F480211

General Info

Members Datasets Scaffolds Average Seq Length
774 320 762 425

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10000049|Ga0070703_1000004938
Length 482
Sequence LNFGARRQSEVATALWLAWSFSFRPHSTLKSGASRRNADPKRRRRFALPAHSKSILMPRVPLTKNQRRGFLAAWGGWVLDGMDSFIYALVMVPALRELLPRTGIAGNQSNIGYYGGLLFALFLVGWGCSLVWGPIADRFGRVRTLMLTILCYSIFTFAGAFAVNVWMLAGFRLLAGIGIGGEWSMGGTFIAEELPESRRKMAAGLMHTGYYAGIFLAAIANYFVGARYGWRAMFLIGGSPALLVGFIRWGVTESRRWEHRLEEVGKAWTMKRAFGALFSDEYRRRTILNSIYLFISIIGLWAGSVYVPASVGQLALRSGFTESDGLKLASYATMVLSAGTIIGCLLLPILAEKFGRRLTLGIYFALMAVFISIGFGYVFYLQAHALVWFMICLFWLGVGGANFAMYTLWLPEQYRTECRASAFAFATSIGRFGGAGITFLVGAGVAYYQTIGIPVALTSLAFIIGLLLLPFGKETKGEPLPV

Samples

Sample ID Description Type Environment
1 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
2 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
3 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
4 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
5 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
6 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
7 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
8 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
9 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
10 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
11 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
166 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
240 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
248 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
256 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
311 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
320 642555112 Paraburkholderia phymatum STM815 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 1.03
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0.39
Rhizoplane 2.97
Rhizosphere 91.47
Stem 0
Stem Tuber 0
Unclassified 4.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10023146 3300003316 Bacteria 4774
2 rootH2_10183119 3300003320 Bacteria 2504
3 rootL2_10010827 3300003322 Bacteria 4090
4 JGI25160J50197_1000737 3300003354 Bacteria 17869
5 Ga0065165_1002132 3300005262 Bacteria 17983
6 Ga0065712_10003618 3300005290 Bacteria 5192
7 Ga0065712_10076179 3300005290 Bacteria 3715
8 Ga0065707_10091837 3300005295 Bacteria 3855
9 Ga0070676_10070552 3300005328 Bacteria 2096
10 Ga0070683_100008500 3300005329 Bacteria 8722
11 Ga0070683_100023872 3300005329 Bacteria 5474
12 Ga0070690_100019704 3300005330 Unclassified 4100
13 Ga0070690_100163605 3300005330 Bacteria 1527
14 Ga0070670_100223484 3300005331 Bacteria 1639
15 Ga0068869_100007437 3300005334 Bacteria 7001
16 Ga0070666_10002012 3300005335 Bacteria 12376
17 Ga0070666_10062670 3300005335 Bacteria 2520
18 Ga0070666_10070719 3300005335 Bacteria 2374
19 Ga0070680_100025148 3300005336 Bacteria 4757
20 Ga0070680_100054642 3300005336 Bacteria 3261
21 Ga0068868_100181521 3300005338 Bacteria 1746
22 Ga0070661_100115516 3300005344 Bacteria 2007
23 Ga0070669_100002938 3300005353 Bacteria 12283
24 Ga0070671_100013692 3300005355 Bacteria 6540
25 Ga0070671_100020610 3300005355 Bacteria 5379
26 Ga0070671_100082613 3300005355 Bacteria 2686
27 Ga0070673_100199476 3300005364 Bacteria 1723
28 Ga0070688_100010104 3300005365 Bacteria 5190
29 Ga0070688_100126505 3300005365 Bacteria 1718
30 Ga0070688_100137117 3300005365 Bacteria 1658
31 Ga0070688_100154097 3300005365 Bacteria 1573
32 Ga0070667_100003123 3300005367 Bacteria 14229
33 Ga0070667_100024918 3300005367 Unclassified 4970
34 Ga0070667_100058991 3300005367 Bacteria 3246
35 Ga0070667_100253230 3300005367 Bacteria 1574
36 Ga0070703_10000049 3300005406 Bacteria 58073
37 Ga0070703_10001024 3300005406 Bacteria 8765
38 Ga0070703_10004669 3300005406 Unclassified 3831
39 Ga0070709_10011363 3300005434 Unclassified 4961
40 Ga0070709_10037422 3300005434 Bacteria 2963
41 Ga0070714_100000350 3300005435 Bacteria 34659
42 Ga0070714_100002001 3300005435 Bacteria 14901
43 Ga0070713_100001374 3300005436 Bacteria 15573
44 Ga0070713_100008885 3300005436 Bacteria 7155
45 Ga0070713_100132943 3300005436 Bacteria 2196
46 Ga0070713_100138284 3300005436 Bacteria 2155
47 Ga0070713_100229197 3300005436 Bacteria 1688
48 Ga0070710_10001748 3300005437 Bacteria 10277
49 Ga0070711_100010061 3300005439 Bacteria 5840
50 Ga0070711_100132845 3300005439 Bacteria 1856
51 Ga0070705_100001028 3300005440 Bacteria 15539
52 Ga0070705_100075087 3300005440 Bacteria 2057
53 Ga0070705_100089558 3300005440 Bacteria 1913
54 Ga0070700_100002653 3300005441 Bacteria 9153
55 Ga0070694_100001586 3300005444 Bacteria 13374
56 Ga0070694_100001951 3300005444 Bacteria 12235
57 Ga0070694_100013057 3300005444 Bacteria 5181
58 Ga0070708_100005140 3300005445 Bacteria 10361
59 Ga0070708_100064998 3300005445 Bacteria 3270
60 Ga0070708_100067561 3300005445 Bacteria 3210
61 Ga0070708_100082427 3300005445 Bacteria 2913
62 Ga0070681_10001478 3300005458 Bacteria 20745
63 Ga0070681_10007010 3300005458 Bacteria 10970
64 Ga0070681_10022150 3300005458 Bacteria 6377
65 Ga0070681_10073635 3300005458 Bacteria 3378
66 Ga0070681_10155948 3300005458 Unclassified 2208
67 Ga0070706_100000362 3300005467 Bacteria 54657
68 Ga0070706_100001465 3300005467 Bacteria 24824
69 Ga0070706_100178163 3300005467 Unclassified 1985
70 Ga0070707_100003580 3300005468 Bacteria 14649
71 Ga0070707_100003882 3300005468 Bacteria 14070
72 Ga0070707_100006238 3300005468 Bacteria 11097
73 Ga0070707_100062025 3300005468 Bacteria 3586
74 Ga0070707_100077339 3300005468 Unclassified 3211
75 Ga0070698_100000253 3300005471 Bacteria 53657
76 Ga0070698_100001898 3300005471 Bacteria 23287
77 Ga0070698_100046696 3300005471 Bacteria 4428
78 Ga0070698_100119334 3300005471 Bacteria 2598
79 Ga0070699_100000008 3300005518 Bacteria 295702
80 Ga0070699_100015327 3300005518 Bacteria 6587
81 Ga0070699_100017210 3300005518 Bacteria 6208
82 Ga0070699_100147787 3300005518 Bacteria 2077
83 Ga0070679_100034298 3300005530 Bacteria 5029
84 Ga0070679_100044093 3300005530 Bacteria 4443
85 Ga0070679_100194382 3300005530 Bacteria 1997
86 Ga0070679_100252259 3300005530 Unclassified 1720
87 Ga0070684_100163961 3300005535 Unclassified 2017
88 Ga0070697_100000305 3300005536 Bacteria 39083
89 Ga0070697_100005223 3300005536 Bacteria 9976
90 Ga0070697_100101790 3300005536 Bacteria 2387
91 Ga0070697_100178992 3300005536 Bacteria 1797
92 Ga0070697_100179847 3300005536 Bacteria 1793
93 Ga0068853_100043607 3300005539 Bacteria 3837
94 Ga0070672_100008309 3300005543 Bacteria 7093
95 Ga0070686_100037279 3300005544 Unclassified 3015
96 Ga0070695_100059265 3300005545 Bacteria 2478
97 Ga0070696_100000596 3300005546 Bacteria 23125
98 Ga0070696_100004313 3300005546 Bacteria 9481
99 Ga0070696_100077144 3300005546 Bacteria 2354
100 Ga0070693_100000798 3300005547 Bacteria 13919
101 Ga0070693_100011994 3300005547 Bacteria 4376
102 Ga0070693_100022346 3300005547 Bacteria 3362
103 Ga0070693_100117515 3300005547 Bacteria 1645
104 Ga0070665_100007584 3300005548 Bacteria 11033
105 Ga0070665_100020326 3300005548 Bacteria 6668
106 Ga0070665_100031792 3300005548 Bacteria 5312
107 Ga0070665_100364154 3300005548 Bacteria 1452
108 Ga0070704_100010113 3300005549 Bacteria 5738
109 Ga0068855_100016245 3300005563 Bacteria 8951
110 Ga0068855_100036469 3300005563 Bacteria 5852
111 Ga0068855_100086466 3300005563 Bacteria 3626
112 Ga0068855_100186067 3300005563 Bacteria 2345
113 Ga0070664_100168830 3300005564 Unclassified 1940
114 Ga0068857_100002930 3300005577 Bacteria 14071
115 Ga0068857_100073381 3300005577 Bacteria 3049
116 Ga0068856_100093690 3300005614 Unclassified 2989
117 Ga0070702_100071841 3300005615 Bacteria 2046
118 Ga0068852_100279861 3300005616 Bacteria 1608
119 Ga0068852_100315733 3300005616 Bacteria 1516
120 Ga0068859_100007260 3300005617 Bacteria 11239
121 Ga0068859_100044597 3300005617 Bacteria 4456
122 Ga0068859_100044982 3300005617 Bacteria 4436
123 Ga0068859_100123472 3300005617 Bacteria 2657
124 Ga0068859_100170430 3300005617 Bacteria 2258
125 Ga0068859_100252925 3300005617 Bacteria 1852
126 Ga0068864_100056456 3300005618 Bacteria 3392
127 Ga0068864_100135634 3300005618 Bacteria 2216
128 Ga0068864_100246621 3300005618 Bacteria 1657
129 Ga0068861_100044233 3300005719 Bacteria 3347
130 Ga0068861_100124501 3300005719 Bacteria 2084
131 Ga0068861_100162661 3300005719 Bacteria 1842
132 Ga0068863_100066793 3300005841 Unclassified 3401
133 Ga0068863_100196788 3300005841 Unclassified 1937
134 Ga0068863_100213001 3300005841 Unclassified 1860
135 Ga0068863_100218804 3300005841 Bacteria 1834
136 Ga0068858_100004881 3300005842 Bacteria 13156
137 Ga0068858_100013552 3300005842 Bacteria 7693
138 Ga0068858_100021406 3300005842 Bacteria 6041
139 Ga0068858_100163775 3300005842 Bacteria 2095
140 Ga0068858_100182384 3300005842 Bacteria 1982
141 Ga0068858_100281339 3300005842 Bacteria 1584
142 Ga0068860_100000198 3300005843 Bacteria 96163
143 Ga0068860_100004091 3300005843 Bacteria 14968
144 Ga0068860_100005182 3300005843 Bacteria 13251
145 Ga0068860_100005909 3300005843 Bacteria 12318
146 Ga0068860_100034333 3300005843 Bacteria 4864
147 Ga0068860_100044060 3300005843 Bacteria 4254
148 Ga0068860_100048411 3300005843 Bacteria 4051
149 Ga0068860_100081363 3300005843 Unclassified 3080
150 Ga0068860_100234903 3300005843 Bacteria 1782
151 Ga0068860_100294136 3300005843 Bacteria 1589
152 Ga0068862_100021601 3300005844 Bacteria 5381
153 Ga0068862_100267418 3300005844 Bacteria 1562
154 Ga0070717_10036626 3300006028 Bacteria 3980
155 Ga0070717_10048482 3300006028 Bacteria 3484
156 Ga0070717_10055947 3300006028 Bacteria 3257
157 Ga0070717_10252026 3300006028 Bacteria 1560
158 Ga0097621_100017484 3300006237 Bacteria 5446
159 Ga0097621_100030008 3300006237 Bacteria 4300
160 Ga0097621_100033449 3300006237 Bacteria 4094
161 Ga0097621_100186399 3300006237 Bacteria 1795
162 Ga0068871_100026641 3300006358 Bacteria 4513
163 Ga0068871_100044589 3300006358 Unclassified 3567
164 Ga0075428_100005727 3300006844 Bacteria 13812
165 Ga0075428_100035337 3300006844 Bacteria 5509
166 Ga0075428_100062444 3300006844 Bacteria 4078
167 Ga0075428_100066521 3300006844 Bacteria 3946
168 Ga0075431_100009733 3300006847 Bacteria 9653
169 Ga0075431_100031011 3300006847 Bacteria 5506
170 Ga0075433_10013848 3300006852 Bacteria 6575
171 Ga0075433_10017057 3300006852 Bacteria 6004
172 Ga0075433_10049585 3300006852 Bacteria 3653
173 Ga0075433_10066634 3300006852 Bacteria 3159
174 Ga0075433_10081231 3300006852 Bacteria 2858
175 Ga0075434_100002388 3300006871 Bacteria 16484
176 Ga0075434_100023931 3300006871 Bacteria 5962
177 Ga0075434_100108840 3300006871 Bacteria 2781
178 Ga0075434_100322023 3300006871 Bacteria 1566
179 Ga0075429_100017069 3300006880 Bacteria 6276
180 Ga0075429_100047943 3300006880 Bacteria 3715
181 Ga0075429_100058289 3300006880 Bacteria 3363
182 Ga0075429_100181821 3300006880 Bacteria 1843
183 Ga0068865_100056892 3300006881 Unclassified 2726
184 Ga0068865_100110572 3300006881 Bacteria 2027
185 Ga0075436_100000811 3300006914 Bacteria 20765
186 Ga0075436_100010772 3300006914 Bacteria 6273
187 Ga0075436_100069752 3300006914 Unclassified 2429
188 Ga0097620_100007260 3300006931 Bacteria 11239
189 Ga0097620_100044597 3300006931 Bacteria 4456
190 Ga0097620_100044982 3300006931 Bacteria 4436
191 Ga0097620_100123473 3300006931 Bacteria 2657
192 Ga0097620_100170432 3300006931 Bacteria 2258
193 Ga0097620_100252918 3300006931 Bacteria 1852
194 Ga0075435_100009684 3300007076 Bacteria 6998
195 Ga0075435_100018412 3300007076 Bacteria 5311
196 Ga0075435_100090891 3300007076 Bacteria 2518
197 Ga0099794_10002659 3300007265 Bacteria 6652
198 Ga0099794_10018351 3300007265 Bacteria 3135
199 Ga0099794_10023224 3300007265 Bacteria 2834
200 Ga0099794_10033213 3300007265 Bacteria 2426
201 Ga0099794_10035351 3300007265 Bacteria 2358
202 Ga0099794_10071147 3300007265 Unclassified 1704
203 Ga0105240_10001298 3300009093 Bacteria 43175
204 Ga0105240_10001445 3300009093 Bacteria 40579
205 Ga0105240_10043696 3300009093 Bacteria 5699
206 Ga0105240_10124930 3300009093 Bacteria 3094
207 Ga0105240_10440858 3300009093 Unclassified 1459
208 Ga0111539_10019829 3300009094 Bacteria 8286
209 Ga0111539_10027852 3300009094 Bacteria 6900
210 Ga0111539_10255374 3300009094 Bacteria 2041
211 Ga0105245_10006697 3300009098 Bacteria 10106
212 Ga0105245_10024831 3300009098 Bacteria 5265
213 Ga0105245_10105200 3300009098 Unclassified 2617
214 Ga0114129_10000925 3300009147 Bacteria 38300
215 Ga0114129_10003232 3300009147 Bacteria 22871
216 Ga0114129_10003498 3300009147 Bacteria 22085
217 Ga0114129_10009696 3300009147 Bacteria 13742
218 Ga0114129_10015399 3300009147 Bacteria 10881
219 Ga0114129_10058512 3300009147 Bacteria 5391
220 Ga0114129_10078754 3300009147 Bacteria 4584
221 Ga0114129_10183819 3300009147 Bacteria 2843
222 Ga0105243_10000124 3300009148 Bacteria 87031
223 Ga0105243_10000774 3300009148 Bacteria 30599
224 Ga0105243_10045386 3300009148 Bacteria 3453
225 Ga0105243_10087767 3300009148 Bacteria 2554
226 Ga0105241_10013230 3300009174 Bacteria 6047
227 Ga0105242_10000021 3300009176 Bacteria 115541
228 Ga0105242_10000935 3300009176 Bacteria 22755
229 Ga0105242_10004531 3300009176 Bacteria 10785
230 Ga0105242_10012931 3300009176 Bacteria 6435
231 Ga0105242_10017345 3300009176 Bacteria 5608
232 Ga0105242_10030630 3300009176 Bacteria 4296
233 Ga0105242_10047425 3300009176 Bacteria 3488
234 Ga0105242_10051912 3300009176 Unclassified 3344
235 Ga0105242_10098592 3300009176 Bacteria 2472
236 Ga0105242_10110482 3300009176 Unclassified 2342
237 Ga0105242_10192920 3300009176 Bacteria 1805
238 Ga0105248_10011112 3300009177 Bacteria 9936
239 Ga0105248_10013288 3300009177 Bacteria 9064
240 Ga0105248_10017559 3300009177 Bacteria 7892
241 Ga0105248_10021176 3300009177 Bacteria 7205
242 Ga0105248_10041341 3300009177 Bacteria 5168
243 Ga0105248_10041529 3300009177 Bacteria 5157
244 Ga0105248_10059308 3300009177 Bacteria 4298
245 Ga0105248_10170718 3300009177 Bacteria 2451
246 Ga0105237_10127236 3300009545 Bacteria 2542
247 Ga0105238_10019327 3300009551 Bacteria 6939
248 Ga0105238_10274848 3300009551 Bacteria 1665
249 Ga0105249_10074475 3300009553 Bacteria 3143
250 Ga0105239_10002786 3300010375 Bacteria 21889
251 Ga0105239_10040412 3300010375 Bacteria 5110
252 Ga0105239_10129624 3300010375 Bacteria 2804
253 Ga0105239_10174604 3300010375 Bacteria 2403
254 Ga0105239_10182057 3300010375 Bacteria 2351
255 Ga0105239_10290912 3300010375 Unclassified 1840
256 Ga0105246_10209678 3300011119 Bacteria 1520
257 Ga0105246_10209727 3300011119 Unclassified 1520
258 Ga0157370_10005536 3300013104 Bacteria 14160
259 Ga0157369_10001300 3300013105 Bacteria 31037
260 Ga0157369_10073539 3300013105 Bacteria 3667
261 Ga0157369_10230260 3300013105 Archaea 1937
262 Ga0157374_10004567 3300013296 Bacteria 11613
263 Ga0157374_10014223 3300013296 Bacteria 6959
264 Ga0157374_10094087 3300013296 Unclassified 2863
265 Ga0157378_10000079 3300013297 Bacteria 88966
266 Ga0157378_10000501 3300013297 Bacteria 37147
267 Ga0157378_10000539 3300013297 Bacteria 36001
268 Ga0157378_10003170 3300013297 Bacteria 14603
269 Ga0157378_10012555 3300013297 Bacteria 7415
270 Ga0157378_10107760 3300013297 Bacteria 2550
271 Ga0157378_10114191 3300013297 Bacteria 2481
272 Ga0157378_10215748 3300013297 Unclassified 1822
273 Ga0157378_10325613 3300013297 Unclassified 1494
274 Ga0163162_10007634 3300013306 Bacteria 10536
275 Ga0163162_10010349 3300013306 Bacteria 9066
276 Ga0163162_10011765 3300013306 Bacteria 8536
277 Ga0163162_10012392 3300013306 Bacteria 8326
278 Ga0163162_10029511 3300013306 Bacteria 5428
279 Ga0163162_10044064 3300013306 Bacteria 4468
280 Ga0163162_10194979 3300013306 Bacteria 2154
281 Ga0157372_10130364 3300013307 Bacteria 2893
282 Ga0157375_10020205 3300013308 Bacteria 6078
283 Ga0157375_10127129 3300013308 Unclassified 2665
284 Ga0157375_10198629 3300013308 Unclassified 2161
285 Ga0157375_10208658 3300013308 Bacteria 2110
286 Ga0163163_10000047 3300014325 Bacteria 131685
287 Ga0163163_10000101 3300014325 Bacteria 90856
288 Ga0163163_10020614 3300014325 Bacteria 6213
289 Ga0163163_10022212 3300014325 Bacteria 6003
290 Ga0163163_10049070 3300014325 Unclassified 4153
291 Ga0163163_10079890 3300014325 Bacteria 3269
292 Ga0163163_10082478 3300014325 Unclassified 3219
293 Ga0157377_10079539 3300014745 Bacteria 1912
294 Ga0157379_10006540 3300014968 Bacteria 10049
295 Ga0157379_10016261 3300014968 Bacteria 6546
296 Ga0157379_10040262 3300014968 Bacteria 4170
297 Ga0157376_10008124 3300014969 Bacteria 7542
298 Ga0157376_10019370 3300014969 Bacteria 5244
299 Ga0157376_10058871 3300014969 Unclassified 3220
300 Ga0157376_10113000 3300014969 Bacteria 2394
301 Ga0157376_10231726 3300014969 Bacteria 1716
302 Ga0157376_10259005 3300014969 Bacteria 1629
303 Ga0183361_10033 3300016635 Bacteria 50513
304 Ga0163161_10139344 3300017792 Bacteria 1836
305 Ga0213873_10006154 3300021358 Bacteria 2348
306 Ga0213874_10002560 3300021377 Bacteria 3927
307 Ga0213875_10001405 3300021388 Bacteria 15682
308 Ga0228598_1000071 3300024227 Bacteria 15175
309 Ga0228598_1002743 3300024227 Bacteria 3815
310 Ga0209130_1010403 3300025284 Bacteria 2564
311 Ga0209564_1032892 3300025295 Bacteria 1552
312 Ga0207426_1000152 3300025302 Bacteria 183514
313 Ga0207653_10000124 3300025885 Bacteria 54615
314 Ga0207653_10000163 3300025885 Bacteria 47337
315 Ga0207653_10000919 3300025885 Bacteria 9758
316 Ga0207692_10021292 3300025898 Bacteria 2965
317 Ga0207710_10035426 3300025900 Bacteria 2196
318 Ga0207680_10001086 3300025903 Bacteria 12840
319 Ga0207680_10097380 3300025903 Bacteria 1884
320 Ga0207699_10018008 3300025906 Unclassified 3734
321 Ga0207699_10032563 3300025906 Bacteria 2938
322 Ga0207699_10119836 3300025906 Bacteria 1700
323 Ga0207684_10000442 3300025910 Bacteria 54677
324 Ga0207684_10182475 3300025910 Bacteria 1810
325 Ga0207684_10323754 3300025910 Bacteria 1328
326 Ga0207707_10022484 3300025912 Bacteria 5512
327 Ga0207707_10036631 3300025912 Bacteria 4288
328 Ga0207695_10007981 3300025913 Bacteria 13346
329 Ga0207695_10010169 3300025913 Bacteria 11541
330 Ga0207695_10037404 3300025913 Bacteria 5237
331 Ga0207695_10090101 3300025913 Bacteria 3083
332 Ga0207671_10041164 3300025914 Bacteria 3420
333 Ga0207671_10123094 3300025914 Bacteria 1984
334 Ga0207693_10051013 3300025915 Bacteria 3248
335 Ga0207693_10142380 3300025915 Bacteria 1885
336 Ga0207660_10061796 3300025917 Bacteria 2697
337 Ga0207662_10033371 3300025918 Bacteria 3000
338 Ga0207662_10046360 3300025918 Unclassified 2571
339 Ga0207652_10024189 3300025921 Bacteria 5038
340 Ga0207652_10151495 3300025921 Bacteria 2077
341 Ga0207646_10002300 3300025922 Bacteria 22687
342 Ga0207646_10063712 3300025922 Unclassified 3290
343 Ga0207646_10095144 3300025922 Bacteria 2668
344 Ga0207681_10008789 3300025923 Bacteria 6171
345 Ga0207681_10107111 3300025923 Bacteria 2027
346 Ga0207694_10006789 3300025924 Bacteria 8688
347 Ga0207694_10008231 3300025924 Bacteria 7886
348 Ga0207650_10092893 3300025925 Bacteria 2309
349 Ga0207659_10104582 3300025926 Unclassified 2141
350 Ga0207687_10011643 3300025927 Bacteria 5749
351 Ga0207687_10015801 3300025927 Unclassified 4954
352 Ga0207687_10074402 3300025927 Bacteria 2435
353 Ga0207687_10145125 3300025927 Unclassified 1805
354 Ga0207700_10006602 3300025928 Bacteria 7027
355 Ga0207700_10028431 3300025928 Bacteria 3931
356 Ga0207700_10030446 3300025928 Bacteria 3823
357 Ga0207700_10052573 3300025928 Bacteria 3046
358 Ga0207700_10102055 3300025928 Bacteria 2290
359 Ga0207700_10137876 3300025928 Bacteria 2001
360 Ga0207664_10003748 3300025929 Bacteria 10210
361 Ga0207664_10041189 3300025929 Bacteria 3597
362 Ga0207644_10063981 3300025931 Unclassified 2672
363 Ga0207644_10072837 3300025931 Unclassified 2517
364 Ga0207644_10182767 3300025931 Bacteria 1644
365 Ga0207686_10000003 3300025934 Bacteria 376934
366 Ga0207686_10000104 3300025934 Bacteria 69026
367 Ga0207686_10001552 3300025934 Bacteria 12968
368 Ga0207686_10002559 3300025934 Bacteria 9888
369 Ga0207686_10008223 3300025934 Bacteria 5630
370 Ga0207686_10015070 3300025934 Bacteria 4315
371 Ga0207686_10017487 3300025934 Bacteria 4041
372 Ga0207686_10052129 3300025934 Bacteria 2552
373 Ga0207686_10067942 3300025934 Unclassified 2282
374 Ga0207686_10131035 3300025934 Bacteria 1720
375 Ga0207686_10152886 3300025934 Bacteria 1608
376 Ga0207709_10000017 3300025935 Bacteria 470753
377 Ga0207709_10002329 3300025935 Bacteria 11991
378 Ga0207709_10067682 3300025935 Bacteria 2255
379 Ga0207670_10074034 3300025936 Unclassified 2363
380 Ga0207704_10012808 3300025938 Bacteria 4171
381 Ga0207704_10032859 3300025938 Bacteria 2943
382 Ga0207704_10047098 3300025938 Bacteria 2575
383 Ga0207704_10189362 3300025938 Bacteria 1495
384 Ga0207665_10000446 3300025939 Bacteria 28349
385 Ga0207691_10003222 3300025940 Bacteria 15914
386 Ga0207691_10010360 3300025940 Bacteria 8942
387 Ga0207691_10010629 3300025940 Bacteria 8832
388 Ga0207711_10007153 3300025941 Bacteria 9354
389 Ga0207711_10065826 3300025941 Unclassified 3133
390 Ga0207711_10111927 3300025941 Bacteria 2429
391 Ga0207711_10262015 3300025941 Bacteria 1589
392 Ga0207689_10243309 3300025942 Bacteria 1487
393 Ga0207661_10024906 3300025944 Bacteria 4543
394 Ga0207679_10066968 3300025945 Bacteria 2693
395 Ga0207667_10018249 3300025949 Bacteria 7874
396 Ga0207667_10066347 3300025949 Bacteria 3762
397 Ga0207667_10148000 3300025949 Bacteria 2417
398 Ga0207667_10266958 3300025949 Bacteria 1750
399 Ga0207651_10038202 3300025960 Bacteria 3153
400 Ga0207640_10033352 3300025981 Unclassified 3203
401 Ga0207658_10033730 3300025986 Bacteria 3653
402 Ga0207658_10042493 3300025986 Bacteria 3298
403 Ga0207658_10074573 3300025986 Bacteria 2578
404 Ga0207703_10002422 3300026035 Bacteria 16181
405 Ga0207703_10025946 3300026035 Bacteria 4611
406 Ga0207703_10038380 3300026035 Bacteria 3821
407 Ga0207703_10067928 3300026035 Bacteria 2935
408 Ga0207703_10141575 3300026035 Bacteria 2088
409 Ga0207639_10048227 3300026041 Bacteria 3222
410 Ga0207678_10032986 3300026067 Bacteria 4512
411 Ga0207641_10000551 3300026088 Bacteria 42007
412 Ga0207641_10000723 3300026088 Bacteria 35443
413 Ga0207641_10157923 3300026088 Bacteria 2059
414 Ga0207641_10200823 3300026088 Unclassified 1838
415 Ga0207648_10022548 3300026089 Bacteria 5652
416 Ga0207648_10023733 3300026089 Bacteria 5488
417 Ga0207648_10043244 3300026089 Unclassified 3955
418 Ga0207674_10027099 3300026116 Bacteria 6070
419 Ga0207674_10081457 3300026116 Bacteria 3239
420 Ga0207675_100000940 3300026118 Bacteria 29087
421 Ga0207675_100015359 3300026118 Bacteria 7142
422 Ga0207675_100153525 3300026118 Unclassified 2193
423 Ga0207683_10085357 3300026121 Bacteria 2806
424 Ga0207698_10051502 3300026142 Bacteria 3148
425 Ga0209588_1004195 3300027671 Bacteria 4049
426 Ga0209588_1005949 3300027671 Bacteria 3518
427 Ga0209588_1007096 3300027671 Bacteria 3285
428 Ga0209588_1015542 3300027671 Bacteria 2341
429 Ga0209588_1019131 3300027671 Bacteria 2136
430 Ga0209588_1043336 3300027671 Bacteria 1454
431 Ga0207428_10002796 3300027907 Bacteria 17330
432 Ga0265354_1000043 3300028016 Bacteria 20369
433 Ga0265354_1001146 3300028016 Unclassified 4047
434 Ga0265356_1000700 3300028017 Bacteria 5761
435 Ga0265356_1002770 3300028017 Bacteria 2269
436 Ga0268266_10003187 3300028379 Bacteria 16624
437 Ga0268266_10052611 3300028379 Bacteria 3497
438 Ga0268264_10001434 3300028381 Bacteria 22298
439 Ga0268264_10002348 3300028381 Bacteria 16727
440 Ga0268264_10007581 3300028381 Bacteria 9050
441 Ga0268264_10032400 3300028381 Bacteria 4288
442 Ga0268264_10059477 3300028381 Unclassified 3201
443 Ga0268264_10332623 3300028381 Bacteria 1440
444 Ga0265338_10002271 3300028800 Bacteria 29273
445 Ga0265762_1000446 3300030760 Bacteria 7135
446 Ga0265770_1003354 3300030878 Unclassified 2177
447 Ga0265770_1003410 3300030878 Bacteria 2161
448 Ga0265765_1002141 3300030879 Bacteria 1889
449 Ga0265760_10004778 3300031090 Bacteria 3881
450 Ga0265760_10005935 3300031090 Unclassified 3490
451 Ga0265760_10006990 3300031090 Bacteria 3236
452 Ga0265760_10009650 3300031090 Bacteria 2757
453 Ga0265314_10000932 3300031711 Bacteria 34486
454 Ga0265314_10017073 3300031711 Bacteria 5707
455 Ga0265314_10030472 3300031711 Bacteria 3992
456 Ga0265314_10063593 3300031711 Bacteria 2502
457 Ga0307405_10014623 3300031731 Bacteria 4226
458 Ga0307406_10067855 3300031901 Bacteria 2327
459 Ga0307411_10087406 3300032005 Bacteria 2165
460 Ga0307507_10074086 3300033179 Bacteria 3056
461 Ga0307510_10000007 3300033180 Bacteria 558582
462 Ga0307510_10028213 3300033180 Bacteria 6413
463 Ga0373926_0002254 3300035083 Bacteria 6092
464 Ga0373926_0025211 3300035083 Bacteria 2074
465 Ga0373934_0000654 3300035086 Bacteria 12311
466 Ga0373923_0009739 3300035111 Bacteria 3474
467 Ga0373945_0074533 3300035116 Bacteria 1290
468 Ga0373953_0001383 3300035117 Bacteria 6975
469 Ga0373954_0018744 3300035118 Bacteria 3118
470 Ga0373954_0041072 3300035118 Bacteria 2156
471 Ga0373954_0051493 3300035118 Bacteria 1934
472 Ga0373943_0015459 3300035170 Bacteria 3467
473 Ga0373946_0034870 3300035171 Bacteria 2034
474 Ga0373955_0124624 3300035172 Bacteria 1500
475 Ga0373935_0014992 3300035692 Bacteria 4680
476 Ga0373935_0032704 3300035692 Unclassified 3233
477 Ga0373927_0004727 3300035695 Bacteria 9492
478 Ga0373927_0011697 3300035695 Bacteria 5840
479 Ga0373927_0054497 3300035695 Bacteria 2587
480 Ga0373927_0122795 3300035695 Bacteria 1695
481 Ga0373933_0000227 3300035724 Bacteria 37466
482 Ga0373933_0000909 3300035724 Bacteria 18108
483 Ga0373933_0024609 3300035724 Bacteria 3447
484 Ga0373947_0001695 3300035725 Bacteria 13511
485 Ga0373947_0002695 3300035725 Bacteria 10658
486 Ga0373947_0002800 3300035725 Bacteria 10424
487 Ga0373947_0027361 3300035725 Unclassified 3337
488 Ga0373937_0000240 3300036401 Bacteria 53719
489 Ga0373937_0000567 3300036401 Bacteria 32809
490 Ga0373937_0011155 3300036401 Bacteria 7875
491 Ga0373937_0013012 3300036401 Bacteria 7328
492 Ga0373937_0032264 3300036401 Bacteria 4750
493 Ga0373937_0062028 3300036401 Bacteria 3436
494 Ga0373937_0077330 3300036401 Bacteria 3075
495 Ga0373937_0282214 3300036401 Bacteria 1568
496 Ga0373925_0000333 3300037068 Bacteria 48976
497 Ga0373925_0045977 3300037068 Bacteria 3244
498 Ga0395900_0000182 3300037418 Bacteria 100777
499 Ga0395905_0000170 3300037471 Bacteria 106114
500 Ga0242420_001054 3300038996 Bacteria 3511
501 Ga0436365_0468904 3300039437 Bacteria 2220
502 Ga0436365_0677203 3300039437 Unclassified 1412
503 Ga0436363_0212799 3300039450 Bacteria 3304
504 Ga0436362_0493363 3300039453 Bacteria 8647
505 Ga0436362_0596821 3300039453 Bacteria 9267
506 Ga0451577_0188750 3300042876 Bacteria 1859
507 Ga0466969_0001860 3300044656 Bacteria 11288
508 Ga0466973_0050677 3300044659 Bacteria 3836
509 Ga0466965_0017365 3300044683 Bacteria 3439
510 Ga0466966_0111242 3300044684 Bacteria 1688
511 Ga0466961_0000909 3300044693 Bacteria 18382
512 Ga0466971_0002450 3300044719 Bacteria 7834
513 Ga0466957_0095388 3300044842 Bacteria 1868
514 Ga0451576_0012567 3300045051 Bacteria 9504
515 Ga0451576_0053420 3300045051 Bacteria 4232
516 Ga0466958_0044785 3300045836 Bacteria 2667
517 Ga0495592_0013644 3300046454 Bacteria 6179
518 Ga0495592_0040453 3300046454 Bacteria 3499
519 Ga0495592_0048846 3300046454 Bacteria 3146
520 Ga0495603_0009406 3300046455 Bacteria 5906
521 Ga0495603_0021295 3300046455 Bacteria 3926
522 Ga0495603_0022068 3300046455 Bacteria 3855
523 Ga0495590_0020130 3300046457 Bacteria 2372
524 Ga0495629_0003594 3300046459 Bacteria 11712
525 Ga0495629_0053243 3300046459 Bacteria 2832
526 Ga0495638_0066920 3300046460 Bacteria 2207
527 Ga0495651_0000403 3300046462 Bacteria 33400
528 Ga0495651_0005082 3300046462 Bacteria 10041
529 Ga0495651_0007646 3300046462 Bacteria 8262
530 Ga0495651_0018236 3300046462 Bacteria 5435
531 Ga0495651_0022576 3300046462 Bacteria 4891
532 Ga0495651_0082982 3300046462 Bacteria 2417
533 Ga0495653_0007545 3300046463 Bacteria 8893
534 Ga0495653_0013936 3300046463 Bacteria 6555
535 Ga0495653_0055504 3300046463 Bacteria 3023
536 Ga0495580_0003744 3300046472 Bacteria 12876
537 Ga0495580_0023809 3300046472 Bacteria 4491
538 Ga0495580_0103839 3300046472 Bacteria 1975
539 Ga0495605_0003258 3300046474 Bacteria 9746
540 Ga0495664_0023108 3300046477 Bacteria 3606
541 Ga0495664_0029171 3300046477 Bacteria 3225
542 Ga0495583_0014076 3300046506 Bacteria 4426
543 Ga0495606_0007390 3300046507 Bacteria 9853
544 Ga0495606_0008777 3300046507 Bacteria 8681
545 Ga0495608_0004290 3300046511 Bacteria 10208
546 Ga0495608_0005790 3300046511 Bacteria 8806
547 Ga0495608_0019206 3300046511 Bacteria 4706
548 Ga0495618_0014299 3300046514 Unclassified 4833
549 Ga0495628_0007050 3300046516 Bacteria 9733
550 Ga0495628_0027714 3300046516 Bacteria 4605
551 Ga0495628_0040201 3300046516 Bacteria 3738
552 Ga0495630_0001259 3300046517 Bacteria 17480
553 Ga0495630_0004428 3300046517 Bacteria 9857
554 Ga0495630_0038003 3300046517 Unclassified 3599
555 Ga0495630_0078049 3300046517 Bacteria 2497
556 Ga0495632_0053331 3300046519 Unclassified 1986
557 Ga0495666_0008978 3300046526 Bacteria 5002
558 Ga0495666_0016249 3300046526 Bacteria 3707
559 Ga0495666_0024222 3300046526 Unclassified 2999
560 Ga0495652_0001736 3300046529 Bacteria 23427
561 Ga0495652_0003676 3300046529 Bacteria 15011
562 Ga0495652_0020627 3300046529 Bacteria 5858
563 Ga0495665_0023753 3300046531 Bacteria 3293
564 Ga0495665_0058901 3300046531 Bacteria 2028
565 Ga0495586_0011667 3300046535 Bacteria 4674
566 Ga0495586_0050111 3300046535 Unclassified 2259
567 Ga0495587_0000047 3300046536 Bacteria 105516
568 Ga0495587_0002494 3300046536 Bacteria 12288
569 Ga0495587_0012276 3300046536 Bacteria 5402
570 Ga0495587_0019460 3300046536 Bacteria 4201
571 Ga0495587_0031491 3300046536 Bacteria 3211
572 Ga0495645_0115738 3300046543 Bacteria 1893
573 Ga0495667_0002932 3300046559 Bacteria 11448
574 Ga0495667_0006687 3300046559 Bacteria 7825
575 Ga0495667_0013419 3300046559 Bacteria 5547
576 Ga0495667_0031632 3300046559 Bacteria 3550
577 Ga0495667_0207014 3300046559 Bacteria 1254
578 Ga0495634_0028567 3300046642 Bacteria 3870
579 Ga0495635_0023070 3300046663 Bacteria 4337
580 Ga0495635_0083748 3300046663 Bacteria 2182
581 Ga0495635_0183779 3300046663 Bacteria 1421
582 Ga0495657_0050150 3300046675 Bacteria 2807
583 Ga0495657_0099741 3300046675 Bacteria 1851
584 Ga0495599_0001234 3300046678 Bacteria 14503
585 Ga0495599_0105941 3300046678 Bacteria 1752
586 Ga0495623_0001700 3300046679 Bacteria 14793
587 Ga0495623_0003183 3300046679 Bacteria 10835
588 Ga0495623_0006028 3300046679 Bacteria 7884
589 Ga0495623_0022900 3300046679 Bacteria 4034
590 Ga0495646_0004591 3300046680 Bacteria 8705
591 Ga0495646_0014315 3300046680 Bacteria 5047
592 Ga0495646_0060867 3300046680 Unclassified 2250
593 Ga0495658_0024701 3300046683 Bacteria 3204
594 Ga0495658_0058449 3300046683 Bacteria 2206
595 Ga0495669_0088535 3300046684 Unclassified 1427
596 Ga0495613_0006482 3300046689 Bacteria 8747
597 Ga0495613_0014685 3300046689 Bacteria 5811
598 Ga0495613_0090425 3300046689 Bacteria 2217
599 Ga0495624_0031579 3300046690 Bacteria 3441
600 Ga0495624_0044583 3300046690 Unclassified 2826
601 Ga0495670_0002531 3300046691 Bacteria 9035
602 Ga0495671_0082607 3300046692 Bacteria 1574
603 Ga0495649_0023007 3300046694 Bacteria 3482
604 Ga0495589_0010109 3300046794 Bacteria 4903
605 Ga0495600_0003524 3300046809 Bacteria 9203
606 Ga0495600_0007823 3300046809 Bacteria 6546
607 Ga0495600_0063531 3300046809 Bacteria 2413
608 Ga0495600_0066366 3300046809 Bacteria 2359
609 Ga0495604_0002198 3300047317 Bacteria 15631
610 Ga0495604_0007186 3300047317 Bacteria 8821
611 Ga0495604_0010957 3300047317 Bacteria 7197
612 Ga0495604_0079951 3300047317 Bacteria 2451
613 Ga0495604_0132720 3300047317 Unclassified 1788
614 Ga0495674_0001602 3300047319 Bacteria 22204
615 Ga0495674_0004770 3300047319 Bacteria 13039
616 Ga0495674_0025522 3300047319 Bacteria 5417
617 Ga0495674_0041420 3300047319 Bacteria 4113
618 Ga0495674_0047178 3300047319 Bacteria 3820
619 Ga0495674_0055569 3300047319 Bacteria 3471
620 Ga0495674_0072805 3300047319 Bacteria 2963
621 Ga0495672_0044012 3300047320 Bacteria 2680
622 Ga0495676_0065128 3300047321 Bacteria 2830
623 Ga0495676_0078798 3300047321 Bacteria 2507
624 Ga0495676_0132510 3300047321 Bacteria 1797
625 Ga0495680_0000274 3300047322 Bacteria 57527
626 Ga0495680_0000400 3300047322 Bacteria 48589
627 Ga0495680_0078806 3300047322 Bacteria 2492
628 Ga0495680_0113093 3300047322 Unclassified 2010
629 Ga0495683_0004889 3300047323 Bacteria 7507
630 Ga0495687_005731 3300047443 Bacteria 7823
631 Ga0495687_010235 3300047443 Bacteria 5156
632 Ga0495675_0000391 3300047444 Bacteria 30273
633 Ga0495675_0000604 3300047444 Bacteria 23129
634 Ga0495675_0005476 3300047444 Bacteria 7745
635 Ga0495675_0006096 3300047444 Bacteria 7379
636 Ga0495675_0011818 3300047444 Bacteria 5485
637 Ga0495675_0029592 3300047444 Bacteria 3493
638 Ga0495673_0024607 3300047469 Bacteria 2905
639 Ga0495673_0094003 3300047469 Bacteria 1221
640 Ga0495684_0000714 3300047471 Bacteria 26732
641 Ga0495684_0017612 3300047471 Bacteria 5501
642 Ga0495684_0028481 3300047471 Bacteria 4288
643 Ga0495684_0028702 3300047471 Bacteria 4271
644 Ga0495684_0059562 3300047471 Bacteria 2908
645 Ga0495684_0136278 3300047471 Bacteria 1842
646 Ga0495686_0000044 3300047472 Bacteria 288079
647 Ga0495593_0025975 3300047673 Bacteria 3238
648 Ga0495602_0001895 3300048088 Bacteria 20969
649 Ga0495602_0041952 3300048088 Unclassified 4173
650 Ga0495602_0053030 3300048088 Unclassified 3594
651 Ga0495614_0014032 3300048089 Bacteria 3513
652 Ga0495614_0015854 3300048089 Bacteria 3282
653 Ga0495626_0007870 3300048091 Bacteria 5900
654 Ga0495626_0023978 3300048091 Bacteria 2996
655 Ga0495626_0049029 3300048091 Bacteria 1957
656 Ga0496100_0000301 3300048903 Bacteria 24531
657 Ga0496100_0017645 3300048903 Bacteria 4218
658 Ga0496101_0101315 3300048904 Bacteria 2156
659 Ga0496102_0001853 3300048905 Bacteria 18212
660 Ga0496102_0003062 3300048905 Bacteria 14161
661 Ga0496102_0005260 3300048905 Bacteria 10991
662 Ga0496102_0066050 3300048905 Bacteria 3316
663 Ga0496103_0001175 3300048906 Bacteria 17975
664 Ga0496104_0048303 3300048907 Bacteria 4012
665 Ga0496104_0184781 3300048907 Bacteria 1995
666 Ga0496104_0319566 3300048907 Bacteria 1465
667 Ga0496106_0003186 3300048909 Bacteria 12270
668 Ga0496106_0008663 3300048909 Bacteria 7527
669 Ga0496106_0026715 3300048909 Bacteria 4299
670 Ga0496107_0069060 3300048910 Bacteria 2564
671 Ga0496111_0225854 3300048914 Bacteria 1391
672 Ga0496112_0003587 3300048915 Bacteria 12907
673 Ga0496112_0064216 3300048915 Unclassified 3623
674 Ga0496112_0117821 3300048915 Bacteria 2626
675 Ga0496113_0013118 3300048916 Bacteria 5597
676 Ga0496114_0077316 3300048917 Bacteria 2806
677 Ga0496114_0079448 3300048917 Bacteria 2769
678 Ga0496115_0052127 3300048918 Bacteria 3282
679 Ga0496117_0000038 3300048920 Bacteria 322781
680 Ga0496117_0002673 3300048920 Bacteria 22048
681 Ga0496118_0000019 3300048921 Bacteria 489649
682 Ga0496118_0001329 3300048921 Bacteria 37528
683 Ga0496119_0000897 3300048922 Bacteria 38891
684 Ga0496119_0033153 3300048922 Bacteria 3430
685 Ga0496120_0001881 3300048923 Bacteria 23314
686 Ga0496120_0008002 3300048923 Bacteria 7779
687 Ga0496121_0002145 3300048924 Bacteria 30929
688 Ga0496121_0007010 3300048924 Bacteria 13689
689 Ga0496121_0048546 3300048924 Bacteria 3610
690 Ga0496121_0146905 3300048924 Unclassified 1741
691 Ga0496124_0096895 3300048927 Bacteria 2395
692 Ga0496125_0000494 3300048928 Bacteria 69000
693 Ga0496125_0011232 3300048928 Bacteria 8976
694 Ga0496126_0015907 3300048929 Bacteria 7553
695 Ga0496126_0027282 3300048929 Bacteria 5457
696 Ga0496126_0037401 3300048929 Bacteria 4530
697 Ga0501038_0068271 3300049574 Unclassified 3022
698 Ga0501039_0054124 3300049575 Bacteria 3106
699 Ga0501040_0054230 3300049576 Unclassified 2748
700 Ga0501041_0002464 3300049577 Bacteria 10516
701 Ga0501042_0031137 3300049578 Unclassified 3775
702 Ga0501043_0084821 3300049579 Bacteria 2490
703 Ga0501046_0019292 3300049580 Bacteria 5657
704 Ga0501046_0080582 3300049580 Bacteria 2516
705 Ga0501047_0015566 3300049581 Bacteria 7247
706 Ga0501071_0006888 3300049587 Bacteria 7410
707 Ga0501072_0018784 3300049588 Bacteria 5332
708 Ga0501073_0089874 3300049589 Bacteria 2135
709 Ga0501075_0045488 3300049591 Unclassified 3294
710 Ga0501076_0000391 3300049592 Bacteria 27401
711 Ga0501077_0067030 3300049593 Unclassified 2277
712 Ga0501077_0085943 3300049593 Viruses 1994
713 Ga0501077_0105392 3300049593 Bacteria 1787
714 Ga0501079_0010179 3300049741 Bacteria 7139
715 Ga0501079_0044726 3300049741 Unclassified 3417
716 Ga0501081_0000897 3300049743 Bacteria 17649
717 Ga0501044_0007066 3300049823 Bacteria 12357
718 Ga0501045_0013252 3300049824 Bacteria 5819
719 nmdc:mga05p37_15017_c1 3300050507 Bacteria 9297
720 nmdc:mga05p37_19928_c1 3300050507 Bacteria 8114
721 nmdc:mga05p37_255702_c1 3300050507 Bacteria 2099
722 nmdc:mga05p37_36575_c1 3300050507 Bacteria 6022
723 nmdc:mga05p37_38585_c1 3300050507 Bacteria 5859
724 nmdc:mga05p37_4852_c1 3300050507 Bacteria 15739
725 nmdc:mga05p37_63_c1 3300050507 Bacteria 93704
726 nmdc:mga05p37_7038_c1 3300050507 Bacteria 13259
727 nmdc:mga09592_23759_c1 3300050508 Bacteria 5064
728 nmdc:mga09592_44726_c1 3300050508 Bacteria 3728
729 nmdc:mga09592_50117_c1 3300050508 Bacteria 3522
730 nmdc:mga0qj67_40135_c1 3300050509 Bacteria 3679
731 nmdc:mga0qj67_69153_c1 3300050509 Unclassified 2816
732 nmdc:mga06r32_147533_c1 3300050510 Bacteria 2330
733 nmdc:mga06r32_90284_c1 3300050510 Bacteria 2993
734 nmdc:mga08y16_117986_c1 3300050511 Bacteria 2762
735 nmdc:mga08y16_23879_c1 3300050511 Bacteria 6457
736 nmdc:mga0n895_169877_c1 3300050512 Bacteria 2213
737 nmdc:mga0n895_305443_c1 3300050512 Bacteria 1613
738 nmdc:mga0n895_337116_c1 3300050512 Bacteria 1528
739 nmdc:mga0n895_37920_c1 3300050512 Bacteria 4666
740 nmdc:mga0n895_5153_c1 3300050512 Bacteria 10870
741 nmdc:mga0n895_71855_c1 3300050512 Bacteria 3432
742 nmdc:mga0rr50_7227_c1 3300050513 Bacteria 6829
743 nmdc:mga08x19_19706_c1 3300050514 Bacteria 3374
744 nmdc:mga08x19_4181_c1 3300050514 Bacteria 8555
745 nmdc:mga08x19_58867_c1 3300050514 Bacteria 2486
746 nmdc:mga08x19_821_c1 3300050514 Bacteria 19741
747 nmdc:mga0a205_103410_c1 3300050515 Bacteria 2747
748 nmdc:mga0a205_37934_c1 3300050515 Bacteria 4634
749 nmdc:mga0a205_60067_c1 3300050515 Bacteria 3672
750 nmdc:mga0a205_66011_c1 3300050515 Bacteria 3497
751 nmdc:mga0a205_74913_c1 3300050515 Bacteria 3270
752 Ga0495601_0069765 3300053077 Bacteria 2242
753 Ga0495612_0006570 3300053078 Bacteria 4769
754 Ga0495612_0007500 3300053078 Unclassified 4458
755 Ga0495619_0062559 3300053085 Bacteria 2478
756 Ga0495619_0084023 3300053085 Bacteria 2148
757 Ga0500618_004453 3300053125 Bacteria 4478
758 Ga0501084_0069128 3300054114 Bacteria 2956
759 Ga0501082_0000488 3300060353 Bacteria 34999
760 Ga0501082_0013057 3300060353 Bacteria 7138
761 Ga0466962_0080574 3300061719 Bacteria 1556
762 Ga0530510_0003649 3300061734 Bacteria 10600

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035171 Ga0373946_0034870 Ga0373946_0034870_932_2014 351
2 3300006914 Ga0075436_100069752 Ga0075436_1000697522 357
3 3300009177 Ga0105248_10021176 Ga0105248_100211761 357
4 3300050514 nmdc:mga08x19_19706_c1 nmdc:mga08x19_19706_c1_14_1168 361
5 3300045051 Ga0451576_0053420 Ga0451576_0053420_2760_3965 362
6 3300005440 Ga0070705_100001028 Ga0070705_1000010282 365
7 3300005536 Ga0070697_100000305 Ga0070697_10000030539 365
8 3300047321 Ga0495676_0078798 Ga0495676_0078798_47_1258 368
9 3300007076 Ga0075435_100018412 Ga0075435_1000184124 370
10 3300009147 Ga0114129_10003498 Ga0114129_100034989 374
11 3300005445 Ga0070708_100067561 Ga0070708_1000675613 379
12 3300021388 Ga0213875_10001405 Ga0213875_100014052 379
13 3300025922 Ga0207646_10095144 Ga0207646_100951441 379
14 3300035083 Ga0373926_0025211 Ga0373926_0025211_204_1418 379
15 3300035116 Ga0373945_0074533 Ga0373945_0074533_14_1228 379
16 3300035725 Ga0373947_0002800 Ga0373947_0002800_4865_6079 379
17 3300036401 Ga0373937_0032264 Ga0373937_0032264_2295_3509 379
18 3300044683 Ga0466965_0017365 Ga0466965_0017365_2162_3361 379
19 3300045836 Ga0466958_0044785 Ga0466958_0044785_79_1278 379
20 3300046454 Ga0495592_0040453 Ga0495592_0040453_1459_2673 379
21 3300046516 Ga0495628_0027714 Ga0495628_0027714_816_2030 379
22 3300046526 Ga0495666_0008978 Ga0495666_0008978_3292_4506 379
23 3300046529 Ga0495652_0003676 Ga0495652_0003676_11632_12846 379
24 3300046543 Ga0495645_0115738 Ga0495645_0115738_345_1559 379
25 3300046559 Ga0495667_0207014 Ga0495667_0207014_18_1232 379
26 3300047444 Ga0495675_0029592 Ga0495675_0029592_1336_2550 379
27 3300047471 Ga0495684_0028481 Ga0495684_0028481_2071_3285 379
28 3300053078 Ga0495612_0007500 Ga0495612_0007500_2302_3516 379
29 3300009147 Ga0114129_10058512 Ga0114129_100585125 381
30 3300009147 Ga0114129_10183819 Ga0114129_101838192 381
31 3300005444 Ga0070694_100013057 Ga0070694_1000130573 382
32 3300005546 Ga0070696_100077144 Ga0070696_1000771443 382
33 3300050514 nmdc:mga08x19_58867_c1 nmdc:mga08x19_58867_c1_1025_2299 382
34 3300053085 Ga0495619_0062559 Ga0495619_0062559_102_1370 383
35 3300014325 Ga0163163_10000047 Ga0163163_1000004782 384
36 3300009093 Ga0105240_10124930 Ga0105240_101249302 387
37 3300005435 Ga0070714_100002001 Ga0070714_1000020014 388
38 3300005436 Ga0070713_100001374 Ga0070713_1000013745 388
39 3300025915 Ga0207693_10051013 Ga0207693_100510131 388
40 3300025928 Ga0207700_10006602 Ga0207700_100066026 388
41 3300025929 Ga0207664_10003748 Ga0207664_100037486 388
42 3300035692 Ga0373935_0014992 Ga0373935_0014992_15_1199 388
43 3300049579 Ga0501043_0084821 Ga0501043_0084821_536_1822 388
44 3300049823 Ga0501044_0007066 Ga0501044_0007066_4383_5669 388
45 3300035724 Ga0373933_0000227 Ga0373933_0000227_18180_19367 389
46 3300036401 Ga0373937_0000240 Ga0373937_0000240_42349_43536 389
47 3300046462 Ga0495651_0018236 Ga0495651_0018236_1291_2478 389
48 3300046463 Ga0495653_0055504 Ga0495653_0055504_863_2050 389
49 3300046529 Ga0495652_0020627 Ga0495652_0020627_4242_5429 389
50 3300046536 Ga0495587_0000047 Ga0495587_0000047_89693_90880 389
51 3300046679 Ga0495623_0006028 Ga0495623_0006028_6502_7689 389
52 3300047317 Ga0495604_0010957 Ga0495604_0010957_5268_6455 389
53 3300047444 Ga0495675_0000391 Ga0495675_0000391_15648_16835 389
54 3300048088 Ga0495602_0001895 Ga0495602_0001895_18191_19378 389
55 3300005467 Ga0070706_100178163 Ga0070706_1001781631 390
56 3300005468 Ga0070707_100062025 Ga0070707_1000620253 390
57 3300006852 Ga0075433_10013848 Ga0075433_100138485 390
58 3300006871 Ga0075434_100108840 Ga0075434_1001088402 390
59 3300006914 Ga0075436_100010772 Ga0075436_1000107727 390
60 3300007076 Ga0075435_100009684 Ga0075435_1000096843 390
61 3300009177 Ga0105248_10041529 Ga0105248_100415295 390
62 3300014325 Ga0163163_10022212 Ga0163163_100222124 390
63 3300025939 Ga0207665_10000446 Ga0207665_100004469 390
64 3300046472 Ga0495580_0023809 Ga0495580_0023809_702_1904 390
65 3300046678 Ga0495599_0105941 Ga0495599_0105941_354_1553 390
66 3300047319 Ga0495674_0004770 Ga0495674_0004770_8156_9349 390
67 3300047319 Ga0495674_0025522 Ga0495674_0025522_2847_4049 390
68 3300047320 Ga0495672_0044012 Ga0495672_0044012_355_1548 390
69 3300047321 Ga0495676_0065128 Ga0495676_0065128_1521_2729 390
70 3300047469 Ga0495673_0094003 Ga0495673_0094003_11_1204 390
71 3300047472 Ga0495686_0000044 Ga0495686_0000044_842_2035 390
72 3300048905 Ga0496102_0003062 Ga0496102_0003062_8866_10149 390
73 3300048907 Ga0496104_0319566 Ga0496104_0319566_183_1382 390
74 3300048909 Ga0496106_0008663 Ga0496106_0008663_2598_3881 390
75 3300048915 Ga0496112_0064216 Ga0496112_0064216_2293_3576 390
76 3300050515 nmdc:mga0a205_60067_c1 nmdc:mga0a205_60067_c1_1561_2763 390
77 3300005330 Ga0070690_100019704 Ga0070690_1000197042 391
78 3300005436 Ga0070713_100138284 Ga0070713_1001382842 391
79 3300005444 Ga0070694_100001586 Ga0070694_10000158611 391
80 3300005468 Ga0070707_100077339 Ga0070707_1000773391 391
81 3300005549 Ga0070704_100010113 Ga0070704_1000101135 391
82 3300005616 Ga0068852_100315733 Ga0068852_1003157331 391
83 3300005843 Ga0068860_100234903 Ga0068860_1002349031 391
84 3300009551 Ga0105238_10274848 Ga0105238_102748483 391
85 3300025918 Ga0207662_10046360 Ga0207662_100463602 391
86 3300025922 Ga0207646_10063712 Ga0207646_100637121 391
87 3300026035 Ga0207703_10141575 Ga0207703_101415751 391
88 3300046679 Ga0495623_0022900 Ga0495623_0022900_2536_3741 391
89 3300005439 Ga0070711_100132845 Ga0070711_1001328451 392
90 3300005471 Ga0070698_100046696 Ga0070698_1000466962 392
91 3300005563 Ga0068855_100186067 Ga0068855_1001860672 392
92 3300006881 Ga0068865_100110572 Ga0068865_1001105721 392
93 3300009093 Ga0105240_10440858 Ga0105240_104408582 392
94 3300009098 Ga0105245_10024831 Ga0105245_100248314 392
95 3300009176 Ga0105242_10030630 Ga0105242_100306302 392
96 3300009545 Ga0105237_10127236 Ga0105237_101272362 392
97 3300010375 Ga0105239_10174604 Ga0105239_101746042 392
98 3300025934 Ga0207686_10015070 Ga0207686_100150703 392
99 3300046536 Ga0495587_0012276 Ga0495587_0012276_3360_4880 392
100 3300005617 Ga0068859_100123472 Ga0068859_1001234722 393
101 3300006931 Ga0097620_100123473 Ga0097620_1001234732 393
102 3300005290 Ga0065712_10076179 Ga0065712_100761793 394
103 3300005406 Ga0070703_10004669 Ga0070703_100046694 394
104 3300005434 Ga0070709_10011363 Ga0070709_100113633 394
105 3300005458 Ga0070681_10155948 Ga0070681_101559481 394
106 3300005518 Ga0070699_100017210 Ga0070699_1000172103 394
107 3300005530 Ga0070679_100034298 Ga0070679_1000342982 394
108 3300005547 Ga0070693_100000798 Ga0070693_1000007985 394
109 3300005843 Ga0068860_100005909 Ga0068860_1000059097 394
110 3300007265 Ga0099794_10035351 Ga0099794_100353512 394
111 3300013297 Ga0157378_10000079 Ga0157378_100000799 394
112 3300025885 Ga0207653_10000919 Ga0207653_100009194 394
113 3300025906 Ga0207699_10018008 Ga0207699_100180083 394
114 3300025921 Ga0207652_10024189 Ga0207652_100241894 394
115 3300027671 Ga0209588_1005949 Ga0209588_10059493 394
116 3300028381 Ga0268264_10007581 Ga0268264_100075813 394
117 3300039437 Ga0436365_0677203 Ga0436365_0677203_106_1320 394
118 3300049593 Ga0501077_0105392 Ga0501077_0105392_379_1635 394
119 3300005436 Ga0070713_100008885 Ga0070713_1000088853 395
120 3300005536 Ga0070697_100178992 Ga0070697_1001789921 395
121 3300025928 Ga0207700_10028431 Ga0207700_100284311 395
122 3300048914 Ga0496111_0225854 Ga0496111_0225854_45_1349 395
123 3300025906 Ga0207699_10119836 Ga0207699_101198362 396
124 3300050512 nmdc:mga0n895_169877_c1 nmdc:mga0n895_169877_c1_266_1558 396
125 3300050513 nmdc:mga0rr50_7227_c1 nmdc:mga0rr50_7227_c1_5145_6437 396
126 3300050515 nmdc:mga0a205_66011_c1 nmdc:mga0a205_66011_c1_1958_3250 396
127 3300006914 Ga0075436_100000811 Ga0075436_1000008114 397
128 3300035083 Ga0373926_0002254 Ga0373926_0002254_4703_6025 397
129 3300035695 Ga0373927_0004727 Ga0373927_0004727_50_1372 397
130 3300035725 Ga0373947_0001695 Ga0373947_0001695_4069_5391 397
131 3300037068 Ga0373925_0000333 Ga0373925_0000333_33065_34387 397
132 3300046526 Ga0495666_0024222 Ga0495666_0024222_1368_2690 397
133 3300050514 nmdc:mga08x19_821_c1 nmdc:mga08x19_821_c1_14773_16086 397
134 3300027671 Ga0209588_1004195 Ga0209588_10041953 398
135 3300046457 Ga0495590_0020130 Ga0495590_0020130_1030_2328 398
136 3300046507 Ga0495606_0007390 Ga0495606_0007390_731_2029 398
137 3300046694 Ga0495649_0023007 Ga0495649_0023007_737_2035 398
138 3300047323 Ga0495683_0004889 Ga0495683_0004889_1002_2300 398
139 3300047443 Ga0495687_005731 Ga0495687_005731_94_1392 398
140 3300048091 Ga0495626_0007870 Ga0495626_0007870_1187_2485 398
141 3300048917 Ga0496114_0079448 Ga0496114_0079448_1289_2572 398
142 3300005436 Ga0070713_100229197 Ga0070713_1002291972 399
143 3300005548 Ga0070665_100364154 Ga0070665_1003641541 400
144 3300005842 Ga0068858_100281339 Ga0068858_1002813392 400
145 3300013306 Ga0163162_10029511 Ga0163162_100295114 400
146 3300014325 Ga0163163_10000101 Ga0163163_1000010137 400
147 3300014968 Ga0157379_10040262 Ga0157379_100402624 400
148 3300026118 Ga0207675_100015359 Ga0207675_1000153596 400
149 3300030878 Ga0265770_1003354 Ga0265770_10033542 400
150 3300006028 Ga0070717_10048482 Ga0070717_100484823 401
151 3300037418 Ga0395900_0000182 Ga0395900_0000182_65394_66683 401
152 3300042876 Ga0451577_0188750 Ga0451577_0188750_408_1688 401
153 3300050507 nmdc:mga05p37_4852_c1 nmdc:mga05p37_4852_c1_1789_3114 401
154 3300005336 Ga0070680_100025148 Ga0070680_1000251485 402
155 3300005344 Ga0070661_100115516 Ga0070661_1001155162 402
156 3300005530 Ga0070679_100194382 Ga0070679_1001943822 402
157 3300005563 Ga0068855_100016245 Ga0068855_1000162452 402
158 3300013104 Ga0157370_10005536 Ga0157370_1000553614 402
159 3300013105 Ga0157369_10073539 Ga0157369_100735392 402
160 3300013306 Ga0163162_10010349 Ga0163162_100103492 402
161 3300013308 Ga0157375_10208658 Ga0157375_102086582 402
162 3300025917 Ga0207660_10061796 Ga0207660_100617962 402
163 3300025921 Ga0207652_10151495 Ga0207652_101514952 402
164 3300025949 Ga0207667_10148000 Ga0207667_101480002 402
165 3300026088 Ga0207641_10000723 Ga0207641_1000072324 402
166 3300026142 Ga0207698_10051502 Ga0207698_100515023 402
167 3300005329 Ga0070683_100023872 Ga0070683_1000238722 403
168 3300005353 Ga0070669_100002938 Ga0070669_1000029381 403
169 3300005406 Ga0070703_10001024 Ga0070703_100010244 403
170 3300005467 Ga0070706_100000362 Ga0070706_1000003624 403
171 3300005518 Ga0070699_100147787 Ga0070699_1001477871 403
172 3300005535 Ga0070684_100163961 Ga0070684_1001639612 403
173 3300005545 Ga0070695_100059265 Ga0070695_1000592653 403
174 3300005546 Ga0070696_100004313 Ga0070696_1000043139 403
175 3300005547 Ga0070693_100022346 Ga0070693_1000223462 403
176 3300005844 Ga0068862_100021601 Ga0068862_1000216014 403
177 3300006852 Ga0075433_10017057 Ga0075433_100170576 403
178 3300009147 Ga0114129_10015399 Ga0114129_100153999 403
179 3300009147 Ga0114129_10078754 Ga0114129_100787543 403
180 3300013307 Ga0157372_10130364 Ga0157372_101303643 403
181 3300014969 Ga0157376_10231726 Ga0157376_102317262 403
182 3300025885 Ga0207653_10000124 Ga0207653_100001244 403
183 3300025910 Ga0207684_10000442 Ga0207684_1000044237 403
184 3300025923 Ga0207681_10008789 Ga0207681_100087892 403
185 3300025944 Ga0207661_10024906 Ga0207661_100249062 403
186 3300028016 Ga0265354_1000043 Ga0265354_10000438 403
187 3300028016 Ga0265354_1001146 Ga0265354_10011463 403
188 3300031090 Ga0265760_10006990 Ga0265760_100069902 403
189 3300035111 Ga0373923_0009739 Ga0373923_0009739_1509_2819 403
190 3300035118 Ga0373954_0041072 Ga0373954_0041072_421_1731 403
191 3300039437 Ga0436365_0468904 Ga0436365_0468904_596_1897 403
192 3300046462 Ga0495651_0022576 Ga0495651_0022576_1258_2568 403
193 3300046463 Ga0495653_0007545 Ga0495653_0007545_5511_6821 403
194 3300046472 Ga0495580_0003744 Ga0495580_0003744_3162_4472 403
195 3300046511 Ga0495608_0019206 Ga0495608_0019206_1289_2599 403
196 3300046536 Ga0495587_0019460 Ga0495587_0019460_2651_3940 403
197 3300046663 Ga0495635_0083748 Ga0495635_0083748_662_1972 403
198 3300046679 Ga0495623_0001700 Ga0495623_0001700_11370_12680 403
199 3300046680 Ga0495646_0004591 Ga0495646_0004591_4164_5474 403
200 3300046689 Ga0495613_0006482 Ga0495613_0006482_6838_8148 403
201 3300046809 Ga0495600_0066366 Ga0495600_0066366_322_1632 403
202 3300047317 Ga0495604_0132720 Ga0495604_0132720_103_1371 403
203 3300047471 Ga0495684_0028702 Ga0495684_0028702_1938_3227 403
204 3300048089 Ga0495614_0014032 Ga0495614_0014032_2073_3383 403
205 3300050507 nmdc:mga05p37_15017_c1 nmdc:mga05p37_15017_c1_4752_6038 403
206 3300050507 nmdc:mga05p37_38585_c1 nmdc:mga05p37_38585_c1_869_2158 403
207 3300005328 Ga0070676_10070552 Ga0070676_100705522 404
208 3300046683 Ga0495658_0058449 Ga0495658_0058449_618_1934 404
209 3300048929 Ga0496126_0037401 Ga0496126_0037401_1213_2466 404
210 3300060353 Ga0501082_0000488 Ga0501082_0000488_30880_32130 404
211 3300021358 Ga0213873_10006154 Ga0213873_100061542 405
212 3300021377 Ga0213874_10002560 Ga0213874_100025602 405
213 3300031711 Ga0265314_10017073 Ga0265314_100170733 405
214 3300039450 Ga0436363_0212799 Ga0436363_0212799_1630_2928 405
215 3300039453 Ga0436362_0596821 Ga0436362_0596821_6468_7766 405
216 3300005445 Ga0070708_100005140 Ga0070708_1000051404 406
217 3300005467 Ga0070706_100001465 Ga0070706_1000014659 406
218 3300005468 Ga0070707_100003882 Ga0070707_1000038822 406
219 3300005518 Ga0070699_100015327 Ga0070699_1000153274 406
220 3300005536 Ga0070697_100005223 Ga0070697_1000052234 406
221 3300006237 Ga0097621_100186399 Ga0097621_1001863992 406
222 3300013105 Ga0157369_10001300 Ga0157369_100013008 406
223 3300025922 Ga0207646_10002300 Ga0207646_1000230012 406
224 3300048929 Ga0496126_0027282 Ga0496126_0027282_3700_5031 407
225 3300005471 Ga0070698_100119334 Ga0070698_1001193343 408
226 3300035170 Ga0373943_0015459 Ga0373943_0015459_191_1456 408
227 3300038996 Ga0242420_001054 Ga0242420_001054_50_1336 408
228 3300025941 Ga0207711_10111927 Ga0207711_101119272 409
229 3300044656 Ga0466969_0001860 Ga0466969_0001860_2762_4060 409
230 3300044659 Ga0466973_0050677 Ga0466973_0050677_1067_2374 409
231 3300044684 Ga0466966_0111242 Ga0466966_0111242_282_1580 409
232 3300044693 Ga0466961_0000909 Ga0466961_0000909_2446_3753 409
233 3300044719 Ga0466971_0002450 Ga0466971_0002450_5063_6361 409
234 3300061719 Ga0466962_0080574 Ga0466962_0080574_221_1519 409
235 3300005548 Ga0070665_100007584 Ga0070665_1000075846 411
236 3300005843 Ga0068860_100044060 Ga0068860_1000440602 411
237 3300005843 Ga0068860_100048411 Ga0068860_1000484112 411
238 3300013297 Ga0157378_10114191 Ga0157378_101141911 411
239 3300025910 Ga0207684_10182475 Ga0207684_101824752 411
240 3300025927 Ga0207687_10074402 Ga0207687_100744022 411
241 3300025934 Ga0207686_10008223 Ga0207686_100082232 411
242 3300025960 Ga0207651_10038202 Ga0207651_100382022 411
243 3300026089 Ga0207648_10023733 Ga0207648_100237336 411
244 3300035695 Ga0373927_0122795 Ga0373927_0122795_101_1366 411
245 3300035725 Ga0373947_0002695 Ga0373947_0002695_8418_9683 411
246 3300037068 Ga0373925_0045977 Ga0373925_0045977_116_1381 411
247 3300046683 Ga0495658_0024701 Ga0495658_0024701_310_1575 411
248 3300048089 Ga0495614_0015854 Ga0495614_0015854_2001_3266 411
249 3300049581 Ga0501047_0015566 Ga0501047_0015566_4976_6262 411
250 3300025928 Ga0207700_10030446 Ga0207700_100304462 412
251 3300033179 Ga0307507_10074086 Ga0307507_100740863 412
252 3300005290 Ga0065712_10003618 Ga0065712_100036183 413
253 3300005295 Ga0065707_10091837 Ga0065707_100918372 413
254 3300005329 Ga0070683_100008500 Ga0070683_1000085003 413
255 3300005330 Ga0070690_100163605 Ga0070690_1001636051 413
256 3300005334 Ga0068869_100007437 Ga0068869_1000074371 413
257 3300005364 Ga0070673_100199476 Ga0070673_1001994762 413
258 3300005365 Ga0070688_100126505 Ga0070688_1001265052 413
259 3300005365 Ga0070688_100137117 Ga0070688_1001371171 413
260 3300005367 Ga0070667_100253230 Ga0070667_1002532301 413
261 3300005406 Ga0070703_10000049 Ga0070703_1000004938 413
262 3300005440 Ga0070705_100089558 Ga0070705_1000895582 413
263 3300005441 Ga0070700_100002653 Ga0070700_1000026539 413
264 3300005444 Ga0070694_100001951 Ga0070694_1000019517 413
265 3300005445 Ga0070708_100064998 Ga0070708_1000649982 413
266 3300005468 Ga0070707_100003580 Ga0070707_10000358011 413
267 3300005471 Ga0070698_100001898 Ga0070698_1000018982 413
268 3300005518 Ga0070699_100000008 Ga0070699_10000000835 413
269 3300005546 Ga0070696_100000596 Ga0070696_10000059613 413
270 3300005547 Ga0070693_100117515 Ga0070693_1001175151 413
271 3300005563 Ga0068855_100036469 Ga0068855_1000364692 413
272 3300005615 Ga0070702_100071841 Ga0070702_1000718411 413
273 3300005617 Ga0068859_100007260 Ga0068859_10000726010 413
274 3300005617 Ga0068859_100170430 Ga0068859_1001704303 413
275 3300005617 Ga0068859_100252925 Ga0068859_1002529252 413
276 3300005618 Ga0068864_100056456 Ga0068864_1000564562 413
277 3300005719 Ga0068861_100044233 Ga0068861_1000442331 413
278 3300005719 Ga0068861_100124501 Ga0068861_1001245012 413
279 3300005719 Ga0068861_100162661 Ga0068861_1001626612 413
280 3300005841 Ga0068863_100196788 Ga0068863_1001967882 413
281 3300005841 Ga0068863_100218804 Ga0068863_1002188041 413
282 3300005842 Ga0068858_100163775 Ga0068858_1001637752 413
283 3300005842 Ga0068858_100182384 Ga0068858_1001823842 413
284 3300005843 Ga0068860_100034333 Ga0068860_1000343332 413
285 3300005843 Ga0068860_100294136 Ga0068860_1002941362 413
286 3300005844 Ga0068862_100267418 Ga0068862_1002674182 413
287 3300006237 Ga0097621_100017484 Ga0097621_1000174842 413
288 3300006844 Ga0075428_100062444 Ga0075428_1000624443 413
289 3300006880 Ga0075429_100047943 Ga0075429_1000479433 413
290 3300006880 Ga0075429_100181821 Ga0075429_1001818212 413
291 3300006881 Ga0068865_100056892 Ga0068865_1000568922 413
292 3300006931 Ga0097620_100007260 Ga0097620_10000726010 413
293 3300006931 Ga0097620_100170432 Ga0097620_1001704321 413
294 3300006931 Ga0097620_100252918 Ga0097620_1002529182 413
295 3300007265 Ga0099794_10002659 Ga0099794_100026597 413
296 3300009093 Ga0105240_10001298 Ga0105240_100012986 413
297 3300009093 Ga0105240_10001445 Ga0105240_1000144515 413
298 3300009094 Ga0111539_10019829 Ga0111539_100198294 413
299 3300009147 Ga0114129_10000925 Ga0114129_1000092527 413
300 3300009148 Ga0105243_10000124 Ga0105243_1000012454 413
301 3300009148 Ga0105243_10000774 Ga0105243_1000077421 413
302 3300009148 Ga0105243_10045386 Ga0105243_100453862 413
303 3300009176 Ga0105242_10000021 Ga0105242_1000002189 413
304 3300009176 Ga0105242_10000935 Ga0105242_1000093517 413
305 3300009176 Ga0105242_10012931 Ga0105242_100129314 413
306 3300009176 Ga0105242_10017345 Ga0105242_100173452 413
307 3300009176 Ga0105242_10098592 Ga0105242_100985922 413
308 3300009177 Ga0105248_10017559 Ga0105248_100175591 413
309 3300009553 Ga0105249_10074475 Ga0105249_100744751 413
310 3300010375 Ga0105239_10002786 Ga0105239_1000278617 413
311 3300010375 Ga0105239_10182057 Ga0105239_101820571 413
312 3300011119 Ga0105246_10209678 Ga0105246_102096781 413
313 3300013296 Ga0157374_10094087 Ga0157374_100940871 413
314 3300013297 Ga0157378_10000501 Ga0157378_1000050128 413
315 3300013297 Ga0157378_10012555 Ga0157378_100125555 413
316 3300013297 Ga0157378_10107760 Ga0157378_101077603 413
317 3300013306 Ga0163162_10012392 Ga0163162_100123922 413
318 3300013308 Ga0157375_10020205 Ga0157375_100202054 413
319 3300013308 Ga0157375_10127129 Ga0157375_101271292 413
320 3300014325 Ga0163163_10082478 Ga0163163_100824783 413
321 3300014969 Ga0157376_10019370 Ga0157376_100193704 413
322 3300017792 Ga0163161_10139344 Ga0163161_101393442 413
323 3300025885 Ga0207653_10000163 Ga0207653_1000016311 413
324 3300025910 Ga0207684_10323754 Ga0207684_103237541 413
325 3300025913 Ga0207695_10007981 Ga0207695_100079817 413
326 3300025913 Ga0207695_10010169 Ga0207695_100101696 413
327 3300025918 Ga0207662_10033371 Ga0207662_100333712 413
328 3300025923 Ga0207681_10107111 Ga0207681_101071112 413
329 3300025926 Ga0207659_10104582 Ga0207659_101045821 413
330 3300025931 Ga0207644_10182767 Ga0207644_101827672 413
331 3300025934 Ga0207686_10000003 Ga0207686_10000003132 413
332 3300025934 Ga0207686_10000104 Ga0207686_1000010458 413
333 3300025934 Ga0207686_10001552 Ga0207686_100015525 413
334 3300025934 Ga0207686_10067942 Ga0207686_100679422 413
335 3300025934 Ga0207686_10152886 Ga0207686_101528861 413
336 3300025935 Ga0207709_10000017 Ga0207709_10000017191 413
337 3300025935 Ga0207709_10002329 Ga0207709_100023291 413
338 3300025938 Ga0207704_10189362 Ga0207704_101893621 413
339 3300025940 Ga0207691_10010629 Ga0207691_100106292 413
340 3300025941 Ga0207711_10262015 Ga0207711_102620152 413
341 3300025942 Ga0207689_10243309 Ga0207689_102433091 413
342 3300025949 Ga0207667_10018249 Ga0207667_100182495 413
343 3300026035 Ga0207703_10025946 Ga0207703_100259462 413
344 3300026089 Ga0207648_10043244 Ga0207648_100432442 413
345 3300026118 Ga0207675_100000940 Ga0207675_1000009403 413
346 3300026118 Ga0207675_100153525 Ga0207675_1001535252 413
347 3300027907 Ga0207428_10002796 Ga0207428_1000279610 413
348 3300028381 Ga0268264_10032400 Ga0268264_100324005 413
349 3300028381 Ga0268264_10332623 Ga0268264_103326231 413
350 3300035086 Ga0373934_0000654 Ga0373934_0000654_9480_10763 413
351 3300035117 Ga0373953_0001383 Ga0373953_0001383_2469_3752 413
352 3300035724 Ga0373933_0000909 Ga0373933_0000909_4484_5767 413
353 3300036401 Ga0373937_0000567 Ga0373937_0000567_25528_26811 413
354 3300046462 Ga0495651_0082982 Ga0495651_0082982_356_1639 413
355 3300046684 Ga0495669_0088535 Ga0495669_0088535_78_1358 413
356 3300048909 Ga0496106_0003186 Ga0496106_0003186_503_1783 413
357 3300050507 nmdc:mga05p37_36575_c1 nmdc:mga05p37_36575_c1_4665_5945 413
358 3300050507 nmdc:mga05p37_63_c1 nmdc:mga05p37_63_c1_47975_49282 413
359 3300050512 nmdc:mga0n895_305443_c1 nmdc:mga0n895_305443_c1_182_1462 413
360 3300050512 nmdc:mga0n895_37920_c1 nmdc:mga0n895_37920_c1_2304_3590 413
361 3300050515 nmdc:mga0a205_37934_c1 nmdc:mga0a205_37934_c1_1959_3245 413
362 3300005335 Ga0070666_10002012 Ga0070666_100020125 414
363 3300005355 Ga0070671_100013692 Ga0070671_1000136925 414
364 3300005367 Ga0070667_100003123 Ga0070667_10000312311 414
365 3300005367 Ga0070667_100024918 Ga0070667_1000249182 414
366 3300005458 Ga0070681_10001478 Ga0070681_1000147816 414
367 3300005530 Ga0070679_100252259 Ga0070679_1002522592 414
368 3300005543 Ga0070672_100008309 Ga0070672_1000083094 414
369 3300005544 Ga0070686_100037279 Ga0070686_1000372791 414
370 3300005577 Ga0068857_100002930 Ga0068857_1000029306 414
371 3300005614 Ga0068856_100093690 Ga0068856_1000936903 414
372 3300005617 Ga0068859_100044597 Ga0068859_1000445973 414
373 3300005841 Ga0068863_100213001 Ga0068863_1002130011 414
374 3300005842 Ga0068858_100013552 Ga0068858_1000135523 414
375 3300005843 Ga0068860_100005182 Ga0068860_1000051824 414
376 3300005843 Ga0068860_100081363 Ga0068860_1000813632 414
377 3300006028 Ga0070717_10252026 Ga0070717_102520262 414
378 3300006237 Ga0097621_100033449 Ga0097621_1000334492 414
379 3300006358 Ga0068871_100026641 Ga0068871_1000266412 414
380 3300006931 Ga0097620_100044597 Ga0097620_1000445972 414
381 3300009176 Ga0105242_10110482 Ga0105242_101104822 414
382 3300009177 Ga0105248_10011112 Ga0105248_100111122 414
383 3300009177 Ga0105248_10041341 Ga0105248_100413415 414
384 3300009177 Ga0105248_10170718 Ga0105248_101707183 414
385 3300010375 Ga0105239_10129624 Ga0105239_101296243 414
386 3300013105 Ga0157369_10230260 Ga0157369_102302602 414
387 3300013297 Ga0157378_10215748 Ga0157378_102157481 414
388 3300013306 Ga0163162_10011765 Ga0163162_100117654 414
389 3300014969 Ga0157376_10008124 Ga0157376_100081244 414
390 3300025903 Ga0207680_10001086 Ga0207680_100010867 414
391 3300025912 Ga0207707_10022484 Ga0207707_100224842 414
392 3300025924 Ga0207694_10008231 Ga0207694_100082313 414
393 3300025927 Ga0207687_10145125 Ga0207687_101451252 414
394 3300025928 Ga0207700_10052573 Ga0207700_100525733 414
395 3300025931 Ga0207644_10072837 Ga0207644_100728372 414
396 3300025934 Ga0207686_10002559 Ga0207686_100025593 414
397 3300025934 Ga0207686_10052129 Ga0207686_100521292 414
398 3300025936 Ga0207670_10074034 Ga0207670_100740342 414
399 3300025938 Ga0207704_10032859 Ga0207704_100328592 414
400 3300025940 Ga0207691_10003222 Ga0207691_100032228 414
401 3300025941 Ga0207711_10007153 Ga0207711_100071533 414
402 3300025941 Ga0207711_10065826 Ga0207711_100658262 414
403 3300026035 Ga0207703_10067928 Ga0207703_100679282 414
404 3300026088 Ga0207641_10200823 Ga0207641_102008232 414
405 3300028381 Ga0268264_10002348 Ga0268264_100023486 414
406 3300028381 Ga0268264_10059477 Ga0268264_100594772 414
407 3300031711 Ga0265314_10063593 Ga0265314_100635932 414
408 3300035172 Ga0373955_0124624 Ga0373955_0124624_190_1467 414
409 3300035695 Ga0373927_0054497 Ga0373927_0054497_738_2015 414
410 3300036401 Ga0373937_0013012 Ga0373937_0013012_5899_7203 414
411 3300036401 Ga0373937_0077330 Ga0373937_0077330_1786_3063 414
412 3300036401 Ga0373937_0282214 Ga0373937_0282214_145_1452 414
413 3300039453 Ga0436362_0493363 Ga0436362_0493363_7041_8345 414
414 3300046454 Ga0495592_0048846 Ga0495592_0048846_354_1661 414
415 3300046535 Ga0495586_0050111 Ga0495586_0050111_646_1920 414
416 3300048918 Ga0496115_0052127 Ga0496115_0052127_295_1596 414
417 3300048929 Ga0496126_0015907 Ga0496126_0015907_6139_7440 414
418 3300050507 nmdc:mga05p37_255702_c1 nmdc:mga05p37_255702_c1_196_1470 414
419 3300005335 Ga0070666_10062670 Ga0070666_100626701 415
420 3300005355 Ga0070671_100020610 Ga0070671_1000206106 415
421 3300005842 Ga0068858_100021406 Ga0068858_1000214062 415
422 3300009176 Ga0105242_10192920 Ga0105242_101929201 415
423 3300009177 Ga0105248_10013288 Ga0105248_100132884 415
424 3300014968 Ga0157379_10006540 Ga0157379_100065403 415
425 3300025900 Ga0207710_10035426 Ga0207710_100354262 415
426 3300025903 Ga0207680_10097380 Ga0207680_100973802 415
427 3300025934 Ga0207686_10131035 Ga0207686_101310352 415
428 3300025940 Ga0207691_10010360 Ga0207691_100103609 415
429 3300025986 Ga0207658_10074573 Ga0207658_100745732 415
430 3300026035 Ga0207703_10038380 Ga0207703_100383803 415
431 3300026088 Ga0207641_10157923 Ga0207641_101579232 415
432 3300044842 Ga0466957_0095388 Ga0466957_0095388_367_1683 415
433 3300046459 Ga0495629_0053243 Ga0495629_0053243_237_1556 415
434 3300046507 Ga0495606_0008777 Ga0495606_0008777_3997_5316 415
435 3300046663 Ga0495635_0023070 Ga0495635_0023070_1076_2395 415
436 3300046690 Ga0495624_0031579 Ga0495624_0031579_523_1842 415
437 3300047319 Ga0495674_0047178 Ga0495674_0047178_2238_3557 415
438 3300048917 Ga0496114_0077316 Ga0496114_0077316_662_1981 415
439 3300050507 nmdc:mga05p37_7038_c1 nmdc:mga05p37_7038_c1_2877_4172 415
440 3300005365 Ga0070688_100010104 Ga0070688_1000101043 416
441 3300005365 Ga0070688_100154097 Ga0070688_1001540972 416
442 3300005440 Ga0070705_100075087 Ga0070705_1000750871 416
443 3300005458 Ga0070681_10022150 Ga0070681_100221505 416
444 3300005468 Ga0070707_100006238 Ga0070707_1000062383 416
445 3300005536 Ga0070697_100101790 Ga0070697_1001017902 416
446 3300005536 Ga0070697_100179847 Ga0070697_1001798472 416
447 3300005547 Ga0070693_100011994 Ga0070693_1000119943 416
448 3300005618 Ga0068864_100246621 Ga0068864_1002466211 416
449 3300006844 Ga0075428_100066521 Ga0075428_1000665214 416
450 3300006847 Ga0075431_100031011 Ga0075431_1000310114 416
451 3300006852 Ga0075433_10049585 Ga0075433_100495854 416
452 3300006852 Ga0075433_10066634 Ga0075433_100666342 416
453 3300006852 Ga0075433_10081231 Ga0075433_100812312 416
454 3300006871 Ga0075434_100002388 Ga0075434_1000023882 416
455 3300006871 Ga0075434_100023931 Ga0075434_1000239314 416
456 3300006871 Ga0075434_100322023 Ga0075434_1003220232 416
457 3300006880 Ga0075429_100058289 Ga0075429_1000582892 416
458 3300007076 Ga0075435_100090891 Ga0075435_1000908912 416
459 3300009093 Ga0105240_10043696 Ga0105240_100436963 416
460 3300009094 Ga0111539_10027852 Ga0111539_100278524 416
461 3300009094 Ga0111539_10255374 Ga0111539_102553742 416
462 3300009147 Ga0114129_10003232 Ga0114129_1000323221 416
463 3300013297 Ga0157378_10000539 Ga0157378_1000053911 416
464 3300014745 Ga0157377_10079539 Ga0157377_100795392 416
465 3300024227 Ga0228598_1000071 Ga0228598_100007111 416
466 3300024227 Ga0228598_1002743 Ga0228598_10027431 416
467 3300025913 Ga0207695_10037404 Ga0207695_100374042 416
468 3300025913 Ga0207695_10090101 Ga0207695_100901012 416
469 3300025931 Ga0207644_10063981 Ga0207644_100639812 416
470 3300025949 Ga0207667_10266958 Ga0207667_102669582 416
471 3300030878 Ga0265770_1003410 Ga0265770_10034101 416
472 3300031090 Ga0265760_10009650 Ga0265760_100096502 416
473 3300031711 Ga0265314_10030472 Ga0265314_100304724 416
474 3300031731 Ga0307405_10014623 Ga0307405_100146233 416
475 3300031901 Ga0307406_10067855 Ga0307406_100678552 416
476 3300032005 Ga0307411_10087406 Ga0307411_100874062 416
477 3300035118 Ga0373954_0051493 Ga0373954_0051493_427_1713 416
478 3300035692 Ga0373935_0032704 Ga0373935_0032704_1401_2687 416
479 3300035695 Ga0373927_0011697 Ga0373927_0011697_3979_5265 416
480 3300035724 Ga0373933_0024609 Ga0373933_0024609_1953_3239 416
481 3300035725 Ga0373947_0027361 Ga0373947_0027361_31_1317 416
482 3300036401 Ga0373937_0062028 Ga0373937_0062028_1942_3228 416
483 3300045051 Ga0451576_0012567 Ga0451576_0012567_3209_4522 416
484 3300046455 Ga0495603_0022068 Ga0495603_0022068_2390_3700 416
485 3300046462 Ga0495651_0005082 Ga0495651_0005082_5632_6918 416
486 3300046463 Ga0495653_0013936 Ga0495653_0013936_2781_4067 416
487 3300046477 Ga0495664_0023108 Ga0495664_0023108_1464_2750 416
488 3300046477 Ga0495664_0029171 Ga0495664_0029171_1832_3118 416
489 3300046511 Ga0495608_0005790 Ga0495608_0005790_5720_7006 416
490 3300046517 Ga0495630_0038003 Ga0495630_0038003_2003_3289 416
491 3300046526 Ga0495666_0016249 Ga0495666_0016249_483_1769 416
492 3300046529 Ga0495652_0001736 Ga0495652_0001736_22049_23335 416
493 3300046531 Ga0495665_0023753 Ga0495665_0023753_182_1468 416
494 3300046531 Ga0495665_0058901 Ga0495665_0058901_698_2011 416
495 3300046535 Ga0495586_0011667 Ga0495586_0011667_1904_3190 416
496 3300046536 Ga0495587_0031491 Ga0495587_0031491_1356_2642 416
497 3300046559 Ga0495667_0006687 Ga0495667_0006687_1646_2932 416
498 3300046663 Ga0495635_0183779 Ga0495635_0183779_103_1389 416
499 3300046675 Ga0495657_0099741 Ga0495657_0099741_464_1750 416
500 3300046679 Ga0495623_0003183 Ga0495623_0003183_8109_9395 416
501 3300046680 Ga0495646_0014315 Ga0495646_0014315_1441_2727 416
502 3300046690 Ga0495624_0044583 Ga0495624_0044583_1230_2516 416
503 3300046809 Ga0495600_0007823 Ga0495600_0007823_3357_4643 416
504 3300046809 Ga0495600_0063531 Ga0495600_0063531_273_1559 416
505 3300047317 Ga0495604_0002198 Ga0495604_0002198_11051_12337 416
506 3300047319 Ga0495674_0041420 Ga0495674_0041420_1211_2497 416
507 3300047321 Ga0495676_0132510 Ga0495676_0132510_387_1673 416
508 3300047322 Ga0495680_0000274 Ga0495680_0000274_40752_42038 416
509 3300047444 Ga0495675_0005476 Ga0495675_0005476_126_1412 416
510 3300047444 Ga0495675_0011818 Ga0495675_0011818_1848_3134 416
511 3300047471 Ga0495684_0017612 Ga0495684_0017612_1951_3237 416
512 3300048088 Ga0495602_0053030 Ga0495602_0053030_311_1597 416
513 3300050507 nmdc:mga05p37_19928_c1 nmdc:mga05p37_19928_c1_5430_6728 416
514 3300050508 nmdc:mga09592_23759_c1 nmdc:mga09592_23759_c1_2688_3986 416
515 3300050510 nmdc:mga06r32_147533_c1 nmdc:mga06r32_147533_c1_913_2211 416
516 3300050511 nmdc:mga08y16_117986_c1 nmdc:mga08y16_117986_c1_855_2150 416
517 3300050511 nmdc:mga08y16_23879_c1 nmdc:mga08y16_23879_c1_4142_5440 416
518 3300050512 nmdc:mga0n895_337116_c1 nmdc:mga0n895_337116_c1_171_1484 416
519 3300050512 nmdc:mga0n895_5153_c1 nmdc:mga0n895_5153_c1_2123_3436 416
520 3300050512 nmdc:mga0n895_71855_c1 nmdc:mga0n895_71855_c1_1260_2561 416
521 3300050514 nmdc:mga08x19_4181_c1 nmdc:mga08x19_4181_c1_6649_7941 416
522 3300050515 nmdc:mga0a205_103410_c1 nmdc:mga0a205_103410_c1_538_1836 416
523 3300050515 nmdc:mga0a205_74913_c1 nmdc:mga0a205_74913_c1_1910_3223 416
524 3300053078 Ga0495612_0006570 Ga0495612_0006570_2014_3300 416
525 iso_pu_bacteria 2721755763 2723877633 416
526 3300005336 Ga0070680_100054642 Ga0070680_1000546422 417
527 3300005355 Ga0070671_100082613 Ga0070671_1000826133 417
528 3300005530 Ga0070679_100044093 Ga0070679_1000440931 417
529 3300006237 Ga0097621_100030008 Ga0097621_1000300081 417
530 3300006844 Ga0075428_100035337 Ga0075428_1000353375 417
531 3300006847 Ga0075431_100009733 Ga0075431_1000097337 417
532 3300014969 Ga0157376_10058871 Ga0157376_100588713 417
533 3300025928 Ga0207700_10137876 Ga0207700_101378762 417
534 3300025935 Ga0207709_10067682 Ga0207709_100676821 417
535 3300025938 Ga0207704_10047098 Ga0207704_100470982 417
536 3300026121 Ga0207683_10085357 Ga0207683_100853572 417
537 3300046517 Ga0495630_0078049 Ga0495630_0078049_101_1408 417
538 3300046689 Ga0495613_0090425 Ga0495613_0090425_748_2055 417
539 3300049574 Ga0501038_0068271 Ga0501038_0068271_1690_2997 417
540 3300049577 Ga0501041_0002464 Ga0501041_0002464_8023_9330 417
541 3300049578 Ga0501042_0031137 Ga0501042_0031137_162_1469 417
542 3300049580 Ga0501046_0019292 Ga0501046_0019292_2958_4265 417
543 3300049587 Ga0501071_0006888 Ga0501071_0006888_6079_7386 417
544 3300049591 Ga0501075_0045488 Ga0501075_0045488_1825_3132 417
545 3300049592 Ga0501076_0000391 Ga0501076_0000391_1754_3061 417
546 3300049593 Ga0501077_0085943 Ga0501077_0085943_12_1319 417
547 3300049741 Ga0501079_0010179 Ga0501079_0010179_35_1342 417
548 3300049743 Ga0501081_0000897 Ga0501081_0000897_2414_3721 417
549 3300050509 nmdc:mga0qj67_40135_c1 nmdc:mga0qj67_40135_c1_1389_2696 417
550 3300050510 nmdc:mga06r32_90284_c1 nmdc:mga06r32_90284_c1_618_1925 417
551 3300053077 Ga0495601_0069765 Ga0495601_0069765_799_2106 417
552 3300054114 Ga0501084_0069128 Ga0501084_0069128_654_1961 417
553 3300060353 Ga0501082_0013057 Ga0501082_0013057_35_1342 417
554 3300061734 Ga0530510_0003649 Ga0530510_0003649_2245_3552 417
555 3300005338 Ga0068868_100181521 Ga0068868_1001815211 418
556 3300005437 Ga0070710_10001748 Ga0070710_100017489 418
557 3300007265 Ga0099794_10071147 Ga0099794_100711472 418
558 3300013296 Ga0157374_10014223 Ga0157374_100142233 418
559 3300013297 Ga0157378_10003170 Ga0157378_100031702 418
560 3300014969 Ga0157376_10259005 Ga0157376_102590052 418
561 3300025898 Ga0207692_10021292 Ga0207692_100212922 418
562 3300028017 Ga0265356_1002770 Ga0265356_10027702 418
563 3300030760 Ga0265762_1000446 Ga0265762_10004464 418
564 3300031090 Ga0265760_10004778 Ga0265760_100047782 418
565 3300035118 Ga0373954_0018744 Ga0373954_0018744_358_1668 418
566 3300046454 Ga0495592_0013644 Ga0495592_0013644_583_1893 418
567 3300046462 Ga0495651_0000403 Ga0495651_0000403_27600_28910 418
568 3300046462 Ga0495651_0007646 Ga0495651_0007646_5850_7160 418
569 3300046511 Ga0495608_0004290 Ga0495608_0004290_5836_7146 418
570 3300046514 Ga0495618_0014299 Ga0495618_0014299_3035_4345 418
571 3300046516 Ga0495628_0007050 Ga0495628_0007050_5929_7239 418
572 3300046516 Ga0495628_0040201 Ga0495628_0040201_1481_2791 418
573 3300046517 Ga0495630_0001259 Ga0495630_0001259_9343_10653 418
574 3300046517 Ga0495630_0004428 Ga0495630_0004428_6849_8159 418
575 3300046536 Ga0495587_0002494 Ga0495587_0002494_10546_11856 418
576 3300046559 Ga0495667_0002932 Ga0495667_0002932_8393_9703 418
577 3300046559 Ga0495667_0013419 Ga0495667_0013419_4020_5330 418
578 3300046559 Ga0495667_0031632 Ga0495667_0031632_720_2030 418
579 3300046642 Ga0495634_0028567 Ga0495634_0028567_1703_3013 418
580 3300046675 Ga0495657_0050150 Ga0495657_0050150_722_2032 418
581 3300046678 Ga0495599_0001234 Ga0495599_0001234_5920_7230 418
582 3300046680 Ga0495646_0060867 Ga0495646_0060867_39_1349 418
583 3300046689 Ga0495613_0014685 Ga0495613_0014685_1181_2476 418
584 3300046809 Ga0495600_0003524 Ga0495600_0003524_3537_4847 418
585 3300047317 Ga0495604_0007186 Ga0495604_0007186_6432_7742 418
586 3300047317 Ga0495604_0079951 Ga0495604_0079951_577_1887 418
587 3300047319 Ga0495674_0001602 Ga0495674_0001602_3618_4928 418
588 3300047319 Ga0495674_0072805 Ga0495674_0072805_980_2290 418
589 3300047322 Ga0495680_0000400 Ga0495680_0000400_18794_20104 418
590 3300047322 Ga0495680_0078806 Ga0495680_0078806_899_2209 418
591 3300047322 Ga0495680_0113093 Ga0495680_0113093_121_1431 418
592 3300047444 Ga0495675_0000604 Ga0495675_0000604_21265_22575 418
593 3300047444 Ga0495675_0006096 Ga0495675_0006096_298_1608 418
594 3300047471 Ga0495684_0000714 Ga0495684_0000714_3887_5197 418
595 3300047471 Ga0495684_0059562 Ga0495684_0059562_861_2156 418
596 3300047471 Ga0495684_0136278 Ga0495684_0136278_104_1408 418
597 3300048088 Ga0495602_0041952 Ga0495602_0041952_819_2129 418
598 3300049575 Ga0501039_0054124 Ga0501039_0054124_1082_2401 418
599 3300049576 Ga0501040_0054230 Ga0501040_0054230_1140_2459 418
600 3300049580 Ga0501046_0080582 Ga0501046_0080582_515_1834 418
601 3300049588 Ga0501072_0018784 Ga0501072_0018784_1488_2807 418
602 3300049593 Ga0501077_0067030 Ga0501077_0067030_276_1595 418
603 3300049741 Ga0501079_0044726 Ga0501079_0044726_542_1858 418
604 3300049824 Ga0501045_0013252 Ga0501045_0013252_4210_5526 418
605 3300050508 nmdc:mga09592_44726_c1 nmdc:mga09592_44726_c1_1532_2851 418
606 3300050509 nmdc:mga0qj67_69153_c1 nmdc:mga0qj67_69153_c1_387_1706 418
607 3300053085 Ga0495619_0084023 Ga0495619_0084023_643_1947 418
608 3300005471 Ga0070698_100000253 Ga0070698_1000002534 419
609 3300006844 Ga0075428_100005727 Ga0075428_1000057275 419
610 3300006880 Ga0075429_100017069 Ga0075429_1000170693 419
611 3300007265 Ga0099794_10018351 Ga0099794_100183513 419
612 3300007265 Ga0099794_10023224 Ga0099794_100232242 419
613 3300007265 Ga0099794_10033213 Ga0099794_100332132 419
614 3300009147 Ga0114129_10009696 Ga0114129_100096964 419
615 3300027671 Ga0209588_1007096 Ga0209588_10070962 419
616 3300027671 Ga0209588_1015542 Ga0209588_10155422 419
617 3300027671 Ga0209588_1019131 Ga0209588_10191312 419
618 3300027671 Ga0209588_1043336 Ga0209588_10433361 419
619 3300031090 Ga0265760_10005935 Ga0265760_100059351 419
620 3300046472 Ga0495580_0103839 Ga0495580_0103839_20_1315 419
621 3300050508 nmdc:mga09592_50117_c1 nmdc:mga09592_50117_c1_1147_2463 419
622 iso_pu_bacteria 2856287931 2856288193 419
623 iso_pu_bacteria 2857357740 2857360302 419
624 3300003320 rootH2_10183119 rootH2_101831191 420
625 3300003322 rootL2_10010827 rootL2_100108273 420
626 3300003354 JGI25160J50197_1000737 JGI25160J50197_100073718 420
627 3300005262 Ga0065165_1002132 Ga0065165_10021321 420
628 3300005335 Ga0070666_10070719 Ga0070666_100707191 420
629 3300005367 Ga0070667_100058991 Ga0070667_1000589912 420
630 3300005434 Ga0070709_10037422 Ga0070709_100374222 420
631 3300005435 Ga0070714_100000350 Ga0070714_1000003502 420
632 3300005436 Ga0070713_100132943 Ga0070713_1001329432 420
633 3300005439 Ga0070711_100010061 Ga0070711_1000100612 420
634 3300005445 Ga0070708_100082427 Ga0070708_1000824271 420
635 3300005458 Ga0070681_10007010 Ga0070681_100070105 420
636 3300005458 Ga0070681_10073635 Ga0070681_100736352 420
637 3300005563 Ga0068855_100086466 Ga0068855_1000864663 420
638 3300005564 Ga0070664_100168830 Ga0070664_1001688302 420
639 3300005577 Ga0068857_100073381 Ga0068857_1000733812 420
640 3300005616 Ga0068852_100279861 Ga0068852_1002798612 420
641 3300005618 Ga0068864_100135634 Ga0068864_1001356342 420
642 3300005841 Ga0068863_100066793 Ga0068863_1000667932 420
643 3300005842 Ga0068858_100004881 Ga0068858_1000048818 420
644 3300005843 Ga0068860_100004091 Ga0068860_1000040914 420
645 3300006028 Ga0070717_10036626 Ga0070717_100366262 420
646 3300006028 Ga0070717_10055947 Ga0070717_100559473 420
647 3300006358 Ga0068871_100044589 Ga0068871_1000445892 420
648 3300009098 Ga0105245_10006697 Ga0105245_100066972 420
649 3300009098 Ga0105245_10105200 Ga0105245_101052001 420
650 3300009148 Ga0105243_10087767 Ga0105243_100877673 420
651 3300009174 Ga0105241_10013230 Ga0105241_100132302 420
652 3300009176 Ga0105242_10004531 Ga0105242_1000453110 420
653 3300009176 Ga0105242_10047425 Ga0105242_100474252 420
654 3300009176 Ga0105242_10051912 Ga0105242_100519122 420
655 3300009177 Ga0105248_10059308 Ga0105248_100593082 420
656 3300009551 Ga0105238_10019327 Ga0105238_100193273 420
657 3300010375 Ga0105239_10040412 Ga0105239_100404123 420
658 3300011119 Ga0105246_10209727 Ga0105246_102097271 420
659 3300013296 Ga0157374_10004567 Ga0157374_100045672 420
660 3300013297 Ga0157378_10325613 Ga0157378_103256131 420
661 3300013306 Ga0163162_10007634 Ga0163162_100076343 420
662 3300013306 Ga0163162_10194979 Ga0163162_101949792 420
663 3300013308 Ga0157375_10198629 Ga0157375_101986292 420
664 3300014325 Ga0163163_10020614 Ga0163163_100206143 420
665 3300014325 Ga0163163_10079890 Ga0163163_100798903 420
666 3300014968 Ga0157379_10016261 Ga0157379_100162612 420
667 3300014969 Ga0157376_10113000 Ga0157376_101130002 420
668 3300016635 Ga0183361_10033 Ga0183361_1003336 420
669 3300025284 Ga0209130_1010403 Ga0209130_10104031 420
670 3300025295 Ga0209564_1032892 Ga0209564_10328922 420
671 3300025302 Ga0207426_1000152 Ga0207426_100015218 420
672 3300025906 Ga0207699_10032563 Ga0207699_100325632 420
673 3300025912 Ga0207707_10036631 Ga0207707_100366313 420
674 3300025915 Ga0207693_10142380 Ga0207693_101423802 420
675 3300025924 Ga0207694_10006789 Ga0207694_100067892 420
676 3300025927 Ga0207687_10011643 Ga0207687_100116432 420
677 3300025927 Ga0207687_10015801 Ga0207687_100158012 420
678 3300025928 Ga0207700_10102055 Ga0207700_101020551 420
679 3300025929 Ga0207664_10041189 Ga0207664_100411892 420
680 3300025934 Ga0207686_10017487 Ga0207686_100174872 420
681 3300025938 Ga0207704_10012808 Ga0207704_100128082 420
682 3300025945 Ga0207679_10066968 Ga0207679_100669682 420
683 3300025949 Ga0207667_10066347 Ga0207667_100663472 420
684 3300025986 Ga0207658_10033730 Ga0207658_100337302 420
685 3300025986 Ga0207658_10042493 Ga0207658_100424934 420
686 3300026089 Ga0207648_10022548 Ga0207648_100225483 420
687 3300026116 Ga0207674_10027099 Ga0207674_100270993 420
688 3300026116 Ga0207674_10081457 Ga0207674_100814572 420
689 3300028800 Ga0265338_10002271 Ga0265338_100022711 420
690 3300030879 Ga0265765_1002141 Ga0265765_10021412 420
691 3300031711 Ga0265314_10000932 Ga0265314_1000093223 420
692 3300036401 Ga0373937_0011155 Ga0373937_0011155_330_1637 420
693 3300037471 Ga0395905_0000170 Ga0395905_0000170_89245_90552 420
694 3300046455 Ga0495603_0009406 Ga0495603_0009406_4455_5762 420
695 3300046455 Ga0495603_0021295 Ga0495603_0021295_2042_3376 420
696 3300046459 Ga0495629_0003594 Ga0495629_0003594_2751_4085 420
697 3300046460 Ga0495638_0066920 Ga0495638_0066920_332_1639 420
698 3300046474 Ga0495605_0003258 Ga0495605_0003258_2602_3909 420
699 3300046506 Ga0495583_0014076 Ga0495583_0014076_10_1317 420
700 3300046691 Ga0495670_0002531 Ga0495670_0002531_3046_4353 420
701 3300046692 Ga0495671_0082607 Ga0495671_0082607_114_1421 420
702 3300046794 Ga0495589_0010109 Ga0495589_0010109_2850_4157 420
703 3300047319 Ga0495674_0055569 Ga0495674_0055569_198_1505 420
704 3300047469 Ga0495673_0024607 Ga0495673_0024607_1485_2792 420
705 3300047673 Ga0495593_0025975 Ga0495593_0025975_1680_2999 420
706 3300048091 Ga0495626_0023978 Ga0495626_0023978_489_1796 420
707 3300048091 Ga0495626_0049029 Ga0495626_0049029_405_1712 420
708 3300048903 Ga0496100_0000301 Ga0496100_0000301_11173_12480 420
709 3300048903 Ga0496100_0017645 Ga0496100_0017645_2646_3953 420
710 3300048904 Ga0496101_0101315 Ga0496101_0101315_137_1444 420
711 3300048905 Ga0496102_0001853 Ga0496102_0001853_294_1601 420
712 3300048905 Ga0496102_0066050 Ga0496102_0066050_1483_2790 420
713 3300048906 Ga0496103_0001175 Ga0496103_0001175_273_1580 420
714 3300048907 Ga0496104_0048303 Ga0496104_0048303_2421_3728 420
715 3300048907 Ga0496104_0184781 Ga0496104_0184781_555_1862 420
716 3300048909 Ga0496106_0026715 Ga0496106_0026715_2848_4155 420
717 3300048910 Ga0496107_0069060 Ga0496107_0069060_777_2084 420
718 3300048915 Ga0496112_0003587 Ga0496112_0003587_14_1321 420
719 3300048915 Ga0496112_0117821 Ga0496112_0117821_140_1447 420
720 3300048916 Ga0496113_0013118 Ga0496113_0013118_565_1872 420
721 3300048920 Ga0496117_0002673 Ga0496117_0002673_4346_5653 420
722 3300048921 Ga0496118_0001329 Ga0496118_0001329_19830_21137 420
723 3300048924 Ga0496121_0002145 Ga0496121_0002145_13227_14534 420
724 3300048924 Ga0496121_0007010 Ga0496121_0007010_429_1736 420
725 3300049589 Ga0501073_0089874 Ga0501073_0089874_613_1965 420
726 3300053125 Ga0500618_004453 Ga0500618_004453_213_1520 420
727 iso_pu_bacteria 2513237166 2514054516 420
728 iso_pu_bacteria 2562617112 2563057082 420
729 iso_pu_bacteria 2711768613 2713474196 420
730 iso_pu_bacteria 2791355137 2792832739 420
731 iso_pu_bacteria 2904615490 2904620192 420
732 iso_pu_bacteria 2921643360 2921652814 420
733 iso_pu_bacteria 642555112 642596819 420
734 3300003316 rootH1_10023146 rootH1_100231463 421
735 3300005331 Ga0070670_100223484 Ga0070670_1002234842 421
736 3300005539 Ga0068853_100043607 Ga0068853_1000436073 421
737 3300005548 Ga0070665_100020326 Ga0070665_1000203264 421
738 3300005548 Ga0070665_100031792 Ga0070665_1000317924 421
739 3300005617 Ga0068859_100044982 Ga0068859_1000449822 421
740 3300005843 Ga0068860_100000198 Ga0068860_1000001985 421
741 3300006931 Ga0097620_100044982 Ga0097620_1000449822 421
742 3300010375 Ga0105239_10290912 Ga0105239_102909122 421
743 3300013306 Ga0163162_10044064 Ga0163162_100440644 421
744 3300014325 Ga0163163_10049070 Ga0163163_100490704 421
745 3300025914 Ga0207671_10041164 Ga0207671_100411643 421
746 3300025914 Ga0207671_10123094 Ga0207671_101230942 421
747 3300025925 Ga0207650_10092893 Ga0207650_100928932 421
748 3300025981 Ga0207640_10033352 Ga0207640_100333522 421
749 3300026035 Ga0207703_10002422 Ga0207703_100024229 421
750 3300026041 Ga0207639_10048227 Ga0207639_100482273 421
751 3300026067 Ga0207678_10032986 Ga0207678_100329862 421
752 3300026088 Ga0207641_10000551 Ga0207641_1000055133 421
753 3300028017 Ga0265356_1000700 Ga0265356_10007005 421
754 3300028379 Ga0268266_10003187 Ga0268266_1000318711 421
755 3300028379 Ga0268266_10052611 Ga0268266_100526114 421
756 3300028381 Ga0268264_10001434 Ga0268264_100014342 421
757 3300033180 Ga0307510_10000007 Ga0307510_10000007281 421
758 3300033180 Ga0307510_10028213 Ga0307510_100282135 421
759 3300046519 Ga0495632_0053331 Ga0495632_0053331_150_1415 421
760 3300047443 Ga0495687_010235 Ga0495687_010235_87_1352 421
761 3300048905 Ga0496102_0005260 Ga0496102_0005260_6526_7791 421
762 3300048920 Ga0496117_0000038 Ga0496117_0000038_199491_200756 421
763 3300048921 Ga0496118_0000019 Ga0496118_0000019_298109_299374 421
764 3300048922 Ga0496119_0000897 Ga0496119_0000897_10867_12132 421
765 3300048922 Ga0496119_0033153 Ga0496119_0033153_1616_2881 421
766 3300048923 Ga0496120_0001881 Ga0496120_0001881_21184_22449 421
767 3300048923 Ga0496120_0008002 Ga0496120_0008002_4424_5689 421
768 3300048924 Ga0496121_0048546 Ga0496121_0048546_370_1635 421
769 3300048924 Ga0496121_0146905 Ga0496121_0146905_427_1692 421
770 3300048927 Ga0496124_0096895 Ga0496124_0096895_1029_2294 421
771 3300048928 Ga0496125_0000494 Ga0496125_0000494_7017_8282 421
772 3300048928 Ga0496125_0011232 Ga0496125_0011232_2319_3584 421
773 iso_pu_bacteria 2744054900 2746091491 421
774 iso_pu_bacteria 2744054901 2746099354 421

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

70

277

0.88

PF07690

MFS_1

Major Facilitator Superfamily

73

438

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gby-assembly1.cif.gz_A the structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose 0.8392 12 419
8sc2-assembly1.cif.gz_A human oct1 bound to diltiazem in inward-open conformation 0.8358 59 412
8sc6-assembly1.cif.gz_A human oct1 bound to thiamine in inward-open conformation 0.8315 60 413
6m20-assembly3.cif.gz_C crystal structure of plasmodium falciparum hexose transporter pfht1 bound with glucose 0.8239 11 421
8sc3-assembly1.cif.gz_A human oct1 bound to fenoterol in inward-open conformation 0.8196 59 413
ID Description Score Start End Superfamily
af_P25744_10_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9207 15 204 1.20.1250.20
af_Q54NX1_225_415_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9107 12 203 1.20.1250.20
af_Q9I7N1_126_296_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9075 63 203 1.20.1250.20
4gc0A01 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9016 13 211 1.20.1250.20
af_P9WG91_8_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8929 19 203 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2M8ZMZ6-F1-model_v4 deleted 0.9538 2 421
AF-A0A2M8ZMZ6-F1-model_v4 deleted 0.9494 2 421
AF-A0A317HR28-F1-model_v4 MFS transporter 0.9411 159 421 GO:0005886
GO:0046943
AF-A0A7Y9WAL0-F1-model_v4 MFS family permease 0.9297 6 258 GO:0005886
GO:0046943
AF-A0A2N9MWZ1-F1-model_v4 AMP-dependent synthetase and ligase (Modular protein) 0.9167 7 278 GO:0006631
GO:0016020
GO:0022857
GO:0031956

Feature Viewer

pLDDT pTM Quality
88.7 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map