3082 |
| 291 | Ga0207693_10000292 | 3300025915 | Bacteria | 46487 |
| 292 | Ga0207693_10007534 | 3300025915 | Bacteria | 8942 |
| 293 | Ga0207693_10203637 | 3300025915 | Bacteria | 1556 |
| 294 | Ga0207663_10027939 | 3300025916 | Bacteria | 3295 |
| 295 | Ga0207663_10089161 | 3300025916 | Bacteria | 2042 |
| 296 | Ga0207662_10101704 | 3300025918 | Bacteria | 1781 |
| 297 | Ga0207657_10031065 | 3300025919 | Bacteria | 4842 |
| 298 | Ga0207649_10270877 | 3300025920 | Bacteria | 1231 |
| 299 | Ga0207681_10099859 | 3300025923 | Bacteria | 2091 |
| 300 | Ga0207694_10117129 | 3300025924 | Bacteria | 2124 |
| 301 | Ga0207694_10156351 | 3300025924 | Bacteria | 1839 |
| 302 | Ga0207694_10243532 | 3300025924 | Bacteria | 1470 |
| 303 | Ga0207694_10450338 | 3300025924 | Bacteria | 1074 |
| 304 | Ga0207687_10026753 | 3300025927 | Bacteria | 3865 |
| 305 | Ga0207687_10114586 | 3300025927 | Bacteria | 2007 |
| 306 | Ga0207687_10215503 | 3300025927 | Bacteria | 1508 |
| 307 | Ga0207687_10298606 | 3300025927 | Bacteria | 1297 |
| 308 | Ga0207700_10146347 | 3300025928 | Bacteria | 1947 |
| 309 | Ga0207664_10008573 | 3300025929 | Bacteria | 7142 |
| 310 | Ga0207664_10293728 | 3300025929 | Bacteria | 1429 |
| 311 | Ga0207644_10003294 | 3300025931 | Bacteria | 10437 |
| 312 | Ga0207706_10018893 | 3300025933 | Bacteria | 6199 |
| 313 | Ga0207706_10103808 | 3300025933 | Bacteria | 2501 |
| 314 | Ga0207706_10533736 | 3300025933 | Bacteria | 1011 |
| 315 | Ga0207686_10015437 | 3300025934 | Bacteria | 4270 |
| 316 | Ga0207709_10003971 | 3300025935 | Bacteria | 8628 |
| 317 | Ga0207709_10061384 | 3300025935 | Bacteria | 2349 |
| 318 | Ga0207670_10083226 | 3300025936 | Bacteria | 2244 |
| 319 | Ga0207670_10172894 | 3300025936 | Bacteria | 1621 |
| 320 | Ga0207670_10181647 | 3300025936 | Bacteria | 1585 |
| 321 | Ga0207669_10048549 | 3300025937 | Bacteria | 2522 |
| 322 | Ga0207669_10223818 | 3300025937 | Bacteria | 1383 |
| 323 | Ga0207704_10046986 | 3300025938 | Bacteria | 2577 |
| 324 | Ga0207704_10132461 | 3300025938 | Bacteria | 1729 |
| 325 | Ga0207704_10209793 | 3300025938 | Bacteria | 1432 |
| 326 | Ga0207704_10258197 | 3300025938 | Bacteria | 1312 |
| 327 | Ga0207665_10019007 | 3300025939 | Bacteria | 4514 |
| 328 | Ga0207665_10051332 | 3300025939 | Bacteria | 2775 |
| 329 | Ga0207665_10100463 | 3300025939 | Bacteria | 2019 |
| 330 | Ga0207691_10109842 | 3300025940 | Bacteria | 2453 |
| 331 | Ga0207691_10111791 | 3300025940 | Bacteria | 2429 |
| 332 | Ga0207691_10112815 | 3300025940 | Bacteria | 2416 |
| 333 | Ga0207711_10043412 | 3300025941 | Bacteria | 3835 |
| 334 | Ga0207711_10228878 | 3300025941 | Bacteria | 1702 |
| 335 | Ga0207689_10009983 | 3300025942 | Bacteria | 8185 |
| 336 | Ga0207689_10015374 | 3300025942 | Bacteria | 6478 |
| 337 | Ga0207689_10060615 | 3300025942 | Bacteria | 3111 |
| 338 | Ga0207689_10258938 | 3300025942 | Bacteria | 1439 |
| 339 | Ga0207689_10433187 | 3300025942 | Bacteria | 1098 |
| 340 | Ga0207661_10130627 | 3300025944 | Bacteria | 2151 |
| 341 | Ga0207661_10314112 | 3300025944 | Bacteria | 1407 |
| 342 | Ga0207661_10325267 | 3300025944 | Bacteria | 1383 |
| 343 | Ga0207679_10130883 | 3300025945 | Bacteria | 2013 |
| 344 | Ga0207651_10434446 | 3300025960 | Bacteria | 1123 |
| 345 | Ga0207651_10513830 | 3300025960 | Bacteria | 1037 |
| 346 | Ga0207712_10069390 | 3300025961 | Bacteria | 2529 |
| 347 | Ga0207712_10891243 | 3300025961 | Bacteria | 786 |
| 348 | Ga0207668_10000521 | 3300025972 | Bacteria | 24086 |
| 349 | Ga0207668_10030372 | 3300025972 | Bacteria | 3551 |
| 350 | Ga0207668_10030679 | 3300025972 | Bacteria | 3534 |
| 351 | Ga0207640_10028647 | 3300025981 | Bacteria | 3407 |
| 352 | Ga0207640_10121031 | 3300025981 | Bacteria | 1875 |
| 353 | Ga0207640_10180786 | 3300025981 | Bacteria | 1581 |
| 354 | Ga0207640_10244464 | 3300025981 | Bacteria | 1389 |
| 355 | Ga0207658_10010530 | 3300025986 | Bacteria | 6283 |
| 356 | Ga0207658_10119701 | 3300025986 | Bacteria | 2097 |
| 357 | Ga0207658_10140555 | 3300025986 | Bacteria | 1953 |
| 358 | Ga0207677_10012418 | 3300026023 | Bacteria | 4896 |
| 359 | Ga0207677_10018253 | 3300026023 | Bacteria | 4206 |
| 360 | Ga0207677_10093410 | 3300026023 | Bacteria | 2193 |
| 361 | Ga0207639_10026057 | 3300026041 | Bacteria | 4246 |
| 362 | Ga0207639_11086141 | 3300026041 | Bacteria | 750 |
| 363 | Ga0207678_10000168 | 3300026067 | Bacteria | 55114 |
| 364 | Ga0207678_10022948 | 3300026067 | Bacteria | 5460 |
| 365 | Ga0207678_10024700 | 3300026067 | Bacteria | 5247 |
| 366 | Ga0207678_10054163 | 3300026067 | Bacteria | 3455 |
| 367 | Ga0207678_10064377 | 3300026067 | Bacteria | 3150 |
| 368 | Ga0207678_10117554 | 3300026067 | Bacteria | 2269 |
| 369 | Ga0207678_10247801 | 3300026067 | Bacteria | 1526 |
| 370 | Ga0207708_10003716 | 3300026075 | Bacteria | 11270 |
| 371 | Ga0207708_10005971 | 3300026075 | Bacteria | 9018 |
| 372 | Ga0207708_10007355 | 3300026075 | Bacteria | 8136 |
| 373 | Ga0207708_10018785 | 3300026075 | Bacteria | 5207 |
| 374 | Ga0207708_10363859 | 3300026075 | Bacteria | 1189 |
| 375 | Ga0207641_10001754 | 3300026088 | Bacteria | 20888 |
| 376 | Ga0207641_10003490 | 3300026088 | Bacteria | 13924 |
| 377 | Ga0207648_10000187 | 3300026089 | Bacteria | 65094 |
| 378 | Ga0207648_10071311 | 3300026089 | Bacteria | 3027 |
| 379 | Ga0207648_10145768 | 3300026089 | Bacteria | 2088 |
| 380 | Ga0207648_10320131 | 3300026089 | Bacteria | 1394 |
| 381 | Ga0207676_10164493 | 3300026095 | Bacteria | 1926 |
| 382 | Ga0207676_10349199 | 3300026095 | Bacteria | 1367 |
| 383 | Ga0207674_10261755 | 3300026116 | Bacteria | 1677 |
| 384 | Ga0207675_100000390 | 3300026118 | Bacteria | 42092 |
| 385 | Ga0207675_100008670 | 3300026118 | Bacteria | 9559 |
| 386 | Ga0207675_100029830 | 3300026118 | Bacteria | 5078 |
| 387 | Ga0207675_100097498 | 3300026118 | Bacteria | 2768 |
| 388 | Ga0207675_100654724 | 3300026118 | Bacteria | 1057 |
| 389 | Ga0207683_10000197 | 3300026121 | Bacteria | 52074 |
| 390 | Ga0207683_10087037 | 3300026121 | Bacteria | 2778 |
| 391 | Ga0207683_10291408 | 3300026121 | Bacteria | 1492 |
| 392 | Ga0207683_10326918 | 3300026121 | Bacteria | 1405 |
| 393 | Ga0207683_10412062 | 3300026121 | Bacteria | 1244 |
| 394 | Ga0207698_10284204 | 3300026142 | Bacteria | 1532 |
| 395 | Ga0207698_10442513 | 3300026142 | Bacteria | 1252 |
| 396 | Ga0207698_10780698 | 3300026142 | Bacteria | 956 |
| 397 | Ga0207428_10205272 | 3300027907 | Bacteria | 1482 |
| 398 | Ga0207428_10379220 | 3300027907 | Bacteria | 1037 |
| 399 | Ga0268266_10026545 | 3300028379 | Bacteria | 4928 |
| 400 | Ga0268266_10361866 | 3300028379 | Bacteria | 1365 |
| 401 | Ga0268265_10045976 | 3300028380 | Bacteria | 3261 |
| 402 | Ga0268265_10060154 | 3300028380 | Bacteria | 2910 |
| 403 | Ga0268264_10004226 | 3300028381 | Bacteria | 12258 |
| 404 | Ga0307511_10000158 | 3300030521 | Bacteria | 65261 |
| 405 | Ga0307511_10072092 | 3300030521 | Bacteria | 2512 |
| 406 | Ga0307512_10045645 | 3300030522 | Bacteria | 3583 |
| 407 | Ga0316177_1183914 | 3300030731 | Bacteria | 1641 |
| 408 | Ga0314311_1066462 | 3300030733 | Bacteria | 2232 |
| 409 | Ga0316180_1112152 | 3300030736 | Bacteria | 1431 |
| 410 | Ga0265320_10124250 | 3300031240 | Bacteria | 1175 |
| 411 | Ga0265327_10024751 | 3300031251 | Bacteria | 3516 |
| 412 | Ga0307513_10007005 | 3300031456 | Bacteria | 14667 |
| 413 | Ga0307513_10018515 | 3300031456 | Bacteria | 8317 |
| 414 | Ga0307513_10035387 | 3300031456 | Bacteria | 5587 |
| 415 | Ga0307509_10107461 | 3300031507 | Bacteria | 2806 |
| 416 | Ga0307413_10001285 | 3300031824 | Bacteria | 9353 |
| 417 | Ga0307413_10026643 | 3300031824 | Bacteria | 3189 |
| 418 | Ga0307413_10316748 | 3300031824 | Bacteria | 1190 |
| 419 | Ga0307518_10000495 | 3300031838 | Bacteria | 30033 |
| 420 | Ga0307518_10012772 | 3300031838 | Bacteria | 5996 |
| 421 | Ga0307410_10130379 | 3300031852 | Bacteria | 1846 |
| 422 | Ga0307410_10428778 | 3300031852 | Bacteria | 1074 |
| 423 | Ga0307410_10480862 | 3300031852 | Bacteria | 1019 |
| 424 | Ga0307410_10492007 | 3300031852 | Bacteria | 1008 |
| 425 | Ga0326468_10002032 | 3300031889 | Bacteria | 1691 |
| 426 | Ga0307406_10046861 | 3300031901 | Bacteria | 2721 |
| 427 | Ga0307406_10394093 | 3300031901 | Bacteria | 1096 |
| 428 | Ga0307407_10072975 | 3300031903 | Bacteria | 2049 |
| 429 | Ga0307407_10203282 | 3300031903 | Bacteria | 1329 |
| 430 | Ga0307409_100042235 | 3300031995 | Bacteria | 3413 |
| 431 | Ga0307409_100314742 | 3300031995 | Bacteria | 1462 |
| 432 | Ga0307409_100599106 | 3300031995 | Bacteria | 1089 |
| 433 | Ga0307416_100259922 | 3300032002 | Bacteria | 1696 |
| 434 | Ga0307416_100316623 | 3300032002 | Bacteria | 1560 |
| 435 | Ga0307411_10003408 | 3300032005 | Bacteria | 7371 |
| 436 | Ga0307415_100134727 | 3300032126 | Bacteria | 1876 |
| 437 | Ga0307415_100262868 | 3300032126 | Bacteria | 1409 |
| 438 | Ga0307415_100315005 | 3300032126 | Bacteria | 1302 |
| 439 | Ga0307507_10019835 | 3300033179 | Bacteria | 7553 |
| 440 | Ga0307507_10039301 | 3300033179 | Bacteria | 4778 |
| 441 | Ga0307507_10191908 | 3300033179 | Bacteria | 1434 |
| 442 | Ga0307510_10041428 | 3300033180 | Bacteria | 5034 |
| 443 | Ga0373949_0080094 | 3300035090 | Bacteria | 869 |
| 444 | Ga0373956_0003096 | 3300035119 | Bacteria | 6729 |
| 445 | Ga0373960_0044193 | 3300035121 | Bacteria | 1300 |
| 446 | Ga0373931_0020857 | 3300035691 | Bacteria | 3282 |
| 447 | Ga0373925_0367964 | 3300037068 | Bacteria | 1169 |
| 448 | Ga0395900_0041501 | 3300037418 | Bacteria | 4743 |
| 449 | Ga0436364_0290389 | 3300037853 | Bacteria | 159315 |
| 450 | Ga0436364_0624094 | 3300037853 | Bacteria | 124588 |
| 451 | Ga0436364_1364710 | 3300037853 | Bacteria | 19673 |
| 452 | Ga0436365_0373159 | 3300039437 | Bacteria | 5503 |
| 453 | Ga0436365_0667812 | 3300039437 | Bacteria | 2145 |
| 454 | Ga0436365_1125927 | 3300039437 | Bacteria | 7423 |
| 455 | Ga0436363_1485375 | 3300039450 | Bacteria | 800 |
| 456 | Ga0436363_1630246 | 3300039450 | Bacteria | 7061 |
| 457 | Ga0436362_0543778 | 3300039453 | Bacteria | 67112 |
| 458 | Ga0439465_0003864 | 3300041413 | Bacteria | 4887 |
| 459 | Ga0439465_0050446 | 3300041413 | Bacteria | 1361 |
| 460 | Ga0451787_473958 | 3300041441 | Bacteria | 828 |
| 461 | Ga0451789_0499532 | 3300041443 | Bacteria | 820 |
| 462 | Ga0451793_1455051 | 3300041452 | Bacteria | 885 |
| 463 | Ga0451795_0390405 | 3300041456 | Bacteria | 2481 |
| 464 | Ga0451847_0509683 | 3300041503 | Bacteria | 1357 |
| 465 | Ga0451853_3838303 | 3300041512 | Bacteria | 1382 |
| 466 | Ga0439442_002363 | 3300042002 | Bacteria | 3701 |
| 467 | Ga0439434_0001333 | 3300042435 | Bacteria | 7118 |
| 468 | Ga0466969_0009005 | 3300044656 | Bacteria | 5290 |
| 469 | Ga0466969_0020898 | 3300044656 | Bacteria | 3386 |
| 470 | Ga0466969_0022487 | 3300044656 | Bacteria | 3254 |
| 471 | Ga0466969_0084380 | 3300044656 | Bacteria | 1512 |
| 472 | Ga0466972_0015752 | 3300044658 | Bacteria | 3780 |
| 473 | Ga0466972_0017424 | 3300044658 | Bacteria | 3595 |
| 474 | Ga0466972_0020429 | 3300044658 | Bacteria | 3309 |
| 475 | Ga0466972_0051868 | 3300044658 | Bacteria | 1978 |
| 476 | Ga0466972_0052770 | 3300044658 | Bacteria | 1958 |
| 477 | Ga0466972_0055314 | 3300044658 | Bacteria | 1908 |
| 478 | Ga0466972_0081147 | 3300044658 | Bacteria | 1544 |
| 479 | Ga0466965_0000951 | 3300044683 | Bacteria | 11161 |
| 480 | Ga0466965_0001005 | 3300044683 | Bacteria | 10920 |
| 481 | Ga0466965_0006905 | 3300044683 | Bacteria | 5193 |
| 482 | Ga0466965_0009663 | 3300044683 | Bacteria | 4485 |
| 483 | Ga0466965_0010481 | 3300044683 | Bacteria | 4325 |
| 484 | Ga0466965_0012711 | 3300044683 | Bacteria | 3965 |
| 485 | Ga0466965_0030672 | 3300044683 | Bacteria | 2620 |
| 486 | Ga0466965_0091766 | 3300044683 | Bacteria | 1546 |
| 487 | Ga0466966_0001132 | 3300044684 | Bacteria | 17127 |
| 488 | Ga0466966_0004920 | 3300044684 | Bacteria | 8784 |
| 489 | Ga0466966_0010384 | 3300044684 | Bacteria | 6182 |
| 490 | Ga0466966_0018541 | 3300044684 | Bacteria | 4589 |
| 491 | Ga0466966_0018676 | 3300044684 | Bacteria | 4570 |
| 492 | Ga0466966_0026070 | 3300044684 | Bacteria | 3817 |
| 493 | Ga0466966_0180035 | 3300044684 | Bacteria | 1283 |
| 494 | Ga0466966_0212407 | 3300044684 | Bacteria | 1169 |
| 495 | Ga0466961_0000624 | 3300044693 | Bacteria | 22156 |
| 496 | Ga0466961_0003917 | 3300044693 | Bacteria | 9309 |
| 497 | Ga0466961_0039410 | 3300044693 | Bacteria | 3028 |
| 498 | Ga0466963_0001389 | 3300044694 | Bacteria | 12982 |
| 499 | Ga0466963_0180155 | 3300044694 | Bacteria | 1475 |
| 500 | Ga0466964_0094578 | 3300044706 | Bacteria | 1306 |
| 501 | Ga0466971_0001403 | 3300044719 | Bacteria | 10117 |
| 502 | Ga0466971_0074589 | 3300044719 | Bacteria | 1542 |
| 503 | Ga0466971_0118430 | 3300044719 | Bacteria | 1225 |
| 504 | Ga0466968_0000337 | 3300044735 | Bacteria | 15138 |
| 505 | Ga0466968_0001457 | 3300044735 | Bacteria | 8493 |
| 506 | Ga0466968_0010117 | 3300044735 | Bacteria | 3647 |
| 507 | Ga0466968_0015930 | 3300044735 | Bacteria | 2986 |
| 508 | Ga0466970_0005494 | 3300044765 | Bacteria | 6292 |
| 509 | Ga0466970_0014465 | 3300044765 | Bacteria | 4051 |
| 510 | Ga0466970_0014651 | 3300044765 | Bacteria | 4026 |
| 511 | Ga0466970_0023618 | 3300044765 | Bacteria | 3212 |
| 512 | Ga0466970_0023791 | 3300044765 | Bacteria | 3202 |
| 513 | Ga0466970_0043391 | 3300044765 | Bacteria | 2392 |
| 514 | Ga0466970_0049075 | 3300044765 | Bacteria | 2251 |
| 515 | Ga0466957_0003161 | 3300044842 | Bacteria | 8982 |
| 516 | Ga0466957_0010912 | 3300044842 | Bacteria | 5225 |
| 517 | Ga0466957_0105502 | 3300044842 | Bacteria | 1781 |
| 518 | Ga0466960_0001845 | 3300044901 | Bacteria | 7776 |
| 519 | Ga0466960_0014957 | 3300044901 | Bacteria | 3335 |
| 520 | Ga0466960_0017713 | 3300044901 | Bacteria | 3111 |
| 521 | Ga0466960_0028126 | 3300044901 | Bacteria | 2571 |
| 522 | Ga0466960_0030685 | 3300044901 | Bacteria | 2475 |
| 523 | Ga0466960_0051144 | 3300044901 | Bacteria | 1995 |
| 524 | Ga0466959_0003933 | 3300045049 | Bacteria | 9865 |
| 525 | Ga0466959_0009913 | 3300045049 | Bacteria | 6790 |
| 526 | Ga0466959_0013848 | 3300045049 | Bacteria | 5855 |
| 527 | Ga0466959_0014815 | 3300045049 | Bacteria | 5676 |
| 528 | Ga0466959_0020245 | 3300045049 | Bacteria | 4899 |
| 529 | Ga0466959_0037459 | 3300045049 | Bacteria | 3583 |
| 530 | Ga0466959_0162533 | 3300045049 | Bacteria | 1569 |
| 531 | Ga0466958_0001216 | 3300045836 | Bacteria | 12032 |
| 532 | Ga0466958_0021385 | 3300045836 | Bacteria | 3780 |
| 533 | Ga0466958_0029701 | 3300045836 | Bacteria | 3244 |
| 534 | Ga0466958_0040492 | 3300045836 | Bacteria | 2800 |
| 535 | Ga0466967_0000901 | 3300045976 | Bacteria | 15900 |
| 536 | Ga0466967_0002000 | 3300045976 | Bacteria | 12400 |
| 537 | Ga0466967_0018137 | 3300045976 | Bacteria | 5615 |
| 538 | Ga0466967_0052834 | 3300045976 | Bacteria | 3569 |
| 539 | Ga0466967_0408514 | 3300045976 | Bacteria | 1322 |
| 540 | Ga0466967_0473002 | 3300045976 | Bacteria | 1227 |
| 541 | Ga0466967_0568425 | 3300045976 | Bacteria | 1117 |
| 542 | Ga0466967_0665595 | 3300045976 | Bacteria | 1030 |
| 543 | Ga0495580_0443932 | 3300046472 | Bacteria | 871 |
| 544 | Ga0495582_0046296 | 3300046473 | Bacteria | 2396 |
| 545 | Ga0495607_0023749 | 3300046501 | Bacteria | 3833 |
| 546 | Ga0495583_0010752 | 3300046506 | Bacteria | 5307 |
| 547 | Ga0495648_0011128 | 3300046524 | Bacteria | 6805 |
| 548 | Ga0495665_0018154 | 3300046531 | Bacteria | 3781 |
| 549 | Ga0495586_0284924 | 3300046535 | Bacteria | 946 |
| 550 | Ga0495668_0000573 | 3300046616 | Bacteria | 45058 |
| 551 | Ga0495658_0280192 | 3300046683 | Bacteria | 1052 |
| 552 | Ga0495613_0197696 | 3300046689 | Bacteria | 1419 |
| 553 | Ga0495581_0002987 | 3300047315 | Bacteria | 9689 |
| 554 | Ga0495672_0001067 | 3300047320 | Bacteria | 27912 |
| 555 | Ga0495676_0128136 | 3300047321 | Bacteria | 1836 |
| 556 | Ga0495683_0001077 | 3300047323 | Bacteria | 18893 |
| 557 | Ga0495683_0177814 | 3300047323 | Bacteria | 974 |
| 558 | Ga0495673_0001125 | 3300047469 | Bacteria | 22914 |
| 559 | Ga0495686_0060496 | 3300047472 | Bacteria | 2354 |
| 560 | Ga0495593_0036340 | 3300047673 | Bacteria | 2671 |
| 561 | Ga0495602_0501130 | 3300048088 | Bacteria | 849 |
| 562 | Ga0496100_0005813 | 3300048903 | Bacteria | 6673 |
| 563 | Ga0496100_0020039 | 3300048903 | Bacteria | 4003 |
| 564 | Ga0496100_0022490 | 3300048903 | Bacteria | 3815 |
| 565 | Ga0496100_0037901 | 3300048903 | Bacteria | 3052 |
| 566 | Ga0496101_0000102 | 3300048904 | Bacteria | 88779 |
| 567 | Ga0496101_0000923 | 3300048904 | Bacteria | 17335 |
| 568 | Ga0496101_0005872 | 3300048904 | Bacteria | 7860 |
| 569 | Ga0496101_0082733 | 3300048904 | Bacteria | 2376 |
| 570 | Ga0496101_0335344 | 3300048904 | Bacteria | 1187 |
| 571 | Ga0496102_0000037 | 3300048905 | Bacteria | 199368 |
| 572 | Ga0496102_0000042 | 3300048905 | Bacteria | 196538 |
| 573 | Ga0496102_0066174 | 3300048905 | Bacteria | 3312 |
| 574 | Ga0496102_0120454 | 3300048905 | Bacteria | 2450 |
| 575 | Ga0496102_0123669 | 3300048905 | Bacteria | 2417 |
| 576 | Ga0496102_0165009 | 3300048905 | Bacteria | 2084 |
| 577 | Ga0496102_0507960 | 3300048905 | Bacteria | 1128 |
| 578 | Ga0496103_0000004 | 3300048906 | Bacteria | 510080 |
| 579 | Ga0496103_0000194 | 3300048906 | Bacteria | 60666 |
| 580 | Ga0496103_0094561 | 3300048906 | Bacteria | 1888 |
| 581 | Ga0496103_0138638 | 3300048906 | Bacteria | 1555 |
| 582 | Ga0496104_0041842 | 3300048907 | Bacteria | 4297 |
| 583 | Ga0496104_0658910 | 3300048907 | Bacteria | 956 |
| 584 | Ga0496104_0686361 | 3300048907 | Bacteria | 932 |
| 585 | Ga0496105_0010731 | 3300048908 | Bacteria | 7211 |
| 586 | Ga0496105_0012835 | 3300048908 | Bacteria | 6639 |
| 587 | Ga0496105_0044370 | 3300048908 | Bacteria | 3667 |
| 588 | Ga0496105_0128433 | 3300048908 | Bacteria | 2090 |
| 589 | Ga0496106_0001446 | 3300048909 | Bacteria | 17814 |
| 590 | Ga0496106_0001888 | 3300048909 | Bacteria | 15700 |
| 591 | Ga0496106_0149874 | 3300048909 | Bacteria | 1839 |
| 592 | Ga0496106_0187282 | 3300048909 | Bacteria | 1644 |
| 593 | Ga0496107_0000421 | 3300048910 | Bacteria | 22921 |
| 594 | Ga0496107_0000619 | 3300048910 | Bacteria | 19912 |
| 595 | Ga0496107_0008362 | 3300048910 | Bacteria | 7159 |
| 596 | Ga0496107_0419425 | 3300048910 | Bacteria | 995 |
| 597 | Ga0496108_0000503 | 3300048911 | Bacteria | 30879 |
| 598 | Ga0496108_0030122 | 3300048911 | Bacteria | 4498 |
| 599 | Ga0496108_0042500 | 3300048911 | Bacteria | 3795 |
| 600 | Ga0496108_0270422 | 3300048911 | Bacteria | 1479 |
| 601 | Ga0496108_0587806 | 3300048911 | Bacteria | 970 |
| 602 | Ga0496108_0588753 | 3300048911 | Bacteria | 970 |
| 603 | Ga0496109_0003492 | 3300048912 | Bacteria | 13132 |
| 604 | Ga0496109_0030858 | 3300048912 | Bacteria | 4805 |
| 605 | Ga0496109_0139662 | 3300048912 | Bacteria | 2265 |
| 606 | Ga0496109_0155936 | 3300048912 | Bacteria | 2139 |
| 607 | Ga0496109_0166860 | 3300048912 | Bacteria | 2064 |
| 608 | Ga0496109_0211324 | 3300048912 | Bacteria | 1824 |
| 609 | Ga0496109_0234468 | 3300048912 | Bacteria | 1727 |
| 610 | Ga0496109_0725642 | 3300048912 | Bacteria | 931 |
| 611 | Ga0496110_0002133 | 3300048913 | Bacteria | 14776 |
| 612 | Ga0496110_0081739 | 3300048913 | Bacteria | 2881 |
| 613 | Ga0496110_0087928 | 3300048913 | Bacteria | 2775 |
| 614 | Ga0496110_0104966 | 3300048913 | Bacteria | 2535 |
| 615 | Ga0496110_0121251 | 3300048913 | Bacteria | 2356 |
| 616 | Ga0496110_0259945 | 3300048913 | Bacteria | 1580 |
| 617 | Ga0496111_0005087 | 3300048914 | Bacteria | 8367 |
| 618 | Ga0496111_0043427 | 3300048914 | Bacteria | 3231 |
| 619 | Ga0496111_0056038 | 3300048914 | Bacteria | 2851 |
| 620 | Ga0496112_0002560 | 3300048915 | Bacteria | 14689 |
| 621 | Ga0496112_0006323 | 3300048915 | Bacteria | 10401 |
| 622 | Ga0496112_0153860 | 3300048915 | Bacteria | 2267 |
| 623 | Ga0496113_0263946 | 3300048916 | Bacteria | 1376 |
| 624 | Ga0496114_0000108 | 3300048917 | Bacteria | 59737 |
| 625 | Ga0496114_0001286 | 3300048917 | Bacteria | 18965 |
| 626 | Ga0496114_0239638 | 3300048917 | Bacteria | 1595 |
| 627 | Ga0496115_0002120 | 3300048918 | Bacteria | 14181 |
| 628 | Ga0496115_0002657 | 3300048918 | Bacteria | 12836 |
| 629 | Ga0496116_0000276 | 3300048919 | Bacteria | 89506 |
| 630 | Ga0496116_0000464 | 3300048919 | Bacteria | 56167 |
| 631 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 632 | Ga0496117_0000339 | 3300048920 | Bacteria | 82597 |
| 633 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 634 | Ga0496118_0000241 | 3300048921 | Bacteria | 96484 |
| 635 | Ga0496119_0006204 | 3300048922 | Bacteria | 11177 |
| 636 | Ga0496119_0190165 | 3300048922 | Bacteria | 1070 |
| 637 | Ga0496120_0009654 | 3300048923 | Bacteria | 6813 |
| 638 | Ga0496120_0025940 | 3300048923 | Bacteria | 3629 |
| 639 | Ga0496120_0066814 | 3300048923 | Bacteria | 1987 |
| 640 | Ga0496121_0000338 | 3300048924 | Bacteria | 97703 |
| 641 | Ga0496121_0004853 | 3300048924 | Bacteria | 17673 |
| 642 | Ga0496121_0207228 | 3300048924 | Bacteria | 1392 |
| 643 | Ga0496122_0014665 | 3300048925 | Bacteria | 7557 |
| 644 | Ga0496125_0020171 | 3300048928 | Bacteria | 6264 |
| 645 | Ga0496125_0029988 | 3300048928 | Bacteria | 4874 |
| 646 | Ga0496125_0090141 | 3300048928 | Bacteria | 2303 |
| 647 | Ga0496125_0430899 | 3300048928 | Bacteria | 761 |
| 648 | Ga0496126_0000551 | 3300048929 | Bacteria | 72093 |
| 649 | Ga0496126_0001408 | 3300048929 | Bacteria | 38053 |
| 650 | Ga0496126_0005413 | 3300048929 | Bacteria | 14564 |
| 651 | Ga0496126_0132182 | 3300048929 | Bacteria | 2156 |
| 652 | Ga0501323_007713 | 3300049539 | Bacteria | 1235 |
| 653 | Ga0501032_0003747 | 3300049569 | Bacteria | 11530 |
| 654 | Ga0501034_0010132 | 3300049571 | Bacteria | 9833 |
| 655 | Ga0501034_0357975 | 3300049571 | Bacteria | 1387 |
| 656 | Ga0501034_0408933 | 3300049571 | Bacteria | 1279 |
| 657 | Ga0501036_0020079 | 3300049572 | Bacteria | 5610 |
| 658 | Ga0501037_0003118 | 3300049573 | Bacteria | 12016 |
| 659 | Ga0501038_0013261 | 3300049574 | Bacteria | 7515 |
| 660 | Ga0501039_0004952 | 3300049575 | Bacteria | 10100 |
| 661 | Ga0501043_0000411 | 3300049579 | Bacteria | 38553 |
| 662 | Ga0501047_0051724 | 3300049581 | Bacteria | 3970 |
| 663 | Ga0501067_0169989 | 3300049583 | Bacteria | 1214 |
| 664 | Ga0501068_0196361 | 3300049584 | Bacteria | 1279 |
| 665 | Ga0501070_0000614 | 3300049586 | Bacteria | 32686 |
| 666 | Ga0501071_0055114 | 3300049587 | Bacteria | 2870 |
| 667 | Ga0501073_0041110 | 3300049589 | Bacteria | 3267 |
| 668 | Ga0501075_0223706 | 3300049591 | Bacteria | 1436 |
| 669 | Ga0501076_0571253 | 3300049592 | Bacteria | 933 |
| 670 | Ga0501077_0169483 | 3300049593 | Bacteria | 1387 |
| 671 | Ga0501079_0287235 | 3300049741 | Bacteria | 1286 |
| 672 | Ga0501080_0404955 | 3300049742 | Bacteria | 1227 |
| 673 | Ga0501044_0132344 | 3300049823 | Bacteria | 2487 |
| 674 | nmdc:mga03683_63843_c1 | 3300050489 | Bacteria | 1561 |
| 675 | nmdc:mga03n38_13056_c2 | 3300050490 | Bacteria | 2216 |
| 676 | nmdc:mga03n38_22356_c1 | 3300050490 | Bacteria | 2558 |
| 677 | nmdc:mga03n38_286877_c1 | 3300050490 | Bacteria | 880 |
| 678 | nmdc:mga03n38_3780_c1 | 3300050490 | Bacteria | 4913 |
| 679 | nmdc:mga03n38_38539_c1 | 3300050490 | Bacteria | 2068 |
| 680 | nmdc:mga03n38_821_c1 | 3300050490 | Bacteria | 8320 |
| 681 | nmdc:mga00v17_209296_c1 | 3300050491 | Bacteria | 1262 |
| 682 | nmdc:mga00v17_27231_c1 | 3300050491 | Bacteria | 3336 |
| 683 | nmdc:mga00v17_28138_c1 | 3300050491 | Bacteria | 3290 |
| 684 | nmdc:mga00v17_33451_c1 | 3300050491 | Bacteria | 3046 |
| 685 | nmdc:mga00v17_721_c1 | 3300050491 | Bacteria | 18067 |
| 686 | nmdc:mga0yw44_1318_c1 | 3300050492 | Bacteria | 7392 |
| 687 | nmdc:mga0yw44_240021_c1 | 3300050492 | Bacteria | 1204 |
| 688 | nmdc:mga0yw44_392639_c1 | 3300050492 | Bacteria | 937 |
| 689 | nmdc:mga0yw44_41158_c1 | 3300050492 | Bacteria | 2749 |
| 690 | nmdc:mga0yw44_6798_c1 | 3300050492 | Bacteria | 5560 |
| 691 | nmdc:mga07m45_107212_c1 | 3300050496 | Bacteria | 1607 |
| 692 | nmdc:mga07m45_124658_c1 | 3300050496 | Bacteria | 1489 |
| 693 | nmdc:mga07m45_138721_c1 | 3300050496 | Bacteria | 1408 |
| 694 | nmdc:mga07m45_162330_c1 | 3300050496 | Bacteria | 1297 |
| 695 | nmdc:mga07m45_352395_c1 | 3300050496 | Bacteria | 855 |
| 696 | nmdc:mga07m45_50346_c1 | 3300050496 | Bacteria | 2347 |
| 697 | nmdc:mga09592_280967_c1 | 3300050508 | Bacteria | 1444 |
| 698 | nmdc:mga0qj67_16695_c1 | 3300050509 | Bacteria | 5572 |
| 699 | nmdc:mga0qj67_194194_c1 | 3300050509 | Bacteria | 1649 |
| 700 | nmdc:mga0qj67_467975_c1 | 3300050509 | Bacteria | 1015 |
| 701 | nmdc:mga06r32_117_c5 | 3300050510 | Bacteria | 10449 |
| 702 | nmdc:mga06r32_17373_c2 | 3300050510 | Bacteria | 4784 |
| 703 | nmdc:mga08y16_43822_c1 | 3300050511 | Bacteria | 3767 |
| 704 | nmdc:mga08y16_559411_c1 | 3300050511 | Bacteria | 1157 |
| 705 | nmdc:mga0sz30_122136_c1 | 3300050516 | Bacteria | 1145 |
| 706 | nmdc:mga0sz30_377_c1 | 3300050516 | Bacteria | 17040 |
| 707 | nmdc:mga0sz30_642_c1 | 3300050516 | Bacteria | 12927 |
| 708 | nmdc:mga0sz30_77257_c1 | 3300050516 | Bacteria | 1438 |
| 709 | nmdc:mga0sz30_88991_c1 | 3300050516 | Bacteria | 1342 |
| 710 | Ga0500610_0008219 | 3300053079 | Bacteria | 4530 |
| 711 | Ga0500635_0000607 | 3300053080 | Bacteria | 9400 |
| 712 | Ga0500643_023377 | 3300053087 | Bacteria | 1975 |
| 713 | Ga0500643_035599 | 3300053087 | Bacteria | 1491 |
| 714 | Ga0500556_0003107 | 3300053104 | Bacteria | 4955 |
| 715 | Ga0500562_034019 | 3300053108 | Bacteria | 1348 |
| 716 | Ga0500572_065475 | 3300053111 | Bacteria | 1113 |
| 717 | Ga0500652_005412 | 3300053131 | Bacteria | 4017 |
| 718 | Ga0500652_009681 | 3300053131 | Bacteria | 3271 |
| 719 | Ga0500658_0159404 | 3300053134 | Bacteria | 1021 |
| 720 | Ga0500559_0002526 | 3300053136 | Bacteria | 9400 |
| 721 | Ga0500589_129723 | 3300053147 | Bacteria | 1055 |
| 722 | Ga0500616_0024990 | 3300053153 | Bacteria | 3315 |
| 723 | Ga0500616_0079747 | 3300053153 | Bacteria | 1647 |
| 724 | Ga0500620_101342 | 3300053155 | Bacteria | 1007 |
| 725 | Ga0500627_0028398 | 3300053158 | Bacteria | 2324 |
| 726 | Ga0500645_000668 | 3300053730 | Bacteria | 21553 |
| 727 | Ga0466962_0001545 | 3300061719 | Bacteria | 10751 |
| 728 | Ga0466962_0033283 | 3300061719 | Bacteria | 2466 |
| 729 | Ga0466962_0039089 | 3300061719 | Bacteria | 2272 |
| 730 | 2523382799 | 2523231044 | Bacteria | 6434991 |
| 731 | 2548697863 | 2547132424 | Bacteria | 8348532 |
| 732 | 2552109519 | 2551306166 | Bacteria | 9731570 |
| 733 | 2558910906 | 2558860112 | Bacteria | 9931328 |
| 734 | 2559429635 | 2558860280 | Bacteria | 11429938 |
| 735 | 2566993084 | 2565956761 | Bacteria | 6601618 |
| 736 | 2583150443 | 2582580736 | Bacteria | 5325865 |
| 737 | 2586059312 | 2585427649 | Bacteria | 9053857 |
| 738 | 2644513017 | 2643221692 | Bacteria | 7282860 |
| 739 | 2738706084 | 2738541274 | Bacteria | 6909446 |
| 740 | 2739238719 | 2738543011 | Bacteria | 5731169 |
| 741 | 2739333016 | 2738543028 | Bacteria | 6917070 |
| 742 | 2739362202 | 2738543034 | Bacteria | 6084756 |
| 743 | 2744957122 | 2744054611 | Bacteria | 5611514 |
| 744 | 2753035251 | 2751185725 | Bacteria | 5740550 |
| 745 | 2753070750 | 2751185734 | Bacteria | 8863695 |
| 746 | 2753323768 | 2751185792 | Bacteria | 5739090 |
| 747 | 2791915385 | 2791354901 | Bacteria | 8322202 |
| 748 | 2795783479 | 2795385470 | Bacteria | 8317180 |
| 749 | 2809591930 | 2808606522 | Bacteria | 9488490 |
| 750 | 2816504643 | 2816332139 | Bacteria | 9138787 |
| 751 | 2863071070 | 2863067949 | Bacteria | 8541735 |
| 752 | 2866552670 | 2866552031 | Bacteria | 5824618 |
| 753 | 2866616852 | 2866612099 | Bacteria | 7543886 |
| 754 | 2870726680 | 2870721527 | Bacteria | 9689237 |
| 755 | 2870789101 | 2870782633 | Bacteria | 9624083 |
| 756 | 2889300992 | 2889300758 | Bacteria | 5690814 |
| 757 | 2891327591 | 2891326441 | Bacteria | 6439512 |
| 758 | 2899364137 | 2899359706 | Bacteria | 10940472 |
| 759 | 2899373305 | 2899370129 | Bacteria | 6781179 |
| 760 | 2902801619 | 2902799365 | Bacteria | 5419524 |
| 761 | 2904538922 | 2904535858 | Bacteria | 6308016 |
| 762 | 2915361595 | 2915358134 | Bacteria | 6050864 |
| 763 | 2915773338 | 2915768154 | Bacteria | 8424322 |
| 764 | 2917738936 | 2917736166 | Bacteria | 9690793 |
| 765 | 2919715962 | 2919713450 | Bacteria | 7431245 |
| 766 | 2922556780 | 2922554459 | Bacteria | 6683962 |
| 767 | 2939587262 | 2939582691 | Bacteria | 7088898 |
| 768 | 2939744511 | 2939743619 | Bacteria | 5762299 |
| 769 | 2956940445 | 2956939328 | Bacteria | 3474458 |
| 770 | 2974317259 | 2974315732 | Bacteria | 4602776 |
| 771 | 2984525464 | 2984523437 | Bacteria | 4508481 |
| 772 | 3001121870 | 3001119090 | Bacteria | 3449530 |
| 773 | 8003322504 | 8003314358 | Bacteria | 10575343 |
| 774 | 8047718035 | 8047710418 | Bacteria | 11023148 |
| 775 | 8054474295 | 8054472261 | Bacteria | 7464355 |
| 776 | 8056212007 | 8056207758 | Bacteria | 8639239 |
| 777 | Ga0105241_10211036 | |||
| 778 | CNXas_1000536 | |||
| 779 | JGI24746J21847_1004021 | |||
| 780 | JGI24735J21928_10023223 | |||
| 781 | JGI24750J21931_1016477 | |||
| 782 | JGI24745J21846_1001114 | |||
| 783 | JGI24745J21846_1004008 | |||
| 784 | JGI24744J21845_10006632 | |||
| 785 | JGI24034J26672_10005404 | |||
| 786 | JGI24742J22300_10003132 | |||
| 787 | JGI24751J29686_10005463 | |||
| 788 | JGI25406J46586_10000557 | |||
| 789 | Ga0055540_1002431 | |||
| 790 | Ga0055540_1005569 | |||
| 791 | Ga0055540_1009773 | |||
| 792 | Ga0070658_10308331 | |||
| 793 | Ga0070676_10041597 | |||
| 794 | Ga0070676_10080723 | |||
| 795 | Ga0070683_100123341 | |||
| 796 | Ga0070683_100147531 | |||
| 797 | Ga0070690_100004656 | |||
| 798 | Ga0068869_100035072 | |||
| 799 | Ga0068869_100077846 | |||
| 800 | Ga0070666_10173181 | |||
| 801 | Ga0070682_100033809 | |||
| 802 | Ga0070682_100319447 | |||
| 803 | Ga0068868_100033397 | |||
| 804 | Ga0068868_100065385 | |||
| 805 | Ga0068868_100208636 | |||
| 806 | Ga0070689_100028370 | |||
| 807 | Ga0070689_100062364 | |||
| 808 | Ga0070689_100122073 | |||
| 809 | Ga0070661_100584590 | |||
| 810 | Ga0070668_100000449 | |||
| 811 | Ga0070668_100059966 | |||
| 812 | Ga0070668_100107435 | |||
| 813 | Ga0070668_100440497 | |||
| 814 | Ga0070669_100028340 | |||
| 815 | Ga0070669_100312037 | |||
| 816 | Ga0070669_100607627 | |||
| 817 | Ga0070675_100207422 | |||
| 818 | Ga0070671_100002308 | |||
| 819 | Ga0070671_100005597 | |||
| 820 | Ga0070671_100096819 | |||
| 821 | Ga0070674_100041361 | |||
| 822 | Ga0070674_100075059 | |||
| 823 | Ga0070688_100073075 | |||
| 824 | Ga0070688_100179536 | |||
| 825 | Ga0070659_100036934 | |||
| 826 | Ga0070659_100495173 | |||
| 827 | Ga0070667_100016599 | |||
| 828 | Ga0070667_100019725 | |||
| 829 | Ga0070667_100036663 | |||
| 830 | Ga0070667_100180096 | |||
| 831 | Ga0070709_10014526 | |||
| 832 | Ga0070714_100009393 | |||
| 833 | Ga0070714_100195712 | |||
| 834 | Ga0070713_100033202 | |||
| 835 | Ga0070713_100064828 | |||
| 836 | Ga0070710_10000364 | |||
| 837 | Ga0070710_10000468 | |||
| 838 | Ga0070710_10010481 | |||
| 839 | Ga0070711_100002851 | |||
| 840 | Ga0070711_100006539 | |||
| 841 | Ga0070705_100103279 | |||
| 842 | Ga0070705_100217623 | |||
| 843 | Ga0070700_100002039 | |||
| 844 | Ga0070700_100282794 | |||
| 845 | Ga0070694_100063135 | |||
| 846 | Ga0070663_100002335 | |||
| 847 | Ga0070663_100005380 | |||
| 848 | Ga0070663_100020149 | |||
| 849 | Ga0070663_100080988 | |||
| 850 | Ga0070663_100392682 | |||
| 851 | Ga0070663_100595055 | |||
| 852 | Ga0070678_100042939 | |||
| 853 | Ga0070678_100063119 | |||
| 854 | Ga0070678_100114047 | |||
| 855 | Ga0070662_100151909 | |||
| 856 | Ga0068867_100003379 | |||
| 857 | Ga0068867_100066793 | |||
| 858 | Ga0068867_100242322 | |||
| 859 | Ga0070685_10057572 | |||
| 860 | Ga0070684_100307871 | |||
| 861 | Ga0068853_100035399 | |||
| 862 | Ga0068853_100060121 | |||
| 863 | Ga0068853_100139386 | |||
| 864 | Ga0070672_100087530 | |||
| 865 | Ga0070672_100112923 | |||
| 866 | Ga0070686_100076990 | |||
| 867 | Ga0070695_100182829 | |||
| 868 | Ga0070696_100003196 | |||
| 869 | Ga0070696_100015832 | |||
| 870 | Ga0070693_100031943 | |||
| 871 | Ga0070693_100054076 | |||
| 872 | Ga0070693_100226567 | |||
| 873 | Ga0070665_100001944 | |||
| 874 | Ga0070665_100010428 | |||
| 875 | Ga0070665_100062380 | |||
| 876 | Ga0070665_100120159 | |||
| 877 | Ga0070704_100006793 | |||
| 878 | Ga0070704_100087587 | |||
| 879 | Ga0068855_100112475 | |||
| 880 | Ga0068855_100119110 | |||
| 881 | Ga0070664_100215535 | |||
| 882 | Ga0070664_100375057 | |||
| 883 | Ga0070664_100598656 | |||
| 884 | Ga0068857_100698424 | |||
| 885 | Ga0068854_100074267 | |||
| 886 | Ga0068854_100091265 | |||
| 887 | Ga0068854_100117114 | |||
| 888 | Ga0068854_100277929 | |||
| 889 | Ga0068854_100383703 | |||
| 890 | Ga0068854_100598498 | |||
| 891 | Ga0068856_100518728 | |||
| 892 | Ga0068856_100661005 | |||
| 893 | Ga0070702_100034338 | |||
| 894 | Ga0070702_100057911 | |||
| 895 | Ga0068852_100058603 | |||
| 896 | Ga0068852_100095343 | |||
| 897 | Ga0068859_100042229 | |||
| 898 | Ga0068859_100166645 | |||
| 899 | Ga0068859_100268433 | |||
| 900 | Ga0068859_100322249 | |||
| 901 | Ga0068859_100463888 | |||
| 902 | Ga0068864_100366505 | |||
| 903 | Ga0068866_10000223 | |||
| 904 | Ga0068866_10009759 | |||
| 905 | Ga0068861_100000566 | |||
| 906 | Ga0068870_10068146 | |||
| 907 | Ga0068870_10297777 | |||
| 908 | Ga0068863_100014660 | |||
| 909 | Ga0068863_100048888 | |||
| 910 | Ga0068858_100000340 | |||
| 911 | Ga0068858_100044837 | |||
| 912 | Ga0068858_100281567 | |||
| 913 | Ga0068860_100014701 | |||
| 914 | Ga0068862_100035998 | |||
| 915 | Ga0068862_100170978 | |||
| 916 | Ga0068862_100323844 | |||
| 917 | Ga0081455_10000011 | |||
| 918 | Ga0081455_10015862 | |||
| 919 | Ga0081455_10074855 | |||
| 920 | Ga0081539_10000680 | |||
| 921 | Ga0070717_10131172 | |||
| 922 | Ga0070717_10245861 | |||
| 923 | Ga0075365_10044901 | |||
| 924 | Ga0075365_10464728 | |||
| 925 | Ga0075363_100003786 | |||
| 926 | Ga0075363_100023765 | |||
| 927 | Ga0075363_100029456 | |||
| 928 | Ga0075363_100032237 | |||
| 929 | Ga0075363_100048365 | |||
| 930 | Ga0075363_100076645 | |||
| 931 | Ga0075364_10000301 | |||
| 932 | Ga0075364_10023127 | |||
| 933 | Ga0075364_10025162 | |||
| 934 | Ga0075364_10034918 | |||
| 935 | Ga0075364_10055801 | |||
| 936 | Ga0075364_10094611 | |||
| 937 | Ga0070715_10037612 | |||
| 938 | Ga0070715_10058405 | |||
| 939 | Ga0070716_100061059 | |||
| 940 | Ga0070716_100064518 | |||
| 941 | Ga0070712_100023175 | |||
| 942 | Ga0070712_100305496 | |||
| 943 | Ga0075362_10073010 | |||
| 944 | Ga0075369_10001858 | |||
| 945 | Ga0075369_10003549 | |||
| 946 | Ga0075369_10017703 | |||
| 947 | Ga0075369_10018933 | |||
| 948 | Ga0075369_10032296 | |||
| 949 | Ga0075369_10088538 | |||
| 950 | Ga0075369_10093603 | |||
| 951 | Ga0075369_10108956 | |||
| 952 | Ga0075369_10154566 | |||
| 953 | Ga0075369_10182403 | |||
| 954 | Ga0097621_100098979 | |||
| 955 | Ga0097621_100284549 | |||
| 956 | Ga0097621_100365570 | |||
| 957 | Ga0075370_10001488 | |||
| 958 | Ga0075370_10099283 | |||
| 959 | Ga0075370_10107238 | |||
| 960 | Ga0075370_10163736 | |||
| 961 | Ga0075370_10249562 | |||
| 962 | Ga0068871_100305608 | |||
| 963 | Ga0075428_100001695 | |||
| 964 | Ga0075430_100029765 | |||
| 965 | Ga0075430_100286610 | |||
| 966 | Ga0075430_100490123 | |||
| 967 | Ga0075431_100056933 | |||
| 968 | Ga0075429_100289645 | |||
| 969 | Ga0097620_100042230 | |||
| 970 | Ga0097620_100166642 | |||
| 971 | Ga0097620_100268422 | |||
| 972 | Ga0097620_100322256 | |||
| 973 | Ga0097620_100463885 | |||
| 974 | Ga0105250_10008866 | |||
| 975 | Ga0105240_10342809 | |||
| 976 | Ga0111539_10058897 | |||
| 977 | Ga0111539_10327525 | |||
| 978 | Ga0111539_10503063 | |||
| 979 | Ga0105245_10017295 | |||
| 980 | Ga0105245_10160233 | |||
| 981 | Ga0105245_10212999 | |||
| 982 | Ga0105247_10034066 | |||
| 983 | Ga0105247_10142010 | |||
| 984 | Ga0105243_10000749 | |||
| 985 | Ga0105243_10008122 | |||
| 986 | Ga0105243_10093391 | |||
| 987 | Ga0105241_10065259 | |||
| 988 | Ga0105241_10227533 | |||
| 989 | Ga0105242_10082815 | |||
| 990 | Ga0105242_10159894 | |||
| 991 | Ga0105242_10250278 | |||
| 992 | Ga0105242_10429682 | |||
| 993 | Ga0105248_10001981 | |||
| 994 | Ga0105248_10073208 | |||
| 995 | Ga0105248_10207833 | |||
| 996 | Ga0105237_10001244 | |||
| 997 | Ga0105237_10084464 | |||
| 998 | Ga0105237_10106964 | |||
| 999 | Ga0105237_10190690 | |||
| 1000 | Ga0105237_10844646 | |||
| 1001 | Ga0105238_10166291 | |||
| 1002 | Ga0105238_10190217 | |||
| 1003 | Ga0105238_10373725 | |||
| 1004 | Ga0105249_10007116 | |||
| 1005 | Ga0105249_10087761 | |||
| 1006 | Ga0105249_11022543 | |||
| 1007 | Ga0105239_10027785 | |||
| 1008 | Ga0105239_10181177 | |||
| 1009 | Ga0105239_10749887 | |||
| 1010 | Ga0105239_11156193 | |||
| 1011 | Ga0105246_10048993 | |||
| 1012 | Ga0105246_10234856 | |||
| 1013 | Ga0105246_10728266 | |||
| 1014 | Ga0157369_10143259 | |||
| 1015 | Ga0157369_10331122 | |||
| 1016 | Ga0157374_10095524 | |||
| 1017 | Ga0157378_10013565 | |||
| 1018 | Ga0157378_10162000 | |||
| 1019 | Ga0163162_10017533 | |||
| 1020 | Ga0163162_10144715 | |||
| 1021 | Ga0163162_10146816 | |||
| 1022 | Ga0163162_10998409 | |||
| 1023 | Ga0157372_10004262 | |||
| 1024 | Ga0157372_10068538 | |||
| 1025 | Ga0157372_10720054 | |||
| 1026 | Ga0157375_10012997 | |||
| 1027 | Ga0157375_10195655 | |||
| 1028 | Ga0157375_10315824 | |||
| 1029 | Ga0157375_11284474 | |||
| 1030 | Ga0163163_10028842 | |||
| 1031 | Ga0163163_10485283 | |||
| 1032 | Ga0157380_10028021 | |||
| 1033 | Ga0157380_10651699 | |||
| 1034 | Ga0157377_10019339 | |||
| 1035 | Ga0157379_10025793 | |||
| 1036 | Ga0157379_10041285 | |||
| 1037 | Ga0157379_10194244 | |||
| 1038 | Ga0157376_10296353 | |||
| 1039 | Ga0163161_10002626 | |||
| 1040 | Ga0163161_10119025 | |||
| 1041 | Ga0213873_10000144 | |||
| 1042 | Ga0213876_10088490 | |||
| 1043 | Ga0213875_10002351 | |||
| 1044 | Ga0213875_10005039 | |||
| 1045 | Ga0213875_10010251 | |||
| 1046 | Ga0209051_1002711 | |||
| 1047 | Ga0209051_1003201 | |||
| 1048 | Ga0209051_1008910 | |||
| 1049 | Ga0207692_10028384 | |||
| 1050 | Ga0207692_10054993 | |||
| 1051 | Ga0207642_10005556 | |||
| 1052 | Ga0207642_10224600 | |||
| 1053 | Ga0207710_10182685 | |||
| 1054 | Ga0207688_10004235 | |||
| 1055 | Ga0207688_10027373 | |||
| 1056 | Ga0207688_10037263 | |||
| 1057 | Ga0207688_10119972 | |||
| 1058 | Ga0207680_10151079 | |||
| 1059 | Ga0207647_10081601 | |||
| 1060 | Ga0207685_10003898 | |||
| 1061 | Ga0207645_10044272 | |||
| 1062 | Ga0207643_10018147 | |||
| 1063 | Ga0207643_10023514 | |||
| 1064 | Ga0207654_10078235 | |||
| 1065 | Ga0207671_10020624 | |||
| 1066 | Ga0207671_10050415 | |||
| 1067 | Ga0207693_10000292 | |||
| 1068 | Ga0207693_10007534 | |||
| 1069 | Ga0207693_10203637 | |||
| 1070 | Ga0207663_10027939 | |||
| 1071 | Ga0207663_10089161 | |||
| 1072 | Ga0207662_10101704 | |||
| 1073 | Ga0207657_10031065 | |||
| 1074 | Ga0207649_10270877 | |||
| 1075 | Ga0207681_10099859 | |||
| 1076 | Ga0207694_10117129 | |||
| 1077 | Ga0207694_10156351 | |||
| 1078 | Ga0207694_10243532 | |||
| 1079 | Ga0207694_10450338 | |||
| 1080 | Ga0207687_10026753 | |||
| 1081 | Ga0207687_10114586 | |||
| 1082 | Ga0207687_10215503 | |||
| 1083 | Ga0207687_10298606 | |||
| 1084 | Ga0207700_10146347 | |||
| 1085 | Ga0207664_10008573 | |||
| 1086 | Ga0207664_10293728 | |||
| 1087 | Ga0207644_10003294 | |||
| 1088 | Ga0207706_10018893 | |||
| 1089 | Ga0207706_10103808 | |||
| 1090 | Ga0207706_10533736 | |||
| 1091 | Ga0207686_10015437 | |||
| 1092 | Ga0207709_10003971 | |||
| 1093 | Ga0207709_10061384 | |||
| 1094 | Ga0207670_10083226 | |||
| 1095 | Ga0207670_10172894 | |||
| 1096 | Ga0207670_10181647 | |||
| 1097 | Ga0207669_10048549 | |||
| 1098 | Ga0207669_10223818 | |||
| 1099 | Ga0207704_10046986 | |||
| 1100 | Ga0207704_10132461 | |||
| 1101 | Ga0207704_10209793 | |||
| 1102 | Ga0207704_10258197 | |||
| 1103 | Ga0207665_10019007 | |||
| 1104 | Ga0207665_10051332 | |||
| 1105 | Ga0207665_10100463 | |||
| 1106 | Ga0207691_10109842 | |||
| 1107 | Ga0207691_10111791 | |||
| 1108 | Ga0207691_10112815 | |||
| 1109 | Ga0207711_10043412 | |||
| 1110 | Ga0207711_10228878 | |||
| 1111 | Ga0207689_10009983 | |||
| 1112 | Ga0207689_10015374 | |||
| 1113 | Ga0207689_10060615 | |||
| 1114 | Ga0207689_10258938 | |||
| 1115 | Ga0207689_10433187 | |||
| 1116 | Ga0207661_10130627 | |||
| 1117 | Ga0207661_10314112 | |||
| 1118 | Ga0207661_10325267 | |||
| 1119 | Ga0207679_10130883 | |||
| 1120 | Ga0207651_10434446 | |||
| 1121 | Ga0207651_10513830 | |||
| 1122 | Ga0207712_10069390 | |||
| 1123 | Ga0207712_10891243 | |||
| 1124 | Ga0207668_10000521 | |||
| 1125 | Ga0207668_10030372 | |||
| 1126 | Ga0207668_10030679 | |||
| 1127 | Ga0207640_10028647 | |||
| 1128 | Ga0207640_10121031 | |||
| 1129 | Ga0207640_10180786 | |||
| 1130 | Ga0207640_10244464 | |||
| 1131 | Ga0207658_10010530 | |||
| 1132 | Ga0207658_10119701 | |||
| 1133 | Ga0207658_10140555 | |||
| 1134 | Ga0207677_10012418 | |||
| 1135 | Ga0207677_10018253 | |||
| 1136 | Ga0207677_10093410 | |||
| 1137 | Ga0207639_10026057 | |||
| 1138 | Ga0207639_11086141 | |||
| 1139 | Ga0207678_10000168 | |||
| 1140 | Ga0207678_10022948 | |||
| 1141 | Ga0207678_10024700 | |||
| 1142 | Ga0207678_10054163 | |||
| 1143 | Ga0207678_10064377 | |||
| 1144 | Ga0207678_10117554 | |||
| 1145 | Ga0207678_10247801 | |||
| 1146 | Ga0207708_10003716 | |||
| 1147 | Ga0207708_10005971 | |||
| 1148 | Ga0207708_10007355 | |||
| 1149 | Ga0207708_10018785 | |||
| 1150 | Ga0207708_10363859 | |||
| 1151 | Ga0207641_10001754 | |||
| 1152 | Ga0207641_10003490 | |||
| 1153 | Ga0207648_10000187 | |||
| 1154 | Ga0207648_10071311 | |||
| 1155 | Ga0207648_10145768 | |||
| 1156 | Ga0207648_10320131 | |||
| 1157 | Ga0207676_10164493 | |||
| 1158 | Ga0207676_10349199 | |||
| 1159 | Ga0207674_10261755 | |||
| 1160 | Ga0207675_100000390 | |||
| 1161 | Ga0207675_100008670 | |||
| 1162 | Ga0207675_100029830 | |||
| 1163 | Ga0207675_100097498 | |||
| 1164 | Ga0207675_100654724 | |||
| 1165 | Ga0207683_10000197 | |||
| 1166 | Ga0207683_10087037 | |||
| 1167 | Ga0207683_10291408 | |||
| 1168 | Ga0207683_10326918 | |||
| 1169 | Ga0207683_10412062 | |||
| 1170 | Ga0207698_10284204 | |||
| 1171 | Ga0207698_10442513 | |||
| 1172 | Ga0207698_10780698 | |||
| 1173 | Ga0207428_10205272 | |||
| 1174 | Ga0207428_10379220 | |||
| 1175 | Ga0268266_10026545 | |||
| 1176 | Ga0268266_10361866 | |||
| 1177 | Ga0268265_10045976 | |||
| 1178 | Ga0268265_10060154 | |||
| 1179 | Ga0268264_10004226 | |||
| 1180 | Ga0307511_10000158 | |||
| 1181 | Ga0307511_10072092 | |||
| 1182 | Ga0307512_10045645 | |||
| 1183 | Ga0316177_1183914 | |||
| 1184 | Ga0314311_1066462 | |||
| 1185 | Ga0316180_1112152 | |||
| 1186 | Ga0265320_10124250 | |||
| 1187 | Ga0265327_10024751 | |||
| 1188 | Ga0307513_10007005 | |||
| 1189 | Ga0307513_10018515 | |||
| 1190 | Ga0307513_10035387 | |||
| 1191 | Ga0307509_10107461 | |||
| 1192 | Ga0307413_10001285 | |||
| 1193 | Ga0307413_10026643 | |||
| 1194 | Ga0307413_10316748 | |||
| 1195 | Ga0307518_10000495 | |||
| 1196 | Ga0307518_10012772 | |||
| 1197 | Ga0307410_10130379 | |||
| 1198 | Ga0307410_10428778 | |||
| 1199 | Ga0307410_10480862 | |||
| 1200 | Ga0307410_10492007 | |||
| 1201 | Ga0326468_10002032 | |||
| 1202 | Ga0307406_10046861 | |||
| 1203 | Ga0307406_10394093 | |||
| 1204 | Ga0307407_10072975 | |||
| 1205 | Ga0307407_10203282 | |||
| 1206 | Ga0307409_100042235 | |||
| 1207 | Ga0307409_100314742 | |||
| 1208 | Ga0307409_100599106 | |||
| 1209 | Ga0307416_100259922 | |||
| 1210 | Ga0307416_100316623 | |||
| 1211 | Ga0307411_10003408 | |||
| 1212 | Ga0307415_100134727 | |||
| 1213 | Ga0307415_100262868 | |||
| 1214 | Ga0307415_100315005 | |||
| 1215 | Ga0307507_10019835 | |||
| 1216 | Ga0307507_10039301 | |||
| 1217 | Ga0307507_10191908 | |||
| 1218 | Ga0307510_10041428 | |||
| 1219 | Ga0373949_0080094 | |||
| 1220 | Ga0373956_0003096 | |||
| 1221 | Ga0373960_0044193 | |||
| 1222 | Ga0373931_0020857 | |||
| 1223 | Ga0373925_0367964 | |||
| 1224 | Ga0395900_0041501 | |||
| 1225 | Ga0436364_0290389 | |||
| 1226 | Ga0436364_0624094 | |||
| 1227 | Ga0436364_1364710 | |||
| 1228 | Ga0436365_0373159 | |||
| 1229 | Ga0436365_0667812 | |||
| 1230 | Ga0436365_1125927 | |||
| 1231 | Ga0436363_1485375 | |||
| 1232 | Ga0436363_1630246 | |||
| 1233 | Ga0436362_0543778 | |||
| 1234 | Ga0439465_0003864 | |||
| 1235 | Ga0439465_0050446 | |||
| 1236 | Ga0451787_473958 | |||
| 1237 | Ga0451789_0499532 | |||
| 1238 | Ga0451793_1455051 | |||
| 1239 | Ga0451795_0390405 | |||
| 1240 | Ga0451847_0509683 | |||
| 1241 | Ga0451853_3838303 | |||
| 1242 | Ga0439442_002363 | |||
| 1243 | Ga0439434_0001333 | |||
| 1244 | Ga0466969_0009005 | |||
| 1245 | Ga0466969_0020898 | |||
| 1246 | Ga0466969_0022487 | |||
| 1247 | Ga0466969_0084380 | |||
| 1248 | Ga0466972_0015752 | |||
| 1249 | Ga0466972_0017424 | |||
| 1250 | Ga0466972_0020429 | |||
| 1251 | Ga0466972_0051868 | |||
| 1252 | Ga0466972_0052770 | |||
| 1253 | Ga0466972_0055314 | |||
| 1254 | Ga0466972_0081147 | |||
| 1255 | Ga0466965_0000951 | |||
| 1256 | Ga0466965_0001005 | |||
| 1257 | Ga0466965_0006905 | |||
| 1258 | Ga0466965_0009663 | |||
| 1259 | Ga0466965_0010481 | |||
| 1260 | Ga0466965_0012711 | |||
| 1261 | Ga0466965_0030672 | |||
| 1262 | Ga0466965_0091766 | |||
| 1263 | Ga0466966_0001132 | |||
| 1264 | Ga0466966_0004920 | |||
| 1265 | Ga0466966_0010384 | |||
| 1266 | Ga0466966_0018541 | |||
| 1267 | Ga0466966_0018676 | |||
| 1268 | Ga0466966_0026070 | |||
| 1269 | Ga0466966_0180035 | |||
| 1270 | Ga0466966_0212407 | |||
| 1271 | Ga0466961_0000624 | |||
| 1272 | Ga0466961_0003917 | |||
| 1273 | Ga0466961_0039410 | |||
| 1274 | Ga0466963_0001389 | |||
| 1275 | Ga0466963_0180155 | |||
| 1276 | Ga0466964_0094578 | |||
| 1277 | Ga0466971_0001403 | |||
| 1278 | Ga0466971_0074589 | |||
| 1279 | Ga0466971_0118430 | |||
| 1280 | Ga0466968_0000337 | |||
| 1281 | Ga0466968_0001457 | |||
| 1282 | Ga0466968_0010117 | |||
| 1283 | Ga0466968_0015930 | |||
| 1284 | Ga0466970_0005494 | |||
| 1285 | Ga0466970_0014465 | |||
| 1286 | Ga0466970_0014651 | |||
| 1287 | Ga0466970_0023618 | |||
| 1288 | Ga0466970_0023791 | |||
| 1289 | Ga0466970_0043391 | |||
| 1290 | Ga0466970_0049075 | |||
| 1291 | Ga0466957_0003161 | |||
| 1292 | Ga0466957_0010912 | |||
| 1293 | Ga0466957_0105502 | |||
| 1294 | Ga0466960_0001845 | |||
| 1295 | Ga0466960_0014957 | |||
| 1296 | Ga0466960_0017713 | |||
| 1297 | Ga0466960_0028126 | |||
| 1298 | Ga0466960_0030685 | |||
| 1299 | Ga0466960_0051144 | |||
| 1300 | Ga0466959_0003933 | |||
| 1301 | Ga0466959_0009913 | |||
| 1302 | Ga0466959_0013848 | |||
| 1303 | Ga0466959_0014815 | |||
| 1304 | Ga0466959_0020245 | |||
| 1305 | Ga0466959_0037459 | |||
| 1306 | Ga0466959_0162533 | |||
| 1307 | Ga0466958_0001216 | |||
| 1308 | Ga0466958_0021385 | |||
| 1309 | Ga0466958_0029701 | |||
| 1310 | Ga0466958_0040492 | |||
| 1311 | Ga0466967_0000901 | |||
| 1312 | Ga0466967_0002000 | |||
| 1313 | Ga0466967_0018137 | |||
| 1314 | Ga0466967_0052834 | |||
| 1315 | Ga0466967_0408514 | |||
| 1316 | Ga0466967_0473002 | |||
| 1317 | Ga0466967_0568425 | |||
| 1318 | Ga0466967_0665595 | |||
| 1319 | Ga0495580_0443932 | |||
| 1320 | Ga0495582_0046296 | |||
| 1321 | Ga0495607_0023749 | |||
| 1322 | Ga0495583_0010752 | |||
| 1323 | Ga0495648_0011128 | |||
| 1324 | Ga0495665_0018154 | |||
| 1325 | Ga0495586_0284924 | |||
| 1326 | Ga0495668_0000573 | |||
| 1327 | Ga0495658_0280192 | |||
| 1328 | Ga0495613_0197696 | |||
| 1329 | Ga0495581_0002987 | |||
| 1330 | Ga0495672_0001067 | |||
| 1331 | Ga0495676_0128136 | |||
| 1332 | Ga0495683_0001077 | |||
| 1333 | Ga0495683_0177814 | |||
| 1334 | Ga0495673_0001125 | |||
| 1335 | Ga0495686_0060496 | |||
| 1336 | Ga0495593_0036340 | |||
| 1337 | Ga0495602_0501130 | |||
| 1338 | Ga0496100_0005813 | |||
| 1339 | Ga0496100_0020039 | |||
| 1340 | Ga0496100_0022490 | |||
| 1341 | Ga0496100_0037901 | |||
| 1342 | Ga0496101_0000102 | |||
| 1343 | Ga0496101_0000923 | |||
| 1344 | Ga0496101_0005872 | |||
| 1345 | Ga0496101_0082733 | |||
| 1346 | Ga0496101_0335344 | |||
| 1347 | Ga0496102_0000037 | |||
| 1348 | Ga0496102_0000042 | |||
| 1349 | Ga0496102_0066174 | |||
| 1350 | Ga0496102_0120454 | |||
| 1351 | Ga0496102_0123669 | |||
| 1352 | Ga0496102_0165009 | |||
| 1353 | Ga0496102_0507960 | |||
| 1354 | Ga0496103_0000004 | |||
| 1355 | Ga0496103_0000194 | |||
| 1356 | Ga0496103_0094561 | |||
| 1357 | Ga0496103_0138638 | |||
| 1358 | Ga0496104_0041842 | |||
| 1359 | Ga0496104_0658910 | |||
| 1360 | Ga0496104_0686361 | |||
| 1361 | Ga0496105_0010731 | |||
| 1362 | Ga0496105_0012835 | |||
| 1363 | Ga0496105_0044370 | |||
| 1364 | Ga0496105_0128433 | |||
| 1365 | Ga0496106_0001446 | |||
| 1366 | Ga0496106_0001888 | |||
| 1367 | Ga0496106_0149874 | |||
| 1368 | Ga0496106_0187282 | |||
| 1369 | Ga0496107_0000421 | |||
| 1370 | Ga0496107_0000619 | |||
| 1371 | Ga0496107_0008362 | |||
| 1372 | Ga0496107_0419425 | |||
| 1373 | Ga0496108_0000503 | |||
| 1374 | Ga0496108_0030122 | |||
| 1375 | Ga0496108_0042500 | |||
| 1376 | Ga0496108_0270422 | |||
| 1377 | Ga0496108_0587806 | |||
| 1378 | Ga0496108_0588753 | |||
| 1379 | Ga0496109_0003492 | |||
| 1380 | Ga0496109_0030858 | |||
| 1381 | Ga0496109_0139662 | |||
| 1382 | Ga0496109_0155936 | |||
| 1383 | Ga0496109_0166860 | |||
| 1384 | Ga0496109_0211324 | |||
| 1385 | Ga0496109_0234468 | |||
| 1386 | Ga0496109_0725642 | |||
| 1387 | Ga0496110_0002133 | |||
| 1388 | Ga0496110_0081739 | |||
| 1389 | Ga0496110_0087928 | |||
| 1390 | Ga0496110_0104966 | |||
| 1391 | Ga0496110_0121251 | |||
| 1392 | Ga0496110_0259945 | |||
| 1393 | Ga0496111_0005087 | |||
| 1394 | Ga0496111_0043427 | |||
| 1395 | Ga0496111_0056038 | |||
| 1396 | Ga0496112_0002560 | |||
| 1397 | Ga0496112_0006323 | |||
| 1398 | Ga0496112_0153860 | |||
| 1399 | Ga0496113_0263946 | |||
| 1400 | Ga0496114_0000108 | |||
| 1401 | Ga0496114_0001286 | |||
| 1402 | Ga0496114_0239638 | |||
| 1403 | Ga0496115_0002120 | |||
| 1404 | Ga0496115_0002657 | |||
| 1405 | Ga0496116_0000276 | |||
| 1406 | Ga0496116_0000464 | |||
| 1407 | Ga0496117_0000003 | |||
| 1408 | Ga0496117_0000339 | |||
| 1409 | Ga0496118_0000001 | |||
| 1410 | Ga0496118_0000241 | |||
| 1411 | Ga0496119_0006204 | |||
| 1412 | Ga0496119_0190165 | |||
| 1413 | Ga0496120_0009654 | |||
| 1414 | Ga0496120_0025940 | |||
| 1415 | Ga0496120_0066814 | |||
| 1416 | Ga0496121_0000338 | |||
| 1417 | Ga0496121_0004853 | |||
| 1418 | Ga0496121_0207228 | |||
| 1419 | Ga0496122_0014665 | |||
| 1420 | Ga0496125_0020171 | |||
| 1421 | Ga0496125_0029988 | |||
| 1422 | Ga0496125_0090141 | |||
| 1423 | Ga0496125_0430899 | |||
| 1424 | Ga0496126_0000551 | |||
| 1425 | Ga0496126_0001408 | |||
| 1426 | Ga0496126_0005413 | |||
| 1427 | Ga0496126_0132182 | |||
| 1428 | Ga0501323_007713 | |||
| 1429 | Ga0501032_0003747 | |||
| 1430 | Ga0501034_0010132 | |||
| 1431 | Ga0501034_0357975 | |||
| 1432 | Ga0501034_0408933 | |||
| 1433 | Ga0501036_0020079 | |||
| 1434 | Ga0501037_0003118 | |||
| 1435 | Ga0501038_0013261 | |||
| 1436 | Ga0501039_0004952 | |||
| 1437 | Ga0501043_0000411 | |||
| 1438 | Ga0501047_0051724 | |||
| 1439 | Ga0501067_0169989 | |||
| 1440 | Ga0501068_0196361 | |||
| 1441 | Ga0501070_0000614 | |||
| 1442 | Ga0501071_0055114 | |||
| 1443 | Ga0501073_0041110 | |||
| 1444 | Ga0501075_0223706 | |||
| 1445 | Ga0501076_0571253 | |||
| 1446 | Ga0501077_0169483 | |||
| 1447 | Ga0501079_0287235 | |||
| 1448 | Ga0501080_0404955 | |||
| 1449 | Ga0501044_0132344 | |||
| 1450 | nmdc:mga03683_63843_c1 | |||
| 1451 | nmdc:mga03n38_13056_c2 | |||
| 1452 | nmdc:mga03n38_22356_c1 | |||
| 1453 | nmdc:mga03n38_286877_c1 | |||
| 1454 | nmdc:mga03n38_3780_c1 | |||
| 1455 | nmdc:mga03n38_38539_c1 | |||
| 1456 | nmdc:mga03n38_821_c1 | |||
| 1457 | nmdc:mga00v17_209296_c1 | |||
| 1458 | nmdc:mga00v17_27231_c1 | |||
| 1459 | nmdc:mga00v17_28138_c1 | |||
| 1460 | nmdc:mga00v17_33451_c1 | |||
| 1461 | nmdc:mga00v17_721_c1 | |||
| 1462 | nmdc:mga0yw44_1318_c1 | |||
| 1463 | nmdc:mga0yw44_240021_c1 | |||
| 1464 | nmdc:mga0yw44_392639_c1 | |||
| 1465 | nmdc:mga0yw44_41158_c1 | |||
| 1466 | nmdc:mga0yw44_6798_c1 | |||
| 1467 | nmdc:mga07m45_107212_c1 | |||
| 1468 | nmdc:mga07m45_124658_c1 | |||
| 1469 | nmdc:mga07m45_138721_c1 | |||
| 1470 | nmdc:mga07m45_162330_c1 | |||
| 1471 | nmdc:mga07m45_352395_c1 | |||
| 1472 | nmdc:mga07m45_50346_c1 | |||
| 1473 | nmdc:mga09592_280967_c1 | |||
| 1474 | nmdc:mga0qj67_16695_c1 | |||
| 1475 | nmdc:mga0qj67_194194_c1 | |||
| 1476 | nmdc:mga0qj67_467975_c1 | |||
| 1477 | nmdc:mga06r32_117_c5 | |||
| 1478 | nmdc:mga06r32_17373_c2 | |||
| 1479 | nmdc:mga08y16_43822_c1 | |||
| 1480 | nmdc:mga08y16_559411_c1 | |||
| 1481 | nmdc:mga0sz30_122136_c1 | |||
| 1482 | nmdc:mga0sz30_377_c1 | |||
| 1483 | nmdc:mga0sz30_642_c1 | |||
| 1484 | nmdc:mga0sz30_77257_c1 | |||
| 1485 | nmdc:mga0sz30_88991_c1 | |||
| 1486 | Ga0500610_0008219 | |||
| 1487 | Ga0500635_0000607 | |||
| 1488 | Ga0500643_023377 | |||
| 1489 | Ga0500643_035599 | |||
| 1490 | Ga0500556_0003107 | |||
| 1491 | Ga0500562_034019 | |||
| 1492 | Ga0500572_065475 | |||
| 1493 | Ga0500652_005412 | |||
| 1494 | Ga0500652_009681 | |||
| 1495 | Ga0500658_0159404 | |||
| 1496 | Ga0500559_0002526 | |||
| 1497 | Ga0500589_129723 | |||
| 1498 | Ga0500616_0024990 | |||
| 1499 | Ga0500616_0079747 | |||
| 1500 | Ga0500620_101342 | |||
| 1501 | Ga0500627_0028398 | |||
| 1502 | Ga0500645_000668 | |||
| 1503 | Ga0466962_0001545 | |||
| 1504 | Ga0466962_0033283 | |||
| 1505 | Ga0466962_0039089 | |||
| 1506 | 2523382799 | |||
| 1507 | 2548697863 | |||
| 1508 | 2552109519 | |||
| 1509 | 2558910906 | |||
| 1510 | 2559429635 | |||
| 1511 | 2566993084 | |||
| 1512 | 2583150443 | |||
| 1513 | 2586059312 | |||
| 1514 | 2644513017 | |||
| 1515 | 2738706084 | |||
| 1516 | 2739238719 | |||
| 1517 | 2739333016 | |||
| 1518 | 2739362202 | |||
| 1519 | 2744957122 | |||
| 1520 | 2753035251 | |||
| 1521 | 2753070750 | |||
| 1522 | 2753323768 | |||
| 1523 | 2791915385 | |||
| 1524 | 2795783479 | |||
| 1525 | 2809591930 | |||
| 1526 | 2816504643 | |||
| 1527 | 2863071070 | |||
| 1528 | 2866552670 | |||
| 1529 | 2866616852 | |||
| 1530 | 2870726680 | |||
| 1531 | 2870789101 | |||
| 1532 | 2889300992 | |||
| 1533 | 2891327591 | |||
| 1534 | 2899364137 | |||
| 1535 | 2899373305 | |||
| 1536 | 2902801619 | |||
| 1537 | 2904538922 | |||
| 1538 | 2915361595 | |||
| 1539 | 2915773338 | |||
| 1540 | 2917738936 | |||
| 1541 | 2919715962 | |||
| 1542 | 2922556780 | |||
| 1543 | 2939587262 | |||
| 1544 | 2939744511 | |||
| 1545 | 2956940445 | |||
| 1546 | 2974317259 | |||
| 1547 | 2984525464 | |||
| 1548 | 3001121870 | |||
| 1549 | 8003322504 | |||
| 1550 | 8047718035 | |||
| 1551 | 8054474295 | |||
| 1552 | 8056212007 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jof-assembly1.cif.gz_A-2 | crystal structure of trmd from mycobacterium tuberculosis in complex with active-site inhibitor | 0.9443 | 1 | 222 |
| 5zhj-assembly1.cif.gz_A-2 | crystal structure of trmd from mycobacterium tuberculosis in complex with s-adenosyl homocysteine (sah) | 0.9435 | 1 | 222 |
| 5zhi-assembly1.cif.gz_A | apo crystal structure of trmd from mycobacterium tuberculosis | 0.9419 | 1 | 222 |
| 6qr5-assembly1.cif.gz_B | crystal structure of trmd, a trna-(n1g37) methyltransferase, from mycobacterium abscessus in complex with inhibitor | 0.9401 | 1 | 224 |
| 6qqs-assembly1.cif.gz_B | crystal structure of trmd, a trna-(n1g37) methyltransferase, from mycobacterium abscessus in complex with inhibitor | 0.9396 | 1 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5zhkA02 | Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 | 0.9958 | 175 | 223 | 1.10.1270.20 |
| 3quvB02 | Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 | 0.9925 | 174 | 224 | 1.10.1270.20 |
| 5zhlA02 | Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 | 0.9925 | 175 | 223 | 1.10.1270.20 |
| 1uajA02 | Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 | 0.9839 | 175 | 225 | 1.10.1270.20 |
| 4yq2A02 | Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 | 0.9813 | 174 | 224 | 1.10.1270.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S9F6U5-F1-model_v4 | tRNA (Guanosine(37)-N1)-methyltransferase TrmD | 0.9984 | 1 | 103 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A2S9F6U5-F1-model_v4 | tRNA (Guanosine(37)-N1)-methyltransferase TrmD | 0.9888 | 1 | 103 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A810MMS7-F1-model_v4 | deleted | 0.9853 | 1 | 134 |
|
| AF-A0A2W4J503-F1-model_v4 | tRNA (Guanosine(37)-N1)-methyltransferase TrmD | 0.9794 | 1 | 125 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A7K1CTM7-F1-model_v4 | tRNA (Guanosine(37)-N1)-methyltransferase TrmD (EC 2.1.1.228) | 0.9764 | 1 | 171 |
GO:0002939
GO:0005829 GO:0052906 |