F480211
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 774 | 320 | 762 | 425 |
Family's Representative Sequence
| Representative Sequence | 3300005406|Ga0070703_10000049|Ga0070703_1000004938 |
| Length | 482 |
| Sequence | LNFGARRQSEVATALWLAWSFSFRPHSTLKSGASRRNADPKRRRRFALPAHSKSILMPRVPLTKNQRRGFLAAWGGWVLDGMDSFIYALVMVPALRELLPRTGIAGNQSNIGYYGGLLFALFLVGWGCSLVWGPIADRFGRVRTLMLTILCYSIFTFAGAFAVNVWMLAGFRLLAGIGIGGEWSMGGTFIAEELPESRRKMAAGLMHTGYYAGIFLAAIANYFVGARYGWRAMFLIGGSPALLVGFIRWGVTESRRWEHRLEEVGKAWTMKRAFGALFSDEYRRRTILNSIYLFISIIGLWAGSVYVPASVGQLALRSGFTESDGLKLASYATMVLSAGTIIGCLLLPILAEKFGRRLTLGIYFALMAVFISIGFGYVFYLQAHALVWFMICLFWLGVGGANFAMYTLWLPEQYRTECRASAFAFATSIGRFGGAGITFLVGAGVAYYQTIGIPVALTSLAFIIGLLLLPFGKETKGEPLPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 2 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 3 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 4 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 5 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 6 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 7 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 8 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 9 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 10 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 11 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 112 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 115 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 166 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 179 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 180 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 181 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 201 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 202 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 203 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 204 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 208 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 209 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 210 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 211 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 272 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 273 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 274 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 275 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 276 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 277 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 278 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 279 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 280 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 281 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 316 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 319 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 320 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.42 |
| Metatranscriptomes | 1.03 |
| Isolates | 1.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.78 |
| Nodule | 0.39 |
| Rhizoplane | 2.97 |
| Rhizosphere | 91.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10023146 | 3300003316 | Bacteria | 4774 |
| 2 | rootH2_10183119 | 3300003320 | Bacteria | 2504 |
| 3 | rootL2_10010827 | 3300003322 | Bacteria | 4090 |
| 4 | JGI25160J50197_1000737 | 3300003354 | Bacteria | 17869 |
| 5 | Ga0065165_1002132 | 3300005262 | Bacteria | 17983 |
| 6 | Ga0065712_10003618 | 3300005290 | Bacteria | 5192 |
| 7 | Ga0065712_10076179 | 3300005290 | Bacteria | 3715 |
| 8 | Ga0065707_10091837 | 3300005295 | Bacteria | 3855 |
| 9 | Ga0070676_10070552 | 3300005328 | Bacteria | 2096 |
| 10 | Ga0070683_100008500 | 3300005329 | Bacteria | 8722 |
| 11 | Ga0070683_100023872 | 3300005329 | Bacteria | 5474 |
| 12 | Ga0070690_100019704 | 3300005330 | Unclassified | 4100 |
| 13 | Ga0070690_100163605 | 3300005330 | Bacteria | 1527 |
| 14 | Ga0070670_100223484 | 3300005331 | Bacteria | 1639 |
| 15 | Ga0068869_100007437 | 3300005334 | Bacteria | 7001 |
| 16 | Ga0070666_10002012 | 3300005335 | Bacteria | 12376 |
| 17 | Ga0070666_10062670 | 3300005335 | Bacteria | 2520 |
| 18 | Ga0070666_10070719 | 3300005335 | Bacteria | 2374 |
| 19 | Ga0070680_100025148 | 3300005336 | Bacteria | 4757 |
| 20 | Ga0070680_100054642 | 3300005336 | Bacteria | 3261 |
| 21 | Ga0068868_100181521 | 3300005338 | Bacteria | 1746 |
| 22 | Ga0070661_100115516 | 3300005344 | Bacteria | 2007 |
| 23 | Ga0070669_100002938 | 3300005353 | Bacteria | 12283 |
| 24 | Ga0070671_100013692 | 3300005355 | Bacteria | 6540 |
| 25 | Ga0070671_100020610 | 3300005355 | Bacteria | 5379 |
| 26 | Ga0070671_100082613 | 3300005355 | Bacteria | 2686 |
| 27 | Ga0070673_100199476 | 3300005364 | Bacteria | 1723 |
| 28 | Ga0070688_100010104 | 3300005365 | Bacteria | 5190 |
| 29 | Ga0070688_100126505 | 3300005365 | Bacteria | 1718 |
| 30 | Ga0070688_100137117 | 3300005365 | Bacteria | 1658 |
| 31 | Ga0070688_100154097 | 3300005365 | Bacteria | 1573 |
| 32 | Ga0070667_100003123 | 3300005367 | Bacteria | 14229 |
| 33 | Ga0070667_100024918 | 3300005367 | Unclassified | 4970 |
| 34 | Ga0070667_100058991 | 3300005367 | Bacteria | 3246 |
| 35 | Ga0070667_100253230 | 3300005367 | Bacteria | 1574 |
| 36 | Ga0070703_10000049 | 3300005406 | Bacteria | 58073 |
| 37 | Ga0070703_10001024 | 3300005406 | Bacteria | 8765 |
| 38 | Ga0070703_10004669 | 3300005406 | Unclassified | 3831 |
| 39 | Ga0070709_10011363 | 3300005434 | Unclassified | 4961 |
| 40 | Ga0070709_10037422 | 3300005434 | Bacteria | 2963 |
| 41 | Ga0070714_100000350 | 3300005435 | Bacteria | 34659 |
| 42 | Ga0070714_100002001 | 3300005435 | Bacteria | 14901 |
| 43 | Ga0070713_100001374 | 3300005436 | Bacteria | 15573 |
| 44 | Ga0070713_100008885 | 3300005436 | Bacteria | 7155 |
| 45 | Ga0070713_100132943 | 3300005436 | Bacteria | 2196 |
| 46 | Ga0070713_100138284 | 3300005436 | Bacteria | 2155 |
| 47 | Ga0070713_100229197 | 3300005436 | Bacteria | 1688 |
| 48 | Ga0070710_10001748 | 3300005437 | Bacteria | 10277 |
| 49 | Ga0070711_100010061 | 3300005439 | Bacteria | 5840 |
| 50 | Ga0070711_100132845 | 3300005439 | Bacteria | 1856 |
| 51 | Ga0070705_100001028 | 3300005440 | Bacteria | 15539 |
| 52 | Ga0070705_100075087 | 3300005440 | Bacteria | 2057 |
| 53 | Ga0070705_100089558 | 3300005440 | Bacteria | 1913 |
| 54 | Ga0070700_100002653 | 3300005441 | Bacteria | 9153 |
| 55 | Ga0070694_100001586 | 3300005444 | Bacteria | 13374 |
| 56 | Ga0070694_100001951 | 3300005444 | Bacteria | 12235 |
| 57 | Ga0070694_100013057 | 3300005444 | Bacteria | 5181 |
| 58 | Ga0070708_100005140 | 3300005445 | Bacteria | 10361 |
| 59 | Ga0070708_100064998 | 3300005445 | Bacteria | 3270 |
| 60 | Ga0070708_100067561 | 3300005445 | Bacteria | 3210 |
| 61 | Ga0070708_100082427 | 3300005445 | Bacteria | 2913 |
| 62 | Ga0070681_10001478 | 3300005458 | Bacteria | 20745 |
| 63 | Ga0070681_10007010 | 3300005458 | Bacteria | 10970 |
| 64 | Ga0070681_10022150 | 3300005458 | Bacteria | 6377 |
| 65 | Ga0070681_10073635 | 3300005458 | Bacteria | 3378 |
| 66 | Ga0070681_10155948 | 3300005458 | Unclassified | 2208 |
| 67 | Ga0070706_100000362 | 3300005467 | Bacteria | 54657 |
| 68 | Ga0070706_100001465 | 3300005467 | Bacteria | 24824 |
| 69 | Ga0070706_100178163 | 3300005467 | Unclassified | 1985 |
| 70 | Ga0070707_100003580 | 3300005468 | Bacteria | 14649 |
| 71 | Ga0070707_100003882 | 3300005468 | Bacteria | 14070 |
| 72 | Ga0070707_100006238 | 3300005468 | Bacteria | 11097 |
| 73 | Ga0070707_100062025 | 3300005468 | Bacteria | 3586 |
| 74 | Ga0070707_100077339 | 3300005468 | Unclassified | 3211 |
| 75 | Ga0070698_100000253 | 3300005471 | Bacteria | 53657 |
| 76 | Ga0070698_100001898 | 3300005471 | Bacteria | 23287 |
| 77 | Ga0070698_100046696 | 3300005471 | Bacteria | 4428 |
| 78 | Ga0070698_100119334 | 3300005471 | Bacteria | 2598 |
| 79 | Ga0070699_100000008 | 3300005518 | Bacteria | 295702 |
| 80 | Ga0070699_100015327 | 3300005518 | Bacteria | 6587 |
| 81 | Ga0070699_100017210 | 3300005518 | Bacteria | 6208 |
| 82 | Ga0070699_100147787 | 3300005518 | Bacteria | 2077 |
| 83 | Ga0070679_100034298 | 3300005530 | Bacteria | 5029 |
| 84 | Ga0070679_100044093 | 3300005530 | Bacteria | 4443 |
| 85 | Ga0070679_100194382 | 3300005530 | Bacteria | 1997 |
| 86 | Ga0070679_100252259 | 3300005530 | Unclassified | 1720 |
| 87 | Ga0070684_100163961 | 3300005535 | Unclassified | 2017 |
| 88 | Ga0070697_100000305 | 3300005536 | Bacteria | 39083 |
| 89 | Ga0070697_100005223 | 3300005536 | Bacteria | 9976 |
| 90 | Ga0070697_100101790 | 3300005536 | Bacteria | 2387 |
| 91 | Ga0070697_100178992 | 3300005536 | Bacteria | 1797 |
| 92 | Ga0070697_100179847 | 3300005536 | Bacteria | 1793 |
| 93 | Ga0068853_100043607 | 3300005539 | Bacteria | 3837 |
| 94 | Ga0070672_100008309 | 3300005543 | Bacteria | 7093 |
| 95 | Ga0070686_100037279 | 3300005544 | Unclassified | 3015 |
| 96 | Ga0070695_100059265 | 3300005545 | Bacteria | 2478 |
| 97 | Ga0070696_100000596 | 3300005546 | Bacteria | 23125 |
| 98 | Ga0070696_100004313 | 3300005546 | Bacteria | 9481 |
| 99 | Ga0070696_100077144 | 3300005546 | Bacteria | 2354 |
| 100 | Ga0070693_100000798 | 3300005547 | Bacteria | 13919 |
| 101 | Ga0070693_100011994 | 3300005547 | Bacteria | 4376 |
| 102 | Ga0070693_100022346 | 3300005547 | Bacteria | 3362 |
| 103 | Ga0070693_100117515 | 3300005547 | Bacteria | 1645 |
| 104 | Ga0070665_100007584 | 3300005548 | Bacteria | 11033 |
| 105 | Ga0070665_100020326 | 3300005548 | Bacteria | 6668 |
| 106 | Ga0070665_100031792 | 3300005548 | Bacteria | 5312 |
| 107 | Ga0070665_100364154 | 3300005548 | Bacteria | 1452 |
| 108 | Ga0070704_100010113 | 3300005549 | Bacteria | 5738 |
| 109 | Ga0068855_100016245 | 3300005563 | Bacteria | 8951 |
| 110 | Ga0068855_100036469 | 3300005563 | Bacteria | 5852 |
| 111 | Ga0068855_100086466 | 3300005563 | Bacteria | 3626 |
| 112 | Ga0068855_100186067 | 3300005563 | Bacteria | 2345 |
| 113 | Ga0070664_100168830 | 3300005564 | Unclassified | 1940 |
| 114 | Ga0068857_100002930 | 3300005577 | Bacteria | 14071 |
| 115 | Ga0068857_100073381 | 3300005577 | Bacteria | 3049 |
| 116 | Ga0068856_100093690 | 3300005614 | Unclassified | 2989 |
| 117 | Ga0070702_100071841 | 3300005615 | Bacteria | 2046 |
| 118 | Ga0068852_100279861 | 3300005616 | Bacteria | 1608 |
| 119 | Ga0068852_100315733 | 3300005616 | Bacteria | 1516 |
| 120 | Ga0068859_100007260 | 3300005617 | Bacteria | 11239 |
| 121 | Ga0068859_100044597 | 3300005617 | Bacteria | 4456 |
| 122 | Ga0068859_100044982 | 3300005617 | Bacteria | 4436 |
| 123 | Ga0068859_100123472 | 3300005617 | Bacteria | 2657 |
| 124 | Ga0068859_100170430 | 3300005617 | Bacteria | 2258 |
| 125 | Ga0068859_100252925 | 3300005617 | Bacteria | 1852 |
| 126 | Ga0068864_100056456 | 3300005618 | Bacteria | 3392 |
| 127 | Ga0068864_100135634 | 3300005618 | Bacteria | 2216 |
| 128 | Ga0068864_100246621 | 3300005618 | Bacteria | 1657 |
| 129 | Ga0068861_100044233 | 3300005719 | Bacteria | 3347 |
| 130 | Ga0068861_100124501 | 3300005719 | Bacteria | 2084 |
| 131 | Ga0068861_100162661 | 3300005719 | Bacteria | 1842 |
| 132 | Ga0068863_100066793 | 3300005841 | Unclassified | 3401 |
| 133 | Ga0068863_100196788 | 3300005841 | Unclassified | 1937 |
| 134 | Ga0068863_100213001 | 3300005841 | Unclassified | 1860 |
| 135 | Ga0068863_100218804 | 3300005841 | Bacteria | 1834 |
| 136 | Ga0068858_100004881 | 3300005842 | Bacteria | 13156 |
| 137 | Ga0068858_100013552 | 3300005842 | Bacteria | 7693 |
| 138 | Ga0068858_100021406 | 3300005842 | Bacteria | 6041 |
| 139 | Ga0068858_100163775 | 3300005842 | Bacteria | 2095 |
| 140 | Ga0068858_100182384 | 3300005842 | Bacteria | 1982 |
| 141 | Ga0068858_100281339 | 3300005842 | Bacteria | 1584 |
| 142 | Ga0068860_100000198 | 3300005843 | Bacteria | 96163 |
| 143 | Ga0068860_100004091 | 3300005843 | Bacteria | 14968 |
| 144 | Ga0068860_100005182 | 3300005843 | Bacteria | 13251 |
| 145 | Ga0068860_100005909 | 3300005843 | Bacteria | 12318 |
| 146 | Ga0068860_100034333 | 3300005843 | Bacteria | 4864 |
| 147 | Ga0068860_100044060 | 3300005843 | Bacteria | 4254 |
| 148 | Ga0068860_100048411 | 3300005843 | Bacteria | 4051 |
| 149 | Ga0068860_100081363 | 3300005843 | Unclassified | 3080 |
| 150 | Ga0068860_100234903 | 3300005843 | Bacteria | 1782 |
| 151 | Ga0068860_100294136 | 3300005843 | Bacteria | 1589 |
| 152 | Ga0068862_100021601 | 3300005844 | Bacteria | 5381 |
| 153 | Ga0068862_100267418 | 3300005844 | Bacteria | 1562 |
| 154 | Ga0070717_10036626 | 3300006028 | Bacteria | 3980 |
| 155 | Ga0070717_10048482 | 3300006028 | Bacteria | 3484 |
| 156 | Ga0070717_10055947 | 3300006028 | Bacteria | 3257 |
| 157 | Ga0070717_10252026 | 3300006028 | Bacteria | 1560 |
| 158 | Ga0097621_100017484 | 3300006237 | Bacteria | 5446 |
| 159 | Ga0097621_100030008 | 3300006237 | Bacteria | 4300 |
| 160 | Ga0097621_100033449 | 3300006237 | Bacteria | 4094 |
| 161 | Ga0097621_100186399 | 3300006237 | Bacteria | 1795 |
| 162 | Ga0068871_100026641 | 3300006358 | Bacteria | 4513 |
| 163 | Ga0068871_100044589 | 3300006358 | Unclassified | 3567 |
| 164 | Ga0075428_100005727 | 3300006844 | Bacteria | 13812 |
| 165 | Ga0075428_100035337 | 3300006844 | Bacteria | 5509 |
| 166 | Ga0075428_100062444 | 3300006844 | Bacteria | 4078 |
| 167 | Ga0075428_100066521 | 3300006844 | Bacteria | 3946 |
| 168 | Ga0075431_100009733 | 3300006847 | Bacteria | 9653 |
| 169 | Ga0075431_100031011 | 3300006847 | Bacteria | 5506 |
| 170 | Ga0075433_10013848 | 3300006852 | Bacteria | 6575 |
| 171 | Ga0075433_10017057 | 3300006852 | Bacteria | 6004 |
| 172 | Ga0075433_10049585 | 3300006852 | Bacteria | 3653 |
| 173 | Ga0075433_10066634 | 3300006852 | Bacteria | 3159 |
| 174 | Ga0075433_10081231 | 3300006852 | Bacteria | 2858 |
| 175 | Ga0075434_100002388 | 3300006871 | Bacteria | 16484 |
| 176 | Ga0075434_100023931 | 3300006871 | Bacteria | 5962 |
| 177 | Ga0075434_100108840 | 3300006871 | Bacteria | 2781 |
| 178 | Ga0075434_100322023 | 3300006871 | Bacteria | 1566 |
| 179 | Ga0075429_100017069 | 3300006880 | Bacteria | 6276 |
| 180 | Ga0075429_100047943 | 3300006880 | Bacteria | 3715 |
| 181 | Ga0075429_100058289 | 3300006880 | Bacteria | 3363 |
| 182 | Ga0075429_100181821 | 3300006880 | Bacteria | 1843 |
| 183 | Ga0068865_100056892 | 3300006881 | Unclassified | 2726 |
| 184 | Ga0068865_100110572 | 3300006881 | Bacteria | 2027 |
| 185 | Ga0075436_100000811 | 3300006914 | Bacteria | 20765 |
| 186 | Ga0075436_100010772 | 3300006914 | Bacteria | 6273 |
| 187 | Ga0075436_100069752 | 3300006914 | Unclassified | 2429 |
| 188 | Ga0097620_100007260 | 3300006931 | Bacteria | 11239 |
| 189 | Ga0097620_100044597 | 3300006931 | Bacteria | 4456 |
| 190 | Ga0097620_100044982 | 3300006931 | Bacteria | 4436 |
| 191 | Ga0097620_100123473 | 3300006931 | Bacteria | 2657 |
| 192 | Ga0097620_100170432 | 3300006931 | Bacteria | 2258 |
| 193 | Ga0097620_100252918 | 3300006931 | Bacteria | 1852 |
| 194 | Ga0075435_100009684 | 3300007076 | Bacteria | 6998 |
| 195 | Ga0075435_100018412 | 3300007076 | Bacteria | 5311 |
| 196 | Ga0075435_100090891 | 3300007076 | Bacteria | 2518 |
| 197 | Ga0099794_10002659 | 3300007265 | Bacteria | 6652 |
| 198 | Ga0099794_10018351 | 3300007265 | Bacteria | 3135 |
| 199 | Ga0099794_10023224 | 3300007265 | Bacteria | 2834 |
| 200 | Ga0099794_10033213 | 3300007265 | Bacteria | 2426 |
| 201 | Ga0099794_10035351 | 3300007265 | Bacteria | 2358 |
| 202 | Ga0099794_10071147 | 3300007265 | Unclassified | 1704 |
| 203 | Ga0105240_10001298 | 3300009093 | Bacteria | 43175 |
| 204 | Ga0105240_10001445 | 3300009093 | Bacteria | 40579 |
| 205 | Ga0105240_10043696 | 3300009093 | Bacteria | 5699 |
| 206 | Ga0105240_10124930 | 3300009093 | Bacteria | 3094 |
| 207 | Ga0105240_10440858 | 3300009093 | Unclassified | 1459 |
| 208 | Ga0111539_10019829 | 3300009094 | Bacteria | 8286 |
| 209 | Ga0111539_10027852 | 3300009094 | Bacteria | 6900 |
| 210 | Ga0111539_10255374 | 3300009094 | Bacteria | 2041 |
| 211 | Ga0105245_10006697 | 3300009098 | Bacteria | 10106 |
| 212 | Ga0105245_10024831 | 3300009098 | Bacteria | 5265 |
| 213 | Ga0105245_10105200 | 3300009098 | Unclassified | 2617 |
| 214 | Ga0114129_10000925 | 3300009147 | Bacteria | 38300 |
| 215 | Ga0114129_10003232 | 3300009147 | Bacteria | 22871 |
| 216 | Ga0114129_10003498 | 3300009147 | Bacteria | 22085 |
| 217 | Ga0114129_10009696 | 3300009147 | Bacteria | 13742 |
| 218 | Ga0114129_10015399 | 3300009147 | Bacteria | 10881 |
| 219 | Ga0114129_10058512 | 3300009147 | Bacteria | 5391 |
| 220 | Ga0114129_10078754 | 3300009147 | Bacteria | 4584 |
| 221 | Ga0114129_10183819 | 3300009147 | Bacteria | 2843 |
| 222 | Ga0105243_10000124 | 3300009148 | Bacteria | 87031 |
| 223 | Ga0105243_10000774 | 3300009148 | Bacteria | 30599 |
| 224 | Ga0105243_10045386 | 3300009148 | Bacteria | 3453 |
| 225 | Ga0105243_10087767 | 3300009148 | Bacteria | 2554 |
| 226 | Ga0105241_10013230 | 3300009174 | Bacteria | 6047 |
| 227 | Ga0105242_10000021 | 3300009176 | Bacteria | 115541 |
| 228 | Ga0105242_10000935 | 3300009176 | Bacteria | 22755 |
| 229 | Ga0105242_10004531 | 3300009176 | Bacteria | 10785 |
| 230 | Ga0105242_10012931 | 3300009176 | Bacteria | 6435 |
| 231 | Ga0105242_10017345 | 3300009176 | Bacteria | 5608 |
| 232 | Ga0105242_10030630 | 3300009176 | Bacteria | 4296 |
| 233 | Ga0105242_10047425 | 3300009176 | Bacteria | 3488 |
| 234 | Ga0105242_10051912 | 3300009176 | Unclassified | 3344 |
| 235 | Ga0105242_10098592 | 3300009176 | Bacteria | 2472 |
| 236 | Ga0105242_10110482 | 3300009176 | Unclassified | 2342 |
| 237 | Ga0105242_10192920 | 3300009176 | Bacteria | 1805 |
| 238 | Ga0105248_10011112 | 3300009177 | Bacteria | 9936 |
| 239 | Ga0105248_10013288 | 3300009177 | Bacteria | 9064 |
| 240 | Ga0105248_10017559 | 3300009177 | Bacteria | 7892 |
| 241 | Ga0105248_10021176 | 3300009177 | Bacteria | 7205 |
| 242 | Ga0105248_10041341 | 3300009177 | Bacteria | 5168 |
| 243 | Ga0105248_10041529 | 3300009177 | Bacteria | 5157 |
| 244 | Ga0105248_10059308 | 3300009177 | Bacteria | 4298 |
| 245 | Ga0105248_10170718 | 3300009177 | Bacteria | 2451 |
| 246 | Ga0105237_10127236 | 3300009545 | Bacteria | 2542 |
| 247 | Ga0105238_10019327 | 3300009551 | Bacteria | 6939 |
| 248 | Ga0105238_10274848 | 3300009551 | Bacteria | 1665 |
| 249 | Ga0105249_10074475 | 3300009553 | Bacteria | 3143 |
| 250 | Ga0105239_10002786 | 3300010375 | Bacteria | 21889 |
| 251 | Ga0105239_10040412 | 3300010375 | Bacteria | 5110 |
| 252 | Ga0105239_10129624 | 3300010375 | Bacteria | 2804 |
| 253 | Ga0105239_10174604 | 3300010375 | Bacteria | 2403 |
| 254 | Ga0105239_10182057 | 3300010375 | Bacteria | 2351 |
| 255 | Ga0105239_10290912 | 3300010375 | Unclassified | 1840 |
| 256 | Ga0105246_10209678 | 3300011119 | Bacteria | 1520 |
| 257 | Ga0105246_10209727 | 3300011119 | Unclassified | 1520 |
| 258 | Ga0157370_10005536 | 3300013104 | Bacteria | 14160 |
| 259 | Ga0157369_10001300 | 3300013105 | Bacteria | 31037 |
| 260 | Ga0157369_10073539 | 3300013105 | Bacteria | 3667 |
| 261 | Ga0157369_10230260 | 3300013105 | Archaea | 1937 |
| 262 | Ga0157374_10004567 | 3300013296 | Bacteria | 11613 |
| 263 | Ga0157374_10014223 | 3300013296 | Bacteria | 6959 |
| 264 | Ga0157374_10094087 | 3300013296 | Unclassified | 2863 |
| 265 | Ga0157378_10000079 | 3300013297 | Bacteria | 88966 |
| 266 | Ga0157378_10000501 | 3300013297 | Bacteria | 37147 |
| 267 | Ga0157378_10000539 | 3300013297 | Bacteria | 36001 |
| 268 | Ga0157378_10003170 | 3300013297 | Bacteria | 14603 |
| 269 | Ga0157378_10012555 | 3300013297 | Bacteria | 7415 |
| 270 | Ga0157378_10107760 | 3300013297 | Bacteria | 2550 |
| 271 | Ga0157378_10114191 | 3300013297 | Bacteria | 2481 |
| 272 | Ga0157378_10215748 | 3300013297 | Unclassified | 1822 |
| 273 | Ga0157378_10325613 | 3300013297 | Unclassified | 1494 |
| 274 | Ga0163162_10007634 | 3300013306 | Bacteria | 10536 |
| 275 | Ga0163162_10010349 | 3300013306 | Bacteria | 9066 |
| 276 | Ga0163162_10011765 | 3300013306 | Bacteria | 8536 |
| 277 | Ga0163162_10012392 | 3300013306 | Bacteria | 8326 |
| 278 | Ga0163162_10029511 | 3300013306 | Bacteria | 5428 |
| 279 | Ga0163162_10044064 | 3300013306 | Bacteria | 4468 |
| 280 | Ga0163162_10194979 | 3300013306 | Bacteria | 2154 |
| 281 | Ga0157372_10130364 | 3300013307 | Bacteria | 2893 |
| 282 | Ga0157375_10020205 | 3300013308 | Bacteria | 6078 |
| 283 | Ga0157375_10127129 | 3300013308 | Unclassified | 2665 |
| 284 | Ga0157375_10198629 | 3300013308 | Unclassified | 2161 |
| 285 | Ga0157375_10208658 | 3300013308 | Bacteria | 2110 |
| 286 | Ga0163163_10000047 | 3300014325 | Bacteria | 131685 |
| 287 | Ga0163163_10000101 | 3300014325 | Bacteria | 90856 |
| 288 | Ga0163163_10020614 | 3300014325 | Bacteria | 6213 |
| 289 | Ga0163163_10022212 | 3300014325 | Bacteria | 6003 |
| 290 | Ga0163163_10049070 | 3300014325 | Unclassified | 4153 |
| 291 | Ga0163163_10079890 | 3300014325 | Bacteria | 3269 |
| 292 | Ga0163163_10082478 | 3300014325 | Unclassified | 3219 |
| 293 | Ga0157377_10079539 | 3300014745 | Bacteria | 1912 |
| 294 | Ga0157379_10006540 | 3300014968 | Bacteria | 10049 |
| 295 | Ga0157379_10016261 | 3300014968 | Bacteria | 6546 |
| 296 | Ga0157379_10040262 | 3300014968 | Bacteria | 4170 |
| 297 | Ga0157376_10008124 | 3300014969 | Bacteria | 7542 |
| 298 | Ga0157376_10019370 | 3300014969 | Bacteria | 5244 |
| 299 | Ga0157376_10058871 | 3300014969 | Unclassified | 3220 |
| 300 | Ga0157376_10113000 | 3300014969 | Bacteria | 2394 |
| 301 | Ga0157376_10231726 | 3300014969 | Bacteria | 1716 |
| 302 | Ga0157376_10259005 | 3300014969 | Bacteria | 1629 |
| 303 | Ga0183361_10033 | 3300016635 | Bacteria | 50513 |
| 304 | Ga0163161_10139344 | 3300017792 | Bacteria | 1836 |
| 305 | Ga0213873_10006154 | 3300021358 | Bacteria | 2348 |
| 306 | Ga0213874_10002560 | 3300021377 | Bacteria | 3927 |
| 307 | Ga0213875_10001405 | 3300021388 | Bacteria | 15682 |
| 308 | Ga0228598_1000071 | 3300024227 | Bacteria | 15175 |
| 309 | Ga0228598_1002743 | 3300024227 | Bacteria | 3815 |
| 310 | Ga0209130_1010403 | 3300025284 | Bacteria | 2564 |
| 311 | Ga0209564_1032892 | 3300025295 | Bacteria | 1552 |
| 312 | Ga0207426_1000152 | 3300025302 | Bacteria | 183514 |
| 313 | Ga0207653_10000124 | 3300025885 | Bacteria | 54615 |
| 314 | Ga0207653_10000163 | 3300025885 | Bacteria | 47337 |
| 315 | Ga0207653_10000919 | 3300025885 | Bacteria | 9758 |
| 316 | Ga0207692_10021292 | 3300025898 | Bacteria | 2965 |
| 317 | Ga0207710_10035426 | 3300025900 | Bacteria | 2196 |
| 318 | Ga0207680_10001086 | 3300025903 | Bacteria | 12840 |
| 319 | Ga0207680_10097380 | 3300025903 | Bacteria | 1884 |
| 320 | Ga0207699_10018008 | 3300025906 | Unclassified | 3734 |
| 321 | Ga0207699_10032563 | 3300025906 | Bacteria | 2938 |
| 322 | Ga0207699_10119836 | 3300025906 | Bacteria | 1700 |
| 323 | Ga0207684_10000442 | 3300025910 | Bacteria | 54677 |
| 324 | Ga0207684_10182475 | 3300025910 | Bacteria | 1810 |
| 325 | Ga0207684_10323754 | 3300025910 | Bacteria | 1328 |
| 326 | Ga0207707_10022484 | 3300025912 | Bacteria | 5512 |
| 327 | Ga0207707_10036631 | 3300025912 | Bacteria | 4288 |
| 328 | Ga0207695_10007981 | 3300025913 | Bacteria | 13346 |
| 329 | Ga0207695_10010169 | 3300025913 | Bacteria | 11541 |
| 330 | Ga0207695_10037404 | 3300025913 | Bacteria | 5237 |
| 331 | Ga0207695_10090101 | 3300025913 | Bacteria | 3083 |
| 332 | Ga0207671_10041164 | 3300025914 | Bacteria | 3420 |
| 333 | Ga0207671_10123094 | 3300025914 | Bacteria | 1984 |
| 334 | Ga0207693_10051013 | 3300025915 | Bacteria | 3248 |
| 335 | Ga0207693_10142380 | 3300025915 | Bacteria | 1885 |
| 336 | Ga0207660_10061796 | 3300025917 | Bacteria | 2697 |
| 337 | Ga0207662_10033371 | 3300025918 | Bacteria | 3000 |
| 338 | Ga0207662_10046360 | 3300025918 | Unclassified | 2571 |
| 339 | Ga0207652_10024189 | 3300025921 | Bacteria | 5038 |
| 340 | Ga0207652_10151495 | 3300025921 | Bacteria | 2077 |
| 341 | Ga0207646_10002300 | 3300025922 | Bacteria | 22687 |
| 342 | Ga0207646_10063712 | 3300025922 | Unclassified | 3290 |
| 343 | Ga0207646_10095144 | 3300025922 | Bacteria | 2668 |
| 344 | Ga0207681_10008789 | 3300025923 | Bacteria | 6171 |
| 345 | Ga0207681_10107111 | 3300025923 | Bacteria | 2027 |
| 346 | Ga0207694_10006789 | 3300025924 | Bacteria | 8688 |
| 347 | Ga0207694_10008231 | 3300025924 | Bacteria | 7886 |
| 348 | Ga0207650_10092893 | 3300025925 | Bacteria | 2309 |
| 349 | Ga0207659_10104582 | 3300025926 | Unclassified | 2141 |
| 350 | Ga0207687_10011643 | 3300025927 | Bacteria | 5749 |
| 351 | Ga0207687_10015801 | 3300025927 | Unclassified | 4954 |
| 352 | Ga0207687_10074402 | 3300025927 | Bacteria | 2435 |
| 353 | Ga0207687_10145125 | 3300025927 | Unclassified | 1805 |
| 354 | Ga0207700_10006602 | 3300025928 | Bacteria | 7027 |
| 355 | Ga0207700_10028431 | 3300025928 | Bacteria | 3931 |
| 356 | Ga0207700_10030446 | 3300025928 | Bacteria | 3823 |
| 357 | Ga0207700_10052573 | 3300025928 | Bacteria | 3046 |
| 358 | Ga0207700_10102055 | 3300025928 | Bacteria | 2290 |
| 359 | Ga0207700_10137876 | 3300025928 | Bacteria | 2001 |
| 360 | Ga0207664_10003748 | 3300025929 | Bacteria | 10210 |
| 361 | Ga0207664_10041189 | 3300025929 | Bacteria | 3597 |
| 362 | Ga0207644_10063981 | 3300025931 | Unclassified | 2672 |
| 363 | Ga0207644_10072837 | 3300025931 | Unclassified | 2517 |
| 364 | Ga0207644_10182767 | 3300025931 | Bacteria | 1644 |
| 365 | Ga0207686_10000003 | 3300025934 | Bacteria | 376934 |
| 366 | Ga0207686_10000104 | 3300025934 | Bacteria | 69026 |
| 367 | Ga0207686_10001552 | 3300025934 | Bacteria | 12968 |
| 368 | Ga0207686_10002559 | 3300025934 | Bacteria | 9888 |
| 369 | Ga0207686_10008223 | 3300025934 | Bacteria | 5630 |
| 370 | Ga0207686_10015070 | 3300025934 | Bacteria | 4315 |
| 371 | Ga0207686_10017487 | 3300025934 | Bacteria | 4041 |
| 372 | Ga0207686_10052129 | 3300025934 | Bacteria | 2552 |
| 373 | Ga0207686_10067942 | 3300025934 | Unclassified | 2282 |
| 374 | Ga0207686_10131035 | 3300025934 | Bacteria | 1720 |
| 375 | Ga0207686_10152886 | 3300025934 | Bacteria | 1608 |
| 376 | Ga0207709_10000017 | 3300025935 | Bacteria | 470753 |
| 377 | Ga0207709_10002329 | 3300025935 | Bacteria | 11991 |
| 378 | Ga0207709_10067682 | 3300025935 | Bacteria | 2255 |
| 379 | Ga0207670_10074034 | 3300025936 | Unclassified | 2363 |
| 380 | Ga0207704_10012808 | 3300025938 | Bacteria | 4171 |
| 381 | Ga0207704_10032859 | 3300025938 | Bacteria | 2943 |
| 382 | Ga0207704_10047098 | 3300025938 | Bacteria | 2575 |
| 383 | Ga0207704_10189362 | 3300025938 | Bacteria | 1495 |
| 384 | Ga0207665_10000446 | 3300025939 | Bacteria | 28349 |
| 385 | Ga0207691_10003222 | 3300025940 | Bacteria | 15914 |
| 386 | Ga0207691_10010360 | 3300025940 | Bacteria | 8942 |
| 387 | Ga0207691_10010629 | 3300025940 | Bacteria | 8832 |
| 388 | Ga0207711_10007153 | 3300025941 | Bacteria | 9354 |
| 389 | Ga0207711_10065826 | 3300025941 | Unclassified | 3133 |
| 390 | Ga0207711_10111927 | 3300025941 | Bacteria | 2429 |
| 391 | Ga0207711_10262015 | 3300025941 | Bacteria | 1589 |
| 392 | Ga0207689_10243309 | 3300025942 | Bacteria | 1487 |
| 393 | Ga0207661_10024906 | 3300025944 | Bacteria | 4543 |
| 394 | Ga0207679_10066968 | 3300025945 | Bacteria | 2693 |
| 395 | Ga0207667_10018249 | 3300025949 | Bacteria | 7874 |
| 396 | Ga0207667_10066347 | 3300025949 | Bacteria | 3762 |
| 397 | Ga0207667_10148000 | 3300025949 | Bacteria | 2417 |
| 398 | Ga0207667_10266958 | 3300025949 | Bacteria | 1750 |
| 399 | Ga0207651_10038202 | 3300025960 | Bacteria | 3153 |
| 400 | Ga0207640_10033352 | 3300025981 | Unclassified | 3203 |
| 401 | Ga0207658_10033730 | 3300025986 | Bacteria | 3653 |
| 402 | Ga0207658_10042493 | 3300025986 | Bacteria | 3298 |
| 403 | Ga0207658_10074573 | 3300025986 | Bacteria | 2578 |
| 404 | Ga0207703_10002422 | 3300026035 | Bacteria | 16181 |
| 405 | Ga0207703_10025946 | 3300026035 | Bacteria | 4611 |
| 406 | Ga0207703_10038380 | 3300026035 | Bacteria | 3821 |
| 407 | Ga0207703_10067928 | 3300026035 | Bacteria | 2935 |
| 408 | Ga0207703_10141575 | 3300026035 | Bacteria | 2088 |
| 409 | Ga0207639_10048227 | 3300026041 | Bacteria | 3222 |
| 410 | Ga0207678_10032986 | 3300026067 | Bacteria | 4512 |
| 411 | Ga0207641_10000551 | 3300026088 | Bacteria | 42007 |
| 412 | Ga0207641_10000723 | 3300026088 | Bacteria | 35443 |
| 413 | Ga0207641_10157923 | 3300026088 | Bacteria | 2059 |
| 414 | Ga0207641_10200823 | 3300026088 | Unclassified | 1838 |
| 415 | Ga0207648_10022548 | 3300026089 | Bacteria | 5652 |
| 416 | Ga0207648_10023733 | 3300026089 | Bacteria | 5488 |
| 417 | Ga0207648_10043244 | 3300026089 | Unclassified | 3955 |
| 418 | Ga0207674_10027099 | 3300026116 | Bacteria | 6070 |
| 419 | Ga0207674_10081457 | 3300026116 | Bacteria | 3239 |
| 420 | Ga0207675_100000940 | 3300026118 | Bacteria | 29087 |
| 421 | Ga0207675_100015359 | 3300026118 | Bacteria | 7142 |
| 422 | Ga0207675_100153525 | 3300026118 | Unclassified | 2193 |
| 423 | Ga0207683_10085357 | 3300026121 | Bacteria | 2806 |
| 424 | Ga0207698_10051502 | 3300026142 | Bacteria | 3148 |
| 425 | Ga0209588_1004195 | 3300027671 | Bacteria | 4049 |
| 426 | Ga0209588_1005949 | 3300027671 | Bacteria | 3518 |
| 427 | Ga0209588_1007096 | 3300027671 | Bacteria | 3285 |
| 428 | Ga0209588_1015542 | 3300027671 | Bacteria | 2341 |
| 429 | Ga0209588_1019131 | 3300027671 | Bacteria | 2136 |
| 430 | Ga0209588_1043336 | 3300027671 | Bacteria | 1454 |
| 431 | Ga0207428_10002796 | 3300027907 | Bacteria | 17330 |
| 432 | Ga0265354_1000043 | 3300028016 | Bacteria | 20369 |
| 433 | Ga0265354_1001146 | 3300028016 | Unclassified | 4047 |
| 434 | Ga0265356_1000700 | 3300028017 | Bacteria | 5761 |
| 435 | Ga0265356_1002770 | 3300028017 | Bacteria | 2269 |
| 436 | Ga0268266_10003187 | 3300028379 | Bacteria | 16624 |
| 437 | Ga0268266_10052611 | 3300028379 | Bacteria | 3497 |
| 438 | Ga0268264_10001434 | 3300028381 | Bacteria | 22298 |
| 439 | Ga0268264_10002348 | 3300028381 | Bacteria | 16727 |
| 440 | Ga0268264_10007581 | 3300028381 | Bacteria | 9050 |
| 441 | Ga0268264_10032400 | 3300028381 | Bacteria | 4288 |
| 442 | Ga0268264_10059477 | 3300028381 | Unclassified | 3201 |
| 443 | Ga0268264_10332623 | 3300028381 | Bacteria | 1440 |
| 444 | Ga0265338_10002271 | 3300028800 | Bacteria | 29273 |
| 445 | Ga0265762_1000446 | 3300030760 | Bacteria | 7135 |
| 446 | Ga0265770_1003354 | 3300030878 | Unclassified | 2177 |
| 447 | Ga0265770_1003410 | 3300030878 | Bacteria | 2161 |
| 448 | Ga0265765_1002141 | 3300030879 | Bacteria | 1889 |
| 449 | Ga0265760_10004778 | 3300031090 | Bacteria | 3881 |
| 450 | Ga0265760_10005935 | 3300031090 | Unclassified | 3490 |
| 451 | Ga0265760_10006990 | 3300031090 | Bacteria | 3236 |
| 452 | Ga0265760_10009650 | 3300031090 | Bacteria | 2757 |
| 453 | Ga0265314_10000932 | 3300031711 | Bacteria | 34486 |
| 454 | Ga0265314_10017073 | 3300031711 | Bacteria | 5707 |
| 455 | Ga0265314_10030472 | 3300031711 | Bacteria | 3992 |
| 456 | Ga0265314_10063593 | 3300031711 | Bacteria | 2502 |
| 457 | Ga0307405_10014623 | 3300031731 | Bacteria | 4226 |
| 458 | Ga0307406_10067855 | 3300031901 | Bacteria | 2327 |
| 459 | Ga0307411_10087406 | 3300032005 | Bacteria | 2165 |
| 460 | Ga0307507_10074086 | 3300033179 | Bacteria | 3056 |
| 461 | Ga0307510_10000007 | 3300033180 | Bacteria | 558582 |
| 462 | Ga0307510_10028213 | 3300033180 | Bacteria | 6413 |
| 463 | Ga0373926_0002254 | 3300035083 | Bacteria | 6092 |
| 464 | Ga0373926_0025211 | 3300035083 | Bacteria | 2074 |
| 465 | Ga0373934_0000654 | 3300035086 | Bacteria | 12311 |
| 466 | Ga0373923_0009739 | 3300035111 | Bacteria | 3474 |
| 467 | Ga0373945_0074533 | 3300035116 | Bacteria | 1290 |
| 468 | Ga0373953_0001383 | 3300035117 | Bacteria | 6975 |
| 469 | Ga0373954_0018744 | 3300035118 | Bacteria | 3118 |
| 470 | Ga0373954_0041072 | 3300035118 | Bacteria | 2156 |
| 471 | Ga0373954_0051493 | 3300035118 | Bacteria | 1934 |
| 472 | Ga0373943_0015459 | 3300035170 | Bacteria | 3467 |
| 473 | Ga0373946_0034870 | 3300035171 | Bacteria | 2034 |
| 474 | Ga0373955_0124624 | 3300035172 | Bacteria | 1500 |
| 475 | Ga0373935_0014992 | 3300035692 | Bacteria | 4680 |
| 476 | Ga0373935_0032704 | 3300035692 | Unclassified | 3233 |
| 477 | Ga0373927_0004727 | 3300035695 | Bacteria | 9492 |
| 478 | Ga0373927_0011697 | 3300035695 | Bacteria | 5840 |
| 479 | Ga0373927_0054497 | 3300035695 | Bacteria | 2587 |
| 480 | Ga0373927_0122795 | 3300035695 | Bacteria | 1695 |
| 481 | Ga0373933_0000227 | 3300035724 | Bacteria | 37466 |
| 482 | Ga0373933_0000909 | 3300035724 | Bacteria | 18108 |
| 483 | Ga0373933_0024609 | 3300035724 | Bacteria | 3447 |
| 484 | Ga0373947_0001695 | 3300035725 | Bacteria | 13511 |
| 485 | Ga0373947_0002695 | 3300035725 | Bacteria | 10658 |
| 486 | Ga0373947_0002800 | 3300035725 | Bacteria | 10424 |
| 487 | Ga0373947_0027361 | 3300035725 | Unclassified | 3337 |
| 488 | Ga0373937_0000240 | 3300036401 | Bacteria | 53719 |
| 489 | Ga0373937_0000567 | 3300036401 | Bacteria | 32809 |
| 490 | Ga0373937_0011155 | 3300036401 | Bacteria | 7875 |
| 491 | Ga0373937_0013012 | 3300036401 | Bacteria | 7328 |
| 492 | Ga0373937_0032264 | 3300036401 | Bacteria | 4750 |
| 493 | Ga0373937_0062028 | 3300036401 | Bacteria | 3436 |
| 494 | Ga0373937_0077330 | 3300036401 | Bacteria | 3075 |
| 495 | Ga0373937_0282214 | 3300036401 | Bacteria | 1568 |
| 496 | Ga0373925_0000333 | 3300037068 | Bacteria | 48976 |
| 497 | Ga0373925_0045977 | 3300037068 | Bacteria | 3244 |
| 498 | Ga0395900_0000182 | 3300037418 | Bacteria | 100777 |
| 499 | Ga0395905_0000170 | 3300037471 | Bacteria | 106114 |
| 500 | Ga0242420_001054 | 3300038996 | Bacteria | 3511 |
| 501 | Ga0436365_0468904 | 3300039437 | Bacteria | 2220 |
| 502 | Ga0436365_0677203 | 3300039437 | Unclassified | 1412 |
| 503 | Ga0436363_0212799 | 3300039450 | Bacteria | 3304 |
| 504 | Ga0436362_0493363 | 3300039453 | Bacteria | 8647 |
| 505 | Ga0436362_0596821 | 3300039453 | Bacteria | 9267 |
| 506 | Ga0451577_0188750 | 3300042876 | Bacteria | 1859 |
| 507 | Ga0466969_0001860 | 3300044656 | Bacteria | 11288 |
| 508 | Ga0466973_0050677 | 3300044659 | Bacteria | 3836 |
| 509 | Ga0466965_0017365 | 3300044683 | Bacteria | 3439 |
| 510 | Ga0466966_0111242 | 3300044684 | Bacteria | 1688 |
| 511 | Ga0466961_0000909 | 3300044693 | Bacteria | 18382 |
| 512 | Ga0466971_0002450 | 3300044719 | Bacteria | 7834 |
| 513 | Ga0466957_0095388 | 3300044842 | Bacteria | 1868 |
| 514 | Ga0451576_0012567 | 3300045051 | Bacteria | 9504 |
| 515 | Ga0451576_0053420 | 3300045051 | Bacteria | 4232 |
| 516 | Ga0466958_0044785 | 3300045836 | Bacteria | 2667 |
| 517 | Ga0495592_0013644 | 3300046454 | Bacteria | 6179 |
| 518 | Ga0495592_0040453 | 3300046454 | Bacteria | 3499 |
| 519 | Ga0495592_0048846 | 3300046454 | Bacteria | 3146 |
| 520 | Ga0495603_0009406 | 3300046455 | Bacteria | 5906 |
| 521 | Ga0495603_0021295 | 3300046455 | Bacteria | 3926 |
| 522 | Ga0495603_0022068 | 3300046455 | Bacteria | 3855 |
| 523 | Ga0495590_0020130 | 3300046457 | Bacteria | 2372 |
| 524 | Ga0495629_0003594 | 3300046459 | Bacteria | 11712 |
| 525 | Ga0495629_0053243 | 3300046459 | Bacteria | 2832 |
| 526 | Ga0495638_0066920 | 3300046460 | Bacteria | 2207 |
| 527 | Ga0495651_0000403 | 3300046462 | Bacteria | 33400 |
| 528 | Ga0495651_0005082 | 3300046462 | Bacteria | 10041 |
| 529 | Ga0495651_0007646 | 3300046462 | Bacteria | 8262 |
| 530 | Ga0495651_0018236 | 3300046462 | Bacteria | 5435 |
| 531 | Ga0495651_0022576 | 3300046462 | Bacteria | 4891 |
| 532 | Ga0495651_0082982 | 3300046462 | Bacteria | 2417 |
| 533 | Ga0495653_0007545 | 3300046463 | Bacteria | 8893 |
| 534 | Ga0495653_0013936 | 3300046463 | Bacteria | 6555 |
| 535 | Ga0495653_0055504 | 3300046463 | Bacteria | 3023 |
| 536 | Ga0495580_0003744 | 3300046472 | Bacteria | 12876 |
| 537 | Ga0495580_0023809 | 3300046472 | Bacteria | 4491 |
| 538 | Ga0495580_0103839 | 3300046472 | Bacteria | 1975 |
| 539 | Ga0495605_0003258 | 3300046474 | Bacteria | 9746 |
| 540 | Ga0495664_0023108 | 3300046477 | Bacteria | 3606 |
| 541 | Ga0495664_0029171 | 3300046477 | Bacteria | 3225 |
| 542 | Ga0495583_0014076 | 3300046506 | Bacteria | 4426 |
| 543 | Ga0495606_0007390 | 3300046507 | Bacteria | 9853 |
| 544 | Ga0495606_0008777 | 3300046507 | Bacteria | 8681 |
| 545 | Ga0495608_0004290 | 3300046511 | Bacteria | 10208 |
| 546 | Ga0495608_0005790 | 3300046511 | Bacteria | 8806 |
| 547 | Ga0495608_0019206 | 3300046511 | Bacteria | 4706 |
| 548 | Ga0495618_0014299 | 3300046514 | Unclassified | 4833 |
| 549 | Ga0495628_0007050 | 3300046516 | Bacteria | 9733 |
| 550 | Ga0495628_0027714 | 3300046516 | Bacteria | 4605 |
| 551 | Ga0495628_0040201 | 3300046516 | Bacteria | 3738 |
| 552 | Ga0495630_0001259 | 3300046517 | Bacteria | 17480 |
| 553 | Ga0495630_0004428 | 3300046517 | Bacteria | 9857 |
| 554 | Ga0495630_0038003 | 3300046517 | Unclassified | 3599 |
| 555 | Ga0495630_0078049 | 3300046517 | Bacteria | 2497 |
| 556 | Ga0495632_0053331 | 3300046519 | Unclassified | 1986 |
| 557 | Ga0495666_0008978 | 3300046526 | Bacteria | 5002 |
| 558 | Ga0495666_0016249 | 3300046526 | Bacteria | 3707 |
| 559 | Ga0495666_0024222 | 3300046526 | Unclassified | 2999 |
| 560 | Ga0495652_0001736 | 3300046529 | Bacteria | 23427 |
| 561 | Ga0495652_0003676 | 3300046529 | Bacteria | 15011 |
| 562 | Ga0495652_0020627 | 3300046529 | Bacteria | 5858 |
| 563 | Ga0495665_0023753 | 3300046531 | Bacteria | 3293 |
| 564 | Ga0495665_0058901 | 3300046531 | Bacteria | 2028 |
| 565 | Ga0495586_0011667 | 3300046535 | Bacteria | 4674 |
| 566 | Ga0495586_0050111 | 3300046535 | Unclassified | 2259 |
| 567 | Ga0495587_0000047 | 3300046536 | Bacteria | 105516 |
| 568 | Ga0495587_0002494 | 3300046536 | Bacteria | 12288 |
| 569 | Ga0495587_0012276 | 3300046536 | Bacteria | 5402 |
| 570 | Ga0495587_0019460 | 3300046536 | Bacteria | 4201 |
| 571 | Ga0495587_0031491 | 3300046536 | Bacteria | 3211 |
| 572 | Ga0495645_0115738 | 3300046543 | Bacteria | 1893 |
| 573 | Ga0495667_0002932 | 3300046559 | Bacteria | 11448 |
| 574 | Ga0495667_0006687 | 3300046559 | Bacteria | 7825 |
| 575 | Ga0495667_0013419 | 3300046559 | Bacteria | 5547 |
| 576 | Ga0495667_0031632 | 3300046559 | Bacteria | 3550 |
| 577 | Ga0495667_0207014 | 3300046559 | Bacteria | 1254 |
| 578 | Ga0495634_0028567 | 3300046642 | Bacteria | 3870 |
| 579 | Ga0495635_0023070 | 3300046663 | Bacteria | 4337 |
| 580 | Ga0495635_0083748 | 3300046663 | Bacteria | 2182 |
| 581 | Ga0495635_0183779 | 3300046663 | Bacteria | 1421 |
| 582 | Ga0495657_0050150 | 3300046675 | Bacteria | 2807 |
| 583 | Ga0495657_0099741 | 3300046675 | Bacteria | 1851 |
| 584 | Ga0495599_0001234 | 3300046678 | Bacteria | 14503 |
| 585 | Ga0495599_0105941 | 3300046678 | Bacteria | 1752 |
| 586 | Ga0495623_0001700 | 3300046679 | Bacteria | 14793 |
| 587 | Ga0495623_0003183 | 3300046679 | Bacteria | 10835 |
| 588 | Ga0495623_0006028 | 3300046679 | Bacteria | 7884 |
| 589 | Ga0495623_0022900 | 3300046679 | Bacteria | 4034 |
| 590 | Ga0495646_0004591 | 3300046680 | Bacteria | 8705 |
| 591 | Ga0495646_0014315 | 3300046680 | Bacteria | 5047 |
| 592 | Ga0495646_0060867 | 3300046680 | Unclassified | 2250 |
| 593 | Ga0495658_0024701 | 3300046683 | Bacteria | 3204 |
| 594 | Ga0495658_0058449 | 3300046683 | Bacteria | 2206 |
| 595 | Ga0495669_0088535 | 3300046684 | Unclassified | 1427 |
| 596 | Ga0495613_0006482 | 3300046689 | Bacteria | 8747 |
| 597 | Ga0495613_0014685 | 3300046689 | Bacteria | 5811 |
| 598 | Ga0495613_0090425 | 3300046689 | Bacteria | 2217 |
| 599 | Ga0495624_0031579 | 3300046690 | Bacteria | 3441 |
| 600 | Ga0495624_0044583 | 3300046690 | Unclassified | 2826 |
| 601 | Ga0495670_0002531 | 3300046691 | Bacteria | 9035 |
| 602 | Ga0495671_0082607 | 3300046692 | Bacteria | 1574 |
| 603 | Ga0495649_0023007 | 3300046694 | Bacteria | 3482 |
| 604 | Ga0495589_0010109 | 3300046794 | Bacteria | 4903 |
| 605 | Ga0495600_0003524 | 3300046809 | Bacteria | 9203 |
| 606 | Ga0495600_0007823 | 3300046809 | Bacteria | 6546 |
| 607 | Ga0495600_0063531 | 3300046809 | Bacteria | 2413 |
| 608 | Ga0495600_0066366 | 3300046809 | Bacteria | 2359 |
| 609 | Ga0495604_0002198 | 3300047317 | Bacteria | 15631 |
| 610 | Ga0495604_0007186 | 3300047317 | Bacteria | 8821 |
| 611 | Ga0495604_0010957 | 3300047317 | Bacteria | 7197 |
| 612 | Ga0495604_0079951 | 3300047317 | Bacteria | 2451 |
| 613 | Ga0495604_0132720 | 3300047317 | Unclassified | 1788 |
| 614 | Ga0495674_0001602 | 3300047319 | Bacteria | 22204 |
| 615 | Ga0495674_0004770 | 3300047319 | Bacteria | 13039 |
| 616 | Ga0495674_0025522 | 3300047319 | Bacteria | 5417 |
| 617 | Ga0495674_0041420 | 3300047319 | Bacteria | 4113 |
| 618 | Ga0495674_0047178 | 3300047319 | Bacteria | 3820 |
| 619 | Ga0495674_0055569 | 3300047319 | Bacteria | 3471 |
| 620 | Ga0495674_0072805 | 3300047319 | Bacteria | 2963 |
| 621 | Ga0495672_0044012 | 3300047320 | Bacteria | 2680 |
| 622 | Ga0495676_0065128 | 3300047321 | Bacteria | 2830 |
| 623 | Ga0495676_0078798 | 3300047321 | Bacteria | 2507 |
| 624 | Ga0495676_0132510 | 3300047321 | Bacteria | 1797 |
| 625 | Ga0495680_0000274 | 3300047322 | Bacteria | 57527 |
| 626 | Ga0495680_0000400 | 3300047322 | Bacteria | 48589 |
| 627 | Ga0495680_0078806 | 3300047322 | Bacteria | 2492 |
| 628 | Ga0495680_0113093 | 3300047322 | Unclassified | 2010 |
| 629 | Ga0495683_0004889 | 3300047323 | Bacteria | 7507 |
| 630 | Ga0495687_005731 | 3300047443 | Bacteria | 7823 |
| 631 | Ga0495687_010235 | 3300047443 | Bacteria | 5156 |
| 632 | Ga0495675_0000391 | 3300047444 | Bacteria | 30273 |
| 633 | Ga0495675_0000604 | 3300047444 | Bacteria | 23129 |
| 634 | Ga0495675_0005476 | 3300047444 | Bacteria | 7745 |
| 635 | Ga0495675_0006096 | 3300047444 | Bacteria | 7379 |
| 636 | Ga0495675_0011818 | 3300047444 | Bacteria | 5485 |
| 637 | Ga0495675_0029592 | 3300047444 | Bacteria | 3493 |
| 638 | Ga0495673_0024607 | 3300047469 | Bacteria | 2905 |
| 639 | Ga0495673_0094003 | 3300047469 | Bacteria | 1221 |
| 640 | Ga0495684_0000714 | 3300047471 | Bacteria | 26732 |
| 641 | Ga0495684_0017612 | 3300047471 | Bacteria | 5501 |
| 642 | Ga0495684_0028481 | 3300047471 | Bacteria | 4288 |
| 643 | Ga0495684_0028702 | 3300047471 | Bacteria | 4271 |
| 644 | Ga0495684_0059562 | 3300047471 | Bacteria | 2908 |
| 645 | Ga0495684_0136278 | 3300047471 | Bacteria | 1842 |
| 646 | Ga0495686_0000044 | 3300047472 | Bacteria | 288079 |
| 647 | Ga0495593_0025975 | 3300047673 | Bacteria | 3238 |
| 648 | Ga0495602_0001895 | 3300048088 | Bacteria | 20969 |
| 649 | Ga0495602_0041952 | 3300048088 | Unclassified | 4173 |
| 650 | Ga0495602_0053030 | 3300048088 | Unclassified | 3594 |
| 651 | Ga0495614_0014032 | 3300048089 | Bacteria | 3513 |
| 652 | Ga0495614_0015854 | 3300048089 | Bacteria | 3282 |
| 653 | Ga0495626_0007870 | 3300048091 | Bacteria | 5900 |
| 654 | Ga0495626_0023978 | 3300048091 | Bacteria | 2996 |
| 655 | Ga0495626_0049029 | 3300048091 | Bacteria | 1957 |
| 656 | Ga0496100_0000301 | 3300048903 | Bacteria | 24531 |
| 657 | Ga0496100_0017645 | 3300048903 | Bacteria | 4218 |
| 658 | Ga0496101_0101315 | 3300048904 | Bacteria | 2156 |
| 659 | Ga0496102_0001853 | 3300048905 | Bacteria | 18212 |
| 660 | Ga0496102_0003062 | 3300048905 | Bacteria | 14161 |
| 661 | Ga0496102_0005260 | 3300048905 | Bacteria | 10991 |
| 662 | Ga0496102_0066050 | 3300048905 | Bacteria | 3316 |
| 663 | Ga0496103_0001175 | 3300048906 | Bacteria | 17975 |
| 664 | Ga0496104_0048303 | 3300048907 | Bacteria | 4012 |
| 665 | Ga0496104_0184781 | 3300048907 | Bacteria | 1995 |
| 666 | Ga0496104_0319566 | 3300048907 | Bacteria | 1465 |
| 667 | Ga0496106_0003186 | 3300048909 | Bacteria | 12270 |
| 668 | Ga0496106_0008663 | 3300048909 | Bacteria | 7527 |
| 669 | Ga0496106_0026715 | 3300048909 | Bacteria | 4299 |
| 670 | Ga0496107_0069060 | 3300048910 | Bacteria | 2564 |
| 671 | Ga0496111_0225854 | 3300048914 | Bacteria | 1391 |
| 672 | Ga0496112_0003587 | 3300048915 | Bacteria | 12907 |
| 673 | Ga0496112_0064216 | 3300048915 | Unclassified | 3623 |
| 674 | Ga0496112_0117821 | 3300048915 | Bacteria | 2626 |
| 675 | Ga0496113_0013118 | 3300048916 | Bacteria | 5597 |
| 676 | Ga0496114_0077316 | 3300048917 | Bacteria | 2806 |
| 677 | Ga0496114_0079448 | 3300048917 | Bacteria | 2769 |
| 678 | Ga0496115_0052127 | 3300048918 | Bacteria | 3282 |
| 679 | Ga0496117_0000038 | 3300048920 | Bacteria | 322781 |
| 680 | Ga0496117_0002673 | 3300048920 | Bacteria | 22048 |
| 681 | Ga0496118_0000019 | 3300048921 | Bacteria | 489649 |
| 682 | Ga0496118_0001329 | 3300048921 | Bacteria | 37528 |
| 683 | Ga0496119_0000897 | 3300048922 | Bacteria | 38891 |
| 684 | Ga0496119_0033153 | 3300048922 | Bacteria | 3430 |
| 685 | Ga0496120_0001881 | 3300048923 | Bacteria | 23314 |
| 686 | Ga0496120_0008002 | 3300048923 | Bacteria | 7779 |
| 687 | Ga0496121_0002145 | 3300048924 | Bacteria | 30929 |
| 688 | Ga0496121_0007010 | 3300048924 | Bacteria | 13689 |
| 689 | Ga0496121_0048546 | 3300048924 | Bacteria | 3610 |
| 690 | Ga0496121_0146905 | 3300048924 | Unclassified | 1741 |
| 691 | Ga0496124_0096895 | 3300048927 | Bacteria | 2395 |
| 692 | Ga0496125_0000494 | 3300048928 | Bacteria | 69000 |
| 693 | Ga0496125_0011232 | 3300048928 | Bacteria | 8976 |
| 694 | Ga0496126_0015907 | 3300048929 | Bacteria | 7553 |
| 695 | Ga0496126_0027282 | 3300048929 | Bacteria | 5457 |
| 696 | Ga0496126_0037401 | 3300048929 | Bacteria | 4530 |
| 697 | Ga0501038_0068271 | 3300049574 | Unclassified | 3022 |
| 698 | Ga0501039_0054124 | 3300049575 | Bacteria | 3106 |
| 699 | Ga0501040_0054230 | 3300049576 | Unclassified | 2748 |
| 700 | Ga0501041_0002464 | 3300049577 | Bacteria | 10516 |
| 701 | Ga0501042_0031137 | 3300049578 | Unclassified | 3775 |
| 702 | Ga0501043_0084821 | 3300049579 | Bacteria | 2490 |
| 703 | Ga0501046_0019292 | 3300049580 | Bacteria | 5657 |
| 704 | Ga0501046_0080582 | 3300049580 | Bacteria | 2516 |
| 705 | Ga0501047_0015566 | 3300049581 | Bacteria | 7247 |
| 706 | Ga0501071_0006888 | 3300049587 | Bacteria | 7410 |
| 707 | Ga0501072_0018784 | 3300049588 | Bacteria | 5332 |
| 708 | Ga0501073_0089874 | 3300049589 | Bacteria | 2135 |
| 709 | Ga0501075_0045488 | 3300049591 | Unclassified | 3294 |
| 710 | Ga0501076_0000391 | 3300049592 | Bacteria | 27401 |
| 711 | Ga0501077_0067030 | 3300049593 | Unclassified | 2277 |
| 712 | Ga0501077_0085943 | 3300049593 | Viruses | 1994 |
| 713 | Ga0501077_0105392 | 3300049593 | Bacteria | 1787 |
| 714 | Ga0501079_0010179 | 3300049741 | Bacteria | 7139 |
| 715 | Ga0501079_0044726 | 3300049741 | Unclassified | 3417 |
| 716 | Ga0501081_0000897 | 3300049743 | Bacteria | 17649 |
| 717 | Ga0501044_0007066 | 3300049823 | Bacteria | 12357 |
| 718 | Ga0501045_0013252 | 3300049824 | Bacteria | 5819 |
| 719 | nmdc:mga05p37_15017_c1 | 3300050507 | Bacteria | 9297 |
| 720 | nmdc:mga05p37_19928_c1 | 3300050507 | Bacteria | 8114 |
| 721 | nmdc:mga05p37_255702_c1 | 3300050507 | Bacteria | 2099 |
| 722 | nmdc:mga05p37_36575_c1 | 3300050507 | Bacteria | 6022 |
| 723 | nmdc:mga05p37_38585_c1 | 3300050507 | Bacteria | 5859 |
| 724 | nmdc:mga05p37_4852_c1 | 3300050507 | Bacteria | 15739 |
| 725 | nmdc:mga05p37_63_c1 | 3300050507 | Bacteria | 93704 |
| 726 | nmdc:mga05p37_7038_c1 | 3300050507 | Bacteria | 13259 |
| 727 | nmdc:mga09592_23759_c1 | 3300050508 | Bacteria | 5064 |
| 728 | nmdc:mga09592_44726_c1 | 3300050508 | Bacteria | 3728 |
| 729 | nmdc:mga09592_50117_c1 | 3300050508 | Bacteria | 3522 |
| 730 | nmdc:mga0qj67_40135_c1 | 3300050509 | Bacteria | 3679 |
| 731 | nmdc:mga0qj67_69153_c1 | 3300050509 | Unclassified | 2816 |
| 732 | nmdc:mga06r32_147533_c1 | 3300050510 | Bacteria | 2330 |
| 733 | nmdc:mga06r32_90284_c1 | 3300050510 | Bacteria | 2993 |
| 734 | nmdc:mga08y16_117986_c1 | 3300050511 | Bacteria | 2762 |
| 735 | nmdc:mga08y16_23879_c1 | 3300050511 | Bacteria | 6457 |
| 736 | nmdc:mga0n895_169877_c1 | 3300050512 | Bacteria | 2213 |
| 737 | nmdc:mga0n895_305443_c1 | 3300050512 | Bacteria | 1613 |
| 738 | nmdc:mga0n895_337116_c1 | 3300050512 | Bacteria | 1528 |
| 739 | nmdc:mga0n895_37920_c1 | 3300050512 | Bacteria | 4666 |
| 740 | nmdc:mga0n895_5153_c1 | 3300050512 | Bacteria | 10870 |
| 741 | nmdc:mga0n895_71855_c1 | 3300050512 | Bacteria | 3432 |
| 742 | nmdc:mga0rr50_7227_c1 | 3300050513 | Bacteria | 6829 |
| 743 | nmdc:mga08x19_19706_c1 | 3300050514 | Bacteria | 3374 |
| 744 | nmdc:mga08x19_4181_c1 | 3300050514 | Bacteria | 8555 |
| 745 | nmdc:mga08x19_58867_c1 | 3300050514 | Bacteria | 2486 |
| 746 | nmdc:mga08x19_821_c1 | 3300050514 | Bacteria | 19741 |
| 747 | nmdc:mga0a205_103410_c1 | 3300050515 | Bacteria | 2747 |
| 748 | nmdc:mga0a205_37934_c1 | 3300050515 | Bacteria | 4634 |
| 749 | nmdc:mga0a205_60067_c1 | 3300050515 | Bacteria | 3672 |
| 750 | nmdc:mga0a205_66011_c1 | 3300050515 | Bacteria | 3497 |
| 751 | nmdc:mga0a205_74913_c1 | 3300050515 | Bacteria | 3270 |
| 752 | Ga0495601_0069765 | 3300053077 | Bacteria | 2242 |
| 753 | Ga0495612_0006570 | 3300053078 | Bacteria | 4769 |
| 754 | Ga0495612_0007500 | 3300053078 | Unclassified | 4458 |
| 755 | Ga0495619_0062559 | 3300053085 | Bacteria | 2478 |
| 756 | Ga0495619_0084023 | 3300053085 | Bacteria | 2148 |
| 757 | Ga0500618_004453 | 3300053125 | Bacteria | 4478 |
| 758 | Ga0501084_0069128 | 3300054114 | Bacteria | 2956 |
| 759 | Ga0501082_0000488 | 3300060353 | Bacteria | 34999 |
| 760 | Ga0501082_0013057 | 3300060353 | Bacteria | 7138 |
| 761 | Ga0466962_0080574 | 3300061719 | Bacteria | 1556 |
| 762 | Ga0530510_0003649 | 3300061734 | Bacteria | 10600 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035171 | Ga0373946_0034870 | Ga0373946_0034870_932_2014 | 351 |
| 2 | 3300006914 | Ga0075436_100069752 | Ga0075436_1000697522 | 357 |
| 3 | 3300009177 | Ga0105248_10021176 | Ga0105248_100211761 | 357 |
| 4 | 3300050514 | nmdc:mga08x19_19706_c1 | nmdc:mga08x19_19706_c1_14_1168 | 361 |
| 5 | 3300045051 | Ga0451576_0053420 | Ga0451576_0053420_2760_3965 | 362 |
| 6 | 3300005440 | Ga0070705_100001028 | Ga0070705_1000010282 | 365 |
| 7 | 3300005536 | Ga0070697_100000305 | Ga0070697_10000030539 | 365 |
| 8 | 3300047321 | Ga0495676_0078798 | Ga0495676_0078798_47_1258 | 368 |
| 9 | 3300007076 | Ga0075435_100018412 | Ga0075435_1000184124 | 370 |
| 10 | 3300009147 | Ga0114129_10003498 | Ga0114129_100034989 | 374 |
| 11 | 3300005445 | Ga0070708_100067561 | Ga0070708_1000675613 | 379 |
| 12 | 3300021388 | Ga0213875_10001405 | Ga0213875_100014052 | 379 |
| 13 | 3300025922 | Ga0207646_10095144 | Ga0207646_100951441 | 379 |
| 14 | 3300035083 | Ga0373926_0025211 | Ga0373926_0025211_204_1418 | 379 |
| 15 | 3300035116 | Ga0373945_0074533 | Ga0373945_0074533_14_1228 | 379 |
| 16 | 3300035725 | Ga0373947_0002800 | Ga0373947_0002800_4865_6079 | 379 |
| 17 | 3300036401 | Ga0373937_0032264 | Ga0373937_0032264_2295_3509 | 379 |
| 18 | 3300044683 | Ga0466965_0017365 | Ga0466965_0017365_2162_3361 | 379 |
| 19 | 3300045836 | Ga0466958_0044785 | Ga0466958_0044785_79_1278 | 379 |
| 20 | 3300046454 | Ga0495592_0040453 | Ga0495592_0040453_1459_2673 | 379 |
| 21 | 3300046516 | Ga0495628_0027714 | Ga0495628_0027714_816_2030 | 379 |
| 22 | 3300046526 | Ga0495666_0008978 | Ga0495666_0008978_3292_4506 | 379 |
| 23 | 3300046529 | Ga0495652_0003676 | Ga0495652_0003676_11632_12846 | 379 |
| 24 | 3300046543 | Ga0495645_0115738 | Ga0495645_0115738_345_1559 | 379 |
| 25 | 3300046559 | Ga0495667_0207014 | Ga0495667_0207014_18_1232 | 379 |
| 26 | 3300047444 | Ga0495675_0029592 | Ga0495675_0029592_1336_2550 | 379 |
| 27 | 3300047471 | Ga0495684_0028481 | Ga0495684_0028481_2071_3285 | 379 |
| 28 | 3300053078 | Ga0495612_0007500 | Ga0495612_0007500_2302_3516 | 379 |
| 29 | 3300009147 | Ga0114129_10058512 | Ga0114129_100585125 | 381 |
| 30 | 3300009147 | Ga0114129_10183819 | Ga0114129_101838192 | 381 |
| 31 | 3300005444 | Ga0070694_100013057 | Ga0070694_1000130573 | 382 |
| 32 | 3300005546 | Ga0070696_100077144 | Ga0070696_1000771443 | 382 |
| 33 | 3300050514 | nmdc:mga08x19_58867_c1 | nmdc:mga08x19_58867_c1_1025_2299 | 382 |
| 34 | 3300053085 | Ga0495619_0062559 | Ga0495619_0062559_102_1370 | 383 |
| 35 | 3300014325 | Ga0163163_10000047 | Ga0163163_1000004782 | 384 |
| 36 | 3300009093 | Ga0105240_10124930 | Ga0105240_101249302 | 387 |
| 37 | 3300005435 | Ga0070714_100002001 | Ga0070714_1000020014 | 388 |
| 38 | 3300005436 | Ga0070713_100001374 | Ga0070713_1000013745 | 388 |
| 39 | 3300025915 | Ga0207693_10051013 | Ga0207693_100510131 | 388 |
| 40 | 3300025928 | Ga0207700_10006602 | Ga0207700_100066026 | 388 |
| 41 | 3300025929 | Ga0207664_10003748 | Ga0207664_100037486 | 388 |
| 42 | 3300035692 | Ga0373935_0014992 | Ga0373935_0014992_15_1199 | 388 |
| 43 | 3300049579 | Ga0501043_0084821 | Ga0501043_0084821_536_1822 | 388 |
| 44 | 3300049823 | Ga0501044_0007066 | Ga0501044_0007066_4383_5669 | 388 |
| 45 | 3300035724 | Ga0373933_0000227 | Ga0373933_0000227_18180_19367 | 389 |
| 46 | 3300036401 | Ga0373937_0000240 | Ga0373937_0000240_42349_43536 | 389 |
| 47 | 3300046462 | Ga0495651_0018236 | Ga0495651_0018236_1291_2478 | 389 |
| 48 | 3300046463 | Ga0495653_0055504 | Ga0495653_0055504_863_2050 | 389 |
| 49 | 3300046529 | Ga0495652_0020627 | Ga0495652_0020627_4242_5429 | 389 |
| 50 | 3300046536 | Ga0495587_0000047 | Ga0495587_0000047_89693_90880 | 389 |
| 51 | 3300046679 | Ga0495623_0006028 | Ga0495623_0006028_6502_7689 | 389 |
| 52 | 3300047317 | Ga0495604_0010957 | Ga0495604_0010957_5268_6455 | 389 |
| 53 | 3300047444 | Ga0495675_0000391 | Ga0495675_0000391_15648_16835 | 389 |
| 54 | 3300048088 | Ga0495602_0001895 | Ga0495602_0001895_18191_19378 | 389 |
| 55 | 3300005467 | Ga0070706_100178163 | Ga0070706_1001781631 | 390 |
| 56 | 3300005468 | Ga0070707_100062025 | Ga0070707_1000620253 | 390 |
| 57 | 3300006852 | Ga0075433_10013848 | Ga0075433_100138485 | 390 |
| 58 | 3300006871 | Ga0075434_100108840 | Ga0075434_1001088402 | 390 |
| 59 | 3300006914 | Ga0075436_100010772 | Ga0075436_1000107727 | 390 |
| 60 | 3300007076 | Ga0075435_100009684 | Ga0075435_1000096843 | 390 |
| 61 | 3300009177 | Ga0105248_10041529 | Ga0105248_100415295 | 390 |
| 62 | 3300014325 | Ga0163163_10022212 | Ga0163163_100222124 | 390 |
| 63 | 3300025939 | Ga0207665_10000446 | Ga0207665_100004469 | 390 |
| 64 | 3300046472 | Ga0495580_0023809 | Ga0495580_0023809_702_1904 | 390 |
| 65 | 3300046678 | Ga0495599_0105941 | Ga0495599_0105941_354_1553 | 390 |
| 66 | 3300047319 | Ga0495674_0004770 | Ga0495674_0004770_8156_9349 | 390 |
| 67 | 3300047319 | Ga0495674_0025522 | Ga0495674_0025522_2847_4049 | 390 |
| 68 | 3300047320 | Ga0495672_0044012 | Ga0495672_0044012_355_1548 | 390 |
| 69 | 3300047321 | Ga0495676_0065128 | Ga0495676_0065128_1521_2729 | 390 |
| 70 | 3300047469 | Ga0495673_0094003 | Ga0495673_0094003_11_1204 | 390 |
| 71 | 3300047472 | Ga0495686_0000044 | Ga0495686_0000044_842_2035 | 390 |
| 72 | 3300048905 | Ga0496102_0003062 | Ga0496102_0003062_8866_10149 | 390 |
| 73 | 3300048907 | Ga0496104_0319566 | Ga0496104_0319566_183_1382 | 390 |
| 74 | 3300048909 | Ga0496106_0008663 | Ga0496106_0008663_2598_3881 | 390 |
| 75 | 3300048915 | Ga0496112_0064216 | Ga0496112_0064216_2293_3576 | 390 |
| 76 | 3300050515 | nmdc:mga0a205_60067_c1 | nmdc:mga0a205_60067_c1_1561_2763 | 390 |
| 77 | 3300005330 | Ga0070690_100019704 | Ga0070690_1000197042 | 391 |
| 78 | 3300005436 | Ga0070713_100138284 | Ga0070713_1001382842 | 391 |
| 79 | 3300005444 | Ga0070694_100001586 | Ga0070694_10000158611 | 391 |
| 80 | 3300005468 | Ga0070707_100077339 | Ga0070707_1000773391 | 391 |
| 81 | 3300005549 | Ga0070704_100010113 | Ga0070704_1000101135 | 391 |
| 82 | 3300005616 | Ga0068852_100315733 | Ga0068852_1003157331 | 391 |
| 83 | 3300005843 | Ga0068860_100234903 | Ga0068860_1002349031 | 391 |
| 84 | 3300009551 | Ga0105238_10274848 | Ga0105238_102748483 | 391 |
| 85 | 3300025918 | Ga0207662_10046360 | Ga0207662_100463602 | 391 |
| 86 | 3300025922 | Ga0207646_10063712 | Ga0207646_100637121 | 391 |
| 87 | 3300026035 | Ga0207703_10141575 | Ga0207703_101415751 | 391 |
| 88 | 3300046679 | Ga0495623_0022900 | Ga0495623_0022900_2536_3741 | 391 |
| 89 | 3300005439 | Ga0070711_100132845 | Ga0070711_1001328451 | 392 |
| 90 | 3300005471 | Ga0070698_100046696 | Ga0070698_1000466962 | 392 |
| 91 | 3300005563 | Ga0068855_100186067 | Ga0068855_1001860672 | 392 |
| 92 | 3300006881 | Ga0068865_100110572 | Ga0068865_1001105721 | 392 |
| 93 | 3300009093 | Ga0105240_10440858 | Ga0105240_104408582 | 392 |
| 94 | 3300009098 | Ga0105245_10024831 | Ga0105245_100248314 | 392 |
| 95 | 3300009176 | Ga0105242_10030630 | Ga0105242_100306302 | 392 |
| 96 | 3300009545 | Ga0105237_10127236 | Ga0105237_101272362 | 392 |
| 97 | 3300010375 | Ga0105239_10174604 | Ga0105239_101746042 | 392 |
| 98 | 3300025934 | Ga0207686_10015070 | Ga0207686_100150703 | 392 |
| 99 | 3300046536 | Ga0495587_0012276 | Ga0495587_0012276_3360_4880 | 392 |
| 100 | 3300005617 | Ga0068859_100123472 | Ga0068859_1001234722 | 393 |
| 101 | 3300006931 | Ga0097620_100123473 | Ga0097620_1001234732 | 393 |
| 102 | 3300005290 | Ga0065712_10076179 | Ga0065712_100761793 | 394 |
| 103 | 3300005406 | Ga0070703_10004669 | Ga0070703_100046694 | 394 |
| 104 | 3300005434 | Ga0070709_10011363 | Ga0070709_100113633 | 394 |
| 105 | 3300005458 | Ga0070681_10155948 | Ga0070681_101559481 | 394 |
| 106 | 3300005518 | Ga0070699_100017210 | Ga0070699_1000172103 | 394 |
| 107 | 3300005530 | Ga0070679_100034298 | Ga0070679_1000342982 | 394 |
| 108 | 3300005547 | Ga0070693_100000798 | Ga0070693_1000007985 | 394 |
| 109 | 3300005843 | Ga0068860_100005909 | Ga0068860_1000059097 | 394 |
| 110 | 3300007265 | Ga0099794_10035351 | Ga0099794_100353512 | 394 |
| 111 | 3300013297 | Ga0157378_10000079 | Ga0157378_100000799 | 394 |
| 112 | 3300025885 | Ga0207653_10000919 | Ga0207653_100009194 | 394 |
| 113 | 3300025906 | Ga0207699_10018008 | Ga0207699_100180083 | 394 |
| 114 | 3300025921 | Ga0207652_10024189 | Ga0207652_100241894 | 394 |
| 115 | 3300027671 | Ga0209588_1005949 | Ga0209588_10059493 | 394 |
| 116 | 3300028381 | Ga0268264_10007581 | Ga0268264_100075813 | 394 |
| 117 | 3300039437 | Ga0436365_0677203 | Ga0436365_0677203_106_1320 | 394 |
| 118 | 3300049593 | Ga0501077_0105392 | Ga0501077_0105392_379_1635 | 394 |
| 119 | 3300005436 | Ga0070713_100008885 | Ga0070713_1000088853 | 395 |
| 120 | 3300005536 | Ga0070697_100178992 | Ga0070697_1001789921 | 395 |
| 121 | 3300025928 | Ga0207700_10028431 | Ga0207700_100284311 | 395 |
| 122 | 3300048914 | Ga0496111_0225854 | Ga0496111_0225854_45_1349 | 395 |
| 123 | 3300025906 | Ga0207699_10119836 | Ga0207699_101198362 | 396 |
| 124 | 3300050512 | nmdc:mga0n895_169877_c1 | nmdc:mga0n895_169877_c1_266_1558 | 396 |
| 125 | 3300050513 | nmdc:mga0rr50_7227_c1 | nmdc:mga0rr50_7227_c1_5145_6437 | 396 |
| 126 | 3300050515 | nmdc:mga0a205_66011_c1 | nmdc:mga0a205_66011_c1_1958_3250 | 396 |
| 127 | 3300006914 | Ga0075436_100000811 | Ga0075436_1000008114 | 397 |
| 128 | 3300035083 | Ga0373926_0002254 | Ga0373926_0002254_4703_6025 | 397 |
| 129 | 3300035695 | Ga0373927_0004727 | Ga0373927_0004727_50_1372 | 397 |
| 130 | 3300035725 | Ga0373947_0001695 | Ga0373947_0001695_4069_5391 | 397 |
| 131 | 3300037068 | Ga0373925_0000333 | Ga0373925_0000333_33065_34387 | 397 |
| 132 | 3300046526 | Ga0495666_0024222 | Ga0495666_0024222_1368_2690 | 397 |
| 133 | 3300050514 | nmdc:mga08x19_821_c1 | nmdc:mga08x19_821_c1_14773_16086 | 397 |
| 134 | 3300027671 | Ga0209588_1004195 | Ga0209588_10041953 | 398 |
| 135 | 3300046457 | Ga0495590_0020130 | Ga0495590_0020130_1030_2328 | 398 |
| 136 | 3300046507 | Ga0495606_0007390 | Ga0495606_0007390_731_2029 | 398 |
| 137 | 3300046694 | Ga0495649_0023007 | Ga0495649_0023007_737_2035 | 398 |
| 138 | 3300047323 | Ga0495683_0004889 | Ga0495683_0004889_1002_2300 | 398 |
| 139 | 3300047443 | Ga0495687_005731 | Ga0495687_005731_94_1392 | 398 |
| 140 | 3300048091 | Ga0495626_0007870 | Ga0495626_0007870_1187_2485 | 398 |
| 141 | 3300048917 | Ga0496114_0079448 | Ga0496114_0079448_1289_2572 | 398 |
| 142 | 3300005436 | Ga0070713_100229197 | Ga0070713_1002291972 | 399 |
| 143 | 3300005548 | Ga0070665_100364154 | Ga0070665_1003641541 | 400 |
| 144 | 3300005842 | Ga0068858_100281339 | Ga0068858_1002813392 | 400 |
| 145 | 3300013306 | Ga0163162_10029511 | Ga0163162_100295114 | 400 |
| 146 | 3300014325 | Ga0163163_10000101 | Ga0163163_1000010137 | 400 |
| 147 | 3300014968 | Ga0157379_10040262 | Ga0157379_100402624 | 400 |
| 148 | 3300026118 | Ga0207675_100015359 | Ga0207675_1000153596 | 400 |
| 149 | 3300030878 | Ga0265770_1003354 | Ga0265770_10033542 | 400 |
| 150 | 3300006028 | Ga0070717_10048482 | Ga0070717_100484823 | 401 |
| 151 | 3300037418 | Ga0395900_0000182 | Ga0395900_0000182_65394_66683 | 401 |
| 152 | 3300042876 | Ga0451577_0188750 | Ga0451577_0188750_408_1688 | 401 |
| 153 | 3300050507 | nmdc:mga05p37_4852_c1 | nmdc:mga05p37_4852_c1_1789_3114 | 401 |
| 154 | 3300005336 | Ga0070680_100025148 | Ga0070680_1000251485 | 402 |
| 155 | 3300005344 | Ga0070661_100115516 | Ga0070661_1001155162 | 402 |
| 156 | 3300005530 | Ga0070679_100194382 | Ga0070679_1001943822 | 402 |
| 157 | 3300005563 | Ga0068855_100016245 | Ga0068855_1000162452 | 402 |
| 158 | 3300013104 | Ga0157370_10005536 | Ga0157370_1000553614 | 402 |
| 159 | 3300013105 | Ga0157369_10073539 | Ga0157369_100735392 | 402 |
| 160 | 3300013306 | Ga0163162_10010349 | Ga0163162_100103492 | 402 |
| 161 | 3300013308 | Ga0157375_10208658 | Ga0157375_102086582 | 402 |
| 162 | 3300025917 | Ga0207660_10061796 | Ga0207660_100617962 | 402 |
| 163 | 3300025921 | Ga0207652_10151495 | Ga0207652_101514952 | 402 |
| 164 | 3300025949 | Ga0207667_10148000 | Ga0207667_101480002 | 402 |
| 165 | 3300026088 | Ga0207641_10000723 | Ga0207641_1000072324 | 402 |
| 166 | 3300026142 | Ga0207698_10051502 | Ga0207698_100515023 | 402 |
| 167 | 3300005329 | Ga0070683_100023872 | Ga0070683_1000238722 | 403 |
| 168 | 3300005353 | Ga0070669_100002938 | Ga0070669_1000029381 | 403 |
| 169 | 3300005406 | Ga0070703_10001024 | Ga0070703_100010244 | 403 |
| 170 | 3300005467 | Ga0070706_100000362 | Ga0070706_1000003624 | 403 |
| 171 | 3300005518 | Ga0070699_100147787 | Ga0070699_1001477871 | 403 |
| 172 | 3300005535 | Ga0070684_100163961 | Ga0070684_1001639612 | 403 |
| 173 | 3300005545 | Ga0070695_100059265 | Ga0070695_1000592653 | 403 |
| 174 | 3300005546 | Ga0070696_100004313 | Ga0070696_1000043139 | 403 |
| 175 | 3300005547 | Ga0070693_100022346 | Ga0070693_1000223462 | 403 |
| 176 | 3300005844 | Ga0068862_100021601 | Ga0068862_1000216014 | 403 |
| 177 | 3300006852 | Ga0075433_10017057 | Ga0075433_100170576 | 403 |
| 178 | 3300009147 | Ga0114129_10015399 | Ga0114129_100153999 | 403 |
| 179 | 3300009147 | Ga0114129_10078754 | Ga0114129_100787543 | 403 |
| 180 | 3300013307 | Ga0157372_10130364 | Ga0157372_101303643 | 403 |
| 181 | 3300014969 | Ga0157376_10231726 | Ga0157376_102317262 | 403 |
| 182 | 3300025885 | Ga0207653_10000124 | Ga0207653_100001244 | 403 |
| 183 | 3300025910 | Ga0207684_10000442 | Ga0207684_1000044237 | 403 |
| 184 | 3300025923 | Ga0207681_10008789 | Ga0207681_100087892 | 403 |
| 185 | 3300025944 | Ga0207661_10024906 | Ga0207661_100249062 | 403 |
| 186 | 3300028016 | Ga0265354_1000043 | Ga0265354_10000438 | 403 |
| 187 | 3300028016 | Ga0265354_1001146 | Ga0265354_10011463 | 403 |
| 188 | 3300031090 | Ga0265760_10006990 | Ga0265760_100069902 | 403 |
| 189 | 3300035111 | Ga0373923_0009739 | Ga0373923_0009739_1509_2819 | 403 |
| 190 | 3300035118 | Ga0373954_0041072 | Ga0373954_0041072_421_1731 | 403 |
| 191 | 3300039437 | Ga0436365_0468904 | Ga0436365_0468904_596_1897 | 403 |
| 192 | 3300046462 | Ga0495651_0022576 | Ga0495651_0022576_1258_2568 | 403 |
| 193 | 3300046463 | Ga0495653_0007545 | Ga0495653_0007545_5511_6821 | 403 |
| 194 | 3300046472 | Ga0495580_0003744 | Ga0495580_0003744_3162_4472 | 403 |
| 195 | 3300046511 | Ga0495608_0019206 | Ga0495608_0019206_1289_2599 | 403 |
| 196 | 3300046536 | Ga0495587_0019460 | Ga0495587_0019460_2651_3940 | 403 |
| 197 | 3300046663 | Ga0495635_0083748 | Ga0495635_0083748_662_1972 | 403 |
| 198 | 3300046679 | Ga0495623_0001700 | Ga0495623_0001700_11370_12680 | 403 |
| 199 | 3300046680 | Ga0495646_0004591 | Ga0495646_0004591_4164_5474 | 403 |
| 200 | 3300046689 | Ga0495613_0006482 | Ga0495613_0006482_6838_8148 | 403 |
| 201 | 3300046809 | Ga0495600_0066366 | Ga0495600_0066366_322_1632 | 403 |
| 202 | 3300047317 | Ga0495604_0132720 | Ga0495604_0132720_103_1371 | 403 |
| 203 | 3300047471 | Ga0495684_0028702 | Ga0495684_0028702_1938_3227 | 403 |
| 204 | 3300048089 | Ga0495614_0014032 | Ga0495614_0014032_2073_3383 | 403 |
| 205 | 3300050507 | nmdc:mga05p37_15017_c1 | nmdc:mga05p37_15017_c1_4752_6038 | 403 |
| 206 | 3300050507 | nmdc:mga05p37_38585_c1 | nmdc:mga05p37_38585_c1_869_2158 | 403 |
| 207 | 3300005328 | Ga0070676_10070552 | Ga0070676_100705522 | 404 |
| 208 | 3300046683 | Ga0495658_0058449 | Ga0495658_0058449_618_1934 | 404 |
| 209 | 3300048929 | Ga0496126_0037401 | Ga0496126_0037401_1213_2466 | 404 |
| 210 | 3300060353 | Ga0501082_0000488 | Ga0501082_0000488_30880_32130 | 404 |
| 211 | 3300021358 | Ga0213873_10006154 | Ga0213873_100061542 | 405 |
| 212 | 3300021377 | Ga0213874_10002560 | Ga0213874_100025602 | 405 |
| 213 | 3300031711 | Ga0265314_10017073 | Ga0265314_100170733 | 405 |
| 214 | 3300039450 | Ga0436363_0212799 | Ga0436363_0212799_1630_2928 | 405 |
| 215 | 3300039453 | Ga0436362_0596821 | Ga0436362_0596821_6468_7766 | 405 |
| 216 | 3300005445 | Ga0070708_100005140 | Ga0070708_1000051404 | 406 |
| 217 | 3300005467 | Ga0070706_100001465 | Ga0070706_1000014659 | 406 |
| 218 | 3300005468 | Ga0070707_100003882 | Ga0070707_1000038822 | 406 |
| 219 | 3300005518 | Ga0070699_100015327 | Ga0070699_1000153274 | 406 |
| 220 | 3300005536 | Ga0070697_100005223 | Ga0070697_1000052234 | 406 |
| 221 | 3300006237 | Ga0097621_100186399 | Ga0097621_1001863992 | 406 |
| 222 | 3300013105 | Ga0157369_10001300 | Ga0157369_100013008 | 406 |
| 223 | 3300025922 | Ga0207646_10002300 | Ga0207646_1000230012 | 406 |
| 224 | 3300048929 | Ga0496126_0027282 | Ga0496126_0027282_3700_5031 | 407 |
| 225 | 3300005471 | Ga0070698_100119334 | Ga0070698_1001193343 | 408 |
| 226 | 3300035170 | Ga0373943_0015459 | Ga0373943_0015459_191_1456 | 408 |
| 227 | 3300038996 | Ga0242420_001054 | Ga0242420_001054_50_1336 | 408 |
| 228 | 3300025941 | Ga0207711_10111927 | Ga0207711_101119272 | 409 |
| 229 | 3300044656 | Ga0466969_0001860 | Ga0466969_0001860_2762_4060 | 409 |
| 230 | 3300044659 | Ga0466973_0050677 | Ga0466973_0050677_1067_2374 | 409 |
| 231 | 3300044684 | Ga0466966_0111242 | Ga0466966_0111242_282_1580 | 409 |
| 232 | 3300044693 | Ga0466961_0000909 | Ga0466961_0000909_2446_3753 | 409 |
| 233 | 3300044719 | Ga0466971_0002450 | Ga0466971_0002450_5063_6361 | 409 |
| 234 | 3300061719 | Ga0466962_0080574 | Ga0466962_0080574_221_1519 | 409 |
| 235 | 3300005548 | Ga0070665_100007584 | Ga0070665_1000075846 | 411 |
| 236 | 3300005843 | Ga0068860_100044060 | Ga0068860_1000440602 | 411 |
| 237 | 3300005843 | Ga0068860_100048411 | Ga0068860_1000484112 | 411 |
| 238 | 3300013297 | Ga0157378_10114191 | Ga0157378_101141911 | 411 |
| 239 | 3300025910 | Ga0207684_10182475 | Ga0207684_101824752 | 411 |
| 240 | 3300025927 | Ga0207687_10074402 | Ga0207687_100744022 | 411 |
| 241 | 3300025934 | Ga0207686_10008223 | Ga0207686_100082232 | 411 |
| 242 | 3300025960 | Ga0207651_10038202 | Ga0207651_100382022 | 411 |
| 243 | 3300026089 | Ga0207648_10023733 | Ga0207648_100237336 | 411 |
| 244 | 3300035695 | Ga0373927_0122795 | Ga0373927_0122795_101_1366 | 411 |
| 245 | 3300035725 | Ga0373947_0002695 | Ga0373947_0002695_8418_9683 | 411 |
| 246 | 3300037068 | Ga0373925_0045977 | Ga0373925_0045977_116_1381 | 411 |
| 247 | 3300046683 | Ga0495658_0024701 | Ga0495658_0024701_310_1575 | 411 |
| 248 | 3300048089 | Ga0495614_0015854 | Ga0495614_0015854_2001_3266 | 411 |
| 249 | 3300049581 | Ga0501047_0015566 | Ga0501047_0015566_4976_6262 | 411 |
| 250 | 3300025928 | Ga0207700_10030446 | Ga0207700_100304462 | 412 |
| 251 | 3300033179 | Ga0307507_10074086 | Ga0307507_100740863 | 412 |
| 252 | 3300005290 | Ga0065712_10003618 | Ga0065712_100036183 | 413 |
| 253 | 3300005295 | Ga0065707_10091837 | Ga0065707_100918372 | 413 |
| 254 | 3300005329 | Ga0070683_100008500 | Ga0070683_1000085003 | 413 |
| 255 | 3300005330 | Ga0070690_100163605 | Ga0070690_1001636051 | 413 |
| 256 | 3300005334 | Ga0068869_100007437 | Ga0068869_1000074371 | 413 |
| 257 | 3300005364 | Ga0070673_100199476 | Ga0070673_1001994762 | 413 |
| 258 | 3300005365 | Ga0070688_100126505 | Ga0070688_1001265052 | 413 |
| 259 | 3300005365 | Ga0070688_100137117 | Ga0070688_1001371171 | 413 |
| 260 | 3300005367 | Ga0070667_100253230 | Ga0070667_1002532301 | 413 |
| 261 | 3300005406 | Ga0070703_10000049 | Ga0070703_1000004938 | 413 |
| 262 | 3300005440 | Ga0070705_100089558 | Ga0070705_1000895582 | 413 |
| 263 | 3300005441 | Ga0070700_100002653 | Ga0070700_1000026539 | 413 |
| 264 | 3300005444 | Ga0070694_100001951 | Ga0070694_1000019517 | 413 |
| 265 | 3300005445 | Ga0070708_100064998 | Ga0070708_1000649982 | 413 |
| 266 | 3300005468 | Ga0070707_100003580 | Ga0070707_10000358011 | 413 |
| 267 | 3300005471 | Ga0070698_100001898 | Ga0070698_1000018982 | 413 |
| 268 | 3300005518 | Ga0070699_100000008 | Ga0070699_10000000835 | 413 |
| 269 | 3300005546 | Ga0070696_100000596 | Ga0070696_10000059613 | 413 |
| 270 | 3300005547 | Ga0070693_100117515 | Ga0070693_1001175151 | 413 |
| 271 | 3300005563 | Ga0068855_100036469 | Ga0068855_1000364692 | 413 |
| 272 | 3300005615 | Ga0070702_100071841 | Ga0070702_1000718411 | 413 |
| 273 | 3300005617 | Ga0068859_100007260 | Ga0068859_10000726010 | 413 |
| 274 | 3300005617 | Ga0068859_100170430 | Ga0068859_1001704303 | 413 |
| 275 | 3300005617 | Ga0068859_100252925 | Ga0068859_1002529252 | 413 |
| 276 | 3300005618 | Ga0068864_100056456 | Ga0068864_1000564562 | 413 |
| 277 | 3300005719 | Ga0068861_100044233 | Ga0068861_1000442331 | 413 |
| 278 | 3300005719 | Ga0068861_100124501 | Ga0068861_1001245012 | 413 |
| 279 | 3300005719 | Ga0068861_100162661 | Ga0068861_1001626612 | 413 |
| 280 | 3300005841 | Ga0068863_100196788 | Ga0068863_1001967882 | 413 |
| 281 | 3300005841 | Ga0068863_100218804 | Ga0068863_1002188041 | 413 |
| 282 | 3300005842 | Ga0068858_100163775 | Ga0068858_1001637752 | 413 |
| 283 | 3300005842 | Ga0068858_100182384 | Ga0068858_1001823842 | 413 |
| 284 | 3300005843 | Ga0068860_100034333 | Ga0068860_1000343332 | 413 |
| 285 | 3300005843 | Ga0068860_100294136 | Ga0068860_1002941362 | 413 |
| 286 | 3300005844 | Ga0068862_100267418 | Ga0068862_1002674182 | 413 |
| 287 | 3300006237 | Ga0097621_100017484 | Ga0097621_1000174842 | 413 |
| 288 | 3300006844 | Ga0075428_100062444 | Ga0075428_1000624443 | 413 |
| 289 | 3300006880 | Ga0075429_100047943 | Ga0075429_1000479433 | 413 |
| 290 | 3300006880 | Ga0075429_100181821 | Ga0075429_1001818212 | 413 |
| 291 | 3300006881 | Ga0068865_100056892 | Ga0068865_1000568922 | 413 |
| 292 | 3300006931 | Ga0097620_100007260 | Ga0097620_10000726010 | 413 |
| 293 | 3300006931 | Ga0097620_100170432 | Ga0097620_1001704321 | 413 |
| 294 | 3300006931 | Ga0097620_100252918 | Ga0097620_1002529182 | 413 |
| 295 | 3300007265 | Ga0099794_10002659 | Ga0099794_100026597 | 413 |
| 296 | 3300009093 | Ga0105240_10001298 | Ga0105240_100012986 | 413 |
| 297 | 3300009093 | Ga0105240_10001445 | Ga0105240_1000144515 | 413 |
| 298 | 3300009094 | Ga0111539_10019829 | Ga0111539_100198294 | 413 |
| 299 | 3300009147 | Ga0114129_10000925 | Ga0114129_1000092527 | 413 |
| 300 | 3300009148 | Ga0105243_10000124 | Ga0105243_1000012454 | 413 |
| 301 | 3300009148 | Ga0105243_10000774 | Ga0105243_1000077421 | 413 |
| 302 | 3300009148 | Ga0105243_10045386 | Ga0105243_100453862 | 413 |
| 303 | 3300009176 | Ga0105242_10000021 | Ga0105242_1000002189 | 413 |
| 304 | 3300009176 | Ga0105242_10000935 | Ga0105242_1000093517 | 413 |
| 305 | 3300009176 | Ga0105242_10012931 | Ga0105242_100129314 | 413 |
| 306 | 3300009176 | Ga0105242_10017345 | Ga0105242_100173452 | 413 |
| 307 | 3300009176 | Ga0105242_10098592 | Ga0105242_100985922 | 413 |
| 308 | 3300009177 | Ga0105248_10017559 | Ga0105248_100175591 | 413 |
| 309 | 3300009553 | Ga0105249_10074475 | Ga0105249_100744751 | 413 |
| 310 | 3300010375 | Ga0105239_10002786 | Ga0105239_1000278617 | 413 |
| 311 | 3300010375 | Ga0105239_10182057 | Ga0105239_101820571 | 413 |
| 312 | 3300011119 | Ga0105246_10209678 | Ga0105246_102096781 | 413 |
| 313 | 3300013296 | Ga0157374_10094087 | Ga0157374_100940871 | 413 |
| 314 | 3300013297 | Ga0157378_10000501 | Ga0157378_1000050128 | 413 |
| 315 | 3300013297 | Ga0157378_10012555 | Ga0157378_100125555 | 413 |
| 316 | 3300013297 | Ga0157378_10107760 | Ga0157378_101077603 | 413 |
| 317 | 3300013306 | Ga0163162_10012392 | Ga0163162_100123922 | 413 |
| 318 | 3300013308 | Ga0157375_10020205 | Ga0157375_100202054 | 413 |
| 319 | 3300013308 | Ga0157375_10127129 | Ga0157375_101271292 | 413 |
| 320 | 3300014325 | Ga0163163_10082478 | Ga0163163_100824783 | 413 |
| 321 | 3300014969 | Ga0157376_10019370 | Ga0157376_100193704 | 413 |
| 322 | 3300017792 | Ga0163161_10139344 | Ga0163161_101393442 | 413 |
| 323 | 3300025885 | Ga0207653_10000163 | Ga0207653_1000016311 | 413 |
| 324 | 3300025910 | Ga0207684_10323754 | Ga0207684_103237541 | 413 |
| 325 | 3300025913 | Ga0207695_10007981 | Ga0207695_100079817 | 413 |
| 326 | 3300025913 | Ga0207695_10010169 | Ga0207695_100101696 | 413 |
| 327 | 3300025918 | Ga0207662_10033371 | Ga0207662_100333712 | 413 |
| 328 | 3300025923 | Ga0207681_10107111 | Ga0207681_101071112 | 413 |
| 329 | 3300025926 | Ga0207659_10104582 | Ga0207659_101045821 | 413 |
| 330 | 3300025931 | Ga0207644_10182767 | Ga0207644_101827672 | 413 |
| 331 | 3300025934 | Ga0207686_10000003 | Ga0207686_10000003132 | 413 |
| 332 | 3300025934 | Ga0207686_10000104 | Ga0207686_1000010458 | 413 |
| 333 | 3300025934 | Ga0207686_10001552 | Ga0207686_100015525 | 413 |
| 334 | 3300025934 | Ga0207686_10067942 | Ga0207686_100679422 | 413 |
| 335 | 3300025934 | Ga0207686_10152886 | Ga0207686_101528861 | 413 |
| 336 | 3300025935 | Ga0207709_10000017 | Ga0207709_10000017191 | 413 |
| 337 | 3300025935 | Ga0207709_10002329 | Ga0207709_100023291 | 413 |
| 338 | 3300025938 | Ga0207704_10189362 | Ga0207704_101893621 | 413 |
| 339 | 3300025940 | Ga0207691_10010629 | Ga0207691_100106292 | 413 |
| 340 | 3300025941 | Ga0207711_10262015 | Ga0207711_102620152 | 413 |
| 341 | 3300025942 | Ga0207689_10243309 | Ga0207689_102433091 | 413 |
| 342 | 3300025949 | Ga0207667_10018249 | Ga0207667_100182495 | 413 |
| 343 | 3300026035 | Ga0207703_10025946 | Ga0207703_100259462 | 413 |
| 344 | 3300026089 | Ga0207648_10043244 | Ga0207648_100432442 | 413 |
| 345 | 3300026118 | Ga0207675_100000940 | Ga0207675_1000009403 | 413 |
| 346 | 3300026118 | Ga0207675_100153525 | Ga0207675_1001535252 | 413 |
| 347 | 3300027907 | Ga0207428_10002796 | Ga0207428_1000279610 | 413 |
| 348 | 3300028381 | Ga0268264_10032400 | Ga0268264_100324005 | 413 |
| 349 | 3300028381 | Ga0268264_10332623 | Ga0268264_103326231 | 413 |
| 350 | 3300035086 | Ga0373934_0000654 | Ga0373934_0000654_9480_10763 | 413 |
| 351 | 3300035117 | Ga0373953_0001383 | Ga0373953_0001383_2469_3752 | 413 |
| 352 | 3300035724 | Ga0373933_0000909 | Ga0373933_0000909_4484_5767 | 413 |
| 353 | 3300036401 | Ga0373937_0000567 | Ga0373937_0000567_25528_26811 | 413 |
| 354 | 3300046462 | Ga0495651_0082982 | Ga0495651_0082982_356_1639 | 413 |
| 355 | 3300046684 | Ga0495669_0088535 | Ga0495669_0088535_78_1358 | 413 |
| 356 | 3300048909 | Ga0496106_0003186 | Ga0496106_0003186_503_1783 | 413 |
| 357 | 3300050507 | nmdc:mga05p37_36575_c1 | nmdc:mga05p37_36575_c1_4665_5945 | 413 |
| 358 | 3300050507 | nmdc:mga05p37_63_c1 | nmdc:mga05p37_63_c1_47975_49282 | 413 |
| 359 | 3300050512 | nmdc:mga0n895_305443_c1 | nmdc:mga0n895_305443_c1_182_1462 | 413 |
| 360 | 3300050512 | nmdc:mga0n895_37920_c1 | nmdc:mga0n895_37920_c1_2304_3590 | 413 |
| 361 | 3300050515 | nmdc:mga0a205_37934_c1 | nmdc:mga0a205_37934_c1_1959_3245 | 413 |
| 362 | 3300005335 | Ga0070666_10002012 | Ga0070666_100020125 | 414 |
| 363 | 3300005355 | Ga0070671_100013692 | Ga0070671_1000136925 | 414 |
| 364 | 3300005367 | Ga0070667_100003123 | Ga0070667_10000312311 | 414 |
| 365 | 3300005367 | Ga0070667_100024918 | Ga0070667_1000249182 | 414 |
| 366 | 3300005458 | Ga0070681_10001478 | Ga0070681_1000147816 | 414 |
| 367 | 3300005530 | Ga0070679_100252259 | Ga0070679_1002522592 | 414 |
| 368 | 3300005543 | Ga0070672_100008309 | Ga0070672_1000083094 | 414 |
| 369 | 3300005544 | Ga0070686_100037279 | Ga0070686_1000372791 | 414 |
| 370 | 3300005577 | Ga0068857_100002930 | Ga0068857_1000029306 | 414 |
| 371 | 3300005614 | Ga0068856_100093690 | Ga0068856_1000936903 | 414 |
| 372 | 3300005617 | Ga0068859_100044597 | Ga0068859_1000445973 | 414 |
| 373 | 3300005841 | Ga0068863_100213001 | Ga0068863_1002130011 | 414 |
| 374 | 3300005842 | Ga0068858_100013552 | Ga0068858_1000135523 | 414 |
| 375 | 3300005843 | Ga0068860_100005182 | Ga0068860_1000051824 | 414 |
| 376 | 3300005843 | Ga0068860_100081363 | Ga0068860_1000813632 | 414 |
| 377 | 3300006028 | Ga0070717_10252026 | Ga0070717_102520262 | 414 |
| 378 | 3300006237 | Ga0097621_100033449 | Ga0097621_1000334492 | 414 |
| 379 | 3300006358 | Ga0068871_100026641 | Ga0068871_1000266412 | 414 |
| 380 | 3300006931 | Ga0097620_100044597 | Ga0097620_1000445972 | 414 |
| 381 | 3300009176 | Ga0105242_10110482 | Ga0105242_101104822 | 414 |
| 382 | 3300009177 | Ga0105248_10011112 | Ga0105248_100111122 | 414 |
| 383 | 3300009177 | Ga0105248_10041341 | Ga0105248_100413415 | 414 |
| 384 | 3300009177 | Ga0105248_10170718 | Ga0105248_101707183 | 414 |
| 385 | 3300010375 | Ga0105239_10129624 | Ga0105239_101296243 | 414 |
| 386 | 3300013105 | Ga0157369_10230260 | Ga0157369_102302602 | 414 |
| 387 | 3300013297 | Ga0157378_10215748 | Ga0157378_102157481 | 414 |
| 388 | 3300013306 | Ga0163162_10011765 | Ga0163162_100117654 | 414 |
| 389 | 3300014969 | Ga0157376_10008124 | Ga0157376_100081244 | 414 |
| 390 | 3300025903 | Ga0207680_10001086 | Ga0207680_100010867 | 414 |
| 391 | 3300025912 | Ga0207707_10022484 | Ga0207707_100224842 | 414 |
| 392 | 3300025924 | Ga0207694_10008231 | Ga0207694_100082313 | 414 |
| 393 | 3300025927 | Ga0207687_10145125 | Ga0207687_101451252 | 414 |
| 394 | 3300025928 | Ga0207700_10052573 | Ga0207700_100525733 | 414 |
| 395 | 3300025931 | Ga0207644_10072837 | Ga0207644_100728372 | 414 |
| 396 | 3300025934 | Ga0207686_10002559 | Ga0207686_100025593 | 414 |
| 397 | 3300025934 | Ga0207686_10052129 | Ga0207686_100521292 | 414 |
| 398 | 3300025936 | Ga0207670_10074034 | Ga0207670_100740342 | 414 |
| 399 | 3300025938 | Ga0207704_10032859 | Ga0207704_100328592 | 414 |
| 400 | 3300025940 | Ga0207691_10003222 | Ga0207691_100032228 | 414 |
| 401 | 3300025941 | Ga0207711_10007153 | Ga0207711_100071533 | 414 |
| 402 | 3300025941 | Ga0207711_10065826 | Ga0207711_100658262 | 414 |
| 403 | 3300026035 | Ga0207703_10067928 | Ga0207703_100679282 | 414 |
| 404 | 3300026088 | Ga0207641_10200823 | Ga0207641_102008232 | 414 |
| 405 | 3300028381 | Ga0268264_10002348 | Ga0268264_100023486 | 414 |
| 406 | 3300028381 | Ga0268264_10059477 | Ga0268264_100594772 | 414 |
| 407 | 3300031711 | Ga0265314_10063593 | Ga0265314_100635932 | 414 |
| 408 | 3300035172 | Ga0373955_0124624 | Ga0373955_0124624_190_1467 | 414 |
| 409 | 3300035695 | Ga0373927_0054497 | Ga0373927_0054497_738_2015 | 414 |
| 410 | 3300036401 | Ga0373937_0013012 | Ga0373937_0013012_5899_7203 | 414 |
| 411 | 3300036401 | Ga0373937_0077330 | Ga0373937_0077330_1786_3063 | 414 |
| 412 | 3300036401 | Ga0373937_0282214 | Ga0373937_0282214_145_1452 | 414 |
| 413 | 3300039453 | Ga0436362_0493363 | Ga0436362_0493363_7041_8345 | 414 |
| 414 | 3300046454 | Ga0495592_0048846 | Ga0495592_0048846_354_1661 | 414 |
| 415 | 3300046535 | Ga0495586_0050111 | Ga0495586_0050111_646_1920 | 414 |
| 416 | 3300048918 | Ga0496115_0052127 | Ga0496115_0052127_295_1596 | 414 |
| 417 | 3300048929 | Ga0496126_0015907 | Ga0496126_0015907_6139_7440 | 414 |
| 418 | 3300050507 | nmdc:mga05p37_255702_c1 | nmdc:mga05p37_255702_c1_196_1470 | 414 |
| 419 | 3300005335 | Ga0070666_10062670 | Ga0070666_100626701 | 415 |
| 420 | 3300005355 | Ga0070671_100020610 | Ga0070671_1000206106 | 415 |
| 421 | 3300005842 | Ga0068858_100021406 | Ga0068858_1000214062 | 415 |
| 422 | 3300009176 | Ga0105242_10192920 | Ga0105242_101929201 | 415 |
| 423 | 3300009177 | Ga0105248_10013288 | Ga0105248_100132884 | 415 |
| 424 | 3300014968 | Ga0157379_10006540 | Ga0157379_100065403 | 415 |
| 425 | 3300025900 | Ga0207710_10035426 | Ga0207710_100354262 | 415 |
| 426 | 3300025903 | Ga0207680_10097380 | Ga0207680_100973802 | 415 |
| 427 | 3300025934 | Ga0207686_10131035 | Ga0207686_101310352 | 415 |
| 428 | 3300025940 | Ga0207691_10010360 | Ga0207691_100103609 | 415 |
| 429 | 3300025986 | Ga0207658_10074573 | Ga0207658_100745732 | 415 |
| 430 | 3300026035 | Ga0207703_10038380 | Ga0207703_100383803 | 415 |
| 431 | 3300026088 | Ga0207641_10157923 | Ga0207641_101579232 | 415 |
| 432 | 3300044842 | Ga0466957_0095388 | Ga0466957_0095388_367_1683 | 415 |
| 433 | 3300046459 | Ga0495629_0053243 | Ga0495629_0053243_237_1556 | 415 |
| 434 | 3300046507 | Ga0495606_0008777 | Ga0495606_0008777_3997_5316 | 415 |
| 435 | 3300046663 | Ga0495635_0023070 | Ga0495635_0023070_1076_2395 | 415 |
| 436 | 3300046690 | Ga0495624_0031579 | Ga0495624_0031579_523_1842 | 415 |
| 437 | 3300047319 | Ga0495674_0047178 | Ga0495674_0047178_2238_3557 | 415 |
| 438 | 3300048917 | Ga0496114_0077316 | Ga0496114_0077316_662_1981 | 415 |
| 439 | 3300050507 | nmdc:mga05p37_7038_c1 | nmdc:mga05p37_7038_c1_2877_4172 | 415 |
| 440 | 3300005365 | Ga0070688_100010104 | Ga0070688_1000101043 | 416 |
| 441 | 3300005365 | Ga0070688_100154097 | Ga0070688_1001540972 | 416 |
| 442 | 3300005440 | Ga0070705_100075087 | Ga0070705_1000750871 | 416 |
| 443 | 3300005458 | Ga0070681_10022150 | Ga0070681_100221505 | 416 |
| 444 | 3300005468 | Ga0070707_100006238 | Ga0070707_1000062383 | 416 |
| 445 | 3300005536 | Ga0070697_100101790 | Ga0070697_1001017902 | 416 |
| 446 | 3300005536 | Ga0070697_100179847 | Ga0070697_1001798472 | 416 |
| 447 | 3300005547 | Ga0070693_100011994 | Ga0070693_1000119943 | 416 |
| 448 | 3300005618 | Ga0068864_100246621 | Ga0068864_1002466211 | 416 |
| 449 | 3300006844 | Ga0075428_100066521 | Ga0075428_1000665214 | 416 |
| 450 | 3300006847 | Ga0075431_100031011 | Ga0075431_1000310114 | 416 |
| 451 | 3300006852 | Ga0075433_10049585 | Ga0075433_100495854 | 416 |
| 452 | 3300006852 | Ga0075433_10066634 | Ga0075433_100666342 | 416 |
| 453 | 3300006852 | Ga0075433_10081231 | Ga0075433_100812312 | 416 |
| 454 | 3300006871 | Ga0075434_100002388 | Ga0075434_1000023882 | 416 |
| 455 | 3300006871 | Ga0075434_100023931 | Ga0075434_1000239314 | 416 |
| 456 | 3300006871 | Ga0075434_100322023 | Ga0075434_1003220232 | 416 |
| 457 | 3300006880 | Ga0075429_100058289 | Ga0075429_1000582892 | 416 |
| 458 | 3300007076 | Ga0075435_100090891 | Ga0075435_1000908912 | 416 |
| 459 | 3300009093 | Ga0105240_10043696 | Ga0105240_100436963 | 416 |
| 460 | 3300009094 | Ga0111539_10027852 | Ga0111539_100278524 | 416 |
| 461 | 3300009094 | Ga0111539_10255374 | Ga0111539_102553742 | 416 |
| 462 | 3300009147 | Ga0114129_10003232 | Ga0114129_1000323221 | 416 |
| 463 | 3300013297 | Ga0157378_10000539 | Ga0157378_1000053911 | 416 |
| 464 | 3300014745 | Ga0157377_10079539 | Ga0157377_100795392 | 416 |
| 465 | 3300024227 | Ga0228598_1000071 | Ga0228598_100007111 | 416 |
| 466 | 3300024227 | Ga0228598_1002743 | Ga0228598_10027431 | 416 |
| 467 | 3300025913 | Ga0207695_10037404 | Ga0207695_100374042 | 416 |
| 468 | 3300025913 | Ga0207695_10090101 | Ga0207695_100901012 | 416 |
| 469 | 3300025931 | Ga0207644_10063981 | Ga0207644_100639812 | 416 |
| 470 | 3300025949 | Ga0207667_10266958 | Ga0207667_102669582 | 416 |
| 471 | 3300030878 | Ga0265770_1003410 | Ga0265770_10034101 | 416 |
| 472 | 3300031090 | Ga0265760_10009650 | Ga0265760_100096502 | 416 |
| 473 | 3300031711 | Ga0265314_10030472 | Ga0265314_100304724 | 416 |
| 474 | 3300031731 | Ga0307405_10014623 | Ga0307405_100146233 | 416 |
| 475 | 3300031901 | Ga0307406_10067855 | Ga0307406_100678552 | 416 |
| 476 | 3300032005 | Ga0307411_10087406 | Ga0307411_100874062 | 416 |
| 477 | 3300035118 | Ga0373954_0051493 | Ga0373954_0051493_427_1713 | 416 |
| 478 | 3300035692 | Ga0373935_0032704 | Ga0373935_0032704_1401_2687 | 416 |
| 479 | 3300035695 | Ga0373927_0011697 | Ga0373927_0011697_3979_5265 | 416 |
| 480 | 3300035724 | Ga0373933_0024609 | Ga0373933_0024609_1953_3239 | 416 |
| 481 | 3300035725 | Ga0373947_0027361 | Ga0373947_0027361_31_1317 | 416 |
| 482 | 3300036401 | Ga0373937_0062028 | Ga0373937_0062028_1942_3228 | 416 |
| 483 | 3300045051 | Ga0451576_0012567 | Ga0451576_0012567_3209_4522 | 416 |
| 484 | 3300046455 | Ga0495603_0022068 | Ga0495603_0022068_2390_3700 | 416 |
| 485 | 3300046462 | Ga0495651_0005082 | Ga0495651_0005082_5632_6918 | 416 |
| 486 | 3300046463 | Ga0495653_0013936 | Ga0495653_0013936_2781_4067 | 416 |
| 487 | 3300046477 | Ga0495664_0023108 | Ga0495664_0023108_1464_2750 | 416 |
| 488 | 3300046477 | Ga0495664_0029171 | Ga0495664_0029171_1832_3118 | 416 |
| 489 | 3300046511 | Ga0495608_0005790 | Ga0495608_0005790_5720_7006 | 416 |
| 490 | 3300046517 | Ga0495630_0038003 | Ga0495630_0038003_2003_3289 | 416 |
| 491 | 3300046526 | Ga0495666_0016249 | Ga0495666_0016249_483_1769 | 416 |
| 492 | 3300046529 | Ga0495652_0001736 | Ga0495652_0001736_22049_23335 | 416 |
| 493 | 3300046531 | Ga0495665_0023753 | Ga0495665_0023753_182_1468 | 416 |
| 494 | 3300046531 | Ga0495665_0058901 | Ga0495665_0058901_698_2011 | 416 |
| 495 | 3300046535 | Ga0495586_0011667 | Ga0495586_0011667_1904_3190 | 416 |
| 496 | 3300046536 | Ga0495587_0031491 | Ga0495587_0031491_1356_2642 | 416 |
| 497 | 3300046559 | Ga0495667_0006687 | Ga0495667_0006687_1646_2932 | 416 |
| 498 | 3300046663 | Ga0495635_0183779 | Ga0495635_0183779_103_1389 | 416 |
| 499 | 3300046675 | Ga0495657_0099741 | Ga0495657_0099741_464_1750 | 416 |
| 500 | 3300046679 | Ga0495623_0003183 | Ga0495623_0003183_8109_9395 | 416 |
| 501 | 3300046680 | Ga0495646_0014315 | Ga0495646_0014315_1441_2727 | 416 |
| 502 | 3300046690 | Ga0495624_0044583 | Ga0495624_0044583_1230_2516 | 416 |
| 503 | 3300046809 | Ga0495600_0007823 | Ga0495600_0007823_3357_4643 | 416 |
| 504 | 3300046809 | Ga0495600_0063531 | Ga0495600_0063531_273_1559 | 416 |
| 505 | 3300047317 | Ga0495604_0002198 | Ga0495604_0002198_11051_12337 | 416 |
| 506 | 3300047319 | Ga0495674_0041420 | Ga0495674_0041420_1211_2497 | 416 |
| 507 | 3300047321 | Ga0495676_0132510 | Ga0495676_0132510_387_1673 | 416 |
| 508 | 3300047322 | Ga0495680_0000274 | Ga0495680_0000274_40752_42038 | 416 |
| 509 | 3300047444 | Ga0495675_0005476 | Ga0495675_0005476_126_1412 | 416 |
| 510 | 3300047444 | Ga0495675_0011818 | Ga0495675_0011818_1848_3134 | 416 |
| 511 | 3300047471 | Ga0495684_0017612 | Ga0495684_0017612_1951_3237 | 416 |
| 512 | 3300048088 | Ga0495602_0053030 | Ga0495602_0053030_311_1597 | 416 |
| 513 | 3300050507 | nmdc:mga05p37_19928_c1 | nmdc:mga05p37_19928_c1_5430_6728 | 416 |
| 514 | 3300050508 | nmdc:mga09592_23759_c1 | nmdc:mga09592_23759_c1_2688_3986 | 416 |
| 515 | 3300050510 | nmdc:mga06r32_147533_c1 | nmdc:mga06r32_147533_c1_913_2211 | 416 |
| 516 | 3300050511 | nmdc:mga08y16_117986_c1 | nmdc:mga08y16_117986_c1_855_2150 | 416 |
| 517 | 3300050511 | nmdc:mga08y16_23879_c1 | nmdc:mga08y16_23879_c1_4142_5440 | 416 |
| 518 | 3300050512 | nmdc:mga0n895_337116_c1 | nmdc:mga0n895_337116_c1_171_1484 | 416 |
| 519 | 3300050512 | nmdc:mga0n895_5153_c1 | nmdc:mga0n895_5153_c1_2123_3436 | 416 |
| 520 | 3300050512 | nmdc:mga0n895_71855_c1 | nmdc:mga0n895_71855_c1_1260_2561 | 416 |
| 521 | 3300050514 | nmdc:mga08x19_4181_c1 | nmdc:mga08x19_4181_c1_6649_7941 | 416 |
| 522 | 3300050515 | nmdc:mga0a205_103410_c1 | nmdc:mga0a205_103410_c1_538_1836 | 416 |
| 523 | 3300050515 | nmdc:mga0a205_74913_c1 | nmdc:mga0a205_74913_c1_1910_3223 | 416 |
| 524 | 3300053078 | Ga0495612_0006570 | Ga0495612_0006570_2014_3300 | 416 |
| 525 | iso_pu_bacteria | 2721755763 | 2723877633 | 416 |
| 526 | 3300005336 | Ga0070680_100054642 | Ga0070680_1000546422 | 417 |
| 527 | 3300005355 | Ga0070671_100082613 | Ga0070671_1000826133 | 417 |
| 528 | 3300005530 | Ga0070679_100044093 | Ga0070679_1000440931 | 417 |
| 529 | 3300006237 | Ga0097621_100030008 | Ga0097621_1000300081 | 417 |
| 530 | 3300006844 | Ga0075428_100035337 | Ga0075428_1000353375 | 417 |
| 531 | 3300006847 | Ga0075431_100009733 | Ga0075431_1000097337 | 417 |
| 532 | 3300014969 | Ga0157376_10058871 | Ga0157376_100588713 | 417 |
| 533 | 3300025928 | Ga0207700_10137876 | Ga0207700_101378762 | 417 |
| 534 | 3300025935 | Ga0207709_10067682 | Ga0207709_100676821 | 417 |
| 535 | 3300025938 | Ga0207704_10047098 | Ga0207704_100470982 | 417 |
| 536 | 3300026121 | Ga0207683_10085357 | Ga0207683_100853572 | 417 |
| 537 | 3300046517 | Ga0495630_0078049 | Ga0495630_0078049_101_1408 | 417 |
| 538 | 3300046689 | Ga0495613_0090425 | Ga0495613_0090425_748_2055 | 417 |
| 539 | 3300049574 | Ga0501038_0068271 | Ga0501038_0068271_1690_2997 | 417 |
| 540 | 3300049577 | Ga0501041_0002464 | Ga0501041_0002464_8023_9330 | 417 |
| 541 | 3300049578 | Ga0501042_0031137 | Ga0501042_0031137_162_1469 | 417 |
| 542 | 3300049580 | Ga0501046_0019292 | Ga0501046_0019292_2958_4265 | 417 |
| 543 | 3300049587 | Ga0501071_0006888 | Ga0501071_0006888_6079_7386 | 417 |
| 544 | 3300049591 | Ga0501075_0045488 | Ga0501075_0045488_1825_3132 | 417 |
| 545 | 3300049592 | Ga0501076_0000391 | Ga0501076_0000391_1754_3061 | 417 |
| 546 | 3300049593 | Ga0501077_0085943 | Ga0501077_0085943_12_1319 | 417 |
| 547 | 3300049741 | Ga0501079_0010179 | Ga0501079_0010179_35_1342 | 417 |
| 548 | 3300049743 | Ga0501081_0000897 | Ga0501081_0000897_2414_3721 | 417 |
| 549 | 3300050509 | nmdc:mga0qj67_40135_c1 | nmdc:mga0qj67_40135_c1_1389_2696 | 417 |
| 550 | 3300050510 | nmdc:mga06r32_90284_c1 | nmdc:mga06r32_90284_c1_618_1925 | 417 |
| 551 | 3300053077 | Ga0495601_0069765 | Ga0495601_0069765_799_2106 | 417 |
| 552 | 3300054114 | Ga0501084_0069128 | Ga0501084_0069128_654_1961 | 417 |
| 553 | 3300060353 | Ga0501082_0013057 | Ga0501082_0013057_35_1342 | 417 |
| 554 | 3300061734 | Ga0530510_0003649 | Ga0530510_0003649_2245_3552 | 417 |
| 555 | 3300005338 | Ga0068868_100181521 | Ga0068868_1001815211 | 418 |
| 556 | 3300005437 | Ga0070710_10001748 | Ga0070710_100017489 | 418 |
| 557 | 3300007265 | Ga0099794_10071147 | Ga0099794_100711472 | 418 |
| 558 | 3300013296 | Ga0157374_10014223 | Ga0157374_100142233 | 418 |
| 559 | 3300013297 | Ga0157378_10003170 | Ga0157378_100031702 | 418 |
| 560 | 3300014969 | Ga0157376_10259005 | Ga0157376_102590052 | 418 |
| 561 | 3300025898 | Ga0207692_10021292 | Ga0207692_100212922 | 418 |
| 562 | 3300028017 | Ga0265356_1002770 | Ga0265356_10027702 | 418 |
| 563 | 3300030760 | Ga0265762_1000446 | Ga0265762_10004464 | 418 |
| 564 | 3300031090 | Ga0265760_10004778 | Ga0265760_100047782 | 418 |
| 565 | 3300035118 | Ga0373954_0018744 | Ga0373954_0018744_358_1668 | 418 |
| 566 | 3300046454 | Ga0495592_0013644 | Ga0495592_0013644_583_1893 | 418 |
| 567 | 3300046462 | Ga0495651_0000403 | Ga0495651_0000403_27600_28910 | 418 |
| 568 | 3300046462 | Ga0495651_0007646 | Ga0495651_0007646_5850_7160 | 418 |
| 569 | 3300046511 | Ga0495608_0004290 | Ga0495608_0004290_5836_7146 | 418 |
| 570 | 3300046514 | Ga0495618_0014299 | Ga0495618_0014299_3035_4345 | 418 |
| 571 | 3300046516 | Ga0495628_0007050 | Ga0495628_0007050_5929_7239 | 418 |
| 572 | 3300046516 | Ga0495628_0040201 | Ga0495628_0040201_1481_2791 | 418 |
| 573 | 3300046517 | Ga0495630_0001259 | Ga0495630_0001259_9343_10653 | 418 |
| 574 | 3300046517 | Ga0495630_0004428 | Ga0495630_0004428_6849_8159 | 418 |
| 575 | 3300046536 | Ga0495587_0002494 | Ga0495587_0002494_10546_11856 | 418 |
| 576 | 3300046559 | Ga0495667_0002932 | Ga0495667_0002932_8393_9703 | 418 |
| 577 | 3300046559 | Ga0495667_0013419 | Ga0495667_0013419_4020_5330 | 418 |
| 578 | 3300046559 | Ga0495667_0031632 | Ga0495667_0031632_720_2030 | 418 |
| 579 | 3300046642 | Ga0495634_0028567 | Ga0495634_0028567_1703_3013 | 418 |
| 580 | 3300046675 | Ga0495657_0050150 | Ga0495657_0050150_722_2032 | 418 |
| 581 | 3300046678 | Ga0495599_0001234 | Ga0495599_0001234_5920_7230 | 418 |
| 582 | 3300046680 | Ga0495646_0060867 | Ga0495646_0060867_39_1349 | 418 |
| 583 | 3300046689 | Ga0495613_0014685 | Ga0495613_0014685_1181_2476 | 418 |
| 584 | 3300046809 | Ga0495600_0003524 | Ga0495600_0003524_3537_4847 | 418 |
| 585 | 3300047317 | Ga0495604_0007186 | Ga0495604_0007186_6432_7742 | 418 |
| 586 | 3300047317 | Ga0495604_0079951 | Ga0495604_0079951_577_1887 | 418 |
| 587 | 3300047319 | Ga0495674_0001602 | Ga0495674_0001602_3618_4928 | 418 |
| 588 | 3300047319 | Ga0495674_0072805 | Ga0495674_0072805_980_2290 | 418 |
| 589 | 3300047322 | Ga0495680_0000400 | Ga0495680_0000400_18794_20104 | 418 |
| 590 | 3300047322 | Ga0495680_0078806 | Ga0495680_0078806_899_2209 | 418 |
| 591 | 3300047322 | Ga0495680_0113093 | Ga0495680_0113093_121_1431 | 418 |
| 592 | 3300047444 | Ga0495675_0000604 | Ga0495675_0000604_21265_22575 | 418 |
| 593 | 3300047444 | Ga0495675_0006096 | Ga0495675_0006096_298_1608 | 418 |
| 594 | 3300047471 | Ga0495684_0000714 | Ga0495684_0000714_3887_5197 | 418 |
| 595 | 3300047471 | Ga0495684_0059562 | Ga0495684_0059562_861_2156 | 418 |
| 596 | 3300047471 | Ga0495684_0136278 | Ga0495684_0136278_104_1408 | 418 |
| 597 | 3300048088 | Ga0495602_0041952 | Ga0495602_0041952_819_2129 | 418 |
| 598 | 3300049575 | Ga0501039_0054124 | Ga0501039_0054124_1082_2401 | 418 |
| 599 | 3300049576 | Ga0501040_0054230 | Ga0501040_0054230_1140_2459 | 418 |
| 600 | 3300049580 | Ga0501046_0080582 | Ga0501046_0080582_515_1834 | 418 |
| 601 | 3300049588 | Ga0501072_0018784 | Ga0501072_0018784_1488_2807 | 418 |
| 602 | 3300049593 | Ga0501077_0067030 | Ga0501077_0067030_276_1595 | 418 |
| 603 | 3300049741 | Ga0501079_0044726 | Ga0501079_0044726_542_1858 | 418 |
| 604 | 3300049824 | Ga0501045_0013252 | Ga0501045_0013252_4210_5526 | 418 |
| 605 | 3300050508 | nmdc:mga09592_44726_c1 | nmdc:mga09592_44726_c1_1532_2851 | 418 |
| 606 | 3300050509 | nmdc:mga0qj67_69153_c1 | nmdc:mga0qj67_69153_c1_387_1706 | 418 |
| 607 | 3300053085 | Ga0495619_0084023 | Ga0495619_0084023_643_1947 | 418 |
| 608 | 3300005471 | Ga0070698_100000253 | Ga0070698_1000002534 | 419 |
| 609 | 3300006844 | Ga0075428_100005727 | Ga0075428_1000057275 | 419 |
| 610 | 3300006880 | Ga0075429_100017069 | Ga0075429_1000170693 | 419 |
| 611 | 3300007265 | Ga0099794_10018351 | Ga0099794_100183513 | 419 |
| 612 | 3300007265 | Ga0099794_10023224 | Ga0099794_100232242 | 419 |
| 613 | 3300007265 | Ga0099794_10033213 | Ga0099794_100332132 | 419 |
| 614 | 3300009147 | Ga0114129_10009696 | Ga0114129_100096964 | 419 |
| 615 | 3300027671 | Ga0209588_1007096 | Ga0209588_10070962 | 419 |
| 616 | 3300027671 | Ga0209588_1015542 | Ga0209588_10155422 | 419 |
| 617 | 3300027671 | Ga0209588_1019131 | Ga0209588_10191312 | 419 |
| 618 | 3300027671 | Ga0209588_1043336 | Ga0209588_10433361 | 419 |
| 619 | 3300031090 | Ga0265760_10005935 | Ga0265760_100059351 | 419 |
| 620 | 3300046472 | Ga0495580_0103839 | Ga0495580_0103839_20_1315 | 419 |
| 621 | 3300050508 | nmdc:mga09592_50117_c1 | nmdc:mga09592_50117_c1_1147_2463 | 419 |
| 622 | iso_pu_bacteria | 2856287931 | 2856288193 | 419 |
| 623 | iso_pu_bacteria | 2857357740 | 2857360302 | 419 |
| 624 | 3300003320 | rootH2_10183119 | rootH2_101831191 | 420 |
| 625 | 3300003322 | rootL2_10010827 | rootL2_100108273 | 420 |
| 626 | 3300003354 | JGI25160J50197_1000737 | JGI25160J50197_100073718 | 420 |
| 627 | 3300005262 | Ga0065165_1002132 | Ga0065165_10021321 | 420 |
| 628 | 3300005335 | Ga0070666_10070719 | Ga0070666_100707191 | 420 |
| 629 | 3300005367 | Ga0070667_100058991 | Ga0070667_1000589912 | 420 |
| 630 | 3300005434 | Ga0070709_10037422 | Ga0070709_100374222 | 420 |
| 631 | 3300005435 | Ga0070714_100000350 | Ga0070714_1000003502 | 420 |
| 632 | 3300005436 | Ga0070713_100132943 | Ga0070713_1001329432 | 420 |
| 633 | 3300005439 | Ga0070711_100010061 | Ga0070711_1000100612 | 420 |
| 634 | 3300005445 | Ga0070708_100082427 | Ga0070708_1000824271 | 420 |
| 635 | 3300005458 | Ga0070681_10007010 | Ga0070681_100070105 | 420 |
| 636 | 3300005458 | Ga0070681_10073635 | Ga0070681_100736352 | 420 |
| 637 | 3300005563 | Ga0068855_100086466 | Ga0068855_1000864663 | 420 |
| 638 | 3300005564 | Ga0070664_100168830 | Ga0070664_1001688302 | 420 |
| 639 | 3300005577 | Ga0068857_100073381 | Ga0068857_1000733812 | 420 |
| 640 | 3300005616 | Ga0068852_100279861 | Ga0068852_1002798612 | 420 |
| 641 | 3300005618 | Ga0068864_100135634 | Ga0068864_1001356342 | 420 |
| 642 | 3300005841 | Ga0068863_100066793 | Ga0068863_1000667932 | 420 |
| 643 | 3300005842 | Ga0068858_100004881 | Ga0068858_1000048818 | 420 |
| 644 | 3300005843 | Ga0068860_100004091 | Ga0068860_1000040914 | 420 |
| 645 | 3300006028 | Ga0070717_10036626 | Ga0070717_100366262 | 420 |
| 646 | 3300006028 | Ga0070717_10055947 | Ga0070717_100559473 | 420 |
| 647 | 3300006358 | Ga0068871_100044589 | Ga0068871_1000445892 | 420 |
| 648 | 3300009098 | Ga0105245_10006697 | Ga0105245_100066972 | 420 |
| 649 | 3300009098 | Ga0105245_10105200 | Ga0105245_101052001 | 420 |
| 650 | 3300009148 | Ga0105243_10087767 | Ga0105243_100877673 | 420 |
| 651 | 3300009174 | Ga0105241_10013230 | Ga0105241_100132302 | 420 |
| 652 | 3300009176 | Ga0105242_10004531 | Ga0105242_1000453110 | 420 |
| 653 | 3300009176 | Ga0105242_10047425 | Ga0105242_100474252 | 420 |
| 654 | 3300009176 | Ga0105242_10051912 | Ga0105242_100519122 | 420 |
| 655 | 3300009177 | Ga0105248_10059308 | Ga0105248_100593082 | 420 |
| 656 | 3300009551 | Ga0105238_10019327 | Ga0105238_100193273 | 420 |
| 657 | 3300010375 | Ga0105239_10040412 | Ga0105239_100404123 | 420 |
| 658 | 3300011119 | Ga0105246_10209727 | Ga0105246_102097271 | 420 |
| 659 | 3300013296 | Ga0157374_10004567 | Ga0157374_100045672 | 420 |
| 660 | 3300013297 | Ga0157378_10325613 | Ga0157378_103256131 | 420 |
| 661 | 3300013306 | Ga0163162_10007634 | Ga0163162_100076343 | 420 |
| 662 | 3300013306 | Ga0163162_10194979 | Ga0163162_101949792 | 420 |
| 663 | 3300013308 | Ga0157375_10198629 | Ga0157375_101986292 | 420 |
| 664 | 3300014325 | Ga0163163_10020614 | Ga0163163_100206143 | 420 |
| 665 | 3300014325 | Ga0163163_10079890 | Ga0163163_100798903 | 420 |
| 666 | 3300014968 | Ga0157379_10016261 | Ga0157379_100162612 | 420 |
| 667 | 3300014969 | Ga0157376_10113000 | Ga0157376_101130002 | 420 |
| 668 | 3300016635 | Ga0183361_10033 | Ga0183361_1003336 | 420 |
| 669 | 3300025284 | Ga0209130_1010403 | Ga0209130_10104031 | 420 |
| 670 | 3300025295 | Ga0209564_1032892 | Ga0209564_10328922 | 420 |
| 671 | 3300025302 | Ga0207426_1000152 | Ga0207426_100015218 | 420 |
| 672 | 3300025906 | Ga0207699_10032563 | Ga0207699_100325632 | 420 |
| 673 | 3300025912 | Ga0207707_10036631 | Ga0207707_100366313 | 420 |
| 674 | 3300025915 | Ga0207693_10142380 | Ga0207693_101423802 | 420 |
| 675 | 3300025924 | Ga0207694_10006789 | Ga0207694_100067892 | 420 |
| 676 | 3300025927 | Ga0207687_10011643 | Ga0207687_100116432 | 420 |
| 677 | 3300025927 | Ga0207687_10015801 | Ga0207687_100158012 | 420 |
| 678 | 3300025928 | Ga0207700_10102055 | Ga0207700_101020551 | 420 |
| 679 | 3300025929 | Ga0207664_10041189 | Ga0207664_100411892 | 420 |
| 680 | 3300025934 | Ga0207686_10017487 | Ga0207686_100174872 | 420 |
| 681 | 3300025938 | Ga0207704_10012808 | Ga0207704_100128082 | 420 |
| 682 | 3300025945 | Ga0207679_10066968 | Ga0207679_100669682 | 420 |
| 683 | 3300025949 | Ga0207667_10066347 | Ga0207667_100663472 | 420 |
| 684 | 3300025986 | Ga0207658_10033730 | Ga0207658_100337302 | 420 |
| 685 | 3300025986 | Ga0207658_10042493 | Ga0207658_100424934 | 420 |
| 686 | 3300026089 | Ga0207648_10022548 | Ga0207648_100225483 | 420 |
| 687 | 3300026116 | Ga0207674_10027099 | Ga0207674_100270993 | 420 |
| 688 | 3300026116 | Ga0207674_10081457 | Ga0207674_100814572 | 420 |
| 689 | 3300028800 | Ga0265338_10002271 | Ga0265338_100022711 | 420 |
| 690 | 3300030879 | Ga0265765_1002141 | Ga0265765_10021412 | 420 |
| 691 | 3300031711 | Ga0265314_10000932 | Ga0265314_1000093223 | 420 |
| 692 | 3300036401 | Ga0373937_0011155 | Ga0373937_0011155_330_1637 | 420 |
| 693 | 3300037471 | Ga0395905_0000170 | Ga0395905_0000170_89245_90552 | 420 |
| 694 | 3300046455 | Ga0495603_0009406 | Ga0495603_0009406_4455_5762 | 420 |
| 695 | 3300046455 | Ga0495603_0021295 | Ga0495603_0021295_2042_3376 | 420 |
| 696 | 3300046459 | Ga0495629_0003594 | Ga0495629_0003594_2751_4085 | 420 |
| 697 | 3300046460 | Ga0495638_0066920 | Ga0495638_0066920_332_1639 | 420 |
| 698 | 3300046474 | Ga0495605_0003258 | Ga0495605_0003258_2602_3909 | 420 |
| 699 | 3300046506 | Ga0495583_0014076 | Ga0495583_0014076_10_1317 | 420 |
| 700 | 3300046691 | Ga0495670_0002531 | Ga0495670_0002531_3046_4353 | 420 |
| 701 | 3300046692 | Ga0495671_0082607 | Ga0495671_0082607_114_1421 | 420 |
| 702 | 3300046794 | Ga0495589_0010109 | Ga0495589_0010109_2850_4157 | 420 |
| 703 | 3300047319 | Ga0495674_0055569 | Ga0495674_0055569_198_1505 | 420 |
| 704 | 3300047469 | Ga0495673_0024607 | Ga0495673_0024607_1485_2792 | 420 |
| 705 | 3300047673 | Ga0495593_0025975 | Ga0495593_0025975_1680_2999 | 420 |
| 706 | 3300048091 | Ga0495626_0023978 | Ga0495626_0023978_489_1796 | 420 |
| 707 | 3300048091 | Ga0495626_0049029 | Ga0495626_0049029_405_1712 | 420 |
| 708 | 3300048903 | Ga0496100_0000301 | Ga0496100_0000301_11173_12480 | 420 |
| 709 | 3300048903 | Ga0496100_0017645 | Ga0496100_0017645_2646_3953 | 420 |
| 710 | 3300048904 | Ga0496101_0101315 | Ga0496101_0101315_137_1444 | 420 |
| 711 | 3300048905 | Ga0496102_0001853 | Ga0496102_0001853_294_1601 | 420 |
| 712 | 3300048905 | Ga0496102_0066050 | Ga0496102_0066050_1483_2790 | 420 |
| 713 | 3300048906 | Ga0496103_0001175 | Ga0496103_0001175_273_1580 | 420 |
| 714 | 3300048907 | Ga0496104_0048303 | Ga0496104_0048303_2421_3728 | 420 |
| 715 | 3300048907 | Ga0496104_0184781 | Ga0496104_0184781_555_1862 | 420 |
| 716 | 3300048909 | Ga0496106_0026715 | Ga0496106_0026715_2848_4155 | 420 |
| 717 | 3300048910 | Ga0496107_0069060 | Ga0496107_0069060_777_2084 | 420 |
| 718 | 3300048915 | Ga0496112_0003587 | Ga0496112_0003587_14_1321 | 420 |
| 719 | 3300048915 | Ga0496112_0117821 | Ga0496112_0117821_140_1447 | 420 |
| 720 | 3300048916 | Ga0496113_0013118 | Ga0496113_0013118_565_1872 | 420 |
| 721 | 3300048920 | Ga0496117_0002673 | Ga0496117_0002673_4346_5653 | 420 |
| 722 | 3300048921 | Ga0496118_0001329 | Ga0496118_0001329_19830_21137 | 420 |
| 723 | 3300048924 | Ga0496121_0002145 | Ga0496121_0002145_13227_14534 | 420 |
| 724 | 3300048924 | Ga0496121_0007010 | Ga0496121_0007010_429_1736 | 420 |
| 725 | 3300049589 | Ga0501073_0089874 | Ga0501073_0089874_613_1965 | 420 |
| 726 | 3300053125 | Ga0500618_004453 | Ga0500618_004453_213_1520 | 420 |
| 727 | iso_pu_bacteria | 2513237166 | 2514054516 | 420 |
| 728 | iso_pu_bacteria | 2562617112 | 2563057082 | 420 |
| 729 | iso_pu_bacteria | 2711768613 | 2713474196 | 420 |
| 730 | iso_pu_bacteria | 2791355137 | 2792832739 | 420 |
| 731 | iso_pu_bacteria | 2904615490 | 2904620192 | 420 |
| 732 | iso_pu_bacteria | 2921643360 | 2921652814 | 420 |
| 733 | iso_pu_bacteria | 642555112 | 642596819 | 420 |
| 734 | 3300003316 | rootH1_10023146 | rootH1_100231463 | 421 |
| 735 | 3300005331 | Ga0070670_100223484 | Ga0070670_1002234842 | 421 |
| 736 | 3300005539 | Ga0068853_100043607 | Ga0068853_1000436073 | 421 |
| 737 | 3300005548 | Ga0070665_100020326 | Ga0070665_1000203264 | 421 |
| 738 | 3300005548 | Ga0070665_100031792 | Ga0070665_1000317924 | 421 |
| 739 | 3300005617 | Ga0068859_100044982 | Ga0068859_1000449822 | 421 |
| 740 | 3300005843 | Ga0068860_100000198 | Ga0068860_1000001985 | 421 |
| 741 | 3300006931 | Ga0097620_100044982 | Ga0097620_1000449822 | 421 |
| 742 | 3300010375 | Ga0105239_10290912 | Ga0105239_102909122 | 421 |
| 743 | 3300013306 | Ga0163162_10044064 | Ga0163162_100440644 | 421 |
| 744 | 3300014325 | Ga0163163_10049070 | Ga0163163_100490704 | 421 |
| 745 | 3300025914 | Ga0207671_10041164 | Ga0207671_100411643 | 421 |
| 746 | 3300025914 | Ga0207671_10123094 | Ga0207671_101230942 | 421 |
| 747 | 3300025925 | Ga0207650_10092893 | Ga0207650_100928932 | 421 |
| 748 | 3300025981 | Ga0207640_10033352 | Ga0207640_100333522 | 421 |
| 749 | 3300026035 | Ga0207703_10002422 | Ga0207703_100024229 | 421 |
| 750 | 3300026041 | Ga0207639_10048227 | Ga0207639_100482273 | 421 |
| 751 | 3300026067 | Ga0207678_10032986 | Ga0207678_100329862 | 421 |
| 752 | 3300026088 | Ga0207641_10000551 | Ga0207641_1000055133 | 421 |
| 753 | 3300028017 | Ga0265356_1000700 | Ga0265356_10007005 | 421 |
| 754 | 3300028379 | Ga0268266_10003187 | Ga0268266_1000318711 | 421 |
| 755 | 3300028379 | Ga0268266_10052611 | Ga0268266_100526114 | 421 |
| 756 | 3300028381 | Ga0268264_10001434 | Ga0268264_100014342 | 421 |
| 757 | 3300033180 | Ga0307510_10000007 | Ga0307510_10000007281 | 421 |
| 758 | 3300033180 | Ga0307510_10028213 | Ga0307510_100282135 | 421 |
| 759 | 3300046519 | Ga0495632_0053331 | Ga0495632_0053331_150_1415 | 421 |
| 760 | 3300047443 | Ga0495687_010235 | Ga0495687_010235_87_1352 | 421 |
| 761 | 3300048905 | Ga0496102_0005260 | Ga0496102_0005260_6526_7791 | 421 |
| 762 | 3300048920 | Ga0496117_0000038 | Ga0496117_0000038_199491_200756 | 421 |
| 763 | 3300048921 | Ga0496118_0000019 | Ga0496118_0000019_298109_299374 | 421 |
| 764 | 3300048922 | Ga0496119_0000897 | Ga0496119_0000897_10867_12132 | 421 |
| 765 | 3300048922 | Ga0496119_0033153 | Ga0496119_0033153_1616_2881 | 421 |
| 766 | 3300048923 | Ga0496120_0001881 | Ga0496120_0001881_21184_22449 | 421 |
| 767 | 3300048923 | Ga0496120_0008002 | Ga0496120_0008002_4424_5689 | 421 |
| 768 | 3300048924 | Ga0496121_0048546 | Ga0496121_0048546_370_1635 | 421 |
| 769 | 3300048924 | Ga0496121_0146905 | Ga0496121_0146905_427_1692 | 421 |
| 770 | 3300048927 | Ga0496124_0096895 | Ga0496124_0096895_1029_2294 | 421 |
| 771 | 3300048928 | Ga0496125_0000494 | Ga0496125_0000494_7017_8282 | 421 |
| 772 | 3300048928 | Ga0496125_0011232 | Ga0496125_0011232_2319_3584 | 421 |
| 773 | iso_pu_bacteria | 2744054900 | 2746091491 | 421 |
| 774 | iso_pu_bacteria | 2744054901 | 2746099354 | 421 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gby-assembly1.cif.gz_A | the structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose | 0.8392 | 12 | 419 |
| 8sc2-assembly1.cif.gz_A | human oct1 bound to diltiazem in inward-open conformation | 0.8358 | 59 | 412 |
| 8sc6-assembly1.cif.gz_A | human oct1 bound to thiamine in inward-open conformation | 0.8315 | 60 | 413 |
| 6m20-assembly3.cif.gz_C | crystal structure of plasmodium falciparum hexose transporter pfht1 bound with glucose | 0.8239 | 11 | 421 |
| 8sc3-assembly1.cif.gz_A | human oct1 bound to fenoterol in inward-open conformation | 0.8196 | 59 | 413 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P25744_10_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9207 | 15 | 204 | 1.20.1250.20 |
| af_Q54NX1_225_415_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9107 | 12 | 203 | 1.20.1250.20 |
| af_Q9I7N1_126_296_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9075 | 63 | 203 | 1.20.1250.20 |
| 4gc0A01 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9016 | 13 | 211 | 1.20.1250.20 |
| af_P9WG91_8_214_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8929 | 19 | 203 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M8ZMZ6-F1-model_v4 | deleted | 0.9538 | 2 | 421 |
|
| AF-A0A2M8ZMZ6-F1-model_v4 | deleted | 0.9494 | 2 | 421 |
|
| AF-A0A317HR28-F1-model_v4 | MFS transporter | 0.9411 | 159 | 421 |
GO:0005886
GO:0046943 |
| AF-A0A7Y9WAL0-F1-model_v4 | MFS family permease | 0.9297 | 6 | 258 |
GO:0005886
GO:0046943 |
| AF-A0A2N9MWZ1-F1-model_v4 | AMP-dependent synthetase and ligase (Modular protein) | 0.9167 | 7 | 278 |
GO:0006631
GO:0016020 GO:0022857 GO:0031956 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar