F480221

General Info

Members Datasets Scaffolds Average Seq Length
774 284 1548 311

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100015997|Ga0075428_1000159973
Length 359
Sequence VTAADRWTQEPGMRTAEGGPRCSDYHTQATRRLLPPAIRVSYRRLMKNEAVRQHFTAALDALVADLKQDRSILAAILCGSLSHDTVWSRSDIDLALITIDDKLVPSSCVALHADGVNVHGFLMPRTEFRKMVDGAIHNSFMHSLLAKGRLLYTHDETIADLCARLTDIGERDTRLQLLSAATEALPAIYKAHKWLVTRDDLDYTALWILYAATPLAKMEVIGAHQIADREVIPQALRLNPGFFRTVYVELLNSPKQRAQVETALEAVDGYIAARAERVFAPVLDYLRDAGEARGCTEIEHHFKRNFGIEGVTTACEYMADQGRIGKAAVTTRLTRKSNVDVQELAFFYLDSEGGPAPQW

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
185 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
186 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
187 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
188 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
244 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
245 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
263 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
264 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 2.2
Rhizosphere 97.16
Stem 0
Stem Tuber 0
Unclassified 9.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100015997 3300006844 Bacteria 8296
2 Ga0065712_10067780 3300005290 Bacteria 37076
3 Ga0065712_10102529 3300005290 Bacteria 2007
4 Ga0065715_10032923 3300005293 Unclassified 1125
5 Ga0065715_10099007 3300005293 Bacteria 3470
6 Ga0065715_10108427 3300005293 Bacteria 2718
7 Ga0065715_10178266 3300005293 Bacteria 1495
8 Ga0065707_10091001 3300005295 Bacteria 4017
9 Ga0065707_10141100 3300005295 Bacteria 1771
10 Ga0070683_100000001 3300005329 Bacteria 529385
11 Ga0070683_100009785 3300005329 Bacteria 8215
12 Ga0070683_100046281 3300005329 Bacteria 4019
13 Ga0070683_100249949 3300005329 Bacteria 1686
14 Ga0070683_100317889 3300005329 Unclassified 1482
15 Ga0070683_100323842 3300005329 Bacteria 1467
16 Ga0070690_100031422 3300005330 Bacteria 3308
17 Ga0070690_100092993 3300005330 Bacteria 1989
18 Ga0070690_100103022 3300005330 Unclassified 1895
19 Ga0070670_100001568 3300005331 Bacteria 18420
20 Ga0070670_100005083 3300005331 Bacteria 11069
21 Ga0070670_100018369 3300005331 Bacteria 6000
22 Ga0070670_100049685 3300005331 Bacteria 3606
23 Ga0070670_100087460 3300005331 Unclassified 2678
24 Ga0070670_100140089 3300005331 Bacteria 2092
25 Ga0070670_100303637 3300005331 Bacteria 1397
26 Ga0068869_100093707 3300005334 Bacteria 2263
27 Ga0068869_100100169 3300005334 Bacteria 2190
28 Ga0068869_100145808 3300005334 Bacteria 1832
29 Ga0070666_10250446 3300005335 Unclassified 1254
30 Ga0070680_100306857 3300005336 Bacteria 1346
31 Ga0070682_100039882 3300005337 Bacteria 2887
32 Ga0068868_100024674 3300005338 Bacteria 4565
33 Ga0068868_100357655 3300005338 Bacteria 1252
34 Ga0070689_100172829 3300005340 Bacteria 1751
35 Ga0070687_100024967 3300005343 Bacteria 2862
36 Ga0070661_100062551 3300005344 Bacteria 2732
37 Ga0070661_100123170 3300005344 Bacteria 1943
38 Ga0070661_100385052 3300005344 Bacteria 1106
39 Ga0070692_10076247 3300005345 Bacteria 1797
40 Ga0070668_100129651 3300005347 Bacteria 2023
41 Ga0070668_100205821 3300005347 Bacteria 1617
42 Ga0070669_100009269 3300005353 Bacteria 7012
43 Ga0070669_100060729 3300005353 Bacteria 2777
44 Ga0070669_100394729 3300005353 Unclassified 1131
45 Ga0070675_100001263 3300005354 Bacteria 18495
46 Ga0070675_100006748 3300005354 Bacteria 8827
47 Ga0070675_100014054 3300005354 Bacteria 6305
48 Ga0070675_100019664 3300005354 Bacteria 5383
49 Ga0070675_100061494 3300005354 Bacteria 3101
50 Ga0070675_100105713 3300005354 Bacteria 2375
51 Ga0070675_100132871 3300005354 Bacteria 2122
52 Ga0070675_100412493 3300005354 Unclassified 1206
53 Ga0070675_100454031 3300005354 Unclassified 1150
54 Ga0070675_100482858 3300005354 Bacteria 1115
55 Ga0070671_100011083 3300005355 Bacteria 7238
56 Ga0070671_100380925 3300005355 Bacteria 1206
57 Ga0070674_100136401 3300005356 Bacteria 1836
58 Ga0070674_100335028 3300005356 Unclassified 1217
59 Ga0070673_100001987 3300005364 Bacteria 12330
60 Ga0070673_100082834 3300005364 Bacteria 2605
61 Ga0070673_100178977 3300005364 Bacteria 1814
62 Ga0070673_100220653 3300005364 Unclassified 1641
63 Ga0070688_100038882 3300005365 Bacteria 2909
64 Ga0070659_100078915 3300005366 Bacteria 2627
65 Ga0070667_100011292 3300005367 Bacteria 7388
66 Ga0070667_100225927 3300005367 Bacteria 1668
67 Ga0070713_100001406 3300005436 Bacteria 15420
68 Ga0070713_100166066 3300005436 Bacteria 1974
69 Ga0070713_100330018 3300005436 Bacteria 1411
70 Ga0070711_100052926 3300005439 Bacteria 2796
71 Ga0070711_100191228 3300005439 Bacteria 1573
72 Ga0070711_100380081 3300005439 Archaea 1142
73 Ga0070700_100053668 3300005441 Bacteria 2517
74 Ga0070700_100068163 3300005441 Bacteria 2262
75 Ga0070694_100001552 3300005444 Bacteria 13500
76 Ga0070708_100000082 3300005445 Bacteria 61560
77 Ga0070708_100107863 3300005445 Bacteria 2557
78 Ga0070663_100058972 3300005455 Bacteria 2758
79 Ga0070678_100281754 3300005456 Bacteria 1406
80 Ga0070678_100354085 3300005456 Bacteria 1263
81 Ga0070662_100009376 3300005457 Bacteria 6398
82 Ga0070662_100076945 3300005457 Bacteria 2475
83 Ga0070662_100266324 3300005457 Bacteria 1382
84 Ga0068867_100210376 3300005459 Bacteria 1562
85 Ga0070685_10054840 3300005466 Bacteria 2314
86 Ga0070707_100000145 3300005468 Bacteria 67345
87 Ga0070707_100040509 3300005468 Bacteria 4457
88 Ga0070698_100454311 3300005471 Unclassified 1217
89 Ga0070679_100093988 3300005530 Bacteria 2986
90 Ga0070684_100000006 3300005535 Bacteria 227715
91 Ga0070684_100004965 3300005535 Bacteria 10156
92 Ga0070684_100029780 3300005535 Bacteria 4630
93 Ga0070684_100056680 3300005535 Bacteria 3420
94 Ga0070684_100077785 3300005535 Bacteria 2930
95 Ga0070684_100138860 3300005535 Bacteria 2196
96 Ga0070684_100145416 3300005535 Bacteria 2145
97 Ga0068853_100187124 3300005539 Bacteria 1880
98 Ga0070672_100012534 3300005543 Bacteria 5958
99 Ga0070672_100015417 3300005543 Bacteria 5440
100 Ga0070672_100024105 3300005543 Bacteria 4491
101 Ga0070672_100152804 3300005543 Bacteria 1910
102 Ga0070672_100155656 3300005543 Unclassified 1893
103 Ga0070672_100206131 3300005543 Unclassified 1645
104 Ga0070672_100322171 3300005543 Bacteria 1314
105 Ga0070672_100330191 3300005543 Bacteria 1297
106 Ga0070695_100076803 3300005545 Bacteria 2200
107 Ga0070695_100329218 3300005545 Unclassified 1138
108 Ga0070695_100372014 3300005545 Bacteria 1076
109 Ga0070693_100020424 3300005547 Bacteria 3493
110 Ga0070665_100084053 3300005548 Bacteria 3188
111 Ga0070704_100013597 3300005549 Bacteria 5058
112 Ga0070704_100073498 3300005549 Bacteria 2491
113 Ga0068855_100083572 3300005563 Bacteria 3698
114 Ga0068855_100089359 3300005563 Bacteria 3557
115 Ga0068855_100175064 3300005563 Bacteria 2428
116 Ga0070664_100012461 3300005564 Bacteria 6912
117 Ga0070664_100019301 3300005564 Bacteria 5608
118 Ga0070664_100022484 3300005564 Bacteria 5200
119 Ga0070664_100088648 3300005564 Bacteria 2675
120 Ga0070664_100122967 3300005564 Bacteria 2273
121 Ga0070664_100649453 3300005564 Bacteria 980
122 Ga0068857_100009623 3300005577 Bacteria 8396
123 Ga0068857_100036925 3300005577 Bacteria 4327
124 Ga0068857_100388525 3300005577 Bacteria 1297
125 Ga0068856_100068581 3300005614 Bacteria 3506
126 Ga0068856_100103880 3300005614 Bacteria 2834
127 Ga0068859_100000048 3300005617 Bacteria 138664
128 Ga0068859_100015446 3300005617 Bacteria 7670
129 Ga0068859_100106570 3300005617 Bacteria 2862
130 Ga0068859_100165744 3300005617 Bacteria 2290
131 Ga0068859_100210696 3300005617 Bacteria 2030
132 Ga0068859_100259286 3300005617 Bacteria 1829
133 Ga0068859_100397500 3300005617 Bacteria 1474
134 Ga0068859_100416385 3300005617 Bacteria 1440
135 Ga0068859_100955806 3300005617 Bacteria 940
136 Ga0068864_100008571 3300005618 Bacteria 8439
137 Ga0068864_100008582 3300005618 Bacteria 8435
138 Ga0068864_100056822 3300005618 Bacteria 3381
139 Ga0068864_100107216 3300005618 Bacteria 2485
140 Ga0068861_100045959 3300005719 Bacteria 3291
141 Ga0068861_100054955 3300005719 Bacteria 3035
142 Ga0068861_100488725 3300005719 Bacteria 1110
143 Ga0068870_10235375 3300005840 Unclassified 1128
144 Ga0068863_100000892 3300005841 Bacteria 30096
145 Ga0068863_100120880 3300005841 Bacteria 2497
146 Ga0068858_100012151 3300005842 Bacteria 8119
147 Ga0068858_100037321 3300005842 Unclassified 4506
148 Ga0068858_100165426 3300005842 Bacteria 2084
149 Ga0068858_100256453 3300005842 Bacteria 1662
150 Ga0068858_100389734 3300005842 Bacteria 1337
151 Ga0068860_100000930 3300005843 Bacteria 32372
152 Ga0068860_100231789 3300005843 Unclassified 1794
153 Ga0068862_100001329 3300005844 Bacteria 22932
154 Ga0068862_100067826 3300005844 Bacteria 3076
155 Ga0081455_10001203 3300005937 Bacteria 32430
156 Ga0081455_10110856 3300005937 Bacteria 2181
157 Ga0081540_1058918 3300005983 Bacteria 1846
158 Ga0075364_10185126 3300006051 Bacteria 1410
159 Ga0075366_10041079 3300006195 Bacteria 2737
160 Ga0097621_100009205 3300006237 Bacteria 7161
161 Ga0097621_100013721 3300006237 Bacteria 6049
162 Ga0097621_100210632 3300006237 Bacteria 1691
163 Ga0097621_100221928 3300006237 Bacteria 1647
164 Ga0068871_100015197 3300006358 Bacteria 5757
165 Ga0068871_100041698 3300006358 Bacteria 3681
166 Ga0068871_100052807 3300006358 Bacteria 3293
167 Ga0068871_100293561 3300006358 Bacteria 1425
168 Ga0075428_100014958 3300006844 Bacteria 8623
169 Ga0075428_100050078 3300006844 Bacteria 4581
170 Ga0075428_100175607 3300006844 Bacteria 2320
171 Ga0075428_100261011 3300006844 Bacteria 1865
172 Ga0075430_100003383 3300006846 Bacteria 13347
173 Ga0075430_100004868 3300006846 Bacteria 11301
174 Ga0075430_100011948 3300006846 Bacteria 7394
175 Ga0075430_100039337 3300006846 Bacteria 4004
176 Ga0075430_100096278 3300006846 Bacteria 2474
177 Ga0075430_100119611 3300006846 Bacteria 2196
178 Ga0075431_100004908 3300006847 Bacteria 13173
179 Ga0075431_100006235 3300006847 Bacteria 11846
180 Ga0075431_100010323 3300006847 Bacteria 9384
181 Ga0075431_100036280 3300006847 Bacteria 5077
182 Ga0075431_100089270 3300006847 Bacteria 3182
183 Ga0075431_100092383 3300006847 Bacteria 3123
184 Ga0075431_100432630 3300006847 Bacteria 1314
185 Ga0075431_100442204 3300006847 Unclassified 1297
186 Ga0075433_10014851 3300006852 Bacteria 6374
187 Ga0075433_10020665 3300006852 Bacteria 5510
188 Ga0075433_10107988 3300006852 Bacteria 2468
189 Ga0075433_10117368 3300006852 Bacteria 2361
190 Ga0075433_10196686 3300006852 Bacteria 1793
191 Ga0075434_100001808 3300006871 Bacteria 18502
192 Ga0075434_100093944 3300006871 Bacteria 3003
193 Ga0075434_100290095 3300006871 Bacteria 1656
194 Ga0075434_100291192 3300006871 Bacteria 1653
195 Ga0075434_100344607 3300006871 Bacteria 1511
196 Ga0075429_100003485 3300006880 Bacteria 13421
197 Ga0075429_100004890 3300006880 Bacteria 11546
198 Ga0075429_100020868 3300006880 Bacteria 5685
199 Ga0075429_100023225 3300006880 Bacteria 5380
200 Ga0075429_100121877 3300006880 Bacteria 2279
201 Ga0068865_100228818 3300006881 Unclassified 1457
202 Ga0075436_100014860 3300006914 Bacteria 5335
203 Ga0097620_100000048 3300006931 Bacteria 138664
204 Ga0097620_100015446 3300006931 Bacteria 7670
205 Ga0097620_100106569 3300006931 Bacteria 2862
206 Ga0097620_100165737 3300006931 Bacteria 2290
207 Ga0097620_100210673 3300006931 Bacteria 2030
208 Ga0097620_100259279 3300006931 Bacteria 1829
209 Ga0097620_100397539 3300006931 Bacteria 1474
210 Ga0097620_100416430 3300006931 Bacteria 1440
211 Ga0097620_100955639 3300006931 Bacteria 940
212 Ga0075435_100175837 3300007076 Bacteria 1808
213 Ga0075435_100470627 3300007076 Unclassified 1085
214 Ga0105240_10000863 3300009093 Bacteria 54696
215 Ga0105240_10001424 3300009093 Bacteria 40938
216 Ga0105240_10002914 3300009093 Bacteria 27000
217 Ga0105240_10661139 3300009093 Bacteria 1144
218 Ga0111539_10000226 3300009094 Bacteria 67584
219 Ga0111539_10000996 3300009094 Bacteria 37109
220 Ga0111539_10006702 3300009094 Bacteria 14831
221 Ga0111539_10009816 3300009094 Bacteria 12081
222 Ga0111539_10045551 3300009094 Bacteria 5250
223 Ga0111539_10048542 3300009094 Bacteria 5067
224 Ga0111539_10057158 3300009094 Unclassified 4633
225 Ga0111539_10061076 3300009094 Bacteria 4465
226 Ga0111539_10079046 3300009094 Bacteria 3869
227 Ga0111539_10095993 3300009094 Bacteria 3482
228 Ga0111539_10098551 3300009094 Bacteria 3433
229 Ga0111539_10108636 3300009094 Bacteria 3256
230 Ga0111539_10156236 3300009094 Bacteria 2669
231 Ga0111539_10169895 3300009094 Bacteria 2548
232 Ga0111539_10354051 3300009094 Bacteria 1709
233 Ga0111539_10414015 3300009094 Bacteria 1570
234 Ga0111539_10475162 3300009094 Bacteria 1456
235 Ga0111539_10514972 3300009094 Bacteria 1394
236 Ga0111539_10916370 3300009094 Unclassified 1019
237 Ga0105245_10001083 3300009098 Bacteria 24684
238 Ga0105245_10058571 3300009098 Bacteria 3468
239 Ga0105245_10109107 3300009098 Bacteria 2571
240 Ga0105245_10224715 3300009098 Bacteria 1813
241 Ga0105245_10419488 3300009098 Bacteria 1341
242 Ga0105247_10075403 3300009101 Unclassified 2117
243 Ga0105247_10355133 3300009101 Unclassified 1032
244 Ga0114129_10000102 3300009147 Bacteria 84059
245 Ga0114129_10001834 3300009147 Bacteria 28925
246 Ga0114129_10018819 3300009147 Bacteria 9835
247 Ga0114129_10023226 3300009147 Bacteria 8797
248 Ga0114129_10031959 3300009147 Bacteria 7441
249 Ga0114129_10055504 3300009147 Bacteria 5551
250 Ga0114129_10079230 3300009147 Bacteria 4568
251 Ga0114129_10185399 3300009147 Unclassified 2829
252 Ga0114129_10212473 3300009147 Bacteria 2615
253 Ga0114129_10280181 3300009147 Bacteria 2228
254 Ga0114129_10368291 3300009147 Bacteria 1900
255 Ga0114129_10425201 3300009147 Bacteria 1746
256 Ga0114129_10505770 3300009147 Bacteria 1577
257 Ga0114129_10713810 3300009147 Bacteria 1287
258 Ga0105243_10044512 3300009148 Bacteria 3483
259 Ga0105243_10092762 3300009148 Bacteria 2490
260 Ga0105243_10187730 3300009148 Bacteria 1803
261 Ga0105243_10410634 3300009148 Bacteria 1260
262 Ga0105243_10497568 3300009148 Bacteria 1154
263 Ga0105241_10127965 3300009174 Bacteria 2053
264 Ga0105242_10105704 3300009176 Bacteria 2391
265 Ga0105242_10147905 3300009176 Bacteria 2045
266 Ga0105248_10001762 3300009177 Bacteria 24063
267 Ga0105248_10009675 3300009177 Bacteria 10621
268 Ga0105248_10034755 3300009177 Bacteria 5639
269 Ga0105248_10039063 3300009177 Bacteria 5315
270 Ga0105248_10048749 3300009177 Bacteria 4751
271 Ga0105248_10152063 3300009177 Bacteria 2611
272 Ga0105248_10243444 3300009177 Bacteria 2025
273 Ga0105248_10274474 3300009177 Bacteria 1898
274 Ga0105248_10340374 3300009177 Unclassified 1689
275 Ga0105248_10436279 3300009177 Unclassified 1475
276 Ga0105237_10020622 3300009545 Bacteria 6791
277 Ga0105237_10152908 3300009545 Bacteria 2304
278 Ga0105237_10219853 3300009545 Unclassified 1900
279 Ga0105238_10017674 3300009551 Bacteria 7249
280 Ga0105238_10038438 3300009551 Bacteria 4861
281 Ga0105238_10217357 3300009551 Bacteria 1887
282 Ga0105238_10287459 3300009551 Bacteria 1626
283 Ga0105249_10009351 3300009553 Bacteria 8574
284 Ga0105239_10061473 3300010375 Bacteria 4122
285 Ga0105239_10077506 3300010375 Bacteria 3658
286 Ga0157371_10022908 3300013102 Bacteria 4568
287 Ga0157370_10153370 3300013104 Bacteria 2143
288 Ga0157369_10089681 3300013105 Bacteria 3283
289 Ga0157369_10248411 3300013105 Bacteria 1857
290 Ga0157369_10250071 3300013105 Bacteria 1850
291 Ga0157369_10440645 3300013105 Bacteria 1349
292 Ga0157369_10479859 3300013105 Archaea 1287
293 Ga0157374_10482511 3300013296 Unclassified 1243
294 Ga0157378_10003421 3300013297 Bacteria 14079
295 Ga0163162_10003315 3300013306 Bacteria 15407
296 Ga0163162_10083778 3300013306 Bacteria 3263
297 Ga0163162_10116672 3300013306 Bacteria 2771
298 Ga0163162_10302794 3300013306 Bacteria 1731
299 Ga0157372_10022491 3300013307 Bacteria 6823
300 Ga0157372_10029590 3300013307 Bacteria 5982
301 Ga0157372_10075184 3300013307 Bacteria 3811
302 Ga0157372_10115393 3300013307 Bacteria 3079
303 Ga0157372_10127032 3300013307 Bacteria 2932
304 Ga0157372_10143791 3300013307 Unclassified 2750
305 Ga0157372_10404713 3300013307 Bacteria 1590
306 Ga0157372_10871091 3300013307 Bacteria 1045
307 Ga0157375_10069130 3300013308 Bacteria 3537
308 Ga0157375_10069315 3300013308 Bacteria 3532
309 Ga0157375_10244300 3300013308 Bacteria 1955
310 Ga0157375_10360320 3300013308 Bacteria 1620
311 Ga0163163_10000008 3300014325 Bacteria 286490
312 Ga0163163_10028158 3300014325 Bacteria 5391
313 Ga0163163_10028930 3300014325 Bacteria 5327
314 Ga0163163_10034715 3300014325 Bacteria 4887
315 Ga0163163_10102882 3300014325 Bacteria 2881
316 Ga0163163_10115216 3300014325 Bacteria 2719
317 Ga0163163_10178184 3300014325 Bacteria 2173
318 Ga0157380_10007238 3300014326 Bacteria 7870
319 Ga0157380_10031850 3300014326 Bacteria 4050
320 Ga0157380_10134978 3300014326 Bacteria 2111
321 Ga0157380_10163985 3300014326 Unclassified 1934
322 Ga0157377_10084957 3300014745 Bacteria 1857
323 Ga0157377_10086987 3300014745 Bacteria 1838
324 Ga0157377_10094791 3300014745 Bacteria 1768
325 Ga0157379_10012294 3300014968 Bacteria 7477
326 Ga0157379_10048221 3300014968 Unclassified 3802
327 Ga0157376_10014268 3300014969 Bacteria 5958
328 Ga0157376_10077367 3300014969 Bacteria 2846
329 Ga0157376_10077544 3300014969 Bacteria 2843
330 Ga0157376_10254414 3300014969 Bacteria 1642
331 Ga0157376_10330205 3300014969 Bacteria 1453
332 Ga0207697_10003145 3300025315 Bacteria 8234
333 Ga0207682_10016049 3300025893 Bacteria 2919
334 Ga0207710_10184266 3300025900 Unclassified 1025
335 Ga0207688_10006615 3300025901 Bacteria 6305
336 Ga0207680_10087061 3300025903 Bacteria 1977
337 Ga0207699_10118422 3300025906 Bacteria 1709
338 Ga0207645_10007332 3300025907 Bacteria 7797
339 Ga0207645_10057591 3300025907 Bacteria 2481
340 Ga0207643_10090163 3300025908 Unclassified 1787
341 Ga0207654_10057141 3300025911 Bacteria 2266
342 Ga0207707_10155358 3300025912 Bacteria 2001
343 Ga0207695_10009126 3300025913 Bacteria 12311
344 Ga0207695_10009246 3300025913 Bacteria 12214
345 Ga0207695_10011427 3300025913 Bacteria 10757
346 Ga0207695_10021992 3300025913 Bacteria 7258
347 Ga0207671_10011240 3300025914 Bacteria 7304
348 Ga0207671_10088462 3300025914 Bacteria 2330
349 Ga0207671_10151904 3300025914 Unclassified 1789
350 Ga0207671_10280935 3300025914 Bacteria 1313
351 Ga0207693_10023771 3300025915 Bacteria 4863
352 Ga0207663_10255204 3300025916 Bacteria 1292
353 Ga0207662_10001641 3300025918 Bacteria 10952
354 Ga0207662_10259154 3300025918 Unclassified 1144
355 Ga0207649_10028211 3300025920 Bacteria 3303
356 Ga0207646_10003368 3300025922 Bacteria 18107
357 Ga0207646_10060627 3300025922 Bacteria 3378
358 Ga0207646_10087433 3300025922 Bacteria 2789
359 Ga0207681_10030753 3300025923 Bacteria 3502
360 Ga0207681_10193536 3300025923 Bacteria 1557
361 Ga0207681_10247265 3300025923 Bacteria 1391
362 Ga0207694_10039694 3300025924 Bacteria 3623
363 Ga0207694_10061526 3300025924 Bacteria 2922
364 Ga0207694_10079898 3300025924 Bacteria 2566
365 Ga0207650_10005300 3300025925 Bacteria 8797
366 Ga0207650_10017202 3300025925 Bacteria 5060
367 Ga0207650_10063832 3300025925 Unclassified 2755
368 Ga0207650_10197265 3300025925 Bacteria 1611
369 Ga0207659_10000814 3300025926 Bacteria 18451
370 Ga0207659_10004685 3300025926 Bacteria 8284
371 Ga0207659_10016644 3300025926 Bacteria 4790
372 Ga0207659_10039048 3300025926 Bacteria 3307
373 Ga0207659_10131164 3300025926 Bacteria 1934
374 Ga0207659_10135739 3300025926 Bacteria 1904
375 Ga0207659_10358095 3300025926 Unclassified 1212
376 Ga0207700_10013319 3300025928 Bacteria 5345
377 Ga0207664_10020404 3300025929 Bacteria 4911
378 Ga0207644_10033371 3300025931 Bacteria 3596
379 Ga0207706_10041415 3300025933 Bacteria 4083
380 Ga0207706_10075996 3300025933 Bacteria 2955
381 Ga0207706_10312093 3300025933 Bacteria 1369
382 Ga0207686_10074448 3300025934 Bacteria 2194
383 Ga0207686_10277894 3300025934 Unclassified 1235
384 Ga0207709_10096472 3300025935 Unclassified 1945
385 Ga0207669_10175414 3300025937 Bacteria 1531
386 Ga0207669_10238639 3300025937 Bacteria 1346
387 Ga0207704_10195830 3300025938 Bacteria 1474
388 Ga0207691_10016354 3300025940 Bacteria 7042
389 Ga0207691_10016707 3300025940 Bacteria 6969
390 Ga0207691_10047660 3300025940 Bacteria 3932
391 Ga0207691_10063928 3300025940 Bacteria 3335
392 Ga0207691_10080849 3300025940 Bacteria 2922
393 Ga0207691_10090757 3300025940 Bacteria 2738
394 Ga0207691_10115472 3300025940 Bacteria 2384
395 Ga0207691_10134680 3300025940 Unclassified 2180
396 Ga0207691_10163889 3300025940 Bacteria 1949
397 Ga0207691_10250746 3300025940 Bacteria 1528
398 Ga0207691_10303169 3300025940 Bacteria 1372
399 Ga0207711_10004617 3300025941 Bacteria 11711
400 Ga0207711_10041912 3300025941 Bacteria 3899
401 Ga0207711_10050126 3300025941 Bacteria 3574
402 Ga0207711_10054064 3300025941 Bacteria 3444
403 Ga0207711_10113038 3300025941 Unclassified 2418
404 Ga0207711_10179185 3300025941 Bacteria 1926
405 Ga0207711_10337231 3300025941 Unclassified 1395
406 Ga0207689_10002093 3300025942 Bacteria 18826
407 Ga0207689_10026916 3300025942 Bacteria 4814
408 Ga0207689_10036307 3300025942 Bacteria 4092
409 Ga0207689_10151002 3300025942 Bacteria 1915
410 Ga0207661_10000005 3300025944 Bacteria 557888
411 Ga0207661_10000364 3300025944 Bacteria 29069
412 Ga0207661_10069287 3300025944 Unclassified 2875
413 Ga0207661_10122469 3300025944 Bacteria 2216
414 Ga0207679_10013128 3300025945 Bacteria 5425
415 Ga0207679_10018160 3300025945 Bacteria 4707
416 Ga0207667_10096279 3300025949 Bacteria 3055
417 Ga0207667_10175598 3300025949 Bacteria 2201
418 Ga0207651_10024713 3300025960 Bacteria 3721
419 Ga0207651_10111245 3300025960 Bacteria 2057
420 Ga0207651_10151160 3300025960 Bacteria 1807
421 Ga0207651_10251688 3300025960 Bacteria 1446
422 Ga0207651_10363162 3300025960 Unclassified 1223
423 Ga0207712_10197890 3300025961 Unclassified 1591
424 Ga0207668_10313438 3300025972 Bacteria 1299
425 Ga0207668_10350618 3300025972 Bacteria 1234
426 Ga0207658_10233609 3300025986 Bacteria 1554
427 Ga0207677_10015548 3300026023 Bacteria 4480
428 Ga0207703_10093950 3300026035 Bacteria 2527
429 Ga0207703_10298808 3300026035 Bacteria 1468
430 Ga0207678_10033332 3300026067 Bacteria 4488
431 Ga0207678_10151206 3300026067 Bacteria 1982
432 Ga0207708_10007113 3300026075 Bacteria 8266
433 Ga0207708_10092928 3300026075 Bacteria 2328
434 Ga0207708_10164459 3300026075 Unclassified 1754
435 Ga0207702_10251289 3300026078 Bacteria 1661
436 Ga0207641_10007073 3300026088 Bacteria 9371
437 Ga0207641_10188883 3300026088 Bacteria 1892
438 Ga0207648_10007916 3300026089 Bacteria 10362
439 Ga0207676_10128782 3300026095 Bacteria 2148
440 Ga0207676_10140554 3300026095 Bacteria 2066
441 Ga0207676_10261462 3300026095 Bacteria 1563
442 Ga0207674_10003447 3300026116 Bacteria 19340
443 Ga0207674_10007875 3300026116 Bacteria 12382
444 Ga0207674_10048045 3300026116 Bacteria 4371
445 Ga0207674_10102293 3300026116 Bacteria 2845
446 Ga0207674_10147857 3300026116 Bacteria 2307
447 Ga0207675_100011601 3300026118 Bacteria 8239
448 Ga0207675_100018644 3300026118 Bacteria 6477
449 Ga0207675_100028794 3300026118 Bacteria 5175
450 Ga0207675_100064554 3300026118 Bacteria 3422
451 Ga0207683_10089561 3300026121 Bacteria 2739
452 Ga0207683_10315482 3300026121 Bacteria 1431
453 Ga0207698_10152871 3300026142 Bacteria 2006
454 Ga0207428_10000555 3300027907 Bacteria 44135
455 Ga0207428_10004956 3300027907 Bacteria 12537
456 Ga0207428_10005077 3300027907 Bacteria 12359
457 Ga0207428_10011703 3300027907 Bacteria 7737
458 Ga0207428_10077371 3300027907 Bacteria 2604
459 Ga0207428_10172837 3300027907 Bacteria 1635
460 Ga0207428_10268354 3300027907 Bacteria 1269
461 Ga0268266_10040957 3300028379 Bacteria 3950
462 Ga0268266_10091208 3300028379 Bacteria 2672
463 Ga0268266_10102091 3300028379 Bacteria 2530
464 Ga0268266_10110896 3300028379 Bacteria 2431
465 Ga0268266_10306213 3300028379 Bacteria 1484
466 Ga0268265_10100667 3300028380 Bacteria 2333
467 Ga0268264_10003235 3300028381 Bacteria 14103
468 Ga0268264_10260856 3300028381 Unclassified 1614
469 Ga0265331_10112900 3300031250 Bacteria 1245
470 Ga0265331_10134855 3300031250 Bacteria 1125
471 Ga0265316_10163451 3300031344 Bacteria 1664
472 Ga0307408_100060682 3300031548 Bacteria 2757
473 Ga0307408_100191106 3300031548 Bacteria 1649
474 Ga0307405_10250838 3300031731 Bacteria 1317
475 Ga0316577_10108860 3300031733 Bacteria 1555
476 Ga0307410_10060117 3300031852 Bacteria 2596
477 Ga0307410_10101866 3300031852 Bacteria 2059
478 Ga0307412_10124952 3300031911 Bacteria 1859
479 Ga0307409_100080894 3300031995 Bacteria 2624
480 Ga0307409_100145190 3300031995 Bacteria 2051
481 Ga0307416_100057276 3300032002 Bacteria 3152
482 Ga0307416_100140770 3300032002 Unclassified 2192
483 Ga0307416_100555792 3300032002 Bacteria 1222
484 Ga0307416_100726772 3300032002 Bacteria 1084
485 Ga0307414_10135499 3300032004 Bacteria 1919
486 Ga0307414_10352897 3300032004 Bacteria 1263
487 Ga0307411_10014277 3300032005 Bacteria 4413
488 Ga0307411_10193427 3300032005 Bacteria 1555
489 Ga0307415_100050673 3300032126 Bacteria 2814
490 Ga0307415_100064092 3300032126 Bacteria 2556
491 Ga0373934_0006423 3300035086 Bacteria 4360
492 Ga0373934_0007926 3300035086 Bacteria 3952
493 Ga0373934_0050574 3300035086 Bacteria 1646
494 Ga0373923_0036707 3300035111 Bacteria 2002
495 Ga0373923_0061916 3300035111 Bacteria 1591
496 Ga0373953_0071055 3300035117 Unclassified 1436
497 Ga0373943_0001049 3300035170 Bacteria 12277
498 Ga0373955_0029605 3300035172 Bacteria 2849
499 Ga0373955_0055458 3300035172 Bacteria 2171
500 Ga0373955_0150272 3300035172 Unclassified 1371
501 Ga0373931_0001968 3300035691 Bacteria 9031
502 Ga0373935_0006665 3300035692 Bacteria 6899
503 Ga0373935_0057520 3300035692 Bacteria 2481
504 Ga0373927_0000683 3300035695 Bacteria 25847
505 Ga0373927_0001087 3300035695 Bacteria 20683
506 Ga0373927_0005255 3300035695 Bacteria 8954
507 Ga0373933_0092431 3300035724 Bacteria 1868
508 Ga0373933_0138039 3300035724 Bacteria 1537
509 Ga0373947_0000436 3300035725 Bacteria 23623
510 Ga0373947_0012711 3300035725 Bacteria 4827
511 Ga0373947_0128564 3300035725 Bacteria 1615
512 Ga0373947_0160859 3300035725 Bacteria 1452
513 Ga0373937_0026703 3300036401 Bacteria 5217
514 Ga0373937_0031286 3300036401 Bacteria 4820
515 Ga0373937_0093952 3300036401 Bacteria 2781
516 Ga0316584_0002331 3300036712 Bacteria 11968
517 Ga0373925_0000564 3300037068 Bacteria 36366
518 Ga0373925_0002462 3300037068 Bacteria 14811
519 Ga0373925_0053588 3300037068 Bacteria 3016
520 Ga0373925_0161633 3300037068 Bacteria 1764
521 Ga0373925_0487097 3300037068 Bacteria 1012
522 Ga0395899_0212593 3300037312 Bacteria 1343
523 Ga0395898_0024586 3300037466 Bacteria 6075
524 Ga0395905_0017136 3300037471 Bacteria 6880
525 Ga0395905_0021376 3300037471 Bacteria 6120
526 Ga0395901_0009525 3300038443 Bacteria 9856
527 Ga0436365_1104027 3300039437 Bacteria 12732
528 Ga0439439_0027848 3300041406 Bacteria 1429
529 Ga0439453_0006718 3300041408 Bacteria 1803
530 Ga0439435_0000571 3300042436 Bacteria 5956
531 Ga0439464_0021516 3300042439 Bacteria 1771
532 Ga0439460_0059942 3300042461 Bacteria 1160
533 Ga0451577_0021313 3300042876 Bacteria 5932
534 Ga0453684_0038669 3300044712 Bacteria 6517
535 Ga0453684_0263538 3300044712 Bacteria 1973
536 Ga0451576_0002164 3300045051 Bacteria 30385
537 Ga0451576_0037104 3300045051 Bacteria 5164
538 Ga0451576_0153227 3300045051 Bacteria 2404
539 Ga0451576_0361981 3300045051 Bacteria 1519
540 Ga0451576_0556669 3300045051 Bacteria 1205
541 Ga0466967_0082823 3300045976 Unclassified 2900
542 Ga0466967_0198753 3300045976 Bacteria 1898
543 Ga0495603_0001932 3300046455 Bacteria 12222
544 Ga0495629_0001600 3300046459 Bacteria 17805
545 Ga0495629_0011662 3300046459 Bacteria 6377
546 Ga0495629_0015123 3300046459 Bacteria 5547
547 Ga0495651_0002085 3300046462 Bacteria 15405
548 Ga0495651_0023432 3300046462 Bacteria 4799
549 Ga0495651_0030830 3300046462 Bacteria 4181
550 Ga0495653_0018806 3300046463 Bacteria 5606
551 Ga0495653_0072769 3300046463 Bacteria 2566
552 Ga0495580_0000920 3300046472 Bacteria 25688
553 Ga0495580_0038378 3300046472 Bacteria 3430
554 Ga0495580_0053122 3300046472 Bacteria 2860
555 Ga0495580_0063332 3300046472 Bacteria 2594
556 Ga0495580_0064990 3300046472 Bacteria 2556
557 Ga0495580_0101921 3300046472 Bacteria 1996
558 Ga0495580_0107763 3300046472 Bacteria 1934
559 Ga0495639_0000299 3300046475 Bacteria 24262
560 Ga0495662_0021201 3300046476 Bacteria 3142
561 Ga0495664_0009586 3300046477 Bacteria 5419
562 Ga0495594_0011786 3300046499 Bacteria 4545
563 Ga0495594_0050798 3300046499 Bacteria 2281
564 Ga0495608_0008978 3300046511 Bacteria 6989
565 Ga0495628_0108848 3300046516 Unclassified 2133
566 Ga0495628_0348632 3300046516 Bacteria 1089
567 Ga0495630_0051893 3300046517 Bacteria 3070
568 Ga0495666_0072396 3300046526 Bacteria 1637
569 Ga0495666_0164847 3300046526 Bacteria 1027
570 Ga0495652_0028751 3300046529 Bacteria 4888
571 Ga0495652_0053648 3300046529 Unclassified 3435
572 Ga0495665_0000210 3300046531 Bacteria 29881
573 Ga0495665_0000657 3300046531 Bacteria 17735
574 Ga0495640_0017457 3300046533 Bacteria 5350
575 Ga0495640_0244861 3300046533 Bacteria 1124
576 Ga0495586_0011963 3300046535 Bacteria 4610
577 Ga0495586_0096401 3300046535 Bacteria 1638
578 Ga0495587_0005626 3300046536 Bacteria 8173
579 Ga0495645_0001141 3300046543 Bacteria 18004
580 Ga0495645_0016444 3300046543 Bacteria 5282
581 Ga0495645_0030095 3300046543 Unclassified 3954
582 Ga0495645_0037119 3300046543 Bacteria 3551
583 Ga0495645_0093066 3300046543 Bacteria 2152
584 Ga0495667_0000670 3300046559 Bacteria 21917
585 Ga0495667_0009772 3300046559 Bacteria 6500
586 Ga0495667_0010878 3300046559 Bacteria 6152
587 Ga0495667_0024579 3300046559 Bacteria 4057
588 Ga0495667_0056044 3300046559 Bacteria 2592
589 Ga0495634_0167527 3300046642 Unclassified 1382
590 Ga0495635_0036525 3300046663 Bacteria 3405
591 Ga0495588_0004253 3300046674 Bacteria 6315
592 Ga0495588_0064489 3300046674 Bacteria 1900
593 Ga0495657_0035878 3300046675 Bacteria 3433
594 Ga0495599_0060996 3300046678 Bacteria 2357
595 Ga0495599_0137740 3300046678 Bacteria 1515
596 Ga0495599_0140527 3300046678 Bacteria 1498
597 Ga0495599_0240672 3300046678 Unclassified 1103
598 Ga0495623_0016983 3300046679 Bacteria 4701
599 Ga0495623_0045317 3300046679 Bacteria 2793
600 Ga0495623_0087173 3300046679 Bacteria 1923
601 Ga0495646_0077301 3300046680 Unclassified 1947
602 Ga0495658_0000216 3300046683 Bacteria 32922
603 Ga0495613_0003520 3300046689 Bacteria 11724
604 Ga0495613_0029499 3300046689 Bacteria 4079
605 Ga0495600_0014364 3300046809 Bacteria 4990
606 Ga0495600_0038539 3300046809 Bacteria 3110
607 Ga0495600_0251988 3300046809 Unclassified 1123
608 Ga0495581_0000157 3300047315 Bacteria 30371
609 Ga0495581_0006689 3300047315 Bacteria 6681
610 Ga0495604_0002200 3300047317 Bacteria 15628
611 Ga0495604_0122481 3300047317 Bacteria 1881
612 Ga0495604_0178964 3300047317 Unclassified 1484
613 Ga0495674_0003092 3300047319 Bacteria 16177
614 Ga0495674_0008093 3300047319 Bacteria 10032
615 Ga0495674_0121185 3300047319 Bacteria 2209
616 Ga0495674_0216558 3300047319 Bacteria 1584
617 Ga0495674_0236115 3300047319 Bacteria 1508
618 Ga0495674_0258524 3300047319 Bacteria 1431
619 Ga0495674_0359365 3300047319 Bacteria 1181
620 Ga0495672_0004867 3300047320 Bacteria 10804
621 Ga0495680_0131672 3300047322 Unclassified 1837
622 Ga0495675_0005886 3300047444 Bacteria 7491
623 Ga0495675_0046731 3300047444 Bacteria 2755
624 Ga0495675_0091421 3300047444 Bacteria 1910
625 Ga0495684_0012309 3300047471 Bacteria 6598
626 Ga0495684_0016467 3300047471 Bacteria 5693
627 Ga0495684_0021742 3300047471 Bacteria 4938
628 Ga0495684_0076882 3300047471 Unclassified 2535
629 Ga0495684_0252888 3300047471 Unclassified 1281
630 Ga0495593_0000204 3300047673 Bacteria 31275
631 Ga0495602_0017350 3300048088 Bacteria 7218
632 Ga0495602_0027446 3300048088 Bacteria 5470
633 Ga0495602_0091508 3300048088 Bacteria 2522
634 Ga0495614_0000137 3300048089 Bacteria 25977
635 Ga0496101_0227264 3300048904 Bacteria 1450
636 Ga0496102_0022988 3300048905 Bacteria 5531
637 Ga0496104_0078124 3300048907 Bacteria 3154
638 Ga0496106_0035724 3300048909 Bacteria 3716
639 Ga0496106_0208911 3300048909 Bacteria 1555
640 Ga0496107_0133911 3300048910 Bacteria 1831
641 Ga0496109_0000026 3300048912 Bacteria 171405
642 Ga0496109_0017232 3300048912 Bacteria 6329
643 Ga0496109_0157778 3300048912 Bacteria 2125
644 Ga0496109_0609783 3300048912 Unclassified 1028
645 Ga0496110_0471334 3300048913 Bacteria 1144
646 Ga0496112_0009246 3300048915 Bacteria 8861
647 Ga0496112_0335665 3300048915 Bacteria 1455
648 Ga0496113_0080012 3300048916 Bacteria 2502
649 Ga0496113_0294223 3300048916 Bacteria 1299
650 Ga0496114_0185979 3300048917 Bacteria 1816
651 Ga0496114_0247496 3300048917 Unclassified 1568
652 Ga0501291_010856 3300049514 Bacteria 1304
653 Ga0501298_014164 3300049521 Bacteria 1421
654 Ga0501299_009362 3300049522 Bacteria 1613
655 Ga0501031_0090588 3300049568 Bacteria 1995
656 Ga0501036_0049217 3300049572 Bacteria 3569
657 Ga0501036_0334857 3300049572 Bacteria 1264
658 Ga0501039_0084075 3300049575 Bacteria 2479
659 Ga0501040_0028753 3300049576 Bacteria 3748
660 Ga0501040_0046601 3300049576 Bacteria 2959
661 Ga0501040_0070368 3300049576 Bacteria 2414
662 Ga0501040_0213551 3300049576 Bacteria 1372
663 Ga0501041_0046222 3300049577 Bacteria 2648
664 Ga0501041_0075854 3300049577 Bacteria 2068
665 Ga0501042_0010247 3300049578 Bacteria 6274
666 Ga0501043_0164090 3300049579 Unclassified 1735
667 Ga0501046_0128814 3300049580 Unclassified 1920
668 Ga0501046_0132033 3300049580 Bacteria 1894
669 Ga0501048_0302769 3300049582 Unclassified 1137
670 Ga0501048_0303157 3300049582 Bacteria 1137
671 Ga0501071_0004565 3300049587 Bacteria 8781
672 Ga0501071_0011520 3300049587 Bacteria 5964
673 Ga0501072_0014611 3300049588 Bacteria 6019
674 Ga0501072_0041263 3300049588 Bacteria 3624
675 Ga0501073_0052799 3300049589 Bacteria 2846
676 Ga0501073_0089210 3300049589 Bacteria 2144
677 Ga0501074_0171581 3300049590 Bacteria 1548
678 Ga0501075_0007039 3300049591 Bacteria 7772
679 Ga0501075_0022429 3300049591 Bacteria 4611
680 Ga0501075_0026638 3300049591 Bacteria 4258
681 Ga0501075_0120781 3300049591 Bacteria 1994
682 Ga0501075_0187196 3300049591 Bacteria 1579
683 Ga0501076_0006890 3300049592 Bacteria 8257
684 Ga0501076_0031774 3300049592 Bacteria 4120
685 Ga0501076_0082117 3300049592 Bacteria 2587
686 Ga0501076_0298209 3300049592 Bacteria 1321
687 Ga0501077_0021592 3300049593 Bacteria 4075
688 Ga0501077_0072657 3300049593 Bacteria 2180
689 Ga0501249_019821 3300049679 Unclassified 1461
690 Ga0501225_0014176 3300049705 Bacteria 2227
691 Ga0501079_0012237 3300049741 Bacteria 6552
692 Ga0501079_0012792 3300049741 Bacteria 6408
693 Ga0501079_0285228 3300049741 Bacteria 1291
694 Ga0501080_0421343 3300049742 Bacteria 1199
695 Ga0501081_0030644 3300049743 Bacteria 3643
696 Ga0501081_0219812 3300049743 Unclassified 1381
697 Ga0501045_0005972 3300049824 Bacteria 8427
698 Ga0501045_0017193 3300049824 Bacteria 5134
699 Ga0501045_0069665 3300049824 Bacteria 2586
700 Ga0501045_0139835 3300049824 Bacteria 1800
701 nmdc:mga00v17_148526_c1 3300050491 Bacteria 1505
702 nmdc:mga0k408_38358_c1 3300050493 Bacteria 2749
703 nmdc:mga05p37_132798_c1 3300050507 Unclassified 3054
704 nmdc:mga05p37_141909_c1 3300050507 Bacteria 2942
705 nmdc:mga05p37_142910_c1 3300050507 Bacteria 2931
706 nmdc:mga05p37_19946_c1 3300050507 Bacteria 8111
707 nmdc:mga05p37_22113_c1 3300050507 Bacteria 7709
708 nmdc:mga05p37_22474_c1 3300050507 Bacteria 7648
709 nmdc:mga05p37_30544_c1 3300050507 Bacteria 6574
710 nmdc:mga05p37_3069_c1 3300050507 Bacteria 19403
711 nmdc:mga05p37_329680_c1 3300050507 Unclassified 1803
712 nmdc:mga05p37_4440_c1 3300050507 Bacteria 16395
713 nmdc:mga05p37_531926_c1 3300050507 Bacteria 1342
714 nmdc:mga05p37_71160_c1 3300050507 Bacteria 4278
715 nmdc:mga05p37_73138_c1 3300050507 Bacteria 4218
716 nmdc:mga05p37_74442_c1 3300050507 Bacteria 4180
717 nmdc:mga09592_13624_c1 3300050508 Bacteria 6644
718 nmdc:mga09592_24402_c1 3300050508 Bacteria 5000
719 nmdc:mga09592_505669_c1 3300050508 Unclassified 1040
720 nmdc:mga09592_5073_c1 3300050508 Bacteria 10684
721 nmdc:mga09592_54117_c1 3300050508 Bacteria 3390
722 nmdc:mga0qj67_131675_c1 3300050509 Bacteria 2026
723 nmdc:mga0qj67_15611_c1 3300050509 Bacteria 5751
724 nmdc:mga0qj67_15639_c1 3300050509 Bacteria 5747
725 nmdc:mga0qj67_189374_c1 3300050509 Bacteria 1672
726 nmdc:mga0qj67_205351_c1 3300050509 Unclassified 1600
727 nmdc:mga0qj67_22785_c1 3300050509 Bacteria 4812
728 nmdc:mga0qj67_266317_c1 3300050509 Bacteria 1390
729 nmdc:mga0qj67_287430_c1 3300050509 Unclassified 1333
730 nmdc:mga0qj67_313013_c1 3300050509 Bacteria 1271
731 nmdc:mga0qj67_64370_c1 3300050509 Bacteria 2916
732 nmdc:mga0qj67_7402_c1 3300050509 Bacteria 8116
733 nmdc:mga06r32_13846_c1 3300050510 Bacteria 7318
734 nmdc:mga06r32_266829_c1 3300050510 Bacteria 1699
735 nmdc:mga06r32_321216_c1 3300050510 Bacteria 1534
736 nmdc:mga06r32_34645_c1 3300050510 Bacteria 4762
737 nmdc:mga06r32_481199_c1 3300050510 Bacteria 1219
738 nmdc:mga06r32_516763_c1 3300050510 Unclassified 1170
739 nmdc:mga06r32_52816_c1 3300050510 Bacteria 3893
740 nmdc:mga06r32_80814_c1 3300050510 Bacteria 3164
741 nmdc:mga06r32_95750_c1 3300050510 Bacteria 2906
742 nmdc:mga08y16_104165_c1 3300050511 Bacteria 2953
743 nmdc:mga08y16_13827_c1 3300050511 Bacteria 8496
744 nmdc:mga08y16_19703_c1 3300050511 Bacteria 7112
745 nmdc:mga08y16_218096_c1 3300050511 Bacteria 1975
746 nmdc:mga08y16_2710_c1 3300050511 Bacteria 18172
747 nmdc:mga08y16_33273_c1 3300050511 Bacteria 5414
748 nmdc:mga08y16_3556_c1 3300050511 Bacteria 16174
749 nmdc:mga08y16_475841_c1 3300050511 Bacteria 1271
750 nmdc:mga08y16_58056_c1 3300050511 Bacteria 4044
751 nmdc:mga08y16_60927_c1 3300050511 Bacteria 3940
752 nmdc:mga08y16_70995_c1 3300050511 Bacteria 2810
753 nmdc:mga08y16_72368_c1 3300050511 Bacteria 3592
754 nmdc:mga08y16_73_c1 3300050511 Bacteria 84090
755 nmdc:mga0n895_14393_c1 3300050512 Bacteria 7181
756 nmdc:mga0rr50_110480_c1 3300050513 Bacteria 2174
757 nmdc:mga0rr50_286594_c1 3300050513 Bacteria 1375
758 nmdc:mga08x19_142464_c1 3300050514 Bacteria 1620
759 nmdc:mga0a205_10438_c1 3300050515 Bacteria 8531
760 nmdc:mga0a205_125234_c1 3300050515 Bacteria 2469
761 nmdc:mga0a205_126249_c1 3300050515 Bacteria 2458
762 nmdc:mga0a205_20023_c1 3300050515 Bacteria 6312
763 nmdc:mga0a205_40831_c2 3300050515 Bacteria 1768
764 Ga0495601_0060983 3300053077 Bacteria 2394
765 Ga0495601_0098134 3300053077 Bacteria 1890
766 Ga0501084_0003322 3300054114 Bacteria 13012
767 Ga0501084_0019338 3300054114 Bacteria 5675
768 Ga0501084_0049998 3300054114 Bacteria 3500
769 Ga0590071_000487 3300059421 Bacteria 11589
770 Ga0590075_000877 3300059424 Bacteria 7882
771 Ga0590075_008321 3300059424 Bacteria 2477
772 Ga0501082_0034799 3300060353 Bacteria 4342
773 Ga0501082_0034953 3300060353 Bacteria 4332
774 Ga0530510_0261523 3300061734 Bacteria 1291
775 Ga0075428_100015997
776 Ga0065712_10067780
777 Ga0065712_10102529
778 Ga0065715_10032923
779 Ga0065715_10099007
780 Ga0065715_10108427
781 Ga0065715_10178266
782 Ga0065707_10091001
783 Ga0065707_10141100
784 Ga0070683_100000001
785 Ga0070683_100009785
786 Ga0070683_100046281
787 Ga0070683_100249949
788 Ga0070683_100317889
789 Ga0070683_100323842
790 Ga0070690_100031422
791 Ga0070690_100092993
792 Ga0070690_100103022
793 Ga0070670_100001568
794 Ga0070670_100005083
795 Ga0070670_100018369
796 Ga0070670_100049685
797 Ga0070670_100087460
798 Ga0070670_100140089
799 Ga0070670_100303637
800 Ga0068869_100093707
801 Ga0068869_100100169
802 Ga0068869_100145808
803 Ga0070666_10250446
804 Ga0070680_100306857
805 Ga0070682_100039882
806 Ga0068868_100024674
807 Ga0068868_100357655
808 Ga0070689_100172829
809 Ga0070687_100024967
810 Ga0070661_100062551
811 Ga0070661_100123170
812 Ga0070661_100385052
813 Ga0070692_10076247
814 Ga0070668_100129651
815 Ga0070668_100205821
816 Ga0070669_100009269
817 Ga0070669_100060729
818 Ga0070669_100394729
819 Ga0070675_100001263
820 Ga0070675_100006748
821 Ga0070675_100014054
822 Ga0070675_100019664
823 Ga0070675_100061494
824 Ga0070675_100105713
825 Ga0070675_100132871
826 Ga0070675_100412493
827 Ga0070675_100454031
828 Ga0070675_100482858
829 Ga0070671_100011083
830 Ga0070671_100380925
831 Ga0070674_100136401
832 Ga0070674_100335028
833 Ga0070673_100001987
834 Ga0070673_100082834
835 Ga0070673_100178977
836 Ga0070673_100220653
837 Ga0070688_100038882
838 Ga0070659_100078915
839 Ga0070667_100011292
840 Ga0070667_100225927
841 Ga0070713_100001406
842 Ga0070713_100166066
843 Ga0070713_100330018
844 Ga0070711_100052926
845 Ga0070711_100191228
846 Ga0070711_100380081
847 Ga0070700_100053668
848 Ga0070700_100068163
849 Ga0070694_100001552
850 Ga0070708_100000082
851 Ga0070708_100107863
852 Ga0070663_100058972
853 Ga0070678_100281754
854 Ga0070678_100354085
855 Ga0070662_100009376
856 Ga0070662_100076945
857 Ga0070662_100266324
858 Ga0068867_100210376
859 Ga0070685_10054840
860 Ga0070707_100000145
861 Ga0070707_100040509
862 Ga0070698_100454311
863 Ga0070679_100093988
864 Ga0070684_100000006
865 Ga0070684_100004965
866 Ga0070684_100029780
867 Ga0070684_100056680
868 Ga0070684_100077785
869 Ga0070684_100138860
870 Ga0070684_100145416
871 Ga0068853_100187124
872 Ga0070672_100012534
873 Ga0070672_100015417
874 Ga0070672_100024105
875 Ga0070672_100152804
876 Ga0070672_100155656
877 Ga0070672_100206131
878 Ga0070672_100322171
879 Ga0070672_100330191
880 Ga0070695_100076803
881 Ga0070695_100329218
882 Ga0070695_100372014
883 Ga0070693_100020424
884 Ga0070665_100084053
885 Ga0070704_100013597
886 Ga0070704_100073498
887 Ga0068855_100083572
888 Ga0068855_100089359
889 Ga0068855_100175064
890 Ga0070664_100012461
891 Ga0070664_100019301
892 Ga0070664_100022484
893 Ga0070664_100088648
894 Ga0070664_100122967
895 Ga0070664_100649453
896 Ga0068857_100009623
897 Ga0068857_100036925
898 Ga0068857_100388525
899 Ga0068856_100068581
900 Ga0068856_100103880
901 Ga0068859_100000048
902 Ga0068859_100015446
903 Ga0068859_100106570
904 Ga0068859_100165744
905 Ga0068859_100210696
906 Ga0068859_100259286
907 Ga0068859_100397500
908 Ga0068859_100416385
909 Ga0068859_100955806
910 Ga0068864_100008571
911 Ga0068864_100008582
912 Ga0068864_100056822
913 Ga0068864_100107216
914 Ga0068861_100045959
915 Ga0068861_100054955
916 Ga0068861_100488725
917 Ga0068870_10235375
918 Ga0068863_100000892
919 Ga0068863_100120880
920 Ga0068858_100012151
921 Ga0068858_100037321
922 Ga0068858_100165426
923 Ga0068858_100256453
924 Ga0068858_100389734
925 Ga0068860_100000930
926 Ga0068860_100231789
927 Ga0068862_100001329
928 Ga0068862_100067826
929 Ga0081455_10001203
930 Ga0081455_10110856
931 Ga0081540_1058918
932 Ga0075364_10185126
933 Ga0075366_10041079
934 Ga0097621_100009205
935 Ga0097621_100013721
936 Ga0097621_100210632
937 Ga0097621_100221928
938 Ga0068871_100015197
939 Ga0068871_100041698
940 Ga0068871_100052807
941 Ga0068871_100293561
942 Ga0075428_100014958
943 Ga0075428_100050078
944 Ga0075428_100175607
945 Ga0075428_100261011
946 Ga0075430_100003383
947 Ga0075430_100004868
948 Ga0075430_100011948
949 Ga0075430_100039337
950 Ga0075430_100096278
951 Ga0075430_100119611
952 Ga0075431_100004908
953 Ga0075431_100006235
954 Ga0075431_100010323
955 Ga0075431_100036280
956 Ga0075431_100089270
957 Ga0075431_100092383
958 Ga0075431_100432630
959 Ga0075431_100442204
960 Ga0075433_10014851
961 Ga0075433_10020665
962 Ga0075433_10107988
963 Ga0075433_10117368
964 Ga0075433_10196686
965 Ga0075434_100001808
966 Ga0075434_100093944
967 Ga0075434_100290095
968 Ga0075434_100291192
969 Ga0075434_100344607
970 Ga0075429_100003485
971 Ga0075429_100004890
972 Ga0075429_100020868
973 Ga0075429_100023225
974 Ga0075429_100121877
975 Ga0068865_100228818
976 Ga0075436_100014860
977 Ga0097620_100000048
978 Ga0097620_100015446
979 Ga0097620_100106569
980 Ga0097620_100165737
981 Ga0097620_100210673
982 Ga0097620_100259279
983 Ga0097620_100397539
984 Ga0097620_100416430
985 Ga0097620_100955639
986 Ga0075435_100175837
987 Ga0075435_100470627
988 Ga0105240_10000863
989 Ga0105240_10001424
990 Ga0105240_10002914
991 Ga0105240_10661139
992 Ga0111539_10000226
993 Ga0111539_10000996
994 Ga0111539_10006702
995 Ga0111539_10009816
996 Ga0111539_10045551
997 Ga0111539_10048542
998 Ga0111539_10057158
999 Ga0111539_10061076
1000 Ga0111539_10079046
1001 Ga0111539_10095993
1002 Ga0111539_10098551
1003 Ga0111539_10108636
1004 Ga0111539_10156236
1005 Ga0111539_10169895
1006 Ga0111539_10354051
1007 Ga0111539_10414015
1008 Ga0111539_10475162
1009 Ga0111539_10514972
1010 Ga0111539_10916370
1011 Ga0105245_10001083
1012 Ga0105245_10058571
1013 Ga0105245_10109107
1014 Ga0105245_10224715
1015 Ga0105245_10419488
1016 Ga0105247_10075403
1017 Ga0105247_10355133
1018 Ga0114129_10000102
1019 Ga0114129_10001834
1020 Ga0114129_10018819
1021 Ga0114129_10023226
1022 Ga0114129_10031959
1023 Ga0114129_10055504
1024 Ga0114129_10079230
1025 Ga0114129_10185399
1026 Ga0114129_10212473
1027 Ga0114129_10280181
1028 Ga0114129_10368291
1029 Ga0114129_10425201
1030 Ga0114129_10505770
1031 Ga0114129_10713810
1032 Ga0105243_10044512
1033 Ga0105243_10092762
1034 Ga0105243_10187730
1035 Ga0105243_10410634
1036 Ga0105243_10497568
1037 Ga0105241_10127965
1038 Ga0105242_10105704
1039 Ga0105242_10147905
1040 Ga0105248_10001762
1041 Ga0105248_10009675
1042 Ga0105248_10034755
1043 Ga0105248_10039063
1044 Ga0105248_10048749
1045 Ga0105248_10152063
1046 Ga0105248_10243444
1047 Ga0105248_10274474
1048 Ga0105248_10340374
1049 Ga0105248_10436279
1050 Ga0105237_10020622
1051 Ga0105237_10152908
1052 Ga0105237_10219853
1053 Ga0105238_10017674
1054 Ga0105238_10038438
1055 Ga0105238_10217357
1056 Ga0105238_10287459
1057 Ga0105249_10009351
1058 Ga0105239_10061473
1059 Ga0105239_10077506
1060 Ga0157371_10022908
1061 Ga0157370_10153370
1062 Ga0157369_10089681
1063 Ga0157369_10248411
1064 Ga0157369_10250071
1065 Ga0157369_10440645
1066 Ga0157369_10479859
1067 Ga0157374_10482511
1068 Ga0157378_10003421
1069 Ga0163162_10003315
1070 Ga0163162_10083778
1071 Ga0163162_10116672
1072 Ga0163162_10302794
1073 Ga0157372_10022491
1074 Ga0157372_10029590
1075 Ga0157372_10075184
1076 Ga0157372_10115393
1077 Ga0157372_10127032
1078 Ga0157372_10143791
1079 Ga0157372_10404713
1080 Ga0157372_10871091
1081 Ga0157375_10069130
1082 Ga0157375_10069315
1083 Ga0157375_10244300
1084 Ga0157375_10360320
1085 Ga0163163_10000008
1086 Ga0163163_10028158
1087 Ga0163163_10028930
1088 Ga0163163_10034715
1089 Ga0163163_10102882
1090 Ga0163163_10115216
1091 Ga0163163_10178184
1092 Ga0157380_10007238
1093 Ga0157380_10031850
1094 Ga0157380_10134978
1095 Ga0157380_10163985
1096 Ga0157377_10084957
1097 Ga0157377_10086987
1098 Ga0157377_10094791
1099 Ga0157379_10012294
1100 Ga0157379_10048221
1101 Ga0157376_10014268
1102 Ga0157376_10077367
1103 Ga0157376_10077544
1104 Ga0157376_10254414
1105 Ga0157376_10330205
1106 Ga0207697_10003145
1107 Ga0207682_10016049
1108 Ga0207710_10184266
1109 Ga0207688_10006615
1110 Ga0207680_10087061
1111 Ga0207699_10118422
1112 Ga0207645_10007332
1113 Ga0207645_10057591
1114 Ga0207643_10090163
1115 Ga0207654_10057141
1116 Ga0207707_10155358
1117 Ga0207695_10009126
1118 Ga0207695_10009246
1119 Ga0207695_10011427
1120 Ga0207695_10021992
1121 Ga0207671_10011240
1122 Ga0207671_10088462
1123 Ga0207671_10151904
1124 Ga0207671_10280935
1125 Ga0207693_10023771
1126 Ga0207663_10255204
1127 Ga0207662_10001641
1128 Ga0207662_10259154
1129 Ga0207649_10028211
1130 Ga0207646_10003368
1131 Ga0207646_10060627
1132 Ga0207646_10087433
1133 Ga0207681_10030753
1134 Ga0207681_10193536
1135 Ga0207681_10247265
1136 Ga0207694_10039694
1137 Ga0207694_10061526
1138 Ga0207694_10079898
1139 Ga0207650_10005300
1140 Ga0207650_10017202
1141 Ga0207650_10063832
1142 Ga0207650_10197265
1143 Ga0207659_10000814
1144 Ga0207659_10004685
1145 Ga0207659_10016644
1146 Ga0207659_10039048
1147 Ga0207659_10131164
1148 Ga0207659_10135739
1149 Ga0207659_10358095
1150 Ga0207700_10013319
1151 Ga0207664_10020404
1152 Ga0207644_10033371
1153 Ga0207706_10041415
1154 Ga0207706_10075996
1155 Ga0207706_10312093
1156 Ga0207686_10074448
1157 Ga0207686_10277894
1158 Ga0207709_10096472
1159 Ga0207669_10175414
1160 Ga0207669_10238639
1161 Ga0207704_10195830
1162 Ga0207691_10016354
1163 Ga0207691_10016707
1164 Ga0207691_10047660
1165 Ga0207691_10063928
1166 Ga0207691_10080849
1167 Ga0207691_10090757
1168 Ga0207691_10115472
1169 Ga0207691_10134680
1170 Ga0207691_10163889
1171 Ga0207691_10250746
1172 Ga0207691_10303169
1173 Ga0207711_10004617
1174 Ga0207711_10041912
1175 Ga0207711_10050126
1176 Ga0207711_10054064
1177 Ga0207711_10113038
1178 Ga0207711_10179185
1179 Ga0207711_10337231
1180 Ga0207689_10002093
1181 Ga0207689_10026916
1182 Ga0207689_10036307
1183 Ga0207689_10151002
1184 Ga0207661_10000005
1185 Ga0207661_10000364
1186 Ga0207661_10069287
1187 Ga0207661_10122469
1188 Ga0207679_10013128
1189 Ga0207679_10018160
1190 Ga0207667_10096279
1191 Ga0207667_10175598
1192 Ga0207651_10024713
1193 Ga0207651_10111245
1194 Ga0207651_10151160
1195 Ga0207651_10251688
1196 Ga0207651_10363162
1197 Ga0207712_10197890
1198 Ga0207668_10313438
1199 Ga0207668_10350618
1200 Ga0207658_10233609
1201 Ga0207677_10015548
1202 Ga0207703_10093950
1203 Ga0207703_10298808
1204 Ga0207678_10033332
1205 Ga0207678_10151206
1206 Ga0207708_10007113
1207 Ga0207708_10092928
1208 Ga0207708_10164459
1209 Ga0207702_10251289
1210 Ga0207641_10007073
1211 Ga0207641_10188883
1212 Ga0207648_10007916
1213 Ga0207676_10128782
1214 Ga0207676_10140554
1215 Ga0207676_10261462
1216 Ga0207674_10003447
1217 Ga0207674_10007875
1218 Ga0207674_10048045
1219 Ga0207674_10102293
1220 Ga0207674_10147857
1221 Ga0207675_100011601
1222 Ga0207675_100018644
1223 Ga0207675_100028794
1224 Ga0207675_100064554
1225 Ga0207683_10089561
1226 Ga0207683_10315482
1227 Ga0207698_10152871
1228 Ga0207428_10000555
1229 Ga0207428_10004956
1230 Ga0207428_10005077
1231 Ga0207428_10011703
1232 Ga0207428_10077371
1233 Ga0207428_10172837
1234 Ga0207428_10268354
1235 Ga0268266_10040957
1236 Ga0268266_10091208
1237 Ga0268266_10102091
1238 Ga0268266_10110896
1239 Ga0268266_10306213
1240 Ga0268265_10100667
1241 Ga0268264_10003235
1242 Ga0268264_10260856
1243 Ga0265331_10112900
1244 Ga0265331_10134855
1245 Ga0265316_10163451
1246 Ga0307408_100060682
1247 Ga0307408_100191106
1248 Ga0307405_10250838
1249 Ga0316577_10108860
1250 Ga0307410_10060117
1251 Ga0307410_10101866
1252 Ga0307412_10124952
1253 Ga0307409_100080894
1254 Ga0307409_100145190
1255 Ga0307416_100057276
1256 Ga0307416_100140770
1257 Ga0307416_100555792
1258 Ga0307416_100726772
1259 Ga0307414_10135499
1260 Ga0307414_10352897
1261 Ga0307411_10014277
1262 Ga0307411_10193427
1263 Ga0307415_100050673
1264 Ga0307415_100064092
1265 Ga0373934_0006423
1266 Ga0373934_0007926
1267 Ga0373934_0050574
1268 Ga0373923_0036707
1269 Ga0373923_0061916
1270 Ga0373953_0071055
1271 Ga0373943_0001049
1272 Ga0373955_0029605
1273 Ga0373955_0055458
1274 Ga0373955_0150272
1275 Ga0373931_0001968
1276 Ga0373935_0006665
1277 Ga0373935_0057520
1278 Ga0373927_0000683
1279 Ga0373927_0001087
1280 Ga0373927_0005255
1281 Ga0373933_0092431
1282 Ga0373933_0138039
1283 Ga0373947_0000436
1284 Ga0373947_0012711
1285 Ga0373947_0128564
1286 Ga0373947_0160859
1287 Ga0373937_0026703
1288 Ga0373937_0031286
1289 Ga0373937_0093952
1290 Ga0316584_0002331
1291 Ga0373925_0000564
1292 Ga0373925_0002462
1293 Ga0373925_0053588
1294 Ga0373925_0161633
1295 Ga0373925_0487097
1296 Ga0395899_0212593
1297 Ga0395898_0024586
1298 Ga0395905_0017136
1299 Ga0395905_0021376
1300 Ga0395901_0009525
1301 Ga0436365_1104027
1302 Ga0439439_0027848
1303 Ga0439453_0006718
1304 Ga0439435_0000571
1305 Ga0439464_0021516
1306 Ga0439460_0059942
1307 Ga0451577_0021313
1308 Ga0453684_0038669
1309 Ga0453684_0263538
1310 Ga0451576_0002164
1311 Ga0451576_0037104
1312 Ga0451576_0153227
1313 Ga0451576_0361981
1314 Ga0451576_0556669
1315 Ga0466967_0082823
1316 Ga0466967_0198753
1317 Ga0495603_0001932
1318 Ga0495629_0001600
1319 Ga0495629_0011662
1320 Ga0495629_0015123
1321 Ga0495651_0002085
1322 Ga0495651_0023432
1323 Ga0495651_0030830
1324 Ga0495653_0018806
1325 Ga0495653_0072769
1326 Ga0495580_0000920
1327 Ga0495580_0038378
1328 Ga0495580_0053122
1329 Ga0495580_0063332
1330 Ga0495580_0064990
1331 Ga0495580_0101921
1332 Ga0495580_0107763
1333 Ga0495639_0000299
1334 Ga0495662_0021201
1335 Ga0495664_0009586
1336 Ga0495594_0011786
1337 Ga0495594_0050798
1338 Ga0495608_0008978
1339 Ga0495628_0108848
1340 Ga0495628_0348632
1341 Ga0495630_0051893
1342 Ga0495666_0072396
1343 Ga0495666_0164847
1344 Ga0495652_0028751
1345 Ga0495652_0053648
1346 Ga0495665_0000210
1347 Ga0495665_0000657
1348 Ga0495640_0017457
1349 Ga0495640_0244861
1350 Ga0495586_0011963
1351 Ga0495586_0096401
1352 Ga0495587_0005626
1353 Ga0495645_0001141
1354 Ga0495645_0016444
1355 Ga0495645_0030095
1356 Ga0495645_0037119
1357 Ga0495645_0093066
1358 Ga0495667_0000670
1359 Ga0495667_0009772
1360 Ga0495667_0010878
1361 Ga0495667_0024579
1362 Ga0495667_0056044
1363 Ga0495634_0167527
1364 Ga0495635_0036525
1365 Ga0495588_0004253
1366 Ga0495588_0064489
1367 Ga0495657_0035878
1368 Ga0495599_0060996
1369 Ga0495599_0137740
1370 Ga0495599_0140527
1371 Ga0495599_0240672
1372 Ga0495623_0016983
1373 Ga0495623_0045317
1374 Ga0495623_0087173
1375 Ga0495646_0077301
1376 Ga0495658_0000216
1377 Ga0495613_0003520
1378 Ga0495613_0029499
1379 Ga0495600_0014364
1380 Ga0495600_0038539
1381 Ga0495600_0251988
1382 Ga0495581_0000157
1383 Ga0495581_0006689
1384 Ga0495604_0002200
1385 Ga0495604_0122481
1386 Ga0495604_0178964
1387 Ga0495674_0003092
1388 Ga0495674_0008093
1389 Ga0495674_0121185
1390 Ga0495674_0216558
1391 Ga0495674_0236115
1392 Ga0495674_0258524
1393 Ga0495674_0359365
1394 Ga0495672_0004867
1395 Ga0495680_0131672
1396 Ga0495675_0005886
1397 Ga0495675_0046731
1398 Ga0495675_0091421
1399 Ga0495684_0012309
1400 Ga0495684_0016467
1401 Ga0495684_0021742
1402 Ga0495684_0076882
1403 Ga0495684_0252888
1404 Ga0495593_0000204
1405 Ga0495602_0017350
1406 Ga0495602_0027446
1407 Ga0495602_0091508
1408 Ga0495614_0000137
1409 Ga0496101_0227264
1410 Ga0496102_0022988
1411 Ga0496104_0078124
1412 Ga0496106_0035724
1413 Ga0496106_0208911
1414 Ga0496107_0133911
1415 Ga0496109_0000026
1416 Ga0496109_0017232
1417 Ga0496109_0157778
1418 Ga0496109_0609783
1419 Ga0496110_0471334
1420 Ga0496112_0009246
1421 Ga0496112_0335665
1422 Ga0496113_0080012
1423 Ga0496113_0294223
1424 Ga0496114_0185979
1425 Ga0496114_0247496
1426 Ga0501291_010856
1427 Ga0501298_014164
1428 Ga0501299_009362
1429 Ga0501031_0090588
1430 Ga0501036_0049217
1431 Ga0501036_0334857
1432 Ga0501039_0084075
1433 Ga0501040_0028753
1434 Ga0501040_0046601
1435 Ga0501040_0070368
1436 Ga0501040_0213551
1437 Ga0501041_0046222
1438 Ga0501041_0075854
1439 Ga0501042_0010247
1440 Ga0501043_0164090
1441 Ga0501046_0128814
1442 Ga0501046_0132033
1443 Ga0501048_0302769
1444 Ga0501048_0303157
1445 Ga0501071_0004565
1446 Ga0501071_0011520
1447 Ga0501072_0014611
1448 Ga0501072_0041263
1449 Ga0501073_0052799
1450 Ga0501073_0089210
1451 Ga0501074_0171581
1452 Ga0501075_0007039
1453 Ga0501075_0022429
1454 Ga0501075_0026638
1455 Ga0501075_0120781
1456 Ga0501075_0187196
1457 Ga0501076_0006890
1458 Ga0501076_0031774
1459 Ga0501076_0082117
1460 Ga0501076_0298209
1461 Ga0501077_0021592
1462 Ga0501077_0072657
1463 Ga0501249_019821
1464 Ga0501225_0014176
1465 Ga0501079_0012237
1466 Ga0501079_0012792
1467 Ga0501079_0285228
1468 Ga0501080_0421343
1469 Ga0501081_0030644
1470 Ga0501081_0219812
1471 Ga0501045_0005972
1472 Ga0501045_0017193
1473 Ga0501045_0069665
1474 Ga0501045_0139835
1475 nmdc:mga00v17_148526_c1
1476 nmdc:mga0k408_38358_c1
1477 nmdc:mga05p37_132798_c1
1478 nmdc:mga05p37_141909_c1
1479 nmdc:mga05p37_142910_c1
1480 nmdc:mga05p37_19946_c1
1481 nmdc:mga05p37_22113_c1
1482 nmdc:mga05p37_22474_c1
1483 nmdc:mga05p37_30544_c1
1484 nmdc:mga05p37_3069_c1
1485 nmdc:mga05p37_329680_c1
1486 nmdc:mga05p37_4440_c1
1487 nmdc:mga05p37_531926_c1
1488 nmdc:mga05p37_71160_c1
1489 nmdc:mga05p37_73138_c1
1490 nmdc:mga05p37_74442_c1
1491 nmdc:mga09592_13624_c1
1492 nmdc:mga09592_24402_c1
1493 nmdc:mga09592_505669_c1
1494 nmdc:mga09592_5073_c1
1495 nmdc:mga09592_54117_c1
1496 nmdc:mga0qj67_131675_c1
1497 nmdc:mga0qj67_15611_c1
1498 nmdc:mga0qj67_15639_c1
1499 nmdc:mga0qj67_189374_c1
1500 nmdc:mga0qj67_205351_c1
1501 nmdc:mga0qj67_22785_c1
1502 nmdc:mga0qj67_266317_c1
1503 nmdc:mga0qj67_287430_c1
1504 nmdc:mga0qj67_313013_c1
1505 nmdc:mga0qj67_64370_c1
1506 nmdc:mga0qj67_7402_c1
1507 nmdc:mga06r32_13846_c1
1508 nmdc:mga06r32_266829_c1
1509 nmdc:mga06r32_321216_c1
1510 nmdc:mga06r32_34645_c1
1511 nmdc:mga06r32_481199_c1
1512 nmdc:mga06r32_516763_c1
1513 nmdc:mga06r32_52816_c1
1514 nmdc:mga06r32_80814_c1
1515 nmdc:mga06r32_95750_c1
1516 nmdc:mga08y16_104165_c1
1517 nmdc:mga08y16_13827_c1
1518 nmdc:mga08y16_19703_c1
1519 nmdc:mga08y16_218096_c1
1520 nmdc:mga08y16_2710_c1
1521 nmdc:mga08y16_33273_c1
1522 nmdc:mga08y16_3556_c1
1523 nmdc:mga08y16_475841_c1
1524 nmdc:mga08y16_58056_c1
1525 nmdc:mga08y16_60927_c1
1526 nmdc:mga08y16_70995_c1
1527 nmdc:mga08y16_72368_c1
1528 nmdc:mga08y16_73_c1
1529 nmdc:mga0n895_14393_c1
1530 nmdc:mga0rr50_110480_c1
1531 nmdc:mga0rr50_286594_c1
1532 nmdc:mga08x19_142464_c1
1533 nmdc:mga0a205_10438_c1
1534 nmdc:mga0a205_125234_c1
1535 nmdc:mga0a205_126249_c1
1536 nmdc:mga0a205_20023_c1
1537 nmdc:mga0a205_40831_c2
1538 Ga0495601_0060983
1539 Ga0495601_0098134
1540 Ga0501084_0003322
1541 Ga0501084_0019338
1542 Ga0501084_0049998
1543 Ga0590071_000487
1544 Ga0590075_000877
1545 Ga0590075_008321
1546 Ga0501082_0034799
1547 Ga0501082_0034953
1548 Ga0530510_0261523

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18765

Polbeta

Polymerase beta, Nucleotidyltransferase

61

157

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.7416 234 302
2efh-assembly2.cif.gz_D ara7-gdp/atvps9a(d185n) 0.738 44 78
7q74-assembly1.cif.gz_A structure of pla1 apo, with a c-terminal deletion 0.7293 29 78
2hsb-assembly1.cif.gz_A crystal structure of a hepn domain containing protein (af_0298) from archaeoglobus fulgidus at 1.95 a resolution 0.7217 130 232
7q73-assembly1.cif.gz_A structure of pla1 apo 0.7199 29 78
ID Description Score Start End Superfamily
4ebkB01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7784 5 86 3.30.460.10
3c18C02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7733 127 245 1.20.120.330
3c18C02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7617 127 245 1.20.120.330
af_Q58022_9_132_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7548 130 232 1.20.120.330
af_A0A1D6GS05_463_585_1.10.1410.10 Mainly Alpha;Orthogonal Bundle;Poly(a)-polymerase, middle domain; 0.7421 10 76 1.10.1410.10
ID Description Score Start End GO Terms
AF-A0A2V7RKI6-F1-model_v4 Nucleotidyltransferase domain-containing protein 0.9657 5 88
AF-A0A2V9MF43-F1-model_v4 Uncharacterized protein 0.9437 197 303
AF-A0A2V8BIR0-F1-model_v4 Uncharacterized protein 0.9423 76 303
AF-A0A2V8FH79-F1-model_v4 Uncharacterized protein 0.9417 140 303
AF-A0A7X3RG87-F1-model_v4 HEPN domain-containing protein 0.9354 125 302

Map