F480275

General Info

Members Datasets Scaffolds Average Seq Length
775 294 1550 152

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0252666|Ga0495629_0252666_84_632
Length 182
Sequence MITTCCALELTGTLWRTAYTASWARCPTLFTVTLYAAYGANLDPARMGERCPHSPLRGTGWLEGWRLTFGGEDHGWDGALTMIVQDTYEQVFVAVYDVTPEDAEALDRWESADTGLYRKVRVRIATLTGEVVAWTYVLDAFEGGLPSASSLGLIADAAEAADAPDDYVAALRARPCRSVFGG

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
149 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
150 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
170 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
171 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
172 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
173 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
174 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
175 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
176 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
177 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
178 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
181 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
182 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
256 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
270 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
271 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
272 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
277 2643221576 Nocardioides sp. Root614 Isolate Unclassified
278 2643221590 Nocardioides sp. Root682 Isolate Unclassified
279 2643221604 Nocardioides sp. Root190 Isolate Unclassified
280 2643221615 Nocardioides sp. Root224 Isolate Unclassified
281 2643221617 Nocardioides sp. Root79 Isolate Unclassified
282 2643221620 Nocardioides sp. Root240 Isolate Unclassified
283 2643221641 Nocardioides sp. Root122 Isolate Unclassified
284 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
285 2738541305 Nocardioides sp. CF167 Isolate Unclassified
286 2739367898 Nocardioides sp. CF479 Isolate Unclassified
287 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
288 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
289 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
290 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
291 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
292 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
293 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
294 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.03
Metatranscriptomes 0.65
Isolates 2.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.74
Nodule 0.13
Rhizoplane 6.58
Rhizosphere 77.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0252666 3300046459 Bacteria 1213
2 LJQas_1002755 3300000549 Bacteria 2414
3 JGI24740J21852_10032381 3300001979 Bacteria 1672
4 JGI24735J21928_10012347 3300002067 Bacteria 2701
5 JGI24735J21928_10055787 3300002067 Bacteria 1138
6 JGI24744J21845_10003006 3300002077 Bacteria 3457
7 JGI25407J50210_10006607 3300003373 Bacteria 2893
8 Ga0006562J51391_1175765 3300003578 Bacteria 1420
9 Ga0070658_10035184 3300005327 Bacteria 4033
10 Ga0070658_10441630 3300005327 Bacteria 1120
11 Ga0070658_11035347 3300005327 Bacteria 714
12 Ga0070683_100004659 3300005329 Bacteria 11331
13 Ga0070683_100027032 3300005329 Bacteria 5172
14 Ga0070683_100029923 3300005329 Bacteria 4938
15 Ga0070683_100149584 3300005329 Bacteria 2213
16 Ga0070683_100582798 3300005329 Bacteria 1070
17 Ga0070683_100699153 3300005329 Bacteria 971
18 Ga0070683_101144521 3300005329 Bacteria 748
19 Ga0070683_101859155 3300005329 Bacteria 579
20 Ga0070690_100257503 3300005330 Bacteria 1236
21 Ga0070677_10324251 3300005333 Bacteria 790
22 Ga0068869_100740792 3300005334 Bacteria 841
23 Ga0070680_100054868 3300005336 Bacteria 3255
24 Ga0070680_100319455 3300005336 Bacteria 1318
25 Ga0070680_100575666 3300005336 Bacteria 966
26 Ga0070682_100093391 3300005337 Bacteria 1973
27 Ga0068868_100070101 3300005338 Bacteria 2795
28 Ga0068868_100242481 3300005338 Bacteria 1515
29 Ga0068868_100561719 3300005338 Bacteria 1007
30 Ga0070660_100018274 3300005339 Bacteria 5121
31 Ga0070660_100179277 3300005339 Bacteria 1714
32 Ga0070660_100399705 3300005339 Bacteria 1136
33 Ga0070660_100460931 3300005339 Bacteria 1055
34 Ga0070660_100755558 3300005339 Bacteria 816
35 Ga0070691_10026956 3300005341 Bacteria 2680
36 Ga0070687_100047908 3300005343 Bacteria 2195
37 Ga0070692_10006618 3300005345 Bacteria 5042
38 Ga0070669_100182969 3300005353 Bacteria 1640
39 Ga0070669_101495334 3300005353 Bacteria 587
40 Ga0070675_100119871 3300005354 Bacteria 2235
41 Ga0070675_100506184 3300005354 Bacteria 1089
42 Ga0070671_100693254 3300005355 Bacteria 883
43 Ga0070674_100022506 3300005356 Bacteria 4066
44 Ga0070674_100974092 3300005356 Bacteria 743
45 Ga0070674_101030395 3300005356 Bacteria 724
46 Ga0070674_101095993 3300005356 Bacteria 703
47 Ga0070673_100079972 3300005364 Bacteria 2648
48 Ga0070673_100949415 3300005364 Bacteria 799
49 Ga0070659_100006245 3300005366 Bacteria 8612
50 Ga0070659_100257638 3300005366 Bacteria 1447
51 Ga0070659_100302810 3300005366 Bacteria 1333
52 Ga0070659_100514927 3300005366 Bacteria 1021
53 Ga0070659_100614224 3300005366 Bacteria 935
54 Ga0070667_100333120 3300005367 Bacteria 1372
55 Ga0070701_10009958 3300005438 Bacteria 4186
56 Ga0070700_100000039 3300005441 Bacteria 108248
57 Ga0070700_100001966 3300005441 Bacteria 10435
58 Ga0070700_100033259 3300005441 Bacteria 3104
59 Ga0070700_100051422 3300005441 Bacteria 2564
60 Ga0070663_100006719 3300005455 Bacteria 6941
61 Ga0070663_100246667 3300005455 Bacteria 1412
62 Ga0070678_100298613 3300005456 Bacteria 1368
63 Ga0070678_100346731 3300005456 Bacteria 1275
64 Ga0070662_100357958 3300005457 Bacteria 1197
65 Ga0070681_10022667 3300005458 Bacteria 6309
66 Ga0070681_10277285 3300005458 Bacteria 1588
67 Ga0070681_11570855 3300005458 Bacteria 583
68 Ga0068867_100031851 3300005459 Bacteria 3810
69 Ga0070685_10019490 3300005466 Bacteria 3661
70 Ga0070707_100769948 3300005468 Bacteria 926
71 Ga0070698_100002871 3300005471 Bacteria 18973
72 Ga0070679_100025139 3300005530 Bacteria 5841
73 Ga0070684_100001579 3300005535 Bacteria 16458
74 Ga0070684_100040859 3300005535 Bacteria 3995
75 Ga0070684_100107036 3300005535 Bacteria 2504
76 Ga0070684_100248431 3300005535 Bacteria 1626
77 Ga0070684_100267042 3300005535 Bacteria 1566
78 Ga0070684_100442508 3300005535 Bacteria 1201
79 Ga0068853_101888862 3300005539 Bacteria 579
80 Ga0070672_100175198 3300005543 Bacteria 1785
81 Ga0070672_100470748 3300005543 Bacteria 1084
82 Ga0070686_100136798 3300005544 Bacteria 1701
83 Ga0070686_100594485 3300005544 Bacteria 871
84 Ga0070693_100092467 3300005547 Bacteria 1826
85 Ga0070693_100804089 3300005547 Bacteria 697
86 Ga0070665_100000523 3300005548 Bacteria 54648
87 Ga0070665_100879297 3300005548 Bacteria 909
88 Ga0070665_101406387 3300005548 Bacteria 707
89 Ga0070704_100336137 3300005549 Bacteria 1270
90 Ga0070704_101620294 3300005549 Bacteria 597
91 Ga0068857_100004178 3300005577 Bacteria 12158
92 Ga0068857_101056069 3300005577 Bacteria 783
93 Ga0068857_101286069 3300005577 Bacteria 710
94 Ga0068856_100059526 3300005614 Bacteria 3773
95 Ga0068856_100368198 3300005614 Bacteria 1456
96 Ga0068856_100468234 3300005614 Bacteria 1281
97 Ga0070702_100022009 3300005615 Bacteria 3364
98 Ga0070702_100030879 3300005615 Bacteria 2925
99 Ga0070702_100056140 3300005615 Bacteria 2273
100 Ga0070702_101262966 3300005615 Bacteria 598
101 Ga0068852_100022107 3300005616 Bacteria 5093
102 Ga0068852_100402374 3300005616 Bacteria 1347
103 Ga0068852_100847138 3300005616 Bacteria 930
104 Ga0068864_100047320 3300005618 Bacteria 3693
105 Ga0068864_100717708 3300005618 Bacteria 977
106 Ga0068864_101072696 3300005618 Bacteria 801
107 Ga0068866_10077300 3300005718 Bacteria 1777
108 Ga0068866_10281084 3300005718 Bacteria 1031
109 Ga0068866_10594888 3300005718 Bacteria 746
110 Ga0068861_100031124 3300005719 Bacteria 3916
111 Ga0068861_100138136 3300005719 Bacteria 1986
112 Ga0068861_100328667 3300005719 Bacteria 1334
113 Ga0068851_10194251 3300005834 Bacteria 1130
114 Ga0068870_10003248 3300005840 Bacteria 6864
115 Ga0068858_100550495 3300005842 Bacteria 1117
116 Ga0068860_100000286 3300005843 Bacteria 71981
117 Ga0068862_100286247 3300005844 Bacteria 1512
118 Ga0081455_10000683 3300005937 Bacteria 44068
119 Ga0081455_10009572 3300005937 Bacteria 9951
120 Ga0081538_10000079 3300005981 Bacteria 92419
121 Ga0081538_10037722 3300005981 Bacteria 3128
122 Ga0081539_10059110 3300005985 Bacteria 2112
123 Ga0075365_10040888 3300006038 Bacteria 3026
124 Ga0075365_10051412 3300006038 Bacteria 2722
125 Ga0075365_10065046 3300006038 Bacteria 2444
126 Ga0075365_10115722 3300006038 Bacteria 1846
127 Ga0075365_10122132 3300006038 Bacteria 1797
128 Ga0075365_10229000 3300006038 Bacteria 1304
129 Ga0075365_10249044 3300006038 Bacteria 1248
130 Ga0075365_10291410 3300006038 Bacteria 1148
131 Ga0075365_10427127 3300006038 Bacteria 935
132 Ga0075365_10902740 3300006038 Bacteria 623
133 Ga0075368_10003590 3300006042 Bacteria 5203
134 Ga0075368_10028252 3300006042 Bacteria 2166
135 Ga0075368_10065894 3300006042 Bacteria 1455
136 Ga0075368_10132218 3300006042 Bacteria 1037
137 Ga0075368_10166198 3300006042 Bacteria 926
138 Ga0075363_100000232 3300006048 Bacteria 15544
139 Ga0075363_100001920 3300006048 Bacteria 8237
140 Ga0075363_100002189 3300006048 Bacteria 7875
141 Ga0075363_100092200 3300006048 Bacteria 1668
142 Ga0075363_100216607 3300006048 Bacteria 1097
143 Ga0075363_100225044 3300006048 Bacteria 1076
144 Ga0075363_100277219 3300006048 Bacteria 969
145 Ga0075364_10003485 3300006051 Bacteria 8959
146 Ga0075364_10009085 3300006051 Bacteria 5953
147 Ga0075364_10085551 3300006051 Bacteria 2088
148 Ga0075364_10136296 3300006051 Bacteria 1649
149 Ga0075364_10207823 3300006051 Bacteria 1327
150 Ga0075364_10317721 3300006051 Bacteria 1060
151 Ga0075364_10429055 3300006051 Bacteria 903
152 Ga0075364_10458143 3300006051 Bacteria 871
153 Ga0075362_10007025 3300006177 Bacteria 4230
154 Ga0075362_10067345 3300006177 Bacteria 1629
155 Ga0075367_10005910 3300006178 Bacteria 6138
156 Ga0075367_10079843 3300006178 Bacteria 1978
157 Ga0075367_10087131 3300006178 Bacteria 1896
158 Ga0075367_10161460 3300006178 Bacteria 1394
159 Ga0075367_10363754 3300006178 Bacteria 913
160 Ga0075367_10409748 3300006178 Bacteria 858
161 Ga0075367_10475279 3300006178 Bacteria 792
162 Ga0075370_10044228 3300006353 Bacteria 2517
163 Ga0068871_100827139 3300006358 Bacteria 855
164 Ga0075430_100600590 3300006846 Bacteria 908
165 Ga0075431_100004927 3300006847 Bacteria 13146
166 Ga0075431_100371444 3300006847 Bacteria 1435
167 Ga0075429_100141361 3300006880 Bacteria 2107
168 Ga0068865_100006555 3300006881 Bacteria 7114
169 Ga0068865_100217716 3300006881 Bacteria 1491
170 Ga0068865_100614782 3300006881 Bacteria 920
171 Ga0068865_100667403 3300006881 Bacteria 885
172 Ga0068865_101096558 3300006881 Bacteria 701
173 Ga0105240_12475686 3300009093 Bacteria 537
174 Ga0111539_10038144 3300009094 Bacteria 5797
175 Ga0111539_10122086 3300009094 Bacteria 3053
176 Ga0105245_10011262 3300009098 Bacteria 7787
177 Ga0105245_10369019 3300009098 Bacteria 1426
178 Ga0105245_10825575 3300009098 Bacteria 966
179 Ga0105247_11106163 3300009101 Bacteria 625
180 Ga0105243_10005950 3300009148 Bacteria 9448
181 Ga0105243_10119303 3300009148 Bacteria 2221
182 Ga0105243_10513334 3300009148 Bacteria 1138
183 Ga0105243_10618473 3300009148 Bacteria 1045
184 Ga0105243_10748498 3300009148 Bacteria 958
185 Ga0105242_10123422 3300009176 Bacteria 2226
186 Ga0105248_10562490 3300009177 Bacteria 1286
187 Ga0105237_10036174 3300009545 Bacteria 4995
188 Ga0105237_10119260 3300009545 Bacteria 2632
189 Ga0105237_10559264 3300009545 Bacteria 1151
190 Ga0105238_10562938 3300009551 Bacteria 1145
191 Ga0105238_10600819 3300009551 Bacteria 1108
192 Ga0105238_11142899 3300009551 Bacteria 802
193 Ga0105249_10081780 3300009553 Bacteria 3003
194 Ga0105249_10668524 3300009553 Bacteria 1097
195 Ga0105249_11184972 3300009553 Bacteria 835
196 Ga0105239_10050783 3300010375 Bacteria 4547
197 Ga0105239_10083293 3300010375 Bacteria 3522
198 Ga0105239_10983367 3300010375 Bacteria 970
199 Ga0105246_10002002 3300011119 Bacteria 12302
200 Ga0105246_10219380 3300011119 Bacteria 1490
201 Ga0105246_10224872 3300011119 Bacteria 1474
202 Ga0105246_10542440 3300011119 Bacteria 995
203 Ga0157373_10467122 3300013100 Bacteria 909
204 Ga0157371_10654102 3300013102 Bacteria 784
205 Ga0157370_10583286 3300013104 Bacteria 1024
206 Ga0157370_10612648 3300013104 Bacteria 996
207 Ga0157369_10057344 3300013105 Bacteria 4202
208 Ga0157369_10639589 3300013105 Bacteria 1097
209 Ga0157369_11084969 3300013105 Bacteria 818
210 Ga0157369_11454602 3300013105 Bacteria 697
211 Ga0157369_12153930 3300013105 Bacteria 565
212 Ga0157374_10521517 3300013296 Bacteria 1194
213 Ga0157374_11105875 3300013296 Bacteria 813
214 Ga0157372_10413162 3300013307 Bacteria 1572
215 Ga0157372_10556548 3300013307 Bacteria 1337
216 Ga0157372_11604016 3300013307 Bacteria 749
217 Ga0157372_12286771 3300013307 Bacteria 621
218 Ga0157375_10136514 3300013308 Bacteria 2577
219 Ga0157375_10619203 3300013308 Bacteria 1241
220 Ga0157375_10626430 3300013308 Bacteria 1233
221 Ga0157375_11068121 3300013308 Bacteria 944
222 Ga0163163_10225866 3300014325 Bacteria 1921
223 Ga0163163_10279849 3300014325 Bacteria 1720
224 Ga0163163_10566928 3300014325 Bacteria 1198
225 Ga0163163_11163158 3300014325 Bacteria 834
226 Ga0157380_10002869 3300014326 Bacteria 11702
227 Ga0157380_10126266 3300014326 Bacteria 2175
228 Ga0157380_10315301 3300014326 Bacteria 1447
229 Ga0157377_10245132 3300014745 Bacteria 1159
230 Ga0157379_10330130 3300014968 Bacteria 1394
231 Ga0157379_10813241 3300014968 Bacteria 883
232 Ga0157376_10443030 3300014969 Bacteria 1265
233 Ga0157376_10620474 3300014969 Bacteria 1078
234 Ga0157376_11767729 3300014969 Bacteria 654
235 Ga0163161_11044902 3300017792 Bacteria 699
236 Ga0163161_11490325 3300017792 Bacteria 593
237 Ga0206356_10110722 3300020070 Bacteria 2106
238 Ga0206354_10529662 3300020081 Bacteria 760
239 Ga0206353_11131302 3300020082 Bacteria 11686
240 Ga0206353_11162912 3300020082 Bacteria 974
241 Ga0207642_10061156 3300025899 Bacteria 1750
242 Ga0207642_10542802 3300025899 Bacteria 717
243 Ga0207642_10892461 3300025899 Bacteria 569
244 Ga0207688_10024975 3300025901 Bacteria 3279
245 Ga0207647_10042483 3300025904 Bacteria 2852
246 Ga0207643_10001251 3300025908 Bacteria 14931
247 Ga0207705_10043892 3300025909 Bacteria 3212
248 Ga0207705_10373166 3300025909 Bacteria 1101
249 Ga0207707_10014821 3300025912 Bacteria 6790
250 Ga0207707_10106355 3300025912 Bacteria 2452
251 Ga0207707_10737619 3300025912 Bacteria 825
252 Ga0207695_10102334 3300025913 Bacteria 2857
253 Ga0207671_10159610 3300025914 Bacteria 1745
254 Ga0207660_10040106 3300025917 Bacteria 3276
255 Ga0207660_10281922 3300025917 Bacteria 1319
256 Ga0207662_10017194 3300025918 Bacteria 4089
257 Ga0207662_10086318 3300025918 Bacteria 1923
258 Ga0207662_10105131 3300025918 Bacteria 1754
259 Ga0207657_10016912 3300025919 Bacteria 7018
260 Ga0207657_10020370 3300025919 Bacteria 6268
261 Ga0207657_10040916 3300025919 Bacteria 4103
262 Ga0207657_10059434 3300025919 Bacteria 3284
263 Ga0207657_10171185 3300025919 Bacteria 1759
264 Ga0207657_10250429 3300025919 Bacteria 1412
265 Ga0207657_10394495 3300025919 Bacteria 1089
266 Ga0207649_10208702 3300025920 Bacteria 1384
267 Ga0207652_10352412 3300025921 Bacteria 1328
268 Ga0207652_10357225 3300025921 Bacteria 1319
269 Ga0207646_10625076 3300025922 Bacteria 966
270 Ga0207681_10140973 3300025923 Bacteria 1795
271 Ga0207694_10299842 3300025924 Bacteria 1323
272 Ga0207694_10781414 3300025924 Bacteria 806
273 Ga0207694_10981298 3300025924 Bacteria 715
274 Ga0207694_11447076 3300025924 Bacteria 580
275 Ga0207650_10110656 3300025925 Bacteria 2126
276 Ga0207650_11357537 3300025925 Bacteria 605
277 Ga0207659_10074597 3300025926 Bacteria 2486
278 Ga0207659_11139669 3300025926 Bacteria 671
279 Ga0207687_10011610 3300025927 Bacteria 5756
280 Ga0207687_10028805 3300025927 Bacteria 3732
281 Ga0207687_10167568 3300025927 Bacteria 1691
282 Ga0207687_10371797 3300025927 Bacteria 1169
283 Ga0207687_10544057 3300025927 Bacteria 973
284 Ga0207690_10066640 3300025932 Bacteria 2467
285 Ga0207690_10284882 3300025932 Bacteria 1288
286 Ga0207706_10041514 3300025933 Bacteria 4078
287 Ga0207706_10370100 3300025933 Bacteria 1244
288 Ga0207686_10052231 3300025934 Bacteria 2550
289 Ga0207709_10015799 3300025935 Bacteria 4190
290 Ga0207709_10120131 3300025935 Bacteria 1773
291 Ga0207709_10130395 3300025935 Bacteria 1712
292 Ga0207709_10198442 3300025935 Bacteria 1431
293 Ga0207709_10516739 3300025935 Bacteria 934
294 Ga0207669_10563181 3300025937 Bacteria 921
295 Ga0207704_10060254 3300025938 Bacteria 2347
296 Ga0207704_10360074 3300025938 Bacteria 1135
297 Ga0207704_10482383 3300025938 Bacteria 996
298 Ga0207691_10107914 3300025940 Bacteria 2478
299 Ga0207711_10201422 3300025941 Bacteria 1816
300 Ga0207661_10010333 3300025944 Bacteria 6716
301 Ga0207661_10027406 3300025944 Bacteria 4352
302 Ga0207661_10059844 3300025944 Bacteria 3071
303 Ga0207661_10130532 3300025944 Bacteria 2151
304 Ga0207661_10205030 3300025944 Bacteria 1735
305 Ga0207661_10278299 3300025944 Bacteria 1495
306 Ga0207661_10515463 3300025944 Bacteria 1093
307 Ga0207661_10669249 3300025944 Bacteria 954
308 Ga0207661_10733807 3300025944 Bacteria 909
309 Ga0207661_11674624 3300025944 Bacteria 581
310 Ga0207679_10175835 3300025945 Bacteria 1767
311 Ga0207667_10321708 3300025949 Bacteria 1580
312 Ga0207668_10392054 3300025972 Bacteria 1172
313 Ga0207658_10312248 3300025986 Bacteria 1358
314 Ga0207703_10072450 3300026035 Bacteria 2848
315 Ga0207639_10655160 3300026041 Bacteria 972
316 Ga0207639_11414792 3300026041 Bacteria 653
317 Ga0207678_10025211 3300026067 Bacteria 5191
318 Ga0207678_10110929 3300026067 Bacteria 2340
319 Ga0207678_10455498 3300026067 Bacteria 1112
320 Ga0207678_10565910 3300026067 Bacteria 995
321 Ga0207708_10000044 3300026075 Bacteria 120765
322 Ga0207708_10000897 3300026075 Bacteria 22343
323 Ga0207708_10043248 3300026075 Bacteria 3433
324 Ga0207708_10072658 3300026075 Bacteria 2636
325 Ga0207702_10057754 3300026078 Bacteria 3300
326 Ga0207702_10136174 3300026078 Bacteria 2216
327 Ga0207702_10411620 3300026078 Bacteria 1306
328 Ga0207648_10001889 3300026089 Bacteria 22892
329 Ga0207648_11413122 3300026089 Bacteria 654
330 Ga0207676_10768216 3300026095 Bacteria 938
331 Ga0207674_10004262 3300026116 Bacteria 17251
332 Ga0207674_10468516 3300026116 Bacteria 1217
333 Ga0207674_10720167 3300026116 Bacteria 963
334 Ga0207675_100035843 3300026118 Bacteria 4628
335 Ga0207675_100053691 3300026118 Bacteria 3760
336 Ga0207675_100344647 3300026118 Bacteria 1459
337 Ga0207675_100443112 3300026118 Bacteria 1286
338 Ga0207698_10098770 3300026142 Bacteria 2413
339 Ga0207698_10963363 3300026142 Bacteria 863
340 Ga0207698_12494229 3300026142 Bacteria 527
341 Ga0209983_1106284 3300027665 Bacteria 637
342 Ga0209813_10001140 3300027866 Bacteria 5927
343 Ga0209813_10050083 3300027866 Bacteria 1302
344 Ga0209813_10106919 3300027866 Bacteria 959
345 Ga0209813_10115713 3300027866 Bacteria 928
346 Ga0207428_10097301 3300027907 Bacteria 2278
347 Ga0207428_10097889 3300027907 Bacteria 2270
348 Ga0268266_10034359 3300028379 Bacteria 4312
349 Ga0268266_10153210 3300028379 Bacteria 2080
350 Ga0268266_11115495 3300028379 Bacteria 763
351 Ga0268265_10742412 3300028380 Bacteria 952
352 Ga0268264_10000246 3300028381 Bacteria 102361
353 Ga0316183_1174096 3300030742 Bacteria 1534
354 Ga0316181_1089569 3300030744 Bacteria 982
355 Ga0316575_10048262 3300031665 Bacteria 1693
356 Ga0307516_10341691 3300031730 Bacteria 1164
357 Ga0307405_10075967 3300031731 Bacteria 2178
358 Ga0307405_10180213 3300031731 Bacteria 1516
359 Ga0307405_10388776 3300031731 Bacteria 1088
360 Ga0307405_10471812 3300031731 Bacteria 1000
361 Ga0307413_10035363 3300031824 Bacteria 2864
362 Ga0307413_10513365 3300031824 Bacteria 965
363 Ga0307413_10717403 3300031824 Bacteria 832
364 Ga0307410_10299751 3300031852 Bacteria 1268
365 Ga0307410_10351003 3300031852 Bacteria 1179
366 Ga0307410_10356618 3300031852 Bacteria 1170
367 Ga0307410_10637069 3300031852 Bacteria 893
368 Ga0307407_10016322 3300031903 Bacteria 3695
369 Ga0307407_10026328 3300031903 Bacteria 3077
370 Ga0307407_10301384 3300031903 Bacteria 1117
371 Ga0307407_10414188 3300031903 Bacteria 970
372 Ga0307412_10034593 3300031911 Bacteria 3221
373 Ga0307412_10256737 3300031911 Bacteria 1360
374 Ga0307409_100113295 3300031995 Bacteria 2279
375 Ga0307409_100178897 3300031995 Bacteria 1875
376 Ga0307409_100333145 3300031995 Bacteria 1425
377 Ga0307409_100510541 3300031995 Bacteria 1172
378 Ga0307409_100734210 3300031995 Bacteria 990
379 Ga0307409_100774180 3300031995 Bacteria 965
380 Ga0307409_101313684 3300031995 Bacteria 748
381 Ga0307409_101761789 3300031995 Bacteria 648
382 Ga0307409_101811738 3300031995 Bacteria 639
383 Ga0307416_100020676 3300032002 Bacteria 4704
384 Ga0307416_100082471 3300032002 Bacteria 2724
385 Ga0307416_100094479 3300032002 Bacteria 2578
386 Ga0307416_101084811 3300032002 Bacteria 905
387 Ga0307416_102036405 3300032002 Bacteria 676
388 Ga0307414_10233123 3300032004 Bacteria 1519
389 Ga0307414_10767843 3300032004 Bacteria 877
390 Ga0307411_10032073 3300032005 Bacteria 3242
391 Ga0307411_10940769 3300032005 Bacteria 770
392 Ga0307415_100024263 3300032126 Bacteria 3783
393 Ga0307415_100044034 3300032126 Bacteria 2981
394 Ga0307415_100045688 3300032126 Bacteria 2938
395 Ga0307415_100313661 3300032126 Bacteria 1304
396 Ga0307415_100550102 3300032126 Bacteria 1018
397 Ga0307415_100766460 3300032126 Bacteria 877
398 Ga0307415_102120151 3300032126 Bacteria 549
399 Ga0373942_0141682 3300035207 Bacteria 766
400 Ga0373931_0176569 3300035691 Bacteria 1262
401 Ga0395899_0000958 3300037312 Bacteria 26854
402 Ga0395899_0025271 3300037312 Bacteria 4484
403 Ga0395900_0087146 3300037418 Bacteria 3209
404 Ga0395900_0155420 3300037418 Bacteria 2336
405 Ga0395898_0036082 3300037466 Bacteria 4911
406 Ga0395905_0275068 3300037471 Bacteria 1570
407 Ga0395905_0481063 3300037471 Bacteria 1141
408 Ga0395901_0050999 3300038443 Bacteria 4300
409 Ga0395901_0134080 3300038443 Bacteria 2603
410 Ga0395901_0356667 3300038443 Bacteria 1509
411 Ga0395901_0586927 3300038443 Bacteria 1125
412 Ga0395901_1054265 3300038443 Bacteria 786
413 Ga0395901_1422566 3300038443 Bacteria 651
414 Ga0439438_040752 3300041405 Bacteria 1206
415 Ga0439438_098601 3300041405 Bacteria 710
416 Ga0439461_0020562 3300041410 Bacteria 1308
417 Ga0451791_0905152 3300041451 Bacteria 696
418 Ga0451797_0239511 3300041453 Bacteria 619
419 Ga0451800_0188691 3300041459 Bacteria 946
420 Ga0451802_1962610 3300041460 Bacteria 1130
421 Ga0451802_2050935 3300041460 Bacteria 557
422 Ga0451807_2641317 3300041486 Bacteria 571
423 Ga0451833_0358041 3300041491 Bacteria 511
424 Ga0451833_1339037 3300041491 Bacteria 595
425 Ga0451837_0438502 3300041494 Bacteria 964
426 Ga0451837_1415084 3300041494 Bacteria 821
427 Ga0451843_0400723 3300041509 Bacteria 641
428 Ga0451843_1615668 3300041509 Bacteria 582
429 Ga0451853_0153734 3300041512 Bacteria 734
430 Ga0451853_1270514 3300041512 Bacteria 618
431 Ga0451853_3643264 3300041512 Bacteria 977
432 Ga0439431_0014682 3300041997 Bacteria 1817
433 Ga0450906_084050 3300042145 Bacteria 575
434 Ga0439434_0021673 3300042435 Bacteria 1930
435 Ga0466969_0254872 3300044656 Bacteria 795
436 Ga0466972_0030784 3300044658 Bacteria 2641
437 Ga0466972_0137984 3300044658 Bacteria 1148
438 Ga0466972_0220998 3300044658 Bacteria 886
439 Ga0466972_0276321 3300044658 Bacteria 785
440 Ga0466965_0010268 3300044683 Bacteria 4362
441 Ga0466965_0014194 3300044683 Bacteria 3769
442 Ga0466965_0064211 3300044683 Bacteria 1838
443 Ga0466965_0070458 3300044683 Bacteria 1757
444 Ga0466965_0080687 3300044683 Bacteria 1644
445 Ga0466965_0734405 3300044683 Bacteria 568
446 Ga0466966_0007512 3300044684 Bacteria 7219
447 Ga0466966_0097026 3300044684 Bacteria 1825
448 Ga0466966_0271512 3300044684 Bacteria 1020
449 Ga0466961_0003882 3300044693 Bacteria 9340
450 Ga0466961_0011889 3300044693 Bacteria 5564
451 Ga0466961_0013378 3300044693 Bacteria 5252
452 Ga0466961_0029775 3300044693 Bacteria 3507
453 Ga0466961_0098876 3300044693 Bacteria 1839
454 Ga0466963_0080652 3300044694 Bacteria 2203
455 Ga0466963_0169043 3300044694 Bacteria 1524
456 Ga0466963_0173623 3300044694 Bacteria 1503
457 Ga0466963_0189295 3300044694 Bacteria 1437
458 Ga0466963_0196322 3300044694 Bacteria 1411
459 Ga0466963_0203634 3300044694 Bacteria 1384
460 Ga0466963_0231381 3300044694 Bacteria 1295
461 Ga0466963_0310228 3300044694 Bacteria 1110
462 Ga0466963_0411220 3300044694 Bacteria 954
463 Ga0466964_0008537 3300044706 Bacteria 3850
464 Ga0466964_0008808 3300044706 Bacteria 3794
465 Ga0466964_0114962 3300044706 Bacteria 1205
466 Ga0466964_0146002 3300044706 Bacteria 1092
467 Ga0466964_0368445 3300044706 Bacteria 743
468 Ga0466971_0011960 3300044719 Bacteria 3803
469 Ga0466971_0105554 3300044719 Bacteria 1297
470 Ga0466971_0181229 3300044719 Bacteria 990
471 Ga0466968_0070202 3300044735 Bacteria 1524
472 Ga0466968_0080195 3300044735 Bacteria 1433
473 Ga0466970_0002471 3300044765 Bacteria 8938
474 Ga0466970_0015093 3300044765 Bacteria 3972
475 Ga0466970_0026360 3300044765 Bacteria 3046
476 Ga0466970_0036445 3300044765 Bacteria 2606
477 Ga0466970_0062107 3300044765 Bacteria 2002
478 Ga0466970_0120290 3300044765 Bacteria 1438
479 Ga0466970_0345733 3300044765 Bacteria 843
480 Ga0466957_0006291 3300044842 Bacteria 6699
481 Ga0466957_0065043 3300044842 Bacteria 2245
482 Ga0466957_0095964 3300044842 Bacteria 1863
483 Ga0466957_0101696 3300044842 Bacteria 1812
484 Ga0466957_0108016 3300044842 Bacteria 1762
485 Ga0466957_0398845 3300044842 Bacteria 940
486 Ga0466960_0004794 3300044901 Bacteria 5315
487 Ga0466960_0027571 3300044901 Bacteria 2592
488 Ga0466960_0049511 3300044901 Bacteria 2023
489 Ga0466960_0077979 3300044901 Bacteria 1662
490 Ga0466960_0093941 3300044901 Bacteria 1534
491 Ga0466960_0139830 3300044901 Bacteria 1285
492 Ga0466959_0022844 3300045049 Bacteria 4623
493 Ga0451576_0323760 3300045051 Bacteria 1613
494 Ga0466958_0101949 3300045836 Bacteria 1785
495 Ga0466958_0129304 3300045836 Bacteria 1585
496 Ga0466958_0290106 3300045836 Bacteria 1049
497 Ga0466958_0362706 3300045836 Bacteria 933
498 Ga0466958_0434882 3300045836 Bacteria 849
499 Ga0466967_0054635 3300045976 Bacteria 3516
500 Ga0466967_0062842 3300045976 Bacteria 3297
501 Ga0466967_0130740 3300045976 Bacteria 2330
502 Ga0466967_0226782 3300045976 Bacteria 1777
503 Ga0466967_0424336 3300045976 Bacteria 1297
504 Ga0466967_0447224 3300045976 Bacteria 1262
505 Ga0466967_0565065 3300045976 Bacteria 1120
506 Ga0466967_0623403 3300045976 Bacteria 1065
507 Ga0466967_0678405 3300045976 Bacteria 1020
508 Ga0466967_0738988 3300045976 Bacteria 976
509 Ga0466967_2114520 3300045976 Bacteria 559
510 Ga0495607_0554804 3300046501 Bacteria 504
511 Ga0495630_1416924 3300046517 Bacteria 522
512 Ga0495631_0112487 3300046518 Bacteria 1171
513 Ga0495667_0403510 3300046559 Bacteria 861
514 Ga0495635_0234260 3300046663 Bacteria 1240
515 Ga0495635_0558036 3300046663 Bacteria 750
516 Ga0495657_0067900 3300046675 Bacteria 2338
517 Ga0495624_0231576 3300046690 Bacteria 1119
518 Ga0495670_0162684 3300046691 Bacteria 1173
519 Ga0495600_0306440 3300046809 Bacteria 1001
520 Ga0495672_0189519 3300047320 Bacteria 1035
521 Ga0496101_0331122 3300048904 Bacteria 1195
522 Ga0496101_0656036 3300048904 Bacteria 829
523 Ga0496101_1519453 3300048904 Bacteria 521
524 Ga0496102_0028334 3300048905 Bacteria 5001
525 Ga0496102_0407020 3300048905 Bacteria 1279
526 Ga0496102_0875787 3300048905 Bacteria 820
527 Ga0496103_0059417 3300048906 Bacteria 2375
528 Ga0496103_0138287 3300048906 Bacteria 1557
529 Ga0496104_0093459 3300048907 Bacteria 2877
530 Ga0496104_0179264 3300048907 Bacteria 2029
531 Ga0496104_0513284 3300048907 Bacteria 1110
532 Ga0496104_1031587 3300048907 Bacteria 726
533 Ga0496105_0158534 3300048908 Bacteria 1858
534 Ga0496105_0386945 3300048908 Bacteria 1112
535 Ga0496105_1003342 3300048908 Bacteria 624
536 Ga0496106_0692879 3300048909 Bacteria 812
537 Ga0496107_0182147 3300048910 Bacteria 1560
538 Ga0496108_0037949 3300048911 Bacteria 4014
539 Ga0496108_0189292 3300048911 Bacteria 1783
540 Ga0496108_0319219 3300048911 Bacteria 1354
541 Ga0496108_0428129 3300048911 Bacteria 1156
542 Ga0496109_0015950 3300048912 Bacteria 6563
543 Ga0496109_0017180 3300048912 Bacteria 6336
544 Ga0496109_0193014 3300048912 Bacteria 1914
545 Ga0496109_0360140 3300048912 Bacteria 1374
546 Ga0496109_0383114 3300048912 Bacteria 1328
547 Ga0496110_0021203 3300048913 Bacteria 5496
548 Ga0496110_0048299 3300048913 Bacteria 3731
549 Ga0496110_0148680 3300048913 Bacteria 2120
550 Ga0496111_0101231 3300048914 Bacteria 2117
551 Ga0496111_0277466 3300048914 Bacteria 1243
552 Ga0496111_0294028 3300048914 Bacteria 1204
553 Ga0496113_0056840 3300048916 Bacteria 2939
554 Ga0496113_0326076 3300048916 Bacteria 1231
555 Ga0496113_0694644 3300048916 Bacteria 812
556 Ga0496114_0033475 3300048917 Bacteria 4234
557 Ga0496114_0062114 3300048917 Bacteria 3126
558 Ga0496114_0066193 3300048917 Bacteria 3029
559 Ga0496114_0082666 3300048917 Bacteria 2715
560 Ga0496114_0088418 3300048917 Bacteria 2628
561 Ga0496114_0276334 3300048917 Bacteria 1480
562 Ga0496114_0448064 3300048917 Bacteria 1143
563 Ga0496114_0651284 3300048917 Bacteria 926
564 Ga0496114_0651589 3300048917 Bacteria 926
565 Ga0496114_1271681 3300048917 Bacteria 622
566 Ga0496124_0518428 3300048927 Bacteria 795
567 Ga0501031_0155671 3300049568 Bacteria 1493
568 Ga0501032_0035663 3300049569 Bacteria 3399
569 Ga0501032_0079355 3300049569 Bacteria 2185
570 Ga0501032_0419209 3300049569 Bacteria 859
571 Ga0501033_0199671 3300049570 Bacteria 1429
572 Ga0501033_0483749 3300049570 Bacteria 857
573 Ga0501034_0063995 3300049571 Bacteria 3691
574 Ga0501034_0128691 3300049571 Bacteria 2516
575 Ga0501034_0869504 3300049571 Bacteria 791
576 Ga0501036_0009051 3300049572 Bacteria 8189
577 Ga0501036_0032791 3300049572 Bacteria 4391
578 Ga0501036_0039200 3300049572 Bacteria 4011
579 Ga0501036_0071918 3300049572 Bacteria 2924
580 Ga0501036_0218312 3300049572 Bacteria 1601
581 Ga0501036_0774274 3300049572 Bacteria 791
582 Ga0501036_1117411 3300049572 Bacteria 644
583 Ga0501037_0024563 3300049573 Bacteria 4457
584 Ga0501037_0029558 3300049573 Bacteria 4049
585 Ga0501037_0172522 3300049573 Bacteria 1537
586 Ga0501038_0003553 3300049574 Bacteria 14508
587 Ga0501038_0020837 3300049574 Bacteria 5892
588 Ga0501038_0157487 3300049574 Bacteria 1848
589 Ga0501038_0167125 3300049574 Bacteria 1784
590 Ga0501038_0285536 3300049574 Bacteria 1298
591 Ga0501038_0423798 3300049574 Bacteria 1026
592 Ga0501039_0027600 3300049575 Bacteria 4365
593 Ga0501039_0057051 3300049575 Bacteria 3025
594 Ga0501039_0142745 3300049575 Bacteria 1881
595 Ga0501039_0191682 3300049575 Bacteria 1607
596 Ga0501039_0235071 3300049575 Bacteria 1441
597 Ga0501039_0343127 3300049575 Bacteria 1174
598 Ga0501039_0908283 3300049575 Bacteria 685
599 Ga0501039_1164159 3300049575 Bacteria 597
600 Ga0501039_1257676 3300049575 Bacteria 572
601 Ga0501039_1434266 3300049575 Bacteria 531
602 Ga0501040_0095313 3300049576 Bacteria 2071
603 Ga0501040_0104676 3300049576 Bacteria 1976
604 Ga0501040_1025660 3300049576 Bacteria 598
605 Ga0501041_0034741 3300049577 Bacteria 3053
606 Ga0501041_0093011 3300049577 Bacteria 1862
607 Ga0501042_0009615 3300049578 Bacteria 6454
608 Ga0501042_0054920 3300049578 Bacteria 2841
609 Ga0501042_0138392 3300049578 Bacteria 1755
610 Ga0501042_0274460 3300049578 Bacteria 1217
611 Ga0501042_0284743 3300049578 Bacteria 1194
612 Ga0501042_0690000 3300049578 Bacteria 742
613 Ga0501046_0006677 3300049580 Bacteria 10192
614 Ga0501046_0105128 3300049580 Bacteria 2163
615 Ga0501047_0071436 3300049581 Bacteria 3341
616 Ga0501048_0004329 3300049582 Bacteria 10814
617 Ga0501048_0056438 3300049582 Bacteria 2786
618 Ga0501048_0139235 3300049582 Bacteria 1716
619 Ga0501048_0783226 3300049582 Bacteria 685
620 Ga0501048_1144830 3300049582 Bacteria 560
621 Ga0501067_0054041 3300049583 Bacteria 2225
622 Ga0501067_0100707 3300049583 Bacteria 1605
623 Ga0501067_0607238 3300049583 Bacteria 614
624 Ga0501068_0020054 3300049584 Bacteria 3890
625 Ga0501068_0108432 3300049584 Bacteria 1725
626 Ga0501068_0594135 3300049584 Bacteria 721
627 Ga0501069_0004825 3300049585 Bacteria 6983
628 Ga0501069_0117963 3300049585 Bacteria 1514
629 Ga0501069_0125518 3300049585 Bacteria 1467
630 Ga0501069_0277556 3300049585 Bacteria 980
631 Ga0501070_0007135 3300049586 Bacteria 9490
632 Ga0501070_0024797 3300049586 Bacteria 5030
633 Ga0501070_0084251 3300049586 Bacteria 2632
634 Ga0501070_0190005 3300049586 Bacteria 1688
635 Ga0501070_0262965 3300049586 Bacteria 1410
636 Ga0501070_0465074 3300049586 Bacteria 1019
637 Ga0501070_1036068 3300049586 Bacteria 635
638 Ga0501071_0000969 3300049587 Bacteria 15678
639 Ga0501071_0038614 3300049587 Bacteria 3412
640 Ga0501071_0189880 3300049587 Bacteria 1541
641 Ga0501071_0283180 3300049587 Bacteria 1255
642 Ga0501072_0087299 3300049588 Bacteria 2475
643 Ga0501072_0217602 3300049588 Bacteria 1522
644 Ga0501072_0253433 3300049588 Bacteria 1401
645 Ga0501072_0276700 3300049588 Bacteria 1335
646 Ga0501072_0722530 3300049588 Bacteria 782
647 Ga0501073_0077103 3300049589 Bacteria 2319
648 Ga0501073_0435315 3300049589 Bacteria 906
649 Ga0501073_0476810 3300049589 Bacteria 863
650 Ga0501073_0574710 3300049589 Bacteria 779
651 Ga0501074_0009264 3300049590 Bacteria 7152
652 Ga0501074_0020859 3300049590 Bacteria 4759
653 Ga0501074_0259266 3300049590 Bacteria 1236
654 Ga0501074_0749802 3300049590 Bacteria 688
655 Ga0501075_0095990 3300049591 Bacteria 2250
656 Ga0501075_0111337 3300049591 Bacteria 2081
657 Ga0501075_0119626 3300049591 Bacteria 2004
658 Ga0501075_0733838 3300049591 Bacteria 752
659 Ga0501076_0052119 3300049592 Bacteria 3241
660 Ga0501076_0207569 3300049592 Bacteria 1600
661 Ga0501076_0450315 3300049592 Bacteria 1060
662 Ga0501076_0566089 3300049592 Bacteria 937
663 Ga0501077_0024411 3300049593 Bacteria 3840
664 Ga0501077_0358355 3300049593 Bacteria 931
665 Ga0501079_1515335 3300049741 Bacteria 527
666 Ga0501080_0013976 3300049742 Bacteria 7389
667 Ga0501080_0054533 3300049742 Bacteria 3722
668 Ga0501080_0182880 3300049742 Bacteria 1928
669 Ga0501080_0484678 3300049742 Bacteria 1106
670 Ga0501080_1030529 3300049742 Bacteria 713
671 Ga0501081_0494999 3300049743 Bacteria 911
672 Ga0501081_0525230 3300049743 Bacteria 883
673 Ga0501081_0634212 3300049743 Bacteria 801
674 Ga0501081_0924507 3300049743 Bacteria 658
675 Ga0501083_0039109 3300049744 Bacteria 3222
676 Ga0501083_0142255 3300049744 Bacteria 1571
677 Ga0501035_0018187 3300049822 Bacteria 6472
678 Ga0501035_0541029 3300049822 Bacteria 955
679 Ga0501044_0013466 3300049823 Bacteria 8845
680 Ga0501044_0299922 3300049823 Bacteria 1536
681 Ga0501044_0787610 3300049823 Bacteria 831
682 Ga0501045_0099271 3300049824 Bacteria 2154
683 Ga0501045_0200586 3300049824 Bacteria 1486
684 Ga0501045_0444961 3300049824 Bacteria 963
685 nmdc:mga03683_70213_c1 3300050489 Bacteria 1496
686 nmdc:mga03n38_17323_c1 3300050490 Bacteria 2819
687 nmdc:mga03n38_20823_c1 3300050490 Bacteria 2630
688 nmdc:mga03n38_292486_c1 3300050490 Bacteria 873
689 nmdc:mga03n38_41994_c1 3300050490 Bacteria 1997
690 nmdc:mga03n38_507908_c1 3300050490 Bacteria 677
691 nmdc:mga00v17_114955_c1 3300050491 Bacteria 1710
692 nmdc:mga00v17_145011_c1 3300050491 Bacteria 1524
693 nmdc:mga00v17_152709_c1 3300050491 Bacteria 1484
694 nmdc:mga00v17_15735_c1 3300050491 Bacteria 4252
695 nmdc:mga00v17_256754_c1 3300050491 Bacteria 1133
696 nmdc:mga00v17_267620_c1 3300050491 Bacteria 1109
697 nmdc:mga00v17_28888_c1 3300050491 Bacteria 3250
698 nmdc:mga00v17_406946_c1 3300050491 Bacteria 884
699 nmdc:mga0yw44_123942_c1 3300050492 Bacteria 1667
700 nmdc:mga0yw44_1360_c1 3300050492 Bacteria 9694
701 nmdc:mga0yw44_147638_c1 3300050492 Bacteria 1532
702 nmdc:mga0yw44_178502_c1 3300050492 Bacteria 1397
703 nmdc:mga0yw44_202659_c1 3300050492 Bacteria 1311
704 nmdc:mga0yw44_3087_c1 3300050492 Bacteria 7298
705 nmdc:mga0yw44_337313_c1 3300050492 Bacteria 1014
706 nmdc:mga0yw44_36598_c1 3300050492 Bacteria 2893
707 nmdc:mga0yw44_382890_c1 3300050492 Bacteria 950
708 nmdc:mga0yw44_512673_c1 3300050492 Bacteria 814
709 nmdc:mga0yw44_529619_c1 3300050492 Bacteria 800
710 nmdc:mga0yw44_58023_c1 3300050492 Bacteria 2363
711 nmdc:mga0yw44_631559_c1 3300050492 Bacteria 728
712 nmdc:mga0yw44_81591_c1 3300050492 Bacteria 2028
713 nmdc:mga0yw44_993581_c1 3300050492 Bacteria 568
714 nmdc:mga06z11_15688_c1 3300050494 Bacteria 3388
715 nmdc:mga06z11_22604_c1 3300050494 Bacteria 2940
716 nmdc:mga06z11_2273_c1 3300050494 Bacteria 7309
717 nmdc:mga06z11_369636_c1 3300050494 Bacteria 860
718 nmdc:mga06z11_96074_c1 3300050494 Bacteria 1618
719 nmdc:mga04h51_155769_c1 3300050495 Bacteria 876
720 nmdc:mga04h51_217332_c1 3300050495 Bacteria 756
721 nmdc:mga04h51_243518_c1 3300050495 Bacteria 719
722 nmdc:mga04h51_858_c1 3300050495 Bacteria 7017
723 nmdc:mga07m45_14020_c1 3300050496 Bacteria 4263
724 nmdc:mga07m45_2764_c1 3300050496 Bacteria 8281
725 nmdc:mga07m45_426929_c1 3300050496 Bacteria 769
726 nmdc:mga07m45_64937_c1 3300050496 Bacteria 2072
727 nmdc:mga09592_1356168_c1 3300050508 Bacteria 583
728 nmdc:mga09592_388465_c1 3300050508 Bacteria 1206
729 nmdc:mga0qj67_318181_c1 3300050509 Bacteria 1260
730 nmdc:mga06r32_27222_c1 3300050510 Bacteria 5339
731 nmdc:mga08y16_177824_c1 3300050511 Bacteria 2210
732 nmdc:mga08y16_180502_c1 3300050511 Bacteria 2192
733 Ga0495612_0283024 3300053078 Bacteria 741
734 Ga0495595_0059602 3300053084 Bacteria 1785
735 Ga0495619_0018960 3300053085 Bacteria 4370
736 Ga0500644_0000400 3300053088 Bacteria 20643
737 Ga0500556_0001648 3300053104 Bacteria 8695
738 Ga0500593_005299 3300053117 Bacteria 5064
739 Ga0500573_0153281 3300053140 Bacteria 1260
740 Ga0500573_0256576 3300053140 Bacteria 897
741 Ga0501084_0005674 3300054114 Bacteria 10246
742 Ga0501084_0050998 3300054114 Bacteria 3463
743 Ga0501084_0070503 3300054114 Bacteria 2926
744 Ga0501084_0361909 3300054114 Bacteria 1226
745 Ga0501084_1224046 3300054114 Bacteria 630
746 Ga0501082_0210486 3300060353 Bacteria 1692
747 Ga0501082_0237259 3300060353 Bacteria 1587
748 Ga0501082_0662173 3300060353 Bacteria 914
749 Ga0501082_1099548 3300060353 Bacteria 695
750 Ga0466962_0012824 3300061719 Bacteria 4032
751 Ga0466962_0021522 3300061719 Bacteria 3096
752 Ga0466962_0122485 3300061719 Bacteria 1255
753 Ga0466962_0146115 3300061719 Bacteria 1147
754 Ga0466962_0166173 3300061719 Bacteria 1073
755 Ga0530510_0072717 3300061734 Bacteria 2496
756 Ga0530510_0078372 3300061734 Bacteria 2402
757 Ga0530510_0240457 3300061734 Bacteria 1348
758 2643892418 2643221576 Bacteria 5214352
759 2643961470 2643221590 Bacteria 5214697
760 2644032405 2643221604 Bacteria 5014917
761 2644090479 2643221615 Bacteria 5487866
762 2644099599 2643221617 Bacteria 5139111
763 2644116206 2643221620 Bacteria 5134593
764 2644231588 2643221641 Bacteria 4490190
765 2644323393 2643221657 Bacteria 5490246
766 2738870577 2738541305 Bacteria 4910150
767 2740167303 2739367898 Bacteria 4367674
768 2774394433 2773857762 Bacteria 5971770
769 2809194712 2808606439 Bacteria 5952208
770 2812334143 2811994874 Bacteria 5367947
771 2812353053 2811994878 Bacteria 5992952
772 2855390800 2855386786 Bacteria 4752232
773 2857483856 2857481737 Bacteria 4761446
774 2891972830 2891968417 Bacteria 5821697
775 8054613981 8054609563 Bacteria 5170090
776 Ga0495629_0252666
777 LJQas_1002755
778 JGI24740J21852_10032381
779 JGI24735J21928_10012347
780 JGI24735J21928_10055787
781 JGI24744J21845_10003006
782 JGI25407J50210_10006607
783 Ga0006562J51391_1175765
784 Ga0070658_10035184
785 Ga0070658_10441630
786 Ga0070658_11035347
787 Ga0070683_100004659
788 Ga0070683_100027032
789 Ga0070683_100029923
790 Ga0070683_100149584
791 Ga0070683_100582798
792 Ga0070683_100699153
793 Ga0070683_101144521
794 Ga0070683_101859155
795 Ga0070690_100257503
796 Ga0070677_10324251
797 Ga0068869_100740792
798 Ga0070680_100054868
799 Ga0070680_100319455
800 Ga0070680_100575666
801 Ga0070682_100093391
802 Ga0068868_100070101
803 Ga0068868_100242481
804 Ga0068868_100561719
805 Ga0070660_100018274
806 Ga0070660_100179277
807 Ga0070660_100399705
808 Ga0070660_100460931
809 Ga0070660_100755558
810 Ga0070691_10026956
811 Ga0070687_100047908
812 Ga0070692_10006618
813 Ga0070669_100182969
814 Ga0070669_101495334
815 Ga0070675_100119871
816 Ga0070675_100506184
817 Ga0070671_100693254
818 Ga0070674_100022506
819 Ga0070674_100974092
820 Ga0070674_101030395
821 Ga0070674_101095993
822 Ga0070673_100079972
823 Ga0070673_100949415
824 Ga0070659_100006245
825 Ga0070659_100257638
826 Ga0070659_100302810
827 Ga0070659_100514927
828 Ga0070659_100614224
829 Ga0070667_100333120
830 Ga0070701_10009958
831 Ga0070700_100000039
832 Ga0070700_100001966
833 Ga0070700_100033259
834 Ga0070700_100051422
835 Ga0070663_100006719
836 Ga0070663_100246667
837 Ga0070678_100298613
838 Ga0070678_100346731
839 Ga0070662_100357958
840 Ga0070681_10022667
841 Ga0070681_10277285
842 Ga0070681_11570855
843 Ga0068867_100031851
844 Ga0070685_10019490
845 Ga0070707_100769948
846 Ga0070698_100002871
847 Ga0070679_100025139
848 Ga0070684_100001579
849 Ga0070684_100040859
850 Ga0070684_100107036
851 Ga0070684_100248431
852 Ga0070684_100267042
853 Ga0070684_100442508
854 Ga0068853_101888862
855 Ga0070672_100175198
856 Ga0070672_100470748
857 Ga0070686_100136798
858 Ga0070686_100594485
859 Ga0070693_100092467
860 Ga0070693_100804089
861 Ga0070665_100000523
862 Ga0070665_100879297
863 Ga0070665_101406387
864 Ga0070704_100336137
865 Ga0070704_101620294
866 Ga0068857_100004178
867 Ga0068857_101056069
868 Ga0068857_101286069
869 Ga0068856_100059526
870 Ga0068856_100368198
871 Ga0068856_100468234
872 Ga0070702_100022009
873 Ga0070702_100030879
874 Ga0070702_100056140
875 Ga0070702_101262966
876 Ga0068852_100022107
877 Ga0068852_100402374
878 Ga0068852_100847138
879 Ga0068864_100047320
880 Ga0068864_100717708
881 Ga0068864_101072696
882 Ga0068866_10077300
883 Ga0068866_10281084
884 Ga0068866_10594888
885 Ga0068861_100031124
886 Ga0068861_100138136
887 Ga0068861_100328667
888 Ga0068851_10194251
889 Ga0068870_10003248
890 Ga0068858_100550495
891 Ga0068860_100000286
892 Ga0068862_100286247
893 Ga0081455_10000683
894 Ga0081455_10009572
895 Ga0081538_10000079
896 Ga0081538_10037722
897 Ga0081539_10059110
898 Ga0075365_10040888
899 Ga0075365_10051412
900 Ga0075365_10065046
901 Ga0075365_10115722
902 Ga0075365_10122132
903 Ga0075365_10229000
904 Ga0075365_10249044
905 Ga0075365_10291410
906 Ga0075365_10427127
907 Ga0075365_10902740
908 Ga0075368_10003590
909 Ga0075368_10028252
910 Ga0075368_10065894
911 Ga0075368_10132218
912 Ga0075368_10166198
913 Ga0075363_100000232
914 Ga0075363_100001920
915 Ga0075363_100002189
916 Ga0075363_100092200
917 Ga0075363_100216607
918 Ga0075363_100225044
919 Ga0075363_100277219
920 Ga0075364_10003485
921 Ga0075364_10009085
922 Ga0075364_10085551
923 Ga0075364_10136296
924 Ga0075364_10207823
925 Ga0075364_10317721
926 Ga0075364_10429055
927 Ga0075364_10458143
928 Ga0075362_10007025
929 Ga0075362_10067345
930 Ga0075367_10005910
931 Ga0075367_10079843
932 Ga0075367_10087131
933 Ga0075367_10161460
934 Ga0075367_10363754
935 Ga0075367_10409748
936 Ga0075367_10475279
937 Ga0075370_10044228
938 Ga0068871_100827139
939 Ga0075430_100600590
940 Ga0075431_100004927
941 Ga0075431_100371444
942 Ga0075429_100141361
943 Ga0068865_100006555
944 Ga0068865_100217716
945 Ga0068865_100614782
946 Ga0068865_100667403
947 Ga0068865_101096558
948 Ga0105240_12475686
949 Ga0111539_10038144
950 Ga0111539_10122086
951 Ga0105245_10011262
952 Ga0105245_10369019
953 Ga0105245_10825575
954 Ga0105247_11106163
955 Ga0105243_10005950
956 Ga0105243_10119303
957 Ga0105243_10513334
958 Ga0105243_10618473
959 Ga0105243_10748498
960 Ga0105242_10123422
961 Ga0105248_10562490
962 Ga0105237_10036174
963 Ga0105237_10119260
964 Ga0105237_10559264
965 Ga0105238_10562938
966 Ga0105238_10600819
967 Ga0105238_11142899
968 Ga0105249_10081780
969 Ga0105249_10668524
970 Ga0105249_11184972
971 Ga0105239_10050783
972 Ga0105239_10083293
973 Ga0105239_10983367
974 Ga0105246_10002002
975 Ga0105246_10219380
976 Ga0105246_10224872
977 Ga0105246_10542440
978 Ga0157373_10467122
979 Ga0157371_10654102
980 Ga0157370_10583286
981 Ga0157370_10612648
982 Ga0157369_10057344
983 Ga0157369_10639589
984 Ga0157369_11084969
985 Ga0157369_11454602
986 Ga0157369_12153930
987 Ga0157374_10521517
988 Ga0157374_11105875
989 Ga0157372_10413162
990 Ga0157372_10556548
991 Ga0157372_11604016
992 Ga0157372_12286771
993 Ga0157375_10136514
994 Ga0157375_10619203
995 Ga0157375_10626430
996 Ga0157375_11068121
997 Ga0163163_10225866
998 Ga0163163_10279849
999 Ga0163163_10566928
1000 Ga0163163_11163158
1001 Ga0157380_10002869
1002 Ga0157380_10126266
1003 Ga0157380_10315301
1004 Ga0157377_10245132
1005 Ga0157379_10330130
1006 Ga0157379_10813241
1007 Ga0157376_10443030
1008 Ga0157376_10620474
1009 Ga0157376_11767729
1010 Ga0163161_11044902
1011 Ga0163161_11490325
1012 Ga0206356_10110722
1013 Ga0206354_10529662
1014 Ga0206353_11131302
1015 Ga0206353_11162912
1016 Ga0207642_10061156
1017 Ga0207642_10542802
1018 Ga0207642_10892461
1019 Ga0207688_10024975
1020 Ga0207647_10042483
1021 Ga0207643_10001251
1022 Ga0207705_10043892
1023 Ga0207705_10373166
1024 Ga0207707_10014821
1025 Ga0207707_10106355
1026 Ga0207707_10737619
1027 Ga0207695_10102334
1028 Ga0207671_10159610
1029 Ga0207660_10040106
1030 Ga0207660_10281922
1031 Ga0207662_10017194
1032 Ga0207662_10086318
1033 Ga0207662_10105131
1034 Ga0207657_10016912
1035 Ga0207657_10020370
1036 Ga0207657_10040916
1037 Ga0207657_10059434
1038 Ga0207657_10171185
1039 Ga0207657_10250429
1040 Ga0207657_10394495
1041 Ga0207649_10208702
1042 Ga0207652_10352412
1043 Ga0207652_10357225
1044 Ga0207646_10625076
1045 Ga0207681_10140973
1046 Ga0207694_10299842
1047 Ga0207694_10781414
1048 Ga0207694_10981298
1049 Ga0207694_11447076
1050 Ga0207650_10110656
1051 Ga0207650_11357537
1052 Ga0207659_10074597
1053 Ga0207659_11139669
1054 Ga0207687_10011610
1055 Ga0207687_10028805
1056 Ga0207687_10167568
1057 Ga0207687_10371797
1058 Ga0207687_10544057
1059 Ga0207690_10066640
1060 Ga0207690_10284882
1061 Ga0207706_10041514
1062 Ga0207706_10370100
1063 Ga0207686_10052231
1064 Ga0207709_10015799
1065 Ga0207709_10120131
1066 Ga0207709_10130395
1067 Ga0207709_10198442
1068 Ga0207709_10516739
1069 Ga0207669_10563181
1070 Ga0207704_10060254
1071 Ga0207704_10360074
1072 Ga0207704_10482383
1073 Ga0207691_10107914
1074 Ga0207711_10201422
1075 Ga0207661_10010333
1076 Ga0207661_10027406
1077 Ga0207661_10059844
1078 Ga0207661_10130532
1079 Ga0207661_10205030
1080 Ga0207661_10278299
1081 Ga0207661_10515463
1082 Ga0207661_10669249
1083 Ga0207661_10733807
1084 Ga0207661_11674624
1085 Ga0207679_10175835
1086 Ga0207667_10321708
1087 Ga0207668_10392054
1088 Ga0207658_10312248
1089 Ga0207703_10072450
1090 Ga0207639_10655160
1091 Ga0207639_11414792
1092 Ga0207678_10025211
1093 Ga0207678_10110929
1094 Ga0207678_10455498
1095 Ga0207678_10565910
1096 Ga0207708_10000044
1097 Ga0207708_10000897
1098 Ga0207708_10043248
1099 Ga0207708_10072658
1100 Ga0207702_10057754
1101 Ga0207702_10136174
1102 Ga0207702_10411620
1103 Ga0207648_10001889
1104 Ga0207648_11413122
1105 Ga0207676_10768216
1106 Ga0207674_10004262
1107 Ga0207674_10468516
1108 Ga0207674_10720167
1109 Ga0207675_100035843
1110 Ga0207675_100053691
1111 Ga0207675_100344647
1112 Ga0207675_100443112
1113 Ga0207698_10098770
1114 Ga0207698_10963363
1115 Ga0207698_12494229
1116 Ga0209983_1106284
1117 Ga0209813_10001140
1118 Ga0209813_10050083
1119 Ga0209813_10106919
1120 Ga0209813_10115713
1121 Ga0207428_10097301
1122 Ga0207428_10097889
1123 Ga0268266_10034359
1124 Ga0268266_10153210
1125 Ga0268266_11115495
1126 Ga0268265_10742412
1127 Ga0268264_10000246
1128 Ga0316183_1174096
1129 Ga0316181_1089569
1130 Ga0316575_10048262
1131 Ga0307516_10341691
1132 Ga0307405_10075967
1133 Ga0307405_10180213
1134 Ga0307405_10388776
1135 Ga0307405_10471812
1136 Ga0307413_10035363
1137 Ga0307413_10513365
1138 Ga0307413_10717403
1139 Ga0307410_10299751
1140 Ga0307410_10351003
1141 Ga0307410_10356618
1142 Ga0307410_10637069
1143 Ga0307407_10016322
1144 Ga0307407_10026328
1145 Ga0307407_10301384
1146 Ga0307407_10414188
1147 Ga0307412_10034593
1148 Ga0307412_10256737
1149 Ga0307409_100113295
1150 Ga0307409_100178897
1151 Ga0307409_100333145
1152 Ga0307409_100510541
1153 Ga0307409_100734210
1154 Ga0307409_100774180
1155 Ga0307409_101313684
1156 Ga0307409_101761789
1157 Ga0307409_101811738
1158 Ga0307416_100020676
1159 Ga0307416_100082471
1160 Ga0307416_100094479
1161 Ga0307416_101084811
1162 Ga0307416_102036405
1163 Ga0307414_10233123
1164 Ga0307414_10767843
1165 Ga0307411_10032073
1166 Ga0307411_10940769
1167 Ga0307415_100024263
1168 Ga0307415_100044034
1169 Ga0307415_100045688
1170 Ga0307415_100313661
1171 Ga0307415_100550102
1172 Ga0307415_100766460
1173 Ga0307415_102120151
1174 Ga0373942_0141682
1175 Ga0373931_0176569
1176 Ga0395899_0000958
1177 Ga0395899_0025271
1178 Ga0395900_0087146
1179 Ga0395900_0155420
1180 Ga0395898_0036082
1181 Ga0395905_0275068
1182 Ga0395905_0481063
1183 Ga0395901_0050999
1184 Ga0395901_0134080
1185 Ga0395901_0356667
1186 Ga0395901_0586927
1187 Ga0395901_1054265
1188 Ga0395901_1422566
1189 Ga0439438_040752
1190 Ga0439438_098601
1191 Ga0439461_0020562
1192 Ga0451791_0905152
1193 Ga0451797_0239511
1194 Ga0451800_0188691
1195 Ga0451802_1962610
1196 Ga0451802_2050935
1197 Ga0451807_2641317
1198 Ga0451833_0358041
1199 Ga0451833_1339037
1200 Ga0451837_0438502
1201 Ga0451837_1415084
1202 Ga0451843_0400723
1203 Ga0451843_1615668
1204 Ga0451853_0153734
1205 Ga0451853_1270514
1206 Ga0451853_3643264
1207 Ga0439431_0014682
1208 Ga0450906_084050
1209 Ga0439434_0021673
1210 Ga0466969_0254872
1211 Ga0466972_0030784
1212 Ga0466972_0137984
1213 Ga0466972_0220998
1214 Ga0466972_0276321
1215 Ga0466965_0010268
1216 Ga0466965_0014194
1217 Ga0466965_0064211
1218 Ga0466965_0070458
1219 Ga0466965_0080687
1220 Ga0466965_0734405
1221 Ga0466966_0007512
1222 Ga0466966_0097026
1223 Ga0466966_0271512
1224 Ga0466961_0003882
1225 Ga0466961_0011889
1226 Ga0466961_0013378
1227 Ga0466961_0029775
1228 Ga0466961_0098876
1229 Ga0466963_0080652
1230 Ga0466963_0169043
1231 Ga0466963_0173623
1232 Ga0466963_0189295
1233 Ga0466963_0196322
1234 Ga0466963_0203634
1235 Ga0466963_0231381
1236 Ga0466963_0310228
1237 Ga0466963_0411220
1238 Ga0466964_0008537
1239 Ga0466964_0008808
1240 Ga0466964_0114962
1241 Ga0466964_0146002
1242 Ga0466964_0368445
1243 Ga0466971_0011960
1244 Ga0466971_0105554
1245 Ga0466971_0181229
1246 Ga0466968_0070202
1247 Ga0466968_0080195
1248 Ga0466970_0002471
1249 Ga0466970_0015093
1250 Ga0466970_0026360
1251 Ga0466970_0036445
1252 Ga0466970_0062107
1253 Ga0466970_0120290
1254 Ga0466970_0345733
1255 Ga0466957_0006291
1256 Ga0466957_0065043
1257 Ga0466957_0095964
1258 Ga0466957_0101696
1259 Ga0466957_0108016
1260 Ga0466957_0398845
1261 Ga0466960_0004794
1262 Ga0466960_0027571
1263 Ga0466960_0049511
1264 Ga0466960_0077979
1265 Ga0466960_0093941
1266 Ga0466960_0139830
1267 Ga0466959_0022844
1268 Ga0451576_0323760
1269 Ga0466958_0101949
1270 Ga0466958_0129304
1271 Ga0466958_0290106
1272 Ga0466958_0362706
1273 Ga0466958_0434882
1274 Ga0466967_0054635
1275 Ga0466967_0062842
1276 Ga0466967_0130740
1277 Ga0466967_0226782
1278 Ga0466967_0424336
1279 Ga0466967_0447224
1280 Ga0466967_0565065
1281 Ga0466967_0623403
1282 Ga0466967_0678405
1283 Ga0466967_0738988
1284 Ga0466967_2114520
1285 Ga0495607_0554804
1286 Ga0495630_1416924
1287 Ga0495631_0112487
1288 Ga0495667_0403510
1289 Ga0495635_0234260
1290 Ga0495635_0558036
1291 Ga0495657_0067900
1292 Ga0495624_0231576
1293 Ga0495670_0162684
1294 Ga0495600_0306440
1295 Ga0495672_0189519
1296 Ga0496101_0331122
1297 Ga0496101_0656036
1298 Ga0496101_1519453
1299 Ga0496102_0028334
1300 Ga0496102_0407020
1301 Ga0496102_0875787
1302 Ga0496103_0059417
1303 Ga0496103_0138287
1304 Ga0496104_0093459
1305 Ga0496104_0179264
1306 Ga0496104_0513284
1307 Ga0496104_1031587
1308 Ga0496105_0158534
1309 Ga0496105_0386945
1310 Ga0496105_1003342
1311 Ga0496106_0692879
1312 Ga0496107_0182147
1313 Ga0496108_0037949
1314 Ga0496108_0189292
1315 Ga0496108_0319219
1316 Ga0496108_0428129
1317 Ga0496109_0015950
1318 Ga0496109_0017180
1319 Ga0496109_0193014
1320 Ga0496109_0360140
1321 Ga0496109_0383114
1322 Ga0496110_0021203
1323 Ga0496110_0048299
1324 Ga0496110_0148680
1325 Ga0496111_0101231
1326 Ga0496111_0277466
1327 Ga0496111_0294028
1328 Ga0496113_0056840
1329 Ga0496113_0326076
1330 Ga0496113_0694644
1331 Ga0496114_0033475
1332 Ga0496114_0062114
1333 Ga0496114_0066193
1334 Ga0496114_0082666
1335 Ga0496114_0088418
1336 Ga0496114_0276334
1337 Ga0496114_0448064
1338 Ga0496114_0651284
1339 Ga0496114_0651589
1340 Ga0496114_1271681
1341 Ga0496124_0518428
1342 Ga0501031_0155671
1343 Ga0501032_0035663
1344 Ga0501032_0079355
1345 Ga0501032_0419209
1346 Ga0501033_0199671
1347 Ga0501033_0483749
1348 Ga0501034_0063995
1349 Ga0501034_0128691
1350 Ga0501034_0869504
1351 Ga0501036_0009051
1352 Ga0501036_0032791
1353 Ga0501036_0039200
1354 Ga0501036_0071918
1355 Ga0501036_0218312
1356 Ga0501036_0774274
1357 Ga0501036_1117411
1358 Ga0501037_0024563
1359 Ga0501037_0029558
1360 Ga0501037_0172522
1361 Ga0501038_0003553
1362 Ga0501038_0020837
1363 Ga0501038_0157487
1364 Ga0501038_0167125
1365 Ga0501038_0285536
1366 Ga0501038_0423798
1367 Ga0501039_0027600
1368 Ga0501039_0057051
1369 Ga0501039_0142745
1370 Ga0501039_0191682
1371 Ga0501039_0235071
1372 Ga0501039_0343127
1373 Ga0501039_0908283
1374 Ga0501039_1164159
1375 Ga0501039_1257676
1376 Ga0501039_1434266
1377 Ga0501040_0095313
1378 Ga0501040_0104676
1379 Ga0501040_1025660
1380 Ga0501041_0034741
1381 Ga0501041_0093011
1382 Ga0501042_0009615
1383 Ga0501042_0054920
1384 Ga0501042_0138392
1385 Ga0501042_0274460
1386 Ga0501042_0284743
1387 Ga0501042_0690000
1388 Ga0501046_0006677
1389 Ga0501046_0105128
1390 Ga0501047_0071436
1391 Ga0501048_0004329
1392 Ga0501048_0056438
1393 Ga0501048_0139235
1394 Ga0501048_0783226
1395 Ga0501048_1144830
1396 Ga0501067_0054041
1397 Ga0501067_0100707
1398 Ga0501067_0607238
1399 Ga0501068_0020054
1400 Ga0501068_0108432
1401 Ga0501068_0594135
1402 Ga0501069_0004825
1403 Ga0501069_0117963
1404 Ga0501069_0125518
1405 Ga0501069_0277556
1406 Ga0501070_0007135
1407 Ga0501070_0024797
1408 Ga0501070_0084251
1409 Ga0501070_0190005
1410 Ga0501070_0262965
1411 Ga0501070_0465074
1412 Ga0501070_1036068
1413 Ga0501071_0000969
1414 Ga0501071_0038614
1415 Ga0501071_0189880
1416 Ga0501071_0283180
1417 Ga0501072_0087299
1418 Ga0501072_0217602
1419 Ga0501072_0253433
1420 Ga0501072_0276700
1421 Ga0501072_0722530
1422 Ga0501073_0077103
1423 Ga0501073_0435315
1424 Ga0501073_0476810
1425 Ga0501073_0574710
1426 Ga0501074_0009264
1427 Ga0501074_0020859
1428 Ga0501074_0259266
1429 Ga0501074_0749802
1430 Ga0501075_0095990
1431 Ga0501075_0111337
1432 Ga0501075_0119626
1433 Ga0501075_0733838
1434 Ga0501076_0052119
1435 Ga0501076_0207569
1436 Ga0501076_0450315
1437 Ga0501076_0566089
1438 Ga0501077_0024411
1439 Ga0501077_0358355
1440 Ga0501079_1515335
1441 Ga0501080_0013976
1442 Ga0501080_0054533
1443 Ga0501080_0182880
1444 Ga0501080_0484678
1445 Ga0501080_1030529
1446 Ga0501081_0494999
1447 Ga0501081_0525230
1448 Ga0501081_0634212
1449 Ga0501081_0924507
1450 Ga0501083_0039109
1451 Ga0501083_0142255
1452 Ga0501035_0018187
1453 Ga0501035_0541029
1454 Ga0501044_0013466
1455 Ga0501044_0299922
1456 Ga0501044_0787610
1457 Ga0501045_0099271
1458 Ga0501045_0200586
1459 Ga0501045_0444961
1460 nmdc:mga03683_70213_c1
1461 nmdc:mga03n38_17323_c1
1462 nmdc:mga03n38_20823_c1
1463 nmdc:mga03n38_292486_c1
1464 nmdc:mga03n38_41994_c1
1465 nmdc:mga03n38_507908_c1
1466 nmdc:mga00v17_114955_c1
1467 nmdc:mga00v17_145011_c1
1468 nmdc:mga00v17_152709_c1
1469 nmdc:mga00v17_15735_c1
1470 nmdc:mga00v17_256754_c1
1471 nmdc:mga00v17_267620_c1
1472 nmdc:mga00v17_28888_c1
1473 nmdc:mga00v17_406946_c1
1474 nmdc:mga0yw44_123942_c1
1475 nmdc:mga0yw44_1360_c1
1476 nmdc:mga0yw44_147638_c1
1477 nmdc:mga0yw44_178502_c1
1478 nmdc:mga0yw44_202659_c1
1479 nmdc:mga0yw44_3087_c1
1480 nmdc:mga0yw44_337313_c1
1481 nmdc:mga0yw44_36598_c1
1482 nmdc:mga0yw44_382890_c1
1483 nmdc:mga0yw44_512673_c1
1484 nmdc:mga0yw44_529619_c1
1485 nmdc:mga0yw44_58023_c1
1486 nmdc:mga0yw44_631559_c1
1487 nmdc:mga0yw44_81591_c1
1488 nmdc:mga0yw44_993581_c1
1489 nmdc:mga06z11_15688_c1
1490 nmdc:mga06z11_22604_c1
1491 nmdc:mga06z11_2273_c1
1492 nmdc:mga06z11_369636_c1
1493 nmdc:mga06z11_96074_c1
1494 nmdc:mga04h51_155769_c1
1495 nmdc:mga04h51_217332_c1
1496 nmdc:mga04h51_243518_c1
1497 nmdc:mga04h51_858_c1
1498 nmdc:mga07m45_14020_c1
1499 nmdc:mga07m45_2764_c1
1500 nmdc:mga07m45_426929_c1
1501 nmdc:mga07m45_64937_c1
1502 nmdc:mga09592_1356168_c1
1503 nmdc:mga09592_388465_c1
1504 nmdc:mga0qj67_318181_c1
1505 nmdc:mga06r32_27222_c1
1506 nmdc:mga08y16_177824_c1
1507 nmdc:mga08y16_180502_c1
1508 Ga0495612_0283024
1509 Ga0495595_0059602
1510 Ga0495619_0018960
1511 Ga0500644_0000400
1512 Ga0500556_0001648
1513 Ga0500593_005299
1514 Ga0500573_0153281
1515 Ga0500573_0256576
1516 Ga0501084_0005674
1517 Ga0501084_0050998
1518 Ga0501084_0070503
1519 Ga0501084_0361909
1520 Ga0501084_1224046
1521 Ga0501082_0210486
1522 Ga0501082_0237259
1523 Ga0501082_0662173
1524 Ga0501082_1099548
1525 Ga0466962_0012824
1526 Ga0466962_0021522
1527 Ga0466962_0122485
1528 Ga0466962_0146115
1529 Ga0466962_0166173
1530 Ga0530510_0072717
1531 Ga0530510_0078372
1532 Ga0530510_0240457
1533 2643892418
1534 2643961470
1535 2644032405
1536 2644090479
1537 2644099599
1538 2644116206
1539 2644231588
1540 2644323393
1541 2738870577
1542 2740167303
1543 2774394433
1544 2809194712
1545 2812334143
1546 2812353053
1547 2855390800
1548 2857483856
1549 2891972830
1550 8054613981

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13772

AIG2_2

AIG2-like family

90

171

0.98

PF06094

GGACT

Gamma-glutamyl cyclotransferase, AIG2-like

35

152

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rbh-assembly1.cif.gz_B gamma-glutamyl cyclotransferase 0.8921 2 150
3cry-assembly1.cif.gz_B gamma-glutamyl cyclotransferase 0.8919 2 150
2q53-assembly1.cif.gz_A ensemble refinement of the crystal structure of uncharacterized protein loc79017 from homo sapiens 0.8827 2 150
2rbh-assembly1.cif.gz_B gamma-glutamyl cyclotransferase 0.8812 2 150
3cry-assembly1.cif.gz_B gamma-glutamyl cyclotransferase 0.8809 2 150
ID Description Score Start End Superfamily
af_O53356_1_154_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.9859 1 149 3.10.490.10
af_O53356_1_154_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.973 1 149 3.10.490.10
af_I6XWK6_2_145_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.9247 2 142 3.10.490.10
af_F1QV19_31_214_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.8981 2 150 3.10.490.10
af_Q18596_14_185_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.8891 2 150 3.10.490.10
ID Description Score Start End GO Terms
AF-A0A1C4TE22-F1-model_v4 deleted 0.9947 2 145
AF-A0A1C6M7W7-F1-model_v4 AIG2-like family protein 0.9939 2 145 GO:0003839
AF-A0A3N4TQU5-F1-model_v4 deleted 0.9934 2 145
AF-A0A160P4G9-F1-model_v4 AIG2 family protein 0.9933 2 145 GO:0003839
AF-A0A327U7A9-F1-model_v4 AIG2 family protein 0.9931 2 145 GO:0003839

Map