F480202

General Info

Members Datasets Scaffolds Average Seq Length
773 430 724 302

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2721755523|2722884340
Length 335
Sequence PRSRHGQPWALRGPARVAAAAGVAALALLAATAGAQEADTPDRTAASRAPATLSGTLAKVRASGSIALGYRQASVPFSYLNARNEPIGYSIELCKALVTSIEDAVNRSLAIRWVPVTADNRVDAVASGQVDLECGSTTSNLERQKRVAFSPIMFVAGTKVMVRQDAQIRSLRDLASKKVAVTAGTTNEKAMRDLDRKFHLGMQLQVVPDHSQGFAQVAGGQTDAFATDDVLLYGLIAENAGKADGNGGTGASQGARLQVVGDYLSYDPYAIMFRKDDPQLAQVVRSSFQALAEDGEIERQYRRWFLRRLPSGTSLDLPMSAQLQTLIETLAAQPR

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
3 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
9 2643221658 Variovorax sp. Root411 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2643221683 Variovorax sp. Root473 Isolate Unclassified
12 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
13 2721755523 Delftia sp. HK171 Isolate Unclassified
14 2738541277 Variovorax sp. GV051 Isolate Unclassified
15 2738543013 Variovorax sp. BT01 Isolate Unclassified
16 2738543019 Variovorax sp. GV040 Isolate Unclassified
17 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
18 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
19 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
20 2842677519 Variovorax sp. R-72495 Isolate Unclassified
21 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
22 2885198086 Variovorax sp. 679 Isolate Unclassified
23 2885211737 Variovorax sp. 553 Isolate Unclassified
24 2899924645 Variovorax sp. 369 Isolate Unclassified
25 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
26 2904456579 Variovorax sp. 2002 Isolate Unclassified
27 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
28 2904564687 Burkholderia sp. 571 Isolate Unclassified
29 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
30 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
31 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
32 2928037797 Variovorax sp. 1126 Isolate Unclassified
33 2928044640 Variovorax sp. 1128 Isolate Unclassified
34 2928051484 Variovorax sp. 1133 Isolate Unclassified
35 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
36 2928070936 Variovorax gossypii 1167 Isolate Unclassified
37 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
38 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
39 2928163908 Burkholderia sp. 567 Isolate Unclassified
40 2928536128 Burkholderia sola 565 Isolate Unclassified
41 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
42 2929520902 Variovorax beijingensis 502 Isolate Unclassified
43 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
44 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
45 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
46 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
47 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
48 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
49 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
50 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
51 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
52 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
53 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
56 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
57 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
58 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
59 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
60 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
61 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
62 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
63 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
64 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
65 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
66 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
67 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
68 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
69 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
70 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
71 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
72 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
73 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
74 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
75 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
76 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
77 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
78 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
79 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
80 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
81 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
82 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
83 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
84 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
85 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
86 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
87 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
88 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
89 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
90 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
91 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
92 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
93 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
94 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
95 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
96 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
97 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
98 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
99 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
100 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
101 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
102 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
103 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
104 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
105 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
106 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
107 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
108 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
109 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
110 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
111 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
112 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
113 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
114 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
115 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
116 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
117 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
118 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
119 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
120 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
121 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
122 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
123 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
124 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
125 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
126 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
127 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
128 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
129 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
130 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
131 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
132 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
133 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
134 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
135 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
136 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
138 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
139 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
140 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
141 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
142 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
144 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
145 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
146 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
147 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
148 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
149 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
158 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
159 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
160 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
161 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
162 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
163 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
164 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
172 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
173 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
174 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
175 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
178 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
179 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
183 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
185 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
194 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
197 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
246 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
248 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
253 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
254 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
255 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
256 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
257 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
258 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
259 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
260 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
261 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
262 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
263 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
264 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
265 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
266 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
269 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
270 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
271 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
272 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
274 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
275 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
276 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
277 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
278 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
279 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
280 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
281 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
282 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
283 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
284 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
285 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
286 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
287 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
288 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
289 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
290 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
291 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
292 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
293 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
294 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
295 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
296 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
297 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
298 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
299 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
300 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
301 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
302 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
303 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
304 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
305 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
306 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
307 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
308 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
309 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
310 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
311 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
312 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
313 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
314 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
315 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
316 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
317 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
318 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
319 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
320 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
321 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
322 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
323 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
324 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
325 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
326 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
327 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
328 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
329 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
330 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
333 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
334 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
335 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
336 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
337 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
338 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
339 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
340 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
341 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
342 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
343 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
344 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
345 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
346 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
347 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
348 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
349 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
350 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
351 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
352 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
353 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
354 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
355 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
356 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
357 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
358 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
359 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
360 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
361 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
362 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
363 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
364 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
365 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
366 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
367 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
368 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
369 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
370 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
371 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
372 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
373 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
374 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
375 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
376 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
377 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
378 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
379 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
380 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
381 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
382 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
383 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
384 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
385 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
386 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
387 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
388 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
389 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
390 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
391 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
392 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
393 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
394 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
395 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
396 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
397 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
398 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
399 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
400 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
401 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
402 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
403 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
404 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
405 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
406 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
407 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
408 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
409 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
410 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
411 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
412 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
413 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
414 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
415 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
416 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
417 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
418 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
419 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
420 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
421 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
422 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
423 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
424 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
425 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
426 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
427 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
428 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
429 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
430 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.66
Metatranscriptomes 0
Isolates 6.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.58
Nodule 0.91
Rhizoplane 5.56
Rhizosphere 60.54
Stem 0
Stem Tuber 0
Unclassified 8.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10055212 3300001979 Bacteria 1119
2 JGI24739J22299_10028465 3300001989 Bacteria 1949
3 JGI24739J22299_10040055 3300001989 Bacteria 1565
4 JGI24735J21928_10000118 3300002067 Bacteria 29248
5 JGI25152J39213_1007368 3300002773 Bacteria 2855
6 JGI25150J39212_1003628 3300002774 Bacteria 3583
7 JGI25159J45721_1012341 3300002987 Bacteria 2044
8 JGI25159J45721_1014046 3300002987 Bacteria 1825
9 JGI25151J46595_10014489 3300003187 Bacteria 3509
10 JGI25151J46595_10020086 3300003187 Bacteria 2824
11 JGI25151J46595_10022268 3300003187 Bacteria 2634
12 JGI25151J46595_10034031 3300003187 Bacteria 1954
13 JGI25153J46596_10017212 3300003215 Bacteria 2855
14 JGI25153J46596_10023422 3300003215 Bacteria 2252
15 rootL2_10009775 3300003322 Bacteria 20349
16 rootL2_10055562 3300003322 Bacteria 1776
17 JGI25160J50197_1000236 3300003354 Bacteria 42883
18 JGI25160J50197_1022107 3300003354 Bacteria 1871
19 JGI25160J50197_1022774 3300003354 Bacteria 1828
20 JGI25161J50226_1006817 3300003374 Bacteria 2005
21 JGI25161J50226_1006882 3300003374 Bacteria 1991
22 Ga0055527_1000474 3300003760 Bacteria 15081
23 Ga0055527_1002538 3300003760 Bacteria 3033
24 Ga0055535_1001024 3300003761 Bacteria 17756
25 Ga0055535_1004998 3300003761 Bacteria 3033
26 Ga0055542_1001021 3300003762 Bacteria 17756
27 Ga0055542_1005095 3300003762 Bacteria 3033
28 Ga0055529_1000848 3300003763 Bacteria 17756
29 Ga0055529_1004753 3300003763 Bacteria 2038
30 Ga0055526_1024175 3300003771 Bacteria 1999
31 Ga0055526_1024266 3300003771 Bacteria 1991
32 Ga0055537_1000150 3300003773 Bacteria 52097
33 Ga0055537_1010462 3300003773 Bacteria 1954
34 Ga0055524_1023190 3300003775 Bacteria 2005
35 Ga0055536_1015488 3300003781 Bacteria 2606
36 Ga0055536_1017660 3300003781 Bacteria 2324
37 Ga0055534_1000016 3300003784 Bacteria 144444
38 Ga0055534_1011279 3300003784 Bacteria 1825
39 Ga0055528_1000894 3300003790 Bacteria 20125
40 Ga0055528_1010911 3300003790 Bacteria 3651
41 Ga0055528_1022580 3300003790 Bacteria 1954
42 Ga0055530_10002826 3300003791 Bacteria 10654
43 Ga0055530_10005609 3300003791 Bacteria 5893
44 Ga0055540_1010029 3300003792 Bacteria 3193
45 Ga0055540_1012059 3300003792 Bacteria 2740
46 Ga0055540_1012085 3300003792 Bacteria 2736
47 Ga0055540_1012688 3300003792 Bacteria 2626
48 Ga0055540_1019961 3300003792 Bacteria 1789
49 Ga0055531_10015213 3300003794 Bacteria 3409
50 Ga0055531_10020363 3300003794 Bacteria 2626
51 Ga0055531_10028252 3300003794 Bacteria 1940
52 Ga0058692_1004345 3300003856 Bacteria 4212
53 Ga0055543_1005291 3300004625 Bacteria 3322
54 Ga0055543_1006975 3300004625 Bacteria 2662
55 Ga0065165_1003383 3300005262 Bacteria 11278
56 Ga0065165_1013354 3300005262 Bacteria 3271
57 Ga0065165_1020086 3300005262 Bacteria 2364
58 Ga0065714_10003179 3300005288 Bacteria 12607
59 Ga0065714_10094920 3300005288 Bacteria 1793
60 Ga0065707_10088077 3300005295 Bacteria 4789
61 Ga0070658_10122685 3300005327 Bacteria 2160
62 Ga0070690_100000075 3300005330 Bacteria 48451
63 Ga0070670_100020310 3300005331 Bacteria 5707
64 Ga0070670_100105881 3300005331 Bacteria 2423
65 Ga0070677_10010516 3300005333 Bacteria 3167
66 Ga0068869_100000841 3300005334 Bacteria 17573
67 Ga0068869_100255259 3300005334 Bacteria 1402
68 Ga0070666_10382839 3300005335 Bacteria 1010
69 Ga0070680_100001183 3300005336 Bacteria 18770
70 Ga0070682_100002153 3300005337 Bacteria 10935
71 Ga0068868_100000329 3300005338 Bacteria 31993
72 Ga0068868_100151365 3300005338 Bacteria 1911
73 Ga0070689_100000481 3300005340 Bacteria 23552
74 Ga0070689_100155762 3300005340 Bacteria 1844
75 Ga0070691_10000399 3300005341 Bacteria 15765
76 Ga0070687_100000014 3300005343 Bacteria 57432
77 Ga0070687_100111412 3300005343 Bacteria 1549
78 Ga0070661_100028727 3300005344 Bacteria 4012
79 Ga0070692_10000041 3300005345 Bacteria 24940
80 Ga0070675_100009449 3300005354 Bacteria 7589
81 Ga0070675_100196077 3300005354 Bacteria 1751
82 Ga0070671_100228407 3300005355 Bacteria 1579
83 Ga0070671_100276856 3300005355 Bacteria 1427
84 Ga0070674_100006507 3300005356 Bacteria 6824
85 Ga0070673_100028604 3300005364 Bacteria 4147
86 Ga0070673_100438207 3300005364 Bacteria 1174
87 Ga0070667_100241851 3300005367 Bacteria 1612
88 Ga0070703_10001484 3300005406 Bacteria 7039
89 Ga0070714_100602312 3300005435 Bacteria 1055
90 Ga0070701_10000641 3300005438 Bacteria 12213
91 Ga0070705_100000466 3300005440 Bacteria 23326
92 Ga0070700_100001345 3300005441 Bacteria 12219
93 Ga0070700_100202954 3300005441 Bacteria 1394
94 Ga0070694_100000099 3300005444 Bacteria 41966
95 Ga0070694_100048243 3300005444 Bacteria 2865
96 Ga0070708_100040247 3300005445 Bacteria 4093
97 Ga0070663_100110828 3300005455 Bacteria 2062
98 Ga0070663_100137893 3300005455 Bacteria 1859
99 Ga0070678_100161320 3300005456 Bacteria 1817
100 Ga0070662_100139441 3300005457 Bacteria 1877
101 Ga0070681_10004134 3300005458 Bacteria 13725
102 Ga0068867_100000174 3300005459 Bacteria 41996
103 Ga0068867_100001412 3300005459 Bacteria 16602
104 Ga0068867_100051153 3300005459 Bacteria 3046
105 Ga0068867_100142491 3300005459 Bacteria 1875
106 Ga0068867_100161679 3300005459 Bacteria 1766
107 Ga0070679_100008012 3300005530 Bacteria 9922
108 Ga0070679_100427909 3300005530 Bacteria 1269
109 Ga0070679_100452585 3300005530 Bacteria 1228
110 Ga0068853_100009734 3300005539 Bacteria 7753
111 Ga0068853_100169141 3300005539 Bacteria 1977
112 Ga0068853_100182792 3300005539 Bacteria 1902
113 Ga0068853_100231983 3300005539 Bacteria 1689
114 Ga0068853_100382396 3300005539 Bacteria 1315
115 Ga0070672_100054132 3300005543 Bacteria 3140
116 Ga0070686_100000134 3300005544 Bacteria 51357
117 Ga0070695_100000018 3300005545 Bacteria 63499
118 Ga0070695_100020478 3300005545 Bacteria 4040
119 Ga0070696_100000384 3300005546 Bacteria 27119
120 Ga0070696_100295433 3300005546 Bacteria 1239
121 Ga0070693_100000021 3300005547 Bacteria 59618
122 Ga0070665_100090933 3300005548 Bacteria 3058
123 Ga0070665_100152237 3300005548 Bacteria 2316
124 Ga0070665_100368261 3300005548 Bacteria 1444
125 Ga0070704_100000043 3300005549 Bacteria 42411
126 Ga0068855_100001327 3300005563 Bacteria 30611
127 Ga0068855_100009203 3300005563 Bacteria 11929
128 Ga0068854_100353393 3300005578 Bacteria 1204
129 Ga0070702_100000007 3300005615 Bacteria 65238
130 Ga0070702_100108515 3300005615 Bacteria 1716
131 Ga0068852_100003873 3300005616 Bacteria 10512
132 Ga0068852_100160858 3300005616 Bacteria 2096
133 Ga0068859_100003085 3300005617 Bacteria 16902
134 Ga0068859_100005193 3300005617 Bacteria 13229
135 Ga0068864_100024915 3300005618 Bacteria 5034
136 Ga0068866_10000561 3300005718 Bacteria 16983
137 Ga0068866_10002518 3300005718 Bacteria 7545
138 Ga0068861_100000632 3300005719 Bacteria 20851
139 Ga0068861_100001082 3300005719 Bacteria 16840
140 Ga0068861_100062852 3300005719 Bacteria 2853
141 Ga0068851_10003399 3300005834 Bacteria 7083
142 Ga0068851_10048817 3300005834 Bacteria 2146
143 Ga0068870_10035250 3300005840 Bacteria 2566
144 Ga0068858_100000334 3300005842 Bacteria 49778
145 Ga0068858_100341344 3300005842 Bacteria 1433
146 Ga0068860_100001410 3300005843 Bacteria 26069
147 Ga0068860_100009209 3300005843 Bacteria 9814
148 Ga0068862_100000688 3300005844 Bacteria 34533
149 Ga0068862_100033181 3300005844 Bacteria 4362
150 Ga0068862_100035210 3300005844 Bacteria 4238
151 Ga0068862_100173873 3300005844 Bacteria 1929
152 Ga0081455_10000306 3300005937 Bacteria 64656
153 Ga0081540_1000611 3300005983 Bacteria 34020
154 Ga0075365_10028907 3300006038 Bacteria 3538
155 Ga0075365_10033864 3300006038 Bacteria 3295
156 Ga0075363_100052882 3300006048 Bacteria 2169
157 Ga0075363_100053902 3300006048 Bacteria 2150
158 Ga0075363_100167069 3300006048 Bacteria 1248
159 Ga0075363_100226536 3300006048 Bacteria 1072
160 Ga0075364_10028512 3300006051 Bacteria 3574
161 Ga0075367_10015540 3300006178 Bacteria 4142
162 Ga0075367_10042080 3300006178 Bacteria 2672
163 Ga0075366_10000612 3300006195 Bacteria 16757
164 Ga0075366_10002010 3300006195 Bacteria 10317
165 Ga0075366_10002408 3300006195 Bacteria 9596
166 Ga0075366_10003773 3300006195 Bacteria 8055
167 Ga0075366_10012757 3300006195 Bacteria 4774
168 Ga0075366_10027241 3300006195 Bacteria 3352
169 Ga0075366_10028016 3300006195 Bacteria 3305
170 Ga0075366_10063050 3300006195 Bacteria 2203
171 Ga0097621_100000593 3300006237 Bacteria 25510
172 Ga0097621_100065343 3300006237 Bacteria 2994
173 Ga0075370_10000304 3300006353 Bacteria 17728
174 Ga0075370_10004349 3300006353 Bacteria 6866
175 Ga0075370_10033537 3300006353 Bacteria 2875
176 Ga0075370_10050547 3300006353 Bacteria 2358
177 Ga0075370_10075368 3300006353 Bacteria 1934
178 Ga0075370_10104915 3300006353 Bacteria 1638
179 Ga0068871_100000157 3300006358 Bacteria 44850
180 Ga0068871_100472197 3300006358 Bacteria 1127
181 Ga0068871_100625271 3300006358 Bacteria 981
182 Ga0075428_100005860 3300006844 Bacteria 13651
183 Ga0075428_100080905 3300006844 Bacteria 3546
184 Ga0075431_100127398 3300006847 Bacteria 2627
185 Ga0068865_100000296 3300006881 Bacteria 27405
186 Ga0068865_100000553 3300006881 Bacteria 20780
187 Ga0097620_100003085 3300006931 Bacteria 16902
188 Ga0097620_100005193 3300006931 Bacteria 13229
189 Ga0079104_1000004 3300006946 Bacteria 444549
190 Ga0099826_10000101 3300006948 Bacteria 40408
191 Ga0099826_10071922 3300006948 Bacteria 2192
192 Ga0105251_10000652 3300009011 Bacteria 31993
193 Ga0105244_10033478 3300009036 Bacteria 2708
194 Ga0105250_10005698 3300009092 Bacteria 5559
195 Ga0105250_10030250 3300009092 Bacteria 2177
196 Ga0105240_10021677 3300009093 Bacteria 8542
197 Ga0105240_10022829 3300009093 Bacteria 8290
198 Ga0105240_10211209 3300009093 Bacteria 2268
199 Ga0105240_10366625 3300009093 Bacteria 1630
200 Ga0111539_10028937 3300009094 Bacteria 6756
201 Ga0111539_10042602 3300009094 Bacteria 5449
202 Ga0111539_10049002 3300009094 Bacteria 5041
203 Ga0111539_10522649 3300009094 Bacteria 1383
204 Ga0105245_10000405 3300009098 Bacteria 40004
205 Ga0105243_10000466 3300009148 Bacteria 41868
206 Ga0105243_10000719 3300009148 Bacteria 31784
207 Ga0105243_10060016 3300009148 Bacteria 3037
208 Ga0105243_10063896 3300009148 Bacteria 2952
209 Ga0105243_10201690 3300009148 Bacteria 1745
210 Ga0105241_10021114 3300009174 Bacteria 4814
211 Ga0105242_10000191 3300009176 Bacteria 47337
212 Ga0105242_10244772 3300009176 Bacteria 1614
213 Ga0105242_10309329 3300009176 Bacteria 1445
214 Ga0105248_10127252 3300009177 Bacteria 2874
215 Ga0105248_10477111 3300009177 Bacteria 1406
216 Ga0105237_10000678 3300009545 Bacteria 47128
217 Ga0105237_10209704 3300009545 Bacteria 1948
218 Ga0105238_10003760 3300009551 Bacteria 15075
219 Ga0105238_10012462 3300009551 Bacteria 8575
220 Ga0105249_10000555 3300009553 Bacteria 34420
221 Ga0105249_10056979 3300009553 Bacteria 3578
222 Ga0105239_10002757 3300010375 Bacteria 22054
223 Ga0105239_10018903 3300010375 Bacteria 7613
224 Ga0105246_10147351 3300011119 Bacteria 1778
225 Ga0157322_1002519 3300012490 Bacteria 1040
226 Ga0157373_10014339 3300013100 Bacteria 5809
227 Ga0157373_10072985 3300013100 Bacteria 2422
228 Ga0157371_10033489 3300013102 Bacteria 3691
229 Ga0157371_10083264 3300013102 Bacteria 2265
230 Ga0157370_10010321 3300013104 Bacteria 9852
231 Ga0157370_10041067 3300013104 Bacteria 4465
232 Ga0157370_10062545 3300013104 Bacteria 3529
233 Ga0157369_10018665 3300013105 Bacteria 7775
234 Ga0157369_10049404 3300013105 Bacteria 4560
235 Ga0157378_10000196 3300013297 Bacteria 58849
236 Ga0157378_10003317 3300013297 Bacteria 14316
237 Ga0163162_10002473 3300013306 Bacteria 17455
238 Ga0163162_10028904 3300013306 Bacteria 5487
239 Ga0163162_10124882 3300013306 Bacteria 2679
240 Ga0163162_10282771 3300013306 Bacteria 1791
241 Ga0163162_10312725 3300013306 Bacteria 1703
242 Ga0163162_10417876 3300013306 Bacteria 1473
243 Ga0163162_10427937 3300013306 Bacteria 1456
244 Ga0157372_10001008 3300013307 Bacteria 30796
245 Ga0157375_10109862 3300013308 Bacteria 2854
246 Ga0157375_10292063 3300013308 Bacteria 1793
247 Ga0157375_10751390 3300013308 Bacteria 1126
248 Ga0163163_10095631 3300014325 Bacteria 2990
249 Ga0163163_10698720 3300014325 Bacteria 1078
250 Ga0157380_10004926 3300014326 Bacteria 9308
251 Ga0157380_10222744 3300014326 Bacteria 1689
252 Ga0182008_10021576 3300014497 Bacteria 3306
253 Ga0157379_10011748 3300014968 Bacteria 7646
254 Ga0182006_1005908 3300015261 Bacteria 5760
255 Ga0182006_1007662 3300015261 Bacteria 4932
256 Ga0182007_10000853 3300015262 Bacteria 16919
257 Ga0182007_10003308 3300015262 Bacteria 7639
258 Ga0182007_10003412 3300015262 Bacteria 7488
259 Ga0182007_10029230 3300015262 Bacteria 1888
260 Ga0183362_10003 3300015683 Bacteria 977584
261 Ga0163161_10016046 3300017792 Bacteria 5228
262 Ga0163161_10022442 3300017792 Bacteria 4445
263 Ga0163161_10054961 3300017792 Bacteria 2890
264 Ga0163161_10089849 3300017792 Bacteria 2272
265 Ga0163161_10195599 3300017792 Bacteria 1556
266 Ga0213875_10000216 3300021388 Bacteria 58475
267 Ga0209436_111171 3300025208 Bacteria 1593
268 Ga0209436_112461 3300025208 Bacteria 1441
269 Ga0209672_100035 3300025228 Bacteria 303111
270 Ga0209672_100040 3300025228 Bacteria 278858
271 Ga0209672_100378 3300025228 Bacteria 27209
272 Ga0209147_100041 3300025229 Bacteria 303111
273 Ga0209147_100048 3300025229 Bacteria 278858
274 Ga0209147_100696 3300025229 Bacteria 17227
275 Ga0209258_100063 3300025242 Bacteria 303577
276 Ga0209258_100070 3300025242 Bacteria 278858
277 Ga0209258_100093 3300025242 Bacteria 223559
278 Ga0207425_1001814 3300025245 Bacteria 8276
279 Ga0207425_1007722 3300025245 Bacteria 2810
280 Ga0209148_1000007 3300025254 Bacteria 1592273
281 Ga0209148_1000311 3300025254 Bacteria 69457
282 Ga0209148_1000450 3300025254 Bacteria 45050
283 Ga0209129_1000024 3300025258 Bacteria 417268
284 Ga0209129_1004707 3300025258 Bacteria 5185
285 Ga0209129_1021638 3300025258 Bacteria 1174
286 Ga0209565_1000098 3300025263 Bacteria 132021
287 Ga0209565_1000633 3300025263 Bacteria 22947
288 Ga0209565_1005528 3300025263 Bacteria 3655
289 Ga0209565_1007756 3300025263 Bacteria 2863
290 Ga0209455_1000351 3300025272 Bacteria 43193
291 Ga0209455_1000780 3300025272 Bacteria 17808
292 Ga0209673_1000030 3300025273 Bacteria 351933
293 Ga0209673_1000058 3300025273 Bacteria 269028
294 Ga0209673_1001185 3300025273 Bacteria 28137
295 Ga0209673_1002178 3300025273 Bacteria 14443
296 Ga0209673_1028050 3300025273 Bacteria 1821
297 Ga0209130_1000654 3300025284 Bacteria 31825
298 Ga0209130_1001114 3300025284 Bacteria 19756
299 Ga0209675_1000010 3300025291 Bacteria 541927
300 Ga0209675_1000151 3300025291 Bacteria 91172
301 Ga0209675_1000431 3300025291 Bacteria 33567
302 Ga0209675_1002776 3300025291 Bacteria 8744
303 Ga0209675_1023061 3300025291 Bacteria 1621
304 Ga0209676_1000028 3300025292 Bacteria 559745
305 Ga0209676_1000333 3300025292 Bacteria 90785
306 Ga0209676_1002526 3300025292 Bacteria 12760
307 Ga0209676_1005235 3300025292 Bacteria 6871
308 Ga0209676_1014874 3300025292 Bacteria 2898
309 Ga0209676_1037188 3300025292 Bacteria 1407
310 Ga0209025_1000685 3300025294 Bacteria 58093
311 Ga0209025_1001904 3300025294 Bacteria 24327
312 Ga0209025_1008279 3300025294 Bacteria 7509
313 Ga0209025_1008530 3300025294 Bacteria 7360
314 Ga0209564_1000209 3300025295 Bacteria 133651
315 Ga0209564_1002281 3300025295 Bacteria 15652
316 Ga0209564_1006924 3300025295 Bacteria 5965
317 Ga0209758_1000049 3300025297 Bacteria 345104
318 Ga0209758_1005721 3300025297 Bacteria 9380
319 Ga0209050_1000072 3300025298 Bacteria 293619
320 Ga0209050_1000721 3300025298 Bacteria 48376
321 Ga0209050_1000927 3300025298 Bacteria 38487
322 Ga0209050_1037603 3300025298 Bacteria 1394
323 Ga0209256_1000088 3300025299 Bacteria 217236
324 Ga0209256_1004126 3300025299 Bacteria 9396
325 Ga0207426_1000021 3300025302 Bacteria 556343
326 Ga0207426_1000038 3300025302 Bacteria 441522
327 Ga0207426_1000053 3300025302 Bacteria 384818
328 Ga0207426_1003265 3300025302 Bacteria 9064
329 Ga0209051_1000015 3300025303 Bacteria 546798
330 Ga0209051_1000056 3300025303 Bacteria 271616
331 Ga0209051_1000424 3300025303 Bacteria 57966
332 Ga0209051_1000545 3300025303 Bacteria 46076
333 Ga0209051_1000757 3300025303 Bacteria 34605
334 Ga0209051_1021185 3300025303 Bacteria 2776
335 Ga0209051_1023463 3300025303 Bacteria 2564
336 Ga0209257_1003278 3300025304 Bacteria 14122
337 Ga0209257_1003691 3300025304 Bacteria 12748
338 Ga0209257_1004686 3300025304 Bacteria 10280
339 Ga0207713_1005069 3300025735 Bacteria 8367
340 Ga0207682_10001551 3300025893 Bacteria 10540
341 Ga0207642_10001932 3300025899 Bacteria 6396
342 Ga0207680_10189332 3300025903 Bacteria 1396
343 Ga0207647_10005484 3300025904 Bacteria 9288
344 Ga0207643_10045223 3300025908 Bacteria 2486
345 Ga0207643_10206139 3300025908 Bacteria 1199
346 Ga0207654_10042125 3300025911 Bacteria 2582
347 Ga0207707_10047840 3300025912 Bacteria 3724
348 Ga0207695_10022456 3300025913 Bacteria 7159
349 Ga0207695_10159606 3300025913 Bacteria 2187
350 Ga0207695_10260834 3300025913 Bacteria 1630
351 Ga0207671_10002997 3300025914 Bacteria 17310
352 Ga0207660_10000284 3300025917 Bacteria 33488
353 Ga0207662_10000063 3300025918 Bacteria 46662
354 Ga0207662_10087984 3300025918 Bacteria 1907
355 Ga0207649_10012026 3300025920 Bacteria 4788
356 Ga0207652_10090395 3300025921 Bacteria 2690
357 Ga0207681_10318310 3300025923 Bacteria 1236
358 Ga0207694_10006188 3300025924 Bacteria 9139
359 Ga0207694_10007970 3300025924 Bacteria 8007
360 Ga0207694_10082026 3300025924 Bacteria 2534
361 Ga0207650_10000877 3300025925 Bacteria 22751
362 Ga0207659_10165588 3300025926 Bacteria 1740
363 Ga0207687_10005404 3300025927 Bacteria 8446
364 Ga0207644_10157439 3300025931 Bacteria 1763
365 Ga0207706_10034754 3300025933 Bacteria 4484
366 Ga0207706_10149924 3300025933 Bacteria 2051
367 Ga0207686_10000623 3300025934 Bacteria 22054
368 Ga0207686_10027163 3300025934 Bacteria 3349
369 Ga0207686_10085311 3300025934 Bacteria 2071
370 Ga0207686_10177720 3300025934 Bacteria 1507
371 Ga0207686_10419549 3300025934 Bacteria 1023
372 Ga0207709_10000019 3300025935 Bacteria 402225
373 Ga0207709_10000958 3300025935 Bacteria 21596
374 Ga0207709_10001025 3300025935 Bacteria 20674
375 Ga0207709_10003409 3300025935 Bacteria 9494
376 Ga0207670_10001140 3300025936 Bacteria 14016
377 Ga0207670_10078891 3300025936 Bacteria 2297
378 Ga0207670_10168924 3300025936 Bacteria 1638
379 Ga0207669_10038190 3300025937 Bacteria 2762
380 Ga0207704_10004232 3300025938 Bacteria 6560
381 Ga0207691_10088070 3300025940 Bacteria 2784
382 Ga0207691_10186589 3300025940 Bacteria 1810
383 Ga0207711_10047691 3300025941 Bacteria 3664
384 Ga0207689_10000214 3300025942 Bacteria 51325
385 Ga0207689_10112010 3300025942 Bacteria 2243
386 Ga0207689_10263351 3300025942 Bacteria 1426
387 Ga0207667_10024635 3300025949 Bacteria 6603
388 Ga0207667_10038913 3300025949 Bacteria 5072
389 Ga0207651_10042034 3300025960 Bacteria 3038
390 Ga0207651_10242270 3300025960 Bacteria 1470
391 Ga0207712_10000849 3300025961 Bacteria 22242
392 Ga0207712_10212381 3300025961 Bacteria 1542
393 Ga0207640_10000972 3300025981 Bacteria 15897
394 Ga0207658_10240123 3300025986 Bacteria 1534
395 Ga0207677_10010717 3300026023 Bacteria 5196
396 Ga0207677_10359633 3300026023 Bacteria 1222
397 Ga0207703_10007007 3300026035 Bacteria 8969
398 Ga0207639_10018508 3300026041 Bacteria 4951
399 Ga0207639_10294033 3300026041 Bacteria 1433
400 Ga0207678_10155630 3300026067 Bacteria 1951
401 Ga0207678_10164182 3300026067 Bacteria 1896
402 Ga0207708_10000117 3300026075 Bacteria 60989
403 Ga0207708_10144778 3300026075 Bacteria 1867
404 Ga0207641_10118767 3300026088 Bacteria 2356
405 Ga0207648_10000293 3300026089 Bacteria 54504
406 Ga0207648_10006211 3300026089 Bacteria 11905
407 Ga0207648_10007082 3300026089 Bacteria 11068
408 Ga0207648_10254656 3300026089 Bacteria 1565
409 Ga0207676_10088988 3300026095 Bacteria 2529
410 Ga0207674_10277622 3300026116 Bacteria 1623
411 Ga0207675_100000218 3300026118 Bacteria 53850
412 Ga0207675_100000819 3300026118 Bacteria 30952
413 Ga0207675_100029740 3300026118 Bacteria 5087
414 Ga0207675_100168829 3300026118 Bacteria 2090
415 Ga0207683_10001266 3300026121 Bacteria 22940
416 Ga0207683_10035360 3300026121 Bacteria 4344
417 Ga0207683_10161133 3300026121 Bacteria 2028
418 Ga0207698_10021889 3300026142 Bacteria 4430
419 Ga0207698_10066310 3300026142 Bacteria 2841
420 Ga0207698_10207444 3300026142 Bacteria 1760
421 Ga0207698_10524408 3300026142 Bacteria 1157
422 Ga0209281_1000005 3300027111 Bacteria 1242284
423 Ga0209371_1000314 3300027312 Bacteria 53375
424 Ga0209282_1001024 3300027666 Bacteria 14706
425 Ga0207428_10022002 3300027907 Bacteria 5386
426 Ga0268266_10018918 3300028379 Bacteria 5868
427 Ga0268265_10009365 3300028380 Bacteria 6618
428 Ga0268265_10019397 3300028380 Bacteria 4726
429 Ga0268264_10000609 3300028381 Bacteria 42936
430 Ga0268264_10006549 3300028381 Bacteria 9805
431 Ga0307515_10000048 3300028794 Bacteria 288111
432 Ga0268256_1000257 3300030500 Bacteria 56293
433 Ga0316177_1185315 3300030731 Bacteria 3297
434 Ga0314311_1019256 3300030733 Bacteria 3793
435 Ga0316183_1181937 3300030742 Bacteria 5794
436 Ga0316181_1066331 3300030744 Bacteria 1533
437 Ga0265327_10000789 3300031251 Bacteria 48791
438 Ga0265316_10093317 3300031344 Bacteria 2294
439 Ga0307513_10009173 3300031456 Bacteria 12529
440 Ga0307513_10110737 3300031456 Bacteria 2740
441 Ga0307408_100050351 3300031548 Bacteria 2995
442 Ga0307408_100291685 3300031548 Bacteria 1362
443 Ga0307508_10022524 3300031616 Bacteria 5725
444 Ga0307514_10004647 3300031649 Bacteria 12588
445 Ga0307405_10019514 3300031731 Bacteria 3767
446 Ga0307405_10101129 3300031731 Bacteria 1933
447 Ga0307405_10155693 3300031731 Bacteria 1612
448 Ga0307405_10357117 3300031731 Bacteria 1129
449 Ga0307410_10122477 3300031852 Bacteria 1899
450 Ga0307410_10124172 3300031852 Bacteria 1887
451 Ga0307406_10005016 3300031901 Bacteria 7215
452 Ga0307406_10130177 3300031901 Bacteria 1765
453 Ga0307416_100178484 3300032002 Bacteria 1987
454 Ga0307414_10054630 3300032004 Bacteria 2792
455 Ga0307411_10026116 3300032005 Bacteria 3511
456 Ga0307411_10418991 3300032005 Bacteria 1112
457 Ga0373926_0008550 3300035083 Bacteria 3409
458 Ga0373944_0025474 3300035089 Bacteria 1741
459 Ga0373944_0073049 3300035089 Bacteria 1121
460 Ga0373936_0013787 3300035113 Bacteria 3085
461 Ga0373936_0024056 3300035113 Bacteria 2376
462 Ga0373945_0002475 3300035116 Bacteria 5793
463 Ga0373957_0064958 3300035120 Bacteria 1419
464 Ga0373943_0002249 3300035170 Bacteria 8772
465 Ga0373943_0036350 3300035170 Bacteria 2358
466 Ga0373946_0014865 3300035171 Bacteria 2941
467 Ga0373955_0007263 3300035172 Bacteria 5086
468 Ga0373942_0122722 3300035207 Bacteria 813
469 Ga0373961_0032273 3300035241 Bacteria 1468
470 Ga0373924_0006212 3300035410 Bacteria 4272
471 Ga0373924_0045161 3300035410 Bacteria 1812
472 Ga0373931_0001350 3300035691 Bacteria 10502
473 Ga0373935_0041207 3300035692 Bacteria 2900
474 Ga0373935_0104694 3300035692 Bacteria 1870
475 Ga0373927_0096889 3300035695 Bacteria 1917
476 Ga0373947_0051400 3300035725 Bacteria 2479
477 Ga0373947_0088908 3300035725 Bacteria 1923
478 Ga0373937_0003903 3300036401 Bacteria 12612
479 Ga0373925_0020270 3300037068 Bacteria 4838
480 Ga0395900_0020164 3300037418 Bacteria 6802
481 Ga0395898_0564306 3300037466 Bacteria 1081
482 Ga0395905_0000143 3300037471 Bacteria 119088
483 Ga0436364_0093683 3300037853 Bacteria 2162
484 Ga0436364_0949154 3300037853 Bacteria 21318
485 Ga0395901_0027907 3300038443 Bacteria 5805
486 Ga0436365_0910371 3300039437 Bacteria 1177
487 Ga0439466_0032648 3300041411 Bacteria 1773
488 Ga0439465_0034032 3300041413 Bacteria 1630
489 Ga0451807_0797333 3300041486 Bacteria 1828
490 Ga0439445_0022254 3300042004 Bacteria 1598
491 Ga0439454_013298 3300042011 Bacteria 1127
492 Ga0450911_000121 3300042115 Bacteria 31301
493 Ga0450910_006925 3300042147 Bacteria 1571
494 Ga0439446_0034131 3300042156 Bacteria 1480
495 Ga0466969_0048521 3300044656 Bacteria 2099
496 Ga0466965_0077550 3300044683 Bacteria 1678
497 Ga0466966_0081171 3300044684 Bacteria 2019
498 Ga0466961_0007552 3300044693 Bacteria 6921
499 Ga0466960_0093023 3300044901 Bacteria 1540
500 Ga0451576_0164603 3300045051 Bacteria 2314
501 Ga0451576_0528201 3300045051 Bacteria 1240
502 Ga0495603_0010042 3300046455 Bacteria 5727
503 Ga0495590_0005072 3300046457 Bacteria 5251
504 Ga0495629_0001862 3300046459 Bacteria 16500
505 Ga0495629_0003276 3300046459 Bacteria 12252
506 Ga0495651_0231285 3300046462 Bacteria 1273
507 Ga0495653_0001825 3300046463 Bacteria 16782
508 Ga0495650_0009826 3300046471 Bacteria 5402
509 Ga0495580_0009565 3300046472 Bacteria 7615
510 Ga0495580_0092192 3300046472 Bacteria 2108
511 Ga0495582_0029835 3300046473 Bacteria 2994
512 Ga0495582_0096432 3300046473 Bacteria 1653
513 Ga0495605_0040379 3300046474 Bacteria 2331
514 Ga0495639_0067193 3300046475 Bacteria 1651
515 Ga0495639_0112842 3300046475 Bacteria 1291
516 Ga0495664_0078697 3300046477 Bacteria 1975
517 Ga0495584_0043651 3300046491 Bacteria 2263
518 Ga0495596_0081033 3300046500 Bacteria 1260
519 Ga0495607_0174456 3300046501 Bacteria 1083
520 Ga0495583_0003388 3300046506 Bacteria 12206
521 Ga0495606_0002910 3300046507 Bacteria 18924
522 Ga0495606_0065786 3300046507 Bacteria 2302
523 Ga0495616_0008804 3300046513 Bacteria 5944
524 Ga0495620_0010769 3300046515 Bacteria 4809
525 Ga0495620_0015706 3300046515 Bacteria 3814
526 Ga0495628_0014353 3300046516 Bacteria 6640
527 Ga0495630_0092996 3300046517 Bacteria 2279
528 Ga0495630_0154977 3300046517 Bacteria 1744
529 Ga0495631_0004715 3300046518 Bacteria 7206
530 Ga0495648_0022103 3300046524 Bacteria 4388
531 Ga0495666_0021882 3300046526 Bacteria 3165
532 Ga0495642_0001048 3300046528 Bacteria 12850
533 Ga0495642_0044563 3300046528 Bacteria 1811
534 Ga0495642_0089135 3300046528 Bacteria 1305
535 Ga0495652_0032596 3300046529 Bacteria 4555
536 Ga0495654_0032632 3300046530 Bacteria 2639
537 Ga0495654_0053084 3300046530 Bacteria 1971
538 Ga0495665_0007068 3300046531 Bacteria 6057
539 Ga0495665_0068089 3300046531 Bacteria 1877
540 Ga0495586_0013899 3300046535 Bacteria 4272
541 Ga0495586_0031911 3300046535 Bacteria 2824
542 Ga0495609_0059027 3300046538 Bacteria 1696
543 Ga0495621_0034393 3300046539 Bacteria 1751
544 Ga0495597_0002220 3300046542 Bacteria 12714
545 Ga0495645_0000267 3300046543 Bacteria 38642
546 Ga0495645_0011058 3300046543 Bacteria 6343
547 Ga0495622_0094936 3300046557 Bacteria 1369
548 Ga0495667_0028052 3300046559 Bacteria 3791
549 Ga0495667_0194740 3300046559 Bacteria 1298
550 Ga0495656_0000646 3300046615 Bacteria 11165
551 Ga0495625_0000950 3300046660 Bacteria 38751
552 Ga0495625_0152705 3300046660 Bacteria 1551
553 Ga0495635_0014095 3300046663 Bacteria 5594
554 Ga0495661_0047151 3300046665 Bacteria 2625
555 Ga0495661_0136270 3300046665 Bacteria 1340
556 Ga0495588_0041992 3300046674 Bacteria 2337
557 Ga0495623_0003659 3300046679 Bacteria 10157
558 Ga0495623_0194717 3300046679 Bacteria 1169
559 Ga0495646_0005877 3300046680 Bacteria 7779
560 Ga0495646_0070380 3300046680 Bacteria 2061
561 Ga0495647_0017673 3300046681 Bacteria 2526
562 Ga0495658_0061416 3300046683 Bacteria 2158
563 Ga0495658_0157973 3300046683 Bacteria 1396
564 Ga0495669_0001642 3300046684 Bacteria 9200
565 Ga0495669_0018189 3300046684 Bacteria 3020
566 Ga0495669_0141329 3300046684 Bacteria 1137
567 Ga0495613_0010203 3300046689 Bacteria 6978
568 Ga0495624_0033774 3300046690 Bacteria 3312
569 Ga0495670_0080427 3300046691 Bacteria 1660
570 Ga0495671_0005567 3300046692 Bacteria 7360
571 Ga0495649_0010601 3300046694 Bacteria 5431
572 Ga0495649_0061486 3300046694 Bacteria 2019
573 Ga0495649_0086426 3300046694 Bacteria 1674
574 Ga0495589_0004109 3300046794 Bacteria 7791
575 Ga0495589_0009291 3300046794 Bacteria 5113
576 Ga0495589_0033787 3300046794 Bacteria 2568
577 Ga0495589_0057640 3300046794 Bacteria 1910
578 Ga0495600_0139997 3300046809 Bacteria 1570
579 Ga0495600_0168793 3300046809 Bacteria 1413
580 Ga0495660_0107095 3300046810 Bacteria 1431
581 Ga0495581_0077415 3300047315 Bacteria 1924
582 Ga0495581_0096401 3300047315 Bacteria 1717
583 Ga0495674_0029512 3300047319 Bacteria 4993
584 Ga0495674_0072476 3300047319 Bacteria 2971
585 Ga0495672_0045150 3300047320 Bacteria 2639
586 Ga0495676_0071720 3300047321 Bacteria 2662
587 Ga0495680_0005821 3300047322 Bacteria 11538
588 Ga0495683_0002721 3300047323 Bacteria 10537
589 Ga0495683_0087906 3300047323 Bacteria 1509
590 Ga0495687_013714 3300047443 Bacteria 4210
591 Ga0495687_016923 3300047443 Bacteria 3653
592 Ga0495687_037893 3300047443 Bacteria 2144
593 Ga0495675_0040988 3300047444 Bacteria 2951
594 Ga0495675_0113718 3300047444 Bacteria 1688
595 Ga0495681_0037485 3300047470 Bacteria 2387
596 Ga0495593_0008842 3300047673 Bacteria 5845
597 Ga0495593_0061066 3300047673 Bacteria 1972
598 Ga0495593_0129545 3300047673 Bacteria 1281
599 Ga0495602_0054300 3300048088 Bacteria 3538
600 Ga0495614_0081426 3300048089 Bacteria 1402
601 Ga0495626_0037680 3300048091 Bacteria 2296
602 Ga0495626_0066559 3300048091 Bacteria 1629
603 Ga0496100_0000588 3300048903 Bacteria 17165
604 Ga0496100_0072467 3300048903 Bacteria 2302
605 Ga0496100_0198895 3300048903 Bacteria 1459
606 Ga0496101_0000441 3300048904 Bacteria 26552
607 Ga0496101_0003078 3300048904 Bacteria 10311
608 Ga0496101_0021260 3300048904 Bacteria 4457
609 Ga0496101_0029055 3300048904 Bacteria 3865
610 Ga0496101_0080802 3300048904 Bacteria 2402
611 Ga0496101_0298499 3300048904 Bacteria 1261
612 Ga0496102_0001021 3300048905 Bacteria 26096
613 Ga0496102_0029784 3300048905 Bacteria 4884
614 Ga0496102_0039923 3300048905 Bacteria 4243
615 Ga0496103_0002188 3300048906 Bacteria 12407
616 Ga0496103_0020307 3300048906 Bacteria 3990
617 Ga0496103_0217298 3300048906 Bacteria 1229
618 Ga0496104_0035535 3300048907 Bacteria 4652
619 Ga0496104_0036114 3300048907 Bacteria 4617
620 Ga0496104_0052227 3300048907 Bacteria 3860
621 Ga0496104_0070305 3300048907 Bacteria 3327
622 Ga0496105_0004053 3300048908 Bacteria 10967
623 Ga0496105_0151423 3300048908 Bacteria 1906
624 Ga0496106_0014372 3300048909 Bacteria 5849
625 Ga0496106_0090127 3300048909 Bacteria 2366
626 Ga0496107_0028871 3300048910 Bacteria 3944
627 Ga0496107_0350196 3300048910 Bacteria 1099
628 Ga0496109_0133660 3300048912 Bacteria 2317
629 Ga0496109_0542091 3300048912 Bacteria 1098
630 Ga0496110_0015898 3300048913 Bacteria 6275
631 Ga0496110_0052040 3300048913 Bacteria 3599
632 Ga0496110_0056966 3300048913 Bacteria 3439
633 Ga0496110_0080316 3300048913 Bacteria 2905
634 Ga0496111_0012891 3300048914 Bacteria 5672
635 Ga0496111_0017568 3300048914 Bacteria 4945
636 Ga0496112_0017573 3300048915 Bacteria 6723
637 Ga0496112_0287886 3300048915 Bacteria 1589
638 Ga0496113_0005804 3300048916 Bacteria 7745
639 Ga0496113_0006028 3300048916 Bacteria 7634
640 Ga0496114_0081997 3300048917 Bacteria 2725
641 Ga0496114_0123552 3300048917 Bacteria 2228
642 Ga0496117_0002412 3300048920 Bacteria 23744
643 Ga0496117_0015225 3300048920 Bacteria 6575
644 Ga0496117_0041471 3300048920 Bacteria 3372
645 Ga0496117_0058083 3300048920 Bacteria 2681
646 Ga0496118_0003264 3300048921 Bacteria 20662
647 Ga0496118_0007454 3300048921 Bacteria 11588
648 Ga0496120_0102737 3300048923 Bacteria 1507
649 Ga0496121_0001535 3300048924 Bacteria 38642
650 Ga0496121_0004607 3300048924 Bacteria 18369
651 Ga0496121_0005075 3300048924 Bacteria 17179
652 Ga0496121_0013189 3300048924 Bacteria 8907
653 Ga0496121_0029050 3300048924 Bacteria 5127
654 Ga0496121_0062280 3300048924 Bacteria 3056
655 Ga0496122_0015406 3300048925 Bacteria 7312
656 Ga0496122_0129383 3300048925 Bacteria 1608
657 Ga0496122_0140468 3300048925 Bacteria 1512
658 Ga0496122_0175141 3300048925 Bacteria 1287
659 Ga0496123_0006720 3300048926 Bacteria 11069
660 Ga0496124_0037502 3300048927 Bacteria 4215
661 Ga0496124_0056547 3300048927 Bacteria 3308
662 Ga0496124_0250646 3300048927 Bacteria 1310
663 Ga0496125_0007748 3300048928 Bacteria 11366
664 Ga0496125_0021863 3300048928 Bacteria 5953
665 Ga0496125_0086876 3300048928 Bacteria 2363
666 Ga0496125_0140353 3300048928 Bacteria 1681
667 Ga0496125_0175578 3300048928 Bacteria 1434
668 Ga0496126_0194457 3300048929 Bacteria 1716
669 Ga0496126_0334635 3300048929 Bacteria 1242
670 Ga0495682_0020288 3300049460 Bacteria 2495
671 Ga0495682_0067669 3300049460 Bacteria 1287
672 Ga0501067_0056711 3300049583 Bacteria 2170
673 Ga0501249_006316 3300049679 Bacteria 2438
674 Ga0501225_0014791 3300049705 Bacteria 2176
675 Ga0501262_000611 3300049759 Bacteria 4194
676 nmdc:mga03683_75008_c1 3300050489 Bacteria 1452
677 nmdc:mga03n38_109414_c1 3300050490 Bacteria 1344
678 nmdc:mga03n38_18792_c1 3300050490 Bacteria 2734
679 nmdc:mga00v17_230093_c1 3300050491 Bacteria 1201
680 nmdc:mga00v17_8095_c1 3300050491 Bacteria 3123
681 nmdc:mga0yw44_70737_c1 3300050492 Bacteria 2164
682 nmdc:mga0k408_10844_c1 3300050493 Bacteria 4942
683 nmdc:mga0k408_137917_c1 3300050493 Bacteria 1450
684 nmdc:mga0k408_2586_c1 3300050493 Bacteria 9608
685 nmdc:mga0k408_2741_c1 3300050493 Bacteria 9364
686 nmdc:mga0k408_27979_c1 3300050493 Bacteria 3204
687 nmdc:mga0k408_423_c1 3300050493 Bacteria 23086
688 nmdc:mga0k408_53260_c1 3300050493 Bacteria 2345
689 nmdc:mga0k408_56752_c1 3300050493 Bacteria 2273
690 nmdc:mga0k408_5696_c2 3300050493 Bacteria 5089
691 nmdc:mga07m45_280779_c1 3300050496 Bacteria 969
692 nmdc:mga07m45_31422_c1 3300050496 Bacteria 2943
693 nmdc:mga07m45_38151_c1 3300050496 Bacteria 2681
694 nmdc:mga07m45_44961_c1 3300050496 Bacteria 2479
695 nmdc:mga07m45_4636_c1 3300050496 Bacteria 6743
696 nmdc:mga07m45_53556_c1 3300050496 Bacteria 2280
697 nmdc:mga07m45_8146_c2 3300050496 Bacteria 4195
698 nmdc:mga09592_6513_c1 3300050508 Bacteria 9516
699 nmdc:mga06r32_209111_c1 3300050510 Bacteria 1939
700 nmdc:mga08y16_205949_c1 3300050511 Bacteria 2038
701 nmdc:mga08y16_25553_c1 3300050511 Bacteria 6230
702 nmdc:mga0a205_299725_c1 3300050515 Bacteria 1480
703 nmdc:mga0sz30_81541_c1 3300050516 Bacteria 1400
704 Ga0500610_0017353 3300053079 Bacteria 3456
705 Ga0500651_0000347 3300053093 Bacteria 26028
706 Ga0500572_035712 3300053111 Bacteria 1415
707 Ga0500593_001062 3300053117 Bacteria 9919
708 Ga0500594_0001635 3300053118 Bacteria 4874
709 Ga0500607_029808 3300053121 Bacteria 3012
710 Ga0500618_025387 3300053125 Bacteria 1421
711 Ga0500626_021140 3300053128 Bacteria 2899
712 Ga0500658_0002780 3300053134 Bacteria 6714
713 Ga0500658_0013278 3300053134 Bacteria 3042
714 Ga0500559_0022801 3300053136 Bacteria 2655
715 Ga0500559_0103377 3300053136 Bacteria 1314
716 Ga0500559_0143023 3300053136 Bacteria 1120
717 Ga0500564_074863 3300053138 Bacteria 1523
718 Ga0500568_0011721 3300053139 Bacteria 4052
719 Ga0500577_0074078 3300053142 Bacteria 1342
720 Ga0500616_0004050 3300053153 Bacteria 10655
721 Ga0500616_0066404 3300053153 Bacteria 1852
722 Ga0500627_0045518 3300053158 Bacteria 1899
723 Ga0500636_0085584 3300053177 Bacteria 1811
724 Ga0500565_000833 3300053734 Bacteria 1863

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035207 Ga0373942_0122722 Ga0373942_0122722_52_783 239
2 3300049583 Ga0501067_0056711 Ga0501067_0056711_673_1575 259
3 3300046500 Ga0495596_0081033 Ga0495596_0081033_15_962 262
4 3300046507 Ga0495606_0002910 Ga0495606_0002910_512_1459 262
5 3300046694 Ga0495649_0010601 Ga0495649_0010601_296_1243 262
6 3300046794 Ga0495589_0057640 Ga0495589_0057640_248_1195 262
7 3300047323 Ga0495683_0087906 Ga0495683_0087906_351_1298 262
8 3300046694 Ga0495649_0086426 Ga0495649_0086426_471_1421 264
9 3300035691 Ga0373931_0001350 Ga0373931_0001350_2805_3707 266
10 3300042115 Ga0450911_000121 Ga0450911_000121_381_1289 267
11 3300047673 Ga0495593_0129545 Ga0495593_0129545_226_1173 267
12 3300048927 Ga0496124_0056547 Ga0496124_0056547_2242_3150 267
13 3300048928 Ga0496125_0140353 Ga0496125_0140353_341_1249 267
14 3300005330 Ga0070690_100000075 Ga0070690_10000007510 269
15 3300005334 Ga0068869_100000841 Ga0068869_1000008415 269
16 3300005336 Ga0070680_100001183 Ga0070680_1000011836 269
17 3300005337 Ga0070682_100002153 Ga0070682_1000021532 269
18 3300005338 Ga0068868_100000329 Ga0068868_10000032912 269
19 3300005340 Ga0070689_100000481 Ga0070689_1000004816 269
20 3300005341 Ga0070691_10000399 Ga0070691_1000039910 269
21 3300005343 Ga0070687_100000014 Ga0070687_10000001418 269
22 3300005345 Ga0070692_10000041 Ga0070692_1000004110 269
23 3300005406 Ga0070703_10001484 Ga0070703_100014843 269
24 3300005438 Ga0070701_10000641 Ga0070701_100006415 269
25 3300005440 Ga0070705_100000466 Ga0070705_1000004662 269
26 3300005441 Ga0070700_100001345 Ga0070700_1000013454 269
27 3300005444 Ga0070694_100000099 Ga0070694_1000000995 269
28 3300005445 Ga0070708_100040247 Ga0070708_1000402473 269
29 3300005459 Ga0068867_100000174 Ga0068867_10000017436 269
30 3300005544 Ga0070686_100000134 Ga0070686_10000013421 269
31 3300005545 Ga0070695_100000018 Ga0070695_10000001836 269
32 3300005546 Ga0070696_100000384 Ga0070696_1000003844 269
33 3300005547 Ga0070693_100000021 Ga0070693_10000002121 269
34 3300005549 Ga0070704_100000043 Ga0070704_10000004312 269
35 3300005563 Ga0068855_100001327 Ga0068855_10000132718 269
36 3300005615 Ga0070702_100000007 Ga0070702_10000000725 269
37 3300005617 Ga0068859_100003085 Ga0068859_1000030853 269
38 3300005718 Ga0068866_10000561 Ga0068866_1000056113 269
39 3300005719 Ga0068861_100001082 Ga0068861_10000108212 269
40 3300005840 Ga0068870_10035250 Ga0068870_100352502 269
41 3300005842 Ga0068858_100000334 Ga0068858_10000033418 269
42 3300005843 Ga0068860_100001410 Ga0068860_10000141012 269
43 3300005844 Ga0068862_100000688 Ga0068862_10000068828 269
44 3300006237 Ga0097621_100000593 Ga0097621_10000059320 269
45 3300006358 Ga0068871_100000157 Ga0068871_10000015737 269
46 3300006881 Ga0068865_100000296 Ga0068865_10000029622 269
47 3300006931 Ga0097620_100003085 Ga0097620_1000030853 269
48 3300009092 Ga0105250_10030250 Ga0105250_100302502 269
49 3300009093 Ga0105240_10366625 Ga0105240_103666252 269
50 3300009098 Ga0105245_10000405 Ga0105245_100004053 269
51 3300009148 Ga0105243_10000466 Ga0105243_100004665 269
52 3300009174 Ga0105241_10021114 Ga0105241_100211142 269
53 3300009176 Ga0105242_10000191 Ga0105242_1000019128 269
54 3300009553 Ga0105249_10000555 Ga0105249_1000055527 269
55 3300010375 Ga0105239_10018903 Ga0105239_100189034 269
56 3300011119 Ga0105246_10147351 Ga0105246_101473512 269
57 3300013102 Ga0157371_10083264 Ga0157371_100832642 269
58 3300013297 Ga0157378_10000196 Ga0157378_1000019634 269
59 3300013308 Ga0157375_10751390 Ga0157375_107513901 269
60 3300025899 Ga0207642_10001932 Ga0207642_100019324 269
61 3300025908 Ga0207643_10045223 Ga0207643_100452232 269
62 3300025911 Ga0207654_10042125 Ga0207654_100421252 269
63 3300025913 Ga0207695_10260834 Ga0207695_102608342 269
64 3300025917 Ga0207660_10000284 Ga0207660_1000028423 269
65 3300025918 Ga0207662_10000063 Ga0207662_1000006324 269
66 3300025927 Ga0207687_10005404 Ga0207687_100054046 269
67 3300025933 Ga0207706_10149924 Ga0207706_101499242 269
68 3300025934 Ga0207686_10000623 Ga0207686_1000062315 269
69 3300025935 Ga0207709_10003409 Ga0207709_100034094 269
70 3300025936 Ga0207670_10001140 Ga0207670_100011407 269
71 3300025942 Ga0207689_10000214 Ga0207689_1000021427 269
72 3300025949 Ga0207667_10024635 Ga0207667_100246352 269
73 3300025961 Ga0207712_10000849 Ga0207712_100008492 269
74 3300025981 Ga0207640_10000972 Ga0207640_1000097213 269
75 3300026023 Ga0207677_10010717 Ga0207677_100107173 269
76 3300026035 Ga0207703_10007007 Ga0207703_100070072 269
77 3300026075 Ga0207708_10000117 Ga0207708_1000011736 269
78 3300026089 Ga0207648_10000293 Ga0207648_1000029327 269
79 3300026118 Ga0207675_100000218 Ga0207675_10000021823 269
80 3300026142 Ga0207698_10207444 Ga0207698_102074442 269
81 3300028380 Ga0268265_10009365 Ga0268265_100093654 269
82 3300028381 Ga0268264_10000609 Ga0268264_1000060922 269
83 3300003354 JGI25160J50197_1000236 JGI25160J50197_100023623 271
84 3300005262 Ga0065165_1003383 Ga0065165_10033835 271
85 3300013104 Ga0157370_10010321 Ga0157370_100103213 271
86 3300025302 Ga0207426_1000021 Ga0207426_1000021495 271
87 3300026067 Ga0207678_10155630 Ga0207678_101556302 271
88 3300035410 Ga0373924_0045161 Ga0373924_0045161_35_877 271
89 3300048903 Ga0496100_0000588 Ga0496100_0000588_15439_16386 271
90 3300048904 Ga0496101_0000441 Ga0496101_0000441_11721_12668 271
91 3300048905 Ga0496102_0001021 Ga0496102_0001021_3069_4016 271
92 3300048906 Ga0496103_0002188 Ga0496103_0002188_515_1462 271
93 3300048907 Ga0496104_0036114 Ga0496104_0036114_553_1500 271
94 3300048908 Ga0496105_0151423 Ga0496105_0151423_517_1464 271
95 3300048920 Ga0496117_0002412 Ga0496117_0002412_17566_18513 271
96 3300048921 Ga0496118_0003264 Ga0496118_0003264_505_1452 271
97 3300048923 Ga0496120_0102737 Ga0496120_0102737_341_1288 271
98 3300048924 Ga0496121_0001535 Ga0496121_0001535_13754_14701 271
99 3300048927 Ga0496124_0250646 Ga0496124_0250646_77_1024 271
100 3300050491 nmdc:mga00v17_230093_c1 nmdc:mga00v17_230093_c1_367_1182 271
101 3300035083 Ga0373926_0008550 Ga0373926_0008550_1004_1930 272
102 3300035113 Ga0373936_0024056 Ga0373936_0024056_195_1121 272
103 3300035116 Ga0373945_0002475 Ga0373945_0002475_1554_2480 272
104 3300035170 Ga0373943_0036350 Ga0373943_0036350_1238_2164 272
105 3300035692 Ga0373935_0041207 Ga0373935_0041207_432_1358 272
106 3300035725 Ga0373947_0051400 Ga0373947_0051400_195_1121 272
107 3300046472 Ga0495580_0009565 Ga0495580_0009565_5818_6744 272
108 3300046473 Ga0495582_0029835 Ga0495582_0029835_222_1148 272
109 3300046475 Ga0495639_0112842 Ga0495639_0112842_28_954 272
110 3300046526 Ga0495666_0021882 Ga0495666_0021882_833_1759 272
111 3300046531 Ga0495665_0068089 Ga0495665_0068089_187_1113 272
112 3300046535 Ga0495586_0013899 Ga0495586_0013899_579_1505 272
113 3300046681 Ga0495647_0017673 Ga0495647_0017673_488_1414 272
114 3300046683 Ga0495658_0157973 Ga0495658_0157973_197_1123 272
115 3300047315 Ga0495581_0096401 Ga0495581_0096401_475_1401 272
116 3300047321 Ga0495676_0071720 Ga0495676_0071720_1238_2164 272
117 3300048924 Ga0496121_0062280 Ga0496121_0062280_314_1249 272
118 3300031251 Ga0265327_10000789 Ga0265327_1000078911 273
119 3300046459 Ga0495629_0003276 Ga0495629_0003276_7405_8352 273
120 iso_pu_bacteria 2839138175 2839139445 273
121 3300002067 JGI24735J21928_10000118 JGI24735J21928_100001189 274
122 3300005355 Ga0070671_100228407 Ga0070671_1002284071 274
123 3300009011 Ga0105251_10000652 Ga0105251_1000065210 274
124 3300013306 Ga0163162_10427937 Ga0163162_104279371 274
125 3300025302 Ga0207426_1003265 Ga0207426_10032656 274
126 3300025735 Ga0207713_1005069 Ga0207713_10050696 274
127 3300025904 Ga0207647_10005484 Ga0207647_100054847 274
128 3300025924 Ga0207694_10082026 Ga0207694_100820262 274
129 3300046457 Ga0495590_0005072 Ga0495590_0005072_803_1750 274
130 3300046474 Ga0495605_0040379 Ga0495605_0040379_17_964 274
131 3300046515 Ga0495620_0010769 Ga0495620_0010769_3423_4370 274
132 3300046528 Ga0495642_0089135 Ga0495642_0089135_211_1119 274
133 3300046542 Ga0495597_0002220 Ga0495597_0002220_11310_12257 274
134 3300046794 Ga0495589_0033787 Ga0495589_0033787_656_1603 274
135 3300047323 Ga0495683_0002721 Ga0495683_0002721_1612_2559 274
136 3300047443 Ga0495687_037893 Ga0495687_037893_743_1690 274
137 3300048091 Ga0495626_0066559 Ga0495626_0066559_490_1437 274
138 3300048904 Ga0496101_0003078 Ga0496101_0003078_6617_7564 274
139 3300048905 Ga0496102_0029784 Ga0496102_0029784_1468_2415 274
140 3300048906 Ga0496103_0020307 Ga0496103_0020307_1611_2558 274
141 3300048909 Ga0496106_0014372 Ga0496106_0014372_3377_4324 274
142 3300048910 Ga0496107_0028871 Ga0496107_0028871_650_1597 274
143 3300048912 Ga0496109_0542091 Ga0496109_0542091_34_981 274
144 3300048913 Ga0496110_0052040 Ga0496110_0052040_484_1431 274
145 3300048914 Ga0496111_0012891 Ga0496111_0012891_635_1582 274
146 3300048915 Ga0496112_0017573 Ga0496112_0017573_4238_5185 274
147 3300048916 Ga0496113_0006028 Ga0496113_0006028_358_1305 274
148 3300048920 Ga0496117_0041471 Ga0496117_0041471_2078_3025 274
149 3300048921 Ga0496118_0007454 Ga0496118_0007454_8632_9579 274
150 3300048924 Ga0496121_0013189 Ga0496121_0013189_2212_3159 274
151 3300048925 Ga0496122_0015406 Ga0496122_0015406_2470_3417 274
152 3300048926 Ga0496123_0006720 Ga0496123_0006720_1474_2421 274
153 3300048927 Ga0496124_0037502 Ga0496124_0037502_1693_2640 274
154 3300048928 Ga0496125_0021863 Ga0496125_0021863_3539_4486 274
155 3300049460 Ga0495682_0067669 Ga0495682_0067669_288_1235 274
156 3300005983 Ga0081540_1000611 Ga0081540_100061112 275
157 3300006358 Ga0068871_100472197 Ga0068871_1004721972 275
158 3300009176 Ga0105242_10244772 Ga0105242_102447722 275
159 3300025934 Ga0207686_10177720 Ga0207686_101777202 275
160 3300025934 Ga0207686_10419549 Ga0207686_104195491 275
161 3300005340 Ga0070689_100155762 Ga0070689_1001557622 276
162 3300009094 Ga0111539_10522649 Ga0111539_105226492 276
163 3300005344 Ga0070661_100028727 Ga0070661_1000287273 277
164 3300005456 Ga0070678_100161320 Ga0070678_1001613202 277
165 3300005458 Ga0070681_10004134 Ga0070681_100041348 277
166 3300005530 Ga0070679_100008012 Ga0070679_1000080123 277
167 3300013100 Ga0157373_10014339 Ga0157373_100143393 277
168 3300025912 Ga0207707_10047840 Ga0207707_100478402 277
169 3300025920 Ga0207649_10012026 Ga0207649_100120263 277
170 3300025921 Ga0207652_10090395 Ga0207652_100903952 277
171 3300026121 Ga0207683_10161133 Ga0207683_101611332 277
172 3300025935 Ga0207709_10000019 Ga0207709_10000019344 279
173 3300005343 Ga0070687_100111412 Ga0070687_1001114122 280
174 3300009092 Ga0105250_10005698 Ga0105250_100056983 280
175 3300009148 Ga0105243_10000719 Ga0105243_100007192 280
176 3300021388 Ga0213875_10000216 Ga0213875_1000021666 280
177 3300037853 Ga0436364_0093683 Ga0436364_0093683_65_985 280
178 3300037853 Ga0436364_0949154 Ga0436364_0949154_20225_21145 280
179 3300005545 Ga0070695_100020478 Ga0070695_1000204783 281
180 3300005718 Ga0068866_10002518 Ga0068866_100025184 281
181 3300005719 Ga0068861_100062852 Ga0068861_1000628522 281
182 3300009545 Ga0105237_10209704 Ga0105237_102097042 281
183 3300026118 Ga0207675_100029740 Ga0207675_1000297405 281
184 3300005338 Ga0068868_100151365 Ga0068868_1001513652 282
185 3300005355 Ga0070671_100276856 Ga0070671_1002768562 282
186 3300005455 Ga0070663_100137893 Ga0070663_1001378932 282
187 3300005578 Ga0068854_100353393 Ga0068854_1003533932 282
188 3300005834 Ga0068851_10048817 Ga0068851_100488172 282
189 3300005844 Ga0068862_100035210 Ga0068862_1000352101 282
190 3300006038 Ga0075365_10028907 Ga0075365_100289073 282
191 3300006051 Ga0075364_10028512 Ga0075364_100285122 282
192 3300006195 Ga0075366_10003773 Ga0075366_100037733 282
193 3300025931 Ga0207644_10157439 Ga0207644_101574392 282
194 3300026023 Ga0207677_10359633 Ga0207677_103596332 282
195 3300049705 Ga0501225_0014791 Ga0501225_0014791_21_896 282
196 3300050492 nmdc:mga0yw44_70737_c1 nmdc:mga0yw44_70737_c1_776_1672 282
197 3300050493 nmdc:mga0k408_137917_c1 nmdc:mga0k408_137917_c1_414_1304 282
198 3300053153 Ga0500616_0066404 Ga0500616_0066404_745_1680 282
199 3300005539 Ga0068853_100382396 Ga0068853_1003823962 283
200 3300005937 Ga0081455_10000306 Ga0081455_1000030620 283
201 3300006195 Ga0075366_10000612 Ga0075366_100006129 283
202 3300006844 Ga0075428_100080905 Ga0075428_1000809053 283
203 3300006946 Ga0079104_1000004 Ga0079104_1000004247 283
204 3300026116 Ga0207674_10277622 Ga0207674_102776221 283
205 3300027111 Ga0209281_1000005 Ga0209281_1000005456 283
206 3300037466 Ga0395898_0564306 Ga0395898_0564306_119_1054 283
207 3300048924 Ga0496121_0005075 Ga0496121_0005075_15915_16835 283
208 3300048925 Ga0496122_0129383 Ga0496122_0129383_76_996 283
209 3300048928 Ga0496125_0007748 Ga0496125_0007748_10075_10995 283
210 3300050493 nmdc:mga0k408_423_c1 nmdc:mga0k408_423_c1_12732_13667 283
211 iso_pu_bacteria 2863421361 2863422760 283
212 iso_pu_bacteria 2904564687 2904566627 283
213 iso_pu_bacteria 2904571731 2904573672 283
214 iso_pu_bacteria 2928157003 2928162201 283
215 iso_pu_bacteria 2928163908 2928166364 283
216 iso_pu_bacteria 2928536128 2928539492 283
217 iso_pu_bacteria 2981990288 2981995535 283
218 iso_pu_bacteria 641736154 642420722 283
219 iso_pu_bacteria 8020938398 8020940343 283
220 iso_pu_bacteria 8020953355 8020955278 283
221 3300003781 Ga0055536_1017660 Ga0055536_10176602 284
222 3300006195 Ga0075366_10002408 Ga0075366_100024084 284
223 3300025291 Ga0209675_1000431 Ga0209675_10004315 284
224 3300025292 Ga0209676_1005235 Ga0209676_10052357 284
225 3300025303 Ga0209051_1023463 Ga0209051_10234633 284
226 3300025304 Ga0209257_1004686 Ga0209257_10046862 284
227 3300025936 Ga0207670_10078891 Ga0207670_100788913 284
228 3300031344 Ga0265316_10093317 Ga0265316_100933172 284
229 3300035120 Ga0373957_0064958 Ga0373957_0064958_193_1083 284
230 3300035172 Ga0373955_0007263 Ga0373955_0007263_3785_4675 284
231 3300035241 Ga0373961_0032273 Ga0373961_0032273_168_1067 284
232 3300035410 Ga0373924_0006212 Ga0373924_0006212_275_1165 284
233 3300036401 Ga0373937_0003903 Ga0373937_0003903_9687_10577 284
234 3300039437 Ga0436365_0910371 Ga0436365_0910371_128_1039 284
235 3300041486 Ga0451807_0797333 Ga0451807_0797333_98_1000 284
236 3300045051 Ga0451576_0528201 Ga0451576_0528201_19_912 284
237 3300046559 Ga0495667_0028052 Ga0495667_0028052_1719_2609 284
238 3300050493 nmdc:mga0k408_10844_c1 nmdc:mga0k408_10844_c1_2487_3458 284
239 3300053142 Ga0500577_0074078 Ga0500577_0074078_170_1105 284
240 3300003322 rootL2_10055562 rootL2_100555622 285
241 3300003760 Ga0055527_1000474 Ga0055527_10004748 285
242 3300003760 Ga0055527_1002538 Ga0055527_10025382 285
243 3300003761 Ga0055535_1001024 Ga0055535_10010242 285
244 3300003761 Ga0055535_1004998 Ga0055535_10049982 285
245 3300003762 Ga0055542_1001021 Ga0055542_10010212 285
246 3300003762 Ga0055542_1005095 Ga0055542_10050952 285
247 3300003763 Ga0055529_1000848 Ga0055529_10008482 285
248 3300003763 Ga0055529_1004753 Ga0055529_10047532 285
249 3300003790 Ga0055528_1010911 Ga0055528_10109113 285
250 3300003856 Ga0058692_1004345 Ga0058692_10043452 285
251 3300005327 Ga0070658_10122685 Ga0070658_101226852 285
252 3300005331 Ga0070670_100020310 Ga0070670_1000203105 285
253 3300005331 Ga0070670_100105881 Ga0070670_1001058812 285
254 3300005333 Ga0070677_10010516 Ga0070677_100105163 285
255 3300005354 Ga0070675_100009449 Ga0070675_1000094494 285
256 3300005354 Ga0070675_100196077 Ga0070675_1001960772 285
257 3300005435 Ga0070714_100602312 Ga0070714_1006023121 285
258 3300005455 Ga0070663_100110828 Ga0070663_1001108282 285
259 3300005459 Ga0068867_100051153 Ga0068867_1000511532 285
260 3300005459 Ga0068867_100161679 Ga0068867_1001616793 285
261 3300005530 Ga0070679_100427909 Ga0070679_1004279092 285
262 3300005539 Ga0068853_100182792 Ga0068853_1001827922 285
263 3300005543 Ga0070672_100054132 Ga0070672_1000541322 285
264 3300005546 Ga0070696_100295433 Ga0070696_1002954331 285
265 3300005548 Ga0070665_100152237 Ga0070665_1001522372 285
266 3300005563 Ga0068855_100009203 Ga0068855_1000092034 285
267 3300005616 Ga0068852_100003873 Ga0068852_1000038737 285
268 3300005618 Ga0068864_100024915 Ga0068864_1000249153 285
269 3300006844 Ga0075428_100005860 Ga0075428_1000058609 285
270 3300009093 Ga0105240_10022829 Ga0105240_100228297 285
271 3300009094 Ga0111539_10028937 Ga0111539_100289373 285
272 3300009177 Ga0105248_10127252 Ga0105248_101272522 285
273 3300009551 Ga0105238_10003760 Ga0105238_100037608 285
274 3300013105 Ga0157369_10018665 Ga0157369_100186657 285
275 3300013306 Ga0163162_10028904 Ga0163162_100289045 285
276 3300013306 Ga0163162_10282771 Ga0163162_102827712 285
277 3300013307 Ga0157372_10001008 Ga0157372_1000100815 285
278 3300014325 Ga0163163_10095631 Ga0163163_100956313 285
279 3300014326 Ga0157380_10004926 Ga0157380_100049269 285
280 3300015262 Ga0182007_10003412 Ga0182007_100034122 285
281 3300025228 Ga0209672_100035 Ga0209672_100035266 285
282 3300025228 Ga0209672_100040 Ga0209672_100040225 285
283 3300025229 Ga0209147_100041 Ga0209147_100041266 285
284 3300025229 Ga0209147_100048 Ga0209147_100048225 285
285 3300025242 Ga0209258_100063 Ga0209258_100063268 285
286 3300025242 Ga0209258_100070 Ga0209258_100070225 285
287 3300025254 Ga0209148_1000311 Ga0209148_100031163 285
288 3300025254 Ga0209148_1000450 Ga0209148_100045023 285
289 3300025263 Ga0209565_1005528 Ga0209565_10055282 285
290 3300025272 Ga0209455_1000351 Ga0209455_100035142 285
291 3300025272 Ga0209455_1000780 Ga0209455_100078011 285
292 3300025273 Ga0209673_1000030 Ga0209673_100003016 285
293 3300025291 Ga0209675_1023061 Ga0209675_10230611 285
294 3300025295 Ga0209564_1006924 Ga0209564_10069242 285
295 3300025893 Ga0207682_10001551 Ga0207682_1000155110 285
296 3300025908 Ga0207643_10206139 Ga0207643_102061391 285
297 3300025923 Ga0207681_10318310 Ga0207681_103183101 285
298 3300025924 Ga0207694_10006188 Ga0207694_100061886 285
299 3300025925 Ga0207650_10000877 Ga0207650_100008779 285
300 3300025926 Ga0207659_10165588 Ga0207659_101655882 285
301 3300025934 Ga0207686_10027163 Ga0207686_100271632 285
302 3300025936 Ga0207670_10168924 Ga0207670_101689242 285
303 3300025940 Ga0207691_10186589 Ga0207691_101865892 285
304 3300025941 Ga0207711_10047691 Ga0207711_100476913 285
305 3300025960 Ga0207651_10042034 Ga0207651_100420342 285
306 3300026041 Ga0207639_10018508 Ga0207639_100185083 285
307 3300026067 Ga0207678_10164182 Ga0207678_101641822 285
308 3300026088 Ga0207641_10118767 Ga0207641_101187672 285
309 3300026089 Ga0207648_10007082 Ga0207648_100070825 285
310 3300026095 Ga0207676_10088988 Ga0207676_100889883 285
311 3300026121 Ga0207683_10001266 Ga0207683_1000126611 285
312 3300026142 Ga0207698_10021889 Ga0207698_100218893 285
313 3300026142 Ga0207698_10524408 Ga0207698_105244082 285
314 3300027312 Ga0209371_1000314 Ga0209371_100031420 285
315 3300027907 Ga0207428_10022002 Ga0207428_100220024 285
316 3300028794 Ga0307515_10000048 Ga0307515_100000483 285
317 3300030500 Ga0268256_1000257 Ga0268256_100025724 285
318 3300031456 Ga0307513_10009173 Ga0307513_100091736 285
319 3300031616 Ga0307508_10022524 Ga0307508_100225242 285
320 3300035113 Ga0373936_0013787 Ga0373936_0013787_1194_2108 285
321 3300035170 Ga0373943_0002249 Ga0373943_0002249_926_1840 285
322 3300035171 Ga0373946_0014865 Ga0373946_0014865_1846_2760 285
323 3300035692 Ga0373935_0104694 Ga0373935_0104694_782_1696 285
324 3300035695 Ga0373927_0096889 Ga0373927_0096889_625_1539 285
325 3300035725 Ga0373947_0088908 Ga0373947_0088908_814_1728 285
326 3300037068 Ga0373925_0020270 Ga0373925_0020270_196_1110 285
327 3300044656 Ga0466969_0048521 Ga0466969_0048521_886_1827 285
328 3300044684 Ga0466966_0081171 Ga0466966_0081171_427_1368 285
329 3300044693 Ga0466961_0007552 Ga0466961_0007552_5623_6564 285
330 3300046683 Ga0495658_0061416 Ga0495658_0061416_197_1123 285
331 3300050496 nmdc:mga07m45_280779_c1 nmdc:mga07m45_280779_c1_18_944 285
332 3300050508 nmdc:mga09592_6513_c1 nmdc:mga09592_6513_c1_2575_3477 285
333 3300050511 nmdc:mga08y16_25553_c1 nmdc:mga08y16_25553_c1_2464_3366 285
334 iso_pu_bacteria 2513237166 2514049699 285
335 iso_pu_bacteria 2562617112 2563060565 285
336 iso_pu_bacteria 2711768613 2713475742 285
337 iso_pu_bacteria 2904615490 2904624979 285
338 3300005441 Ga0070700_100202954 Ga0070700_1002029541 286
339 3300005444 Ga0070694_100048243 Ga0070694_1000482433 286
340 3300005548 Ga0070665_100090933 Ga0070665_1000909332 286
341 3300005615 Ga0070702_100108515 Ga0070702_1001085152 286
342 3300005616 Ga0068852_100160858 Ga0068852_1001608581 286
343 3300005617 Ga0068859_100005193 Ga0068859_10000519310 286
344 3300005834 Ga0068851_10003399 Ga0068851_100033996 286
345 3300006178 Ga0075367_10042080 Ga0075367_100420803 286
346 3300006237 Ga0097621_100065343 Ga0097621_1000653432 286
347 3300006353 Ga0075370_10033537 Ga0075370_100335372 286
348 3300006931 Ga0097620_100005193 Ga0097620_10000519310 286
349 3300009093 Ga0105240_10211209 Ga0105240_102112092 286
350 3300009094 Ga0111539_10049002 Ga0111539_100490022 286
351 3300009177 Ga0105248_10477111 Ga0105248_104771112 286
352 3300012490 Ga0157322_1002519 Ga0157322_10025191 286
353 3300025913 Ga0207695_10159606 Ga0207695_101596062 286
354 3300025918 Ga0207662_10087984 Ga0207662_100879842 286
355 3300026075 Ga0207708_10144778 Ga0207708_101447782 286
356 3300026118 Ga0207675_100168829 Ga0207675_1001688292 286
357 3300048913 Ga0496110_0015898 Ga0496110_0015898_3333_4235 286
358 3300050493 nmdc:mga0k408_5696_c2 nmdc:mga0k408_5696_c2_485_1387 286
359 3300050496 nmdc:mga07m45_8146_c2 nmdc:mga07m45_8146_c2_1491_2423 286
360 3300050511 nmdc:mga08y16_205949_c1 nmdc:mga08y16_205949_c1_327_1235 286
361 iso_pu_bacteria 2738543013 2739250123 286
362 iso_pu_bacteria 2904541872 2904547984 286
363 iso_pu_bacteria 2929160207 2929161621 286
364 3300003322 rootL2_10009775 rootL2_100097753 287
365 3300005335 Ga0070666_10382839 Ga0070666_103828391 287
366 3300005364 Ga0070673_100438207 Ga0070673_1004382071 287
367 3300005367 Ga0070667_100241851 Ga0070667_1002418512 287
368 3300005530 Ga0070679_100452585 Ga0070679_1004525852 287
369 3300005539 Ga0068853_100169141 Ga0068853_1001691412 287
370 3300005539 Ga0068853_100231983 Ga0068853_1002319832 287
371 3300006847 Ga0075431_100127398 Ga0075431_1001273982 287
372 3300009093 Ga0105240_10021677 Ga0105240_100216778 287
373 3300009545 Ga0105237_10000678 Ga0105237_1000067829 287
374 3300009551 Ga0105238_10012462 Ga0105238_100124628 287
375 3300010375 Ga0105239_10002757 Ga0105239_1000275722 287
376 3300013306 Ga0163162_10124882 Ga0163162_101248822 287
377 3300013306 Ga0163162_10312725 Ga0163162_103127252 287
378 3300013308 Ga0157375_10292063 Ga0157375_102920631 287
379 3300014325 Ga0163163_10698720 Ga0163163_106987201 287
380 3300015262 Ga0182007_10003308 Ga0182007_100033082 287
381 3300015683 Ga0183362_10003 Ga0183362_10003629 287
382 3300017792 Ga0163161_10195599 Ga0163161_101955992 287
383 3300025913 Ga0207695_10022456 Ga0207695_100224567 287
384 3300025914 Ga0207671_10002997 Ga0207671_100029973 287
385 3300025924 Ga0207694_10007970 Ga0207694_100079705 287
386 3300025960 Ga0207651_10242270 Ga0207651_102422702 287
387 3300025986 Ga0207658_10240123 Ga0207658_102401232 287
388 3300026041 Ga0207639_10294033 Ga0207639_102940332 287
389 3300026121 Ga0207683_10035360 Ga0207683_100353602 287
390 3300035089 Ga0373944_0025474 Ga0373944_0025474_390_1316 287
391 3300035089 Ga0373944_0073049 Ga0373944_0073049_42_971 287
392 3300037418 Ga0395900_0020164 Ga0395900_0020164_219_1124 287
393 3300037471 Ga0395905_0000143 Ga0395905_0000143_16038_16985 287
394 3300038443 Ga0395901_0027907 Ga0395901_0027907_3891_4796 287
395 3300044683 Ga0466965_0077550 Ga0466965_0077550_483_1400 287
396 3300044901 Ga0466960_0093023 Ga0466960_0093023_96_1013 287
397 3300045051 Ga0451576_0164603 Ga0451576_0164603_444_1358 287
398 3300046455 Ga0495603_0010042 Ga0495603_0010042_2003_2947 287
399 3300046459 Ga0495629_0001862 Ga0495629_0001862_2004_2948 287
400 3300046462 Ga0495651_0231285 Ga0495651_0231285_143_1087 287
401 3300046463 Ga0495653_0001825 Ga0495653_0001825_14932_15879 287
402 3300046471 Ga0495650_0009826 Ga0495650_0009826_1032_1976 287
403 3300046472 Ga0495580_0092192 Ga0495580_0092192_183_1130 287
404 3300046473 Ga0495582_0096432 Ga0495582_0096432_271_1215 287
405 3300046475 Ga0495639_0067193 Ga0495639_0067193_251_1195 287
406 3300046477 Ga0495664_0078697 Ga0495664_0078697_270_1214 287
407 3300046491 Ga0495584_0043651 Ga0495584_0043651_1176_2123 287
408 3300046501 Ga0495607_0174456 Ga0495607_0174456_17_961 287
409 3300046506 Ga0495583_0003388 Ga0495583_0003388_4679_5626 287
410 3300046507 Ga0495606_0065786 Ga0495606_0065786_1276_2220 287
411 3300046516 Ga0495628_0014353 Ga0495628_0014353_4699_5646 287
412 3300046517 Ga0495630_0092996 Ga0495630_0092996_515_1462 287
413 3300046517 Ga0495630_0154977 Ga0495630_0154977_440_1384 287
414 3300046524 Ga0495648_0022103 Ga0495648_0022103_1007_1954 287
415 3300046528 Ga0495642_0001048 Ga0495642_0001048_9260_10204 287
416 3300046528 Ga0495642_0044563 Ga0495642_0044563_356_1294 287
417 3300046529 Ga0495652_0032596 Ga0495652_0032596_3086_4033 287
418 3300046530 Ga0495654_0032632 Ga0495654_0032632_744_1688 287
419 3300046531 Ga0495665_0007068 Ga0495665_0007068_4574_5521 287
420 3300046535 Ga0495586_0031911 Ga0495586_0031911_530_1474 287
421 3300046539 Ga0495621_0034393 Ga0495621_0034393_205_1116 287
422 3300046543 Ga0495645_0000267 Ga0495645_0000267_1453_2397 287
423 3300046543 Ga0495645_0011058 Ga0495645_0011058_2924_3868 287
424 3300046557 Ga0495622_0094936 Ga0495622_0094936_58_1005 287
425 3300046559 Ga0495667_0194740 Ga0495667_0194740_315_1259 287
426 3300046615 Ga0495656_0000646 Ga0495656_0000646_4455_5393 287
427 3300046663 Ga0495635_0014095 Ga0495635_0014095_332_1279 287
428 3300046665 Ga0495661_0136270 Ga0495661_0136270_211_1155 287
429 3300046674 Ga0495588_0041992 Ga0495588_0041992_457_1395 287
430 3300046679 Ga0495623_0003659 Ga0495623_0003659_9184_10131 287
431 3300046679 Ga0495623_0194717 Ga0495623_0194717_151_1095 287
432 3300046680 Ga0495646_0005877 Ga0495646_0005877_1798_2745 287
433 3300046680 Ga0495646_0070380 Ga0495646_0070380_711_1655 287
434 3300046684 Ga0495669_0018189 Ga0495669_0018189_1856_2800 287
435 3300046684 Ga0495669_0141329 Ga0495669_0141329_40_978 287
436 3300046689 Ga0495613_0010203 Ga0495613_0010203_594_1538 287
437 3300046690 Ga0495624_0033774 Ga0495624_0033774_1764_2711 287
438 3300046691 Ga0495670_0080427 Ga0495670_0080427_564_1502 287
439 3300046694 Ga0495649_0061486 Ga0495649_0061486_865_1812 287
440 3300046794 Ga0495589_0004109 Ga0495589_0004109_1035_1979 287
441 3300046794 Ga0495589_0009291 Ga0495589_0009291_1772_2719 287
442 3300046809 Ga0495600_0139997 Ga0495600_0139997_479_1423 287
443 3300046809 Ga0495600_0168793 Ga0495600_0168793_326_1264 287
444 3300046810 Ga0495660_0107095 Ga0495660_0107095_118_1065 287
445 3300047315 Ga0495581_0077415 Ga0495581_0077415_527_1471 287
446 3300047319 Ga0495674_0029512 Ga0495674_0029512_2829_3776 287
447 3300047319 Ga0495674_0072476 Ga0495674_0072476_546_1490 287
448 3300047320 Ga0495672_0045150 Ga0495672_0045150_183_1130 287
449 3300047322 Ga0495680_0005821 Ga0495680_0005821_10398_11345 287
450 3300047443 Ga0495687_013714 Ga0495687_013714_2802_3746 287
451 3300047443 Ga0495687_016923 Ga0495687_016923_160_1107 287
452 3300047444 Ga0495675_0040988 Ga0495675_0040988_468_1415 287
453 3300047444 Ga0495675_0113718 Ga0495675_0113718_397_1341 287
454 3300047470 Ga0495681_0037485 Ga0495681_0037485_927_1871 287
455 3300047673 Ga0495593_0008842 Ga0495593_0008842_4399_5346 287
456 3300047673 Ga0495593_0061066 Ga0495593_0061066_382_1326 287
457 3300048088 Ga0495602_0054300 Ga0495602_0054300_488_1435 287
458 3300048089 Ga0495614_0081426 Ga0495614_0081426_384_1328 287
459 3300048091 Ga0495626_0037680 Ga0495626_0037680_434_1381 287
460 3300048903 Ga0496100_0072467 Ga0496100_0072467_941_1888 287
461 3300048903 Ga0496100_0198895 Ga0496100_0198895_278_1216 287
462 3300048904 Ga0496101_0021260 Ga0496101_0021260_3204_4142 287
463 3300048904 Ga0496101_0029055 Ga0496101_0029055_1807_2754 287
464 3300048904 Ga0496101_0080802 Ga0496101_0080802_803_1750 287
465 3300048904 Ga0496101_0298499 Ga0496101_0298499_26_970 287
466 3300048905 Ga0496102_0039923 Ga0496102_0039923_1332_2270 287
467 3300048906 Ga0496103_0217298 Ga0496103_0217298_136_1074 287
468 3300048907 Ga0496104_0035535 Ga0496104_0035535_647_1585 287
469 3300048907 Ga0496104_0052227 Ga0496104_0052227_1300_2247 287
470 3300048907 Ga0496104_0070305 Ga0496104_0070305_2031_2978 287
471 3300048908 Ga0496105_0004053 Ga0496105_0004053_2055_2993 287
472 3300048909 Ga0496106_0090127 Ga0496106_0090127_325_1263 287
473 3300048910 Ga0496107_0350196 Ga0496107_0350196_26_964 287
474 3300048913 Ga0496110_0056966 Ga0496110_0056966_1130_2068 287
475 3300048913 Ga0496110_0080316 Ga0496110_0080316_1406_2344 287
476 3300048914 Ga0496111_0017568 Ga0496111_0017568_2368_3306 287
477 3300048915 Ga0496112_0287886 Ga0496112_0287886_145_1092 287
478 3300048916 Ga0496113_0005804 Ga0496113_0005804_636_1583 287
479 3300048917 Ga0496114_0081997 Ga0496114_0081997_1657_2595 287
480 3300048917 Ga0496114_0123552 Ga0496114_0123552_519_1463 287
481 3300048924 Ga0496121_0004607 Ga0496121_0004607_6739_7686 287
482 3300048929 Ga0496126_0334635 Ga0496126_0334635_171_1115 287
483 3300049460 Ga0495682_0020288 Ga0495682_0020288_792_1739 287
484 3300049759 Ga0501262_000611 Ga0501262_000611_479_1396 287
485 3300050510 nmdc:mga06r32_209111_c1 nmdc:mga06r32_209111_c1_592_1506 287
486 3300050515 nmdc:mga0a205_299725_c1 nmdc:mga0a205_299725_c1_55_966 287
487 3300005548 Ga0070665_100368261 Ga0070665_1003682612 288
488 3300005844 Ga0068862_100173873 Ga0068862_1001738732 288
489 3300006358 Ga0068871_100625271 Ga0068871_1006252711 288
490 3300013102 Ga0157371_10033489 Ga0157371_100334893 288
491 3300013306 Ga0163162_10417876 Ga0163162_104178762 288
492 3300014968 Ga0157379_10011748 Ga0157379_100117484 288
493 3300017792 Ga0163161_10089849 Ga0163161_100898493 288
494 3300025228 Ga0209672_100378 Ga0209672_10037820 288
495 3300025229 Ga0209147_100696 Ga0209147_10069612 288
496 3300025242 Ga0209258_100093 Ga0209258_10009318 288
497 3300025254 Ga0209148_1000007 Ga0209148_1000007985 288
498 3300046684 Ga0495669_0001642 Ga0495669_0001642_3063_3968 288
499 iso_pu_bacteria 2643221683 2644464954 288
500 3300002773 JGI25152J39213_1007368 JGI25152J39213_10073683 289
501 3300002774 JGI25150J39212_1003628 JGI25150J39212_10036282 289
502 3300002987 JGI25159J45721_1014046 JGI25159J45721_10140462 289
503 3300003187 JGI25151J46595_10034031 JGI25151J46595_100340312 289
504 3300003215 JGI25153J46596_10017212 JGI25153J46596_100172123 289
505 3300003354 JGI25160J50197_1022774 JGI25160J50197_10227742 289
506 3300003374 JGI25161J50226_1006817 JGI25161J50226_10068172 289
507 3300003771 Ga0055526_1024175 Ga0055526_10241752 289
508 3300003773 Ga0055537_1010462 Ga0055537_10104622 289
509 3300003775 Ga0055524_1023190 Ga0055524_10231902 289
510 3300003784 Ga0055534_1011279 Ga0055534_10112792 289
511 3300003790 Ga0055528_1022580 Ga0055528_10225802 289
512 3300003792 Ga0055540_1019961 Ga0055540_10199612 289
513 3300003794 Ga0055531_10015213 Ga0055531_100152133 289
514 3300004625 Ga0055543_1005291 Ga0055543_10052912 289
515 3300005262 Ga0065165_1013354 Ga0065165_10133542 289
516 3300005356 Ga0070674_100006507 Ga0070674_1000065074 289
517 3300005459 Ga0068867_100001412 Ga0068867_1000014129 289
518 3300005459 Ga0068867_100142491 Ga0068867_1001424911 289
519 3300005719 Ga0068861_100000632 Ga0068861_1000006328 289
520 3300005842 Ga0068858_100341344 Ga0068858_1003413442 289
521 3300005843 Ga0068860_100009209 Ga0068860_1000092099 289
522 3300005844 Ga0068862_100033181 Ga0068862_1000331814 289
523 3300006881 Ga0068865_100000553 Ga0068865_1000005532 289
524 3300009148 Ga0105243_10060016 Ga0105243_100600162 289
525 3300009176 Ga0105242_10309329 Ga0105242_103093292 289
526 3300009553 Ga0105249_10056979 Ga0105249_100569794 289
527 3300013100 Ga0157373_10072985 Ga0157373_100729852 289
528 3300013104 Ga0157370_10041067 Ga0157370_100410674 289
529 3300013105 Ga0157369_10049404 Ga0157369_100494042 289
530 3300013297 Ga0157378_10003317 Ga0157378_100033179 289
531 3300013306 Ga0163162_10002473 Ga0163162_100024734 289
532 3300013308 Ga0157375_10109862 Ga0157375_101098623 289
533 3300014326 Ga0157380_10222744 Ga0157380_102227442 289
534 3300015261 Ga0182006_1005908 Ga0182006_10059085 289
535 3300025208 Ga0209436_111171 Ga0209436_1111712 289
536 3300025245 Ga0207425_1001814 Ga0207425_10018142 289
537 3300025258 Ga0209129_1000024 Ga0209129_100002492 289
538 3300025263 Ga0209565_1000633 Ga0209565_100063317 289
539 3300025284 Ga0209130_1000654 Ga0209130_100065428 289
540 3300025291 Ga0209675_1000151 Ga0209675_100015113 289
541 3300025292 Ga0209676_1014874 Ga0209676_10148742 289
542 3300025294 Ga0209025_1008279 Ga0209025_10082798 289
543 3300025295 Ga0209564_1000209 Ga0209564_100020981 289
544 3300025297 Ga0209758_1000049 Ga0209758_100004911 289
545 3300025299 Ga0209256_1004126 Ga0209256_10041262 289
546 3300025302 Ga0207426_1000053 Ga0207426_100005347 289
547 3300025303 Ga0209051_1021185 Ga0209051_10211853 289
548 3300025903 Ga0207680_10189332 Ga0207680_101893322 289
549 3300025934 Ga0207686_10085311 Ga0207686_100853113 289
550 3300025937 Ga0207669_10038190 Ga0207669_100381902 289
551 3300025938 Ga0207704_10004232 Ga0207704_100042322 289
552 3300025940 Ga0207691_10088070 Ga0207691_100880703 289
553 3300025942 Ga0207689_10112010 Ga0207689_101120102 289
554 3300025949 Ga0207667_10038913 Ga0207667_100389133 289
555 3300025961 Ga0207712_10212381 Ga0207712_102123812 289
556 3300026089 Ga0207648_10006211 Ga0207648_100062119 289
557 3300026089 Ga0207648_10254656 Ga0207648_102546562 289
558 3300026118 Ga0207675_100000819 Ga0207675_10000081921 289
559 3300026142 Ga0207698_10066310 Ga0207698_100663102 289
560 3300028380 Ga0268265_10019397 Ga0268265_100193974 289
561 3300028381 Ga0268264_10006549 Ga0268264_100065492 289
562 3300031456 Ga0307513_10110737 Ga0307513_101107372 289
563 3300031649 Ga0307514_10004647 Ga0307514_100046477 289
564 3300053136 Ga0500559_0103377 Ga0500559_0103377_53_1057 289
565 3300005295 Ga0065707_10088077 Ga0065707_100880774 290
566 3300005334 Ga0068869_100255259 Ga0068869_1002552591 290
567 3300006048 Ga0075363_100052882 Ga0075363_1000528823 290
568 3300006195 Ga0075366_10012757 Ga0075366_100127572 290
569 3300006195 Ga0075366_10027241 Ga0075366_100272413 290
570 3300006195 Ga0075366_10063050 Ga0075366_100630503 290
571 3300006353 Ga0075370_10004349 Ga0075370_100043498 290
572 3300025294 Ga0209025_1000685 Ga0209025_100068523 290
573 3300025942 Ga0207689_10263351 Ga0207689_102633512 290
574 3300042011 Ga0439454_013298 Ga0439454_013298_15_941 290
575 3300042156 Ga0439446_0034131 Ga0439446_0034131_503_1429 290
576 3300048912 Ga0496109_0133660 Ga0496109_0133660_1275_2204 290
577 3300050489 nmdc:mga03683_75008_c1 nmdc:mga03683_75008_c1_493_1419 290
578 3300050490 nmdc:mga03n38_109414_c1 nmdc:mga03n38_109414_c1_273_1199 290
579 3300050493 nmdc:mga0k408_27979_c1 nmdc:mga0k408_27979_c1_926_1867 290
580 3300050493 nmdc:mga0k408_53260_c1 nmdc:mga0k408_53260_c1_992_1918 290
581 3300050493 nmdc:mga0k408_56752_c1 nmdc:mga0k408_56752_c1_305_1231 290
582 3300050496 nmdc:mga07m45_53556_c1 nmdc:mga07m45_53556_c1_464_1390 290
583 3300053111 Ga0500572_035712 Ga0500572_035712_218_1138 290
584 iso_pu_bacteria 2721755523 2722884340 290
585 3300003791 Ga0055530_10002826 Ga0055530_1000282613 291
586 3300003792 Ga0055540_1012059 Ga0055540_10120592 291
587 3300003794 Ga0055531_10028252 Ga0055531_100282522 291
588 3300025292 Ga0209676_1000028 Ga0209676_1000028264 291
589 3300025298 Ga0209050_1000072 Ga0209050_100007220 291
590 3300025298 Ga0209050_1000927 Ga0209050_100092724 291
591 3300025303 Ga0209051_1000015 Ga0209051_1000015193 291
592 3300025303 Ga0209051_1000056 Ga0209051_1000056207 291
593 3300025304 Ga0209257_1003278 Ga0209257_100327811 291
594 3300050490 nmdc:mga03n38_18792_c1 nmdc:mga03n38_18792_c1_305_1210 291
595 3300050491 nmdc:mga00v17_8095_c1 nmdc:mga00v17_8095_c1_822_1727 291
596 3300050493 nmdc:mga0k408_2586_c1 nmdc:mga0k408_2586_c1_4015_4920 291
597 iso_pu_bacteria 2842677519 2842680593 291
598 iso_pu_bacteria 2919462493 2919462708 291
599 iso_pu_bacteria 2929520902 2929521480 291
600 iso_pu_bacteria 2945984333 2945990665 291
601 3300015262 Ga0182007_10029230 Ga0182007_100292302 292
602 3300031731 Ga0307405_10019514 Ga0307405_100195142 292
603 3300031731 Ga0307405_10155693 Ga0307405_101556932 292
604 iso_pu_bacteria 2513020051 2513230084 292
605 iso_pu_bacteria 2643221628 2644162170 292
606 iso_pu_bacteria 2643221658 2644324293 292
607 iso_pu_bacteria 2643221672 2644396134 292
608 iso_pu_bacteria 2904449895 2904450762 292
609 iso_pu_bacteria 2904456579 2904459738 292
610 iso_pu_bacteria 2928084124 2928087006 292
611 iso_pu_bacteria 2945909444 2945913937 292
612 iso_pu_bacteria 2945972063 2945973539 292
613 3300006048 Ga0075363_100053902 Ga0075363_1000539022 293
614 3300006178 Ga0075367_10015540 Ga0075367_100155403 293
615 3300006195 Ga0075366_10002010 Ga0075366_1000201012 293
616 3300006353 Ga0075370_10050547 Ga0075370_100505472 293
617 3300050493 nmdc:mga0k408_2741_c1 nmdc:mga0k408_2741_c1_688_1632 293
618 3300050496 nmdc:mga07m45_44961_c1 nmdc:mga07m45_44961_c1_810_1754 293
619 iso_pu_bacteria 2599185214 2599620566 293
620 iso_pu_bacteria 2599185226 2599673865 293
621 iso_pu_bacteria 2599185227 2599678818 293
622 iso_pu_bacteria 2599185229 2599690077 293
623 iso_pu_bacteria 2831265667 2831271543 293
624 iso_pu_bacteria 2838054893 2838055445 293
625 iso_pu_bacteria 2885198086 2885201023 293
626 iso_pu_bacteria 2885211737 2885214194 293
627 iso_pu_bacteria 2899924645 2899927511 293
628 iso_pu_bacteria 2928037797 2928042577 293
629 iso_pu_bacteria 2928044640 2928048996 293
630 iso_pu_bacteria 2928051484 2928051546 293
631 iso_pu_bacteria 2928064002 2928068757 293
632 iso_pu_bacteria 2928070936 2928073245 293
633 3300001989 JGI24739J22299_10028465 JGI24739J22299_100284652 294
634 3300002987 JGI25159J45721_1012341 JGI25159J45721_10123412 294
635 3300003187 JGI25151J46595_10014489 JGI25151J46595_100144893 294
636 3300003187 JGI25151J46595_10022268 JGI25151J46595_100222682 294
637 3300003215 JGI25153J46596_10023422 JGI25153J46596_100234222 294
638 3300003354 JGI25160J50197_1022107 JGI25160J50197_10221072 294
639 3300003374 JGI25161J50226_1006882 JGI25161J50226_10068822 294
640 3300003771 Ga0055526_1024266 Ga0055526_10242662 294
641 3300004625 Ga0055543_1006975 Ga0055543_10069752 294
642 3300005262 Ga0065165_1020086 Ga0065165_10200862 294
643 3300005288 Ga0065714_10094920 Ga0065714_100949202 294
644 3300005364 Ga0070673_100028604 Ga0070673_1000286044 294
645 3300006048 Ga0075363_100167069 Ga0075363_1001670692 294
646 3300006353 Ga0075370_10075368 Ga0075370_100753682 294
647 3300009094 Ga0111539_10042602 Ga0111539_100426024 294
648 3300025208 Ga0209436_112461 Ga0209436_1124612 294
649 3300025245 Ga0207425_1007722 Ga0207425_10077222 294
650 3300025258 Ga0209129_1004707 Ga0209129_10047074 294
651 3300025263 Ga0209565_1007756 Ga0209565_10077563 294
652 3300025273 Ga0209673_1002178 Ga0209673_10021789 294
653 3300025284 Ga0209130_1001114 Ga0209130_100111423 294
654 3300025291 Ga0209675_1002776 Ga0209675_10027762 294
655 3300025294 Ga0209025_1008530 Ga0209025_10085303 294
656 3300025295 Ga0209564_1002281 Ga0209564_10022819 294
657 3300025297 Ga0209758_1005721 Ga0209758_10057212 294
658 3300025299 Ga0209256_1000088 Ga0209256_1000088173 294
659 3300025302 Ga0207426_1000038 Ga0207426_1000038367 294
660 3300028379 Ga0268266_10018918 Ga0268266_100189185 294
661 3300048924 Ga0496121_0029050 Ga0496121_0029050_1668_2567 294
662 3300048925 Ga0496122_0175141 Ga0496122_0175141_137_1036 294
663 3300048928 Ga0496125_0175578 Ga0496125_0175578_18_935 294
664 3300050496 nmdc:mga07m45_31422_c1 nmdc:mga07m45_31422_c1_234_1154 294
665 3300013104 Ga0157370_10062545 Ga0157370_100625452 295
666 3300017792 Ga0163161_10016046 Ga0163161_100160462 295
667 3300030731 Ga0316177_1185315 Ga0316177_11853153 295
668 3300030733 Ga0314311_1019256 Ga0314311_10192562 295
669 3300030742 Ga0316183_1181937 Ga0316183_11819373 295
670 3300030744 Ga0316181_1066331 Ga0316181_10663312 295
671 3300031548 Ga0307408_100050351 Ga0307408_1000503513 295
672 3300031731 Ga0307405_10101129 Ga0307405_101011292 295
673 3300031731 Ga0307405_10357117 Ga0307405_103571172 295
674 3300031901 Ga0307406_10005016 Ga0307406_100050168 295
675 3300032002 Ga0307416_100178484 Ga0307416_1001784842 295
676 3300032004 Ga0307414_10054630 Ga0307414_100546302 295
677 3300032005 Ga0307411_10418991 Ga0307411_104189912 295
678 3300046515 Ga0495620_0015706 Ga0495620_0015706_438_1361 295
679 3300046538 Ga0495609_0059027 Ga0495609_0059027_298_1221 295
680 3300046665 Ga0495661_0047151 Ga0495661_0047151_1371_2294 295
681 3300046692 Ga0495671_0005567 Ga0495671_0005567_186_1109 295
682 3300049679 Ga0501249_006316 Ga0501249_006316_627_1544 295
683 3300053079 Ga0500610_0017353 Ga0500610_0017353_390_1313 295
684 3300053093 Ga0500651_0000347 Ga0500651_0000347_4190_5107 295
685 3300053117 Ga0500593_001062 Ga0500593_001062_302_1225 295
686 3300053134 Ga0500658_0013278 Ga0500658_0013278_424_1341 295
687 3300053158 Ga0500627_0045518 Ga0500627_0045518_751_1674 295
688 3300003187 JGI25151J46595_10020086 JGI25151J46595_100200863 296
689 3300003773 Ga0055537_1000150 Ga0055537_100015012 296
690 3300003781 Ga0055536_1015488 Ga0055536_10154882 296
691 3300003784 Ga0055534_1000016 Ga0055534_100001698 296
692 3300003790 Ga0055528_1000894 Ga0055528_10008948 296
693 3300003791 Ga0055530_10005609 Ga0055530_100056098 296
694 3300003792 Ga0055540_1010029 Ga0055540_10100293 296
695 3300003792 Ga0055540_1012085 Ga0055540_10120852 296
696 3300003792 Ga0055540_1012688 Ga0055540_10126882 296
697 3300003794 Ga0055531_10020363 Ga0055531_100203632 296
698 3300005288 Ga0065714_10003179 Ga0065714_1000317916 296
699 3300005457 Ga0070662_100139441 Ga0070662_1001394412 296
700 3300006038 Ga0075365_10033864 Ga0075365_100338642 296
701 3300006048 Ga0075363_100226536 Ga0075363_1002265362 296
702 3300006195 Ga0075366_10028016 Ga0075366_100280162 296
703 3300006353 Ga0075370_10000304 Ga0075370_1000030414 296
704 3300006353 Ga0075370_10104915 Ga0075370_101049152 296
705 3300006948 Ga0099826_10000101 Ga0099826_1000010126 296
706 3300006948 Ga0099826_10071922 Ga0099826_100719221 296
707 3300009036 Ga0105244_10033478 Ga0105244_100334782 296
708 3300009148 Ga0105243_10063896 Ga0105243_100638962 296
709 3300009148 Ga0105243_10201690 Ga0105243_102016902 296
710 3300014497 Ga0182008_10021576 Ga0182008_100215762 296
711 3300015261 Ga0182006_1007662 Ga0182006_10076622 296
712 3300015262 Ga0182007_10000853 Ga0182007_100008535 296
713 3300017792 Ga0163161_10022442 Ga0163161_100224425 296
714 3300017792 Ga0163161_10054961 Ga0163161_100549613 296
715 3300025258 Ga0209129_1021638 Ga0209129_10216382 296
716 3300025263 Ga0209565_1000098 Ga0209565_100009880 296
717 3300025273 Ga0209673_1000058 Ga0209673_1000058171 296
718 3300025273 Ga0209673_1001185 Ga0209673_10011853 296
719 3300025273 Ga0209673_1028050 Ga0209673_10280502 296
720 3300025291 Ga0209675_1000010 Ga0209675_100001094 296
721 3300025292 Ga0209676_1000333 Ga0209676_100033391 296
722 3300025292 Ga0209676_1002526 Ga0209676_100252610 296
723 3300025292 Ga0209676_1037188 Ga0209676_10371881 296
724 3300025294 Ga0209025_1001904 Ga0209025_100190424 296
725 3300025298 Ga0209050_1000721 Ga0209050_100072141 296
726 3300025298 Ga0209050_1037603 Ga0209050_10376032 296
727 3300025303 Ga0209051_1000424 Ga0209051_100042422 296
728 3300025303 Ga0209051_1000545 Ga0209051_100054531 296
729 3300025303 Ga0209051_1000757 Ga0209051_100075734 296
730 3300025304 Ga0209257_1003691 Ga0209257_10036918 296
731 3300025933 Ga0207706_10034754 Ga0207706_100347542 296
732 3300025935 Ga0207709_10000958 Ga0207709_1000095820 296
733 3300025935 Ga0207709_10001025 Ga0207709_1000102520 296
734 3300027666 Ga0209282_1001024 Ga0209282_10010242 296
735 3300031548 Ga0307408_100291685 Ga0307408_1002916852 296
736 3300031852 Ga0307410_10122477 Ga0307410_101224772 296
737 3300031852 Ga0307410_10124172 Ga0307410_101241722 296
738 3300031901 Ga0307406_10130177 Ga0307406_101301772 296
739 3300032005 Ga0307411_10026116 Ga0307411_100261162 296
740 3300041411 Ga0439466_0032648 Ga0439466_0032648_536_1456 296
741 3300041413 Ga0439465_0034032 Ga0439465_0034032_438_1358 296
742 3300042004 Ga0439445_0022254 Ga0439445_0022254_337_1257 296
743 3300042147 Ga0450910_006925 Ga0450910_006925_340_1260 296
744 3300046513 Ga0495616_0008804 Ga0495616_0008804_4218_5141 296
745 3300046518 Ga0495631_0004715 Ga0495631_0004715_6022_6945 296
746 3300046530 Ga0495654_0053084 Ga0495654_0053084_829_1752 296
747 3300046660 Ga0495625_0000950 Ga0495625_0000950_30631_31551 296
748 3300046660 Ga0495625_0152705 Ga0495625_0152705_492_1415 296
749 3300048920 Ga0496117_0015225 Ga0496117_0015225_696_1619 296
750 3300048925 Ga0496122_0140468 Ga0496122_0140468_185_1108 296
751 3300048929 Ga0496126_0194457 Ga0496126_0194457_370_1293 296
752 3300050496 nmdc:mga07m45_38151_c1 nmdc:mga07m45_38151_c1_18_941 296
753 3300050496 nmdc:mga07m45_4636_c1 nmdc:mga07m45_4636_c1_5011_5943 296
754 3300050516 nmdc:mga0sz30_81541_c1 nmdc:mga0sz30_81541_c1_437_1369 296
755 3300053118 Ga0500594_0001635 Ga0500594_0001635_2566_3489 296
756 3300053121 Ga0500607_029808 Ga0500607_029808_286_1200 296
757 3300053128 Ga0500626_021140 Ga0500626_021140_410_1333 296
758 3300053134 Ga0500658_0002780 Ga0500658_0002780_4029_4952 296
759 3300053136 Ga0500559_0143023 Ga0500559_0143023_183_1106 296
760 3300053138 Ga0500564_074863 Ga0500564_074863_278_1198 296
761 3300053139 Ga0500568_0011721 Ga0500568_0011721_312_1235 296
762 3300053153 Ga0500616_0004050 Ga0500616_0004050_2502_3425 296
763 3300053177 Ga0500636_0085584 Ga0500636_0085584_665_1585 296
764 3300053734 Ga0500565_000833 Ga0500565_000833_697_1617 296
765 iso_pu_bacteria 2738541277 2738720460 296
766 iso_pu_bacteria 2738543019 2739279659 296
767 3300001979 JGI24740J21852_10055212 JGI24740J21852_100552121 297
768 3300001989 JGI24739J22299_10040055 JGI24739J22299_100400552 297
769 3300005539 Ga0068853_100009734 Ga0068853_1000097342 297
770 3300048920 Ga0496117_0058083 Ga0496117_0058083_320_1237 297
771 3300048928 Ga0496125_0086876 Ga0496125_0086876_42_959 297
772 3300053125 Ga0500618_025387 Ga0500618_025387_290_1228 297
773 3300053136 Ga0500559_0022801 Ga0500559_0022801_324_1265 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

66

307

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ovp-assembly1.cif.gz_A x-ray structure of the iaspsnfr in complex with l-aspartate 0.9781 28 269
8ovo-assembly1.cif.gz_B x-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate 0.976 28 269
8ovp-assembly1.cif.gz_B x-ray structure of the iaspsnfr in complex with l-aspartate 0.9715 26 269
2vha-assembly1.cif.gz_B debp 0.9637 26 290
6svf-assembly1.cif.gz_A crystal structure of the p235gk mutant of argbp from t. maritima 0.9452 31 269
ID Description Score Start End Superfamily
af_P96257_184_272_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9279 133 224 3.40.190.10
2ia4B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.925 133 227 3.40.190.10
2pyyC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9166 130 226 3.40.190.10
3vv5A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.915 130 222 3.40.190.10
2ia4A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9063 26 290 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A259CJ43-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9784 33 290 GO:0005576
GO:0006865
GO:0030288
AF-A0A537N2P0-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9743 72 221 GO:0005576
GO:0006865
GO:0030288
AF-A0A421DJ27-F1-model_v4 ABC transporter substrate-binding protein 0.9742 30 289 GO:0005576
GO:0006865
GO:0030288
AF-A0A6P1J7U9-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9704 25 290 GO:0005576
GO:0006865
GO:0030288
AF-A0A5T7LS93-F1-model_v4 deleted 0.9673 21 289

Feature Viewer

pLDDT pTM Quality
91.21 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map