F480161

General Info

Members Datasets Scaffolds Average Seq Length
773 283 1546 283

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100000731|Ga0075434_1000007319
Length 302
Sequence MAHVPVATATVSRDAISPNAAATSIVIPALDEAASIASVVAGFRAAAPWREILVVDDGSHDETGREAEAAGARVLRHPYNIGNGAAVKNGIRNASGTFVLIADADGQHRPADAVRLVSRLDQYDLVVGTRSSQSQATSARRLGNTVLNWLASYLTGQPVPDLTSGFRAARRDHLAEFLHLLPNGFSTPTTTTLAFMKAGYRVRFEPIDAAQRSGASKIRLGADGVRFFVILLKVITIFSPLRIFMPVSAASFALGAAYAVWTIITQSHVTNSSVLLILLSVVIFLVGLVSEQISSLRFEGRR

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
172 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
173 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
174 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
277 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.36
Nodule 0
Rhizoplane 2.98
Rhizosphere 93.66
Stem 0
Stem Tuber 0
Unclassified 7.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100000731 3300006871 Bacteria 25794
2 JGI25406J46586_10009006 3300003203 Bacteria 4486
3 Ga0065714_10138713 3300005288 Unclassified 1188
4 Ga0065712_10001067 3300005290 Bacteria 7125
5 Ga0065712_10072264 3300005290 Bacteria 4834
6 Ga0065712_10107967 3300005290 Bacteria 1885
7 Ga0065712_10207944 3300005290 Bacteria 1083
8 Ga0065715_10001723 3300005293 Bacteria 6503
9 Ga0065715_10270509 3300005293 Bacteria 1112
10 Ga0065707_10000798 3300005295 Bacteria 12363
11 Ga0065707_10284468 3300005295 Bacteria 1040
12 Ga0070676_10000699 3300005328 Bacteria 16384
13 Ga0070676_10017521 3300005328 Bacteria 3965
14 Ga0070676_10068840 3300005328 Bacteria 2120
15 Ga0070683_100112517 3300005329 Bacteria 2569
16 Ga0070690_100033059 3300005330 Bacteria 3235
17 Ga0070690_100039162 3300005330 Unclassified 2994
18 Ga0070670_100098656 3300005331 Bacteria 2514
19 Ga0070670_100238307 3300005331 Bacteria 1584
20 Ga0068869_100000964 3300005334 Bacteria 16738
21 Ga0070666_10106778 3300005335 Bacteria 1934
22 Ga0068868_100136478 3300005338 Unclassified 2011
23 Ga0070689_100007688 3300005340 Bacteria 7550
24 Ga0070689_100164729 3300005340 Unclassified 1794
25 Ga0070689_100219068 3300005340 Bacteria 1560
26 Ga0070689_100380007 3300005340 Bacteria 1190
27 Ga0070691_10003375 3300005341 Bacteria 7177
28 Ga0070687_100038685 3300005343 Bacteria 2392
29 Ga0070687_100168436 3300005343 Bacteria 1302
30 Ga0070668_100103380 3300005347 Unclassified 2260
31 Ga0070669_100031922 3300005353 Bacteria 3805
32 Ga0070669_100043051 3300005353 Bacteria 3287
33 Ga0070669_100097555 3300005353 Bacteria 2212
34 Ga0070669_100137527 3300005353 Unclassified 1880
35 Ga0070669_100397713 3300005353 Bacteria 1127
36 Ga0070675_100005236 3300005354 Bacteria 9898
37 Ga0070675_100053786 3300005354 Bacteria 3312
38 Ga0070675_100126870 3300005354 Bacteria 2171
39 Ga0070675_100573310 3300005354 Unclassified 1022
40 Ga0070671_100026568 3300005355 Bacteria 4759
41 Ga0070674_100001871 3300005356 Bacteria 11420
42 Ga0070674_100059259 3300005356 Bacteria 2665
43 Ga0070674_100417024 3300005356 Unclassified 1100
44 Ga0070673_100041377 3300005364 Bacteria 3544
45 Ga0070673_100445383 3300005364 Bacteria 1164
46 Ga0070688_100007851 3300005365 Bacteria 5770
47 Ga0070688_100026468 3300005365 Bacteria 3446
48 Ga0070688_100034875 3300005365 Bacteria 3052
49 Ga0070688_100169452 3300005365 Bacteria 1505
50 Ga0070688_100250071 3300005365 Unclassified 1262
51 Ga0070667_100022288 3300005367 Bacteria 5255
52 Ga0070667_100057268 3300005367 Bacteria 3294
53 Ga0070667_100205627 3300005367 Bacteria 1748
54 Ga0070703_10030703 3300005406 Unclassified 1621
55 Ga0070709_10071049 3300005434 Bacteria 2246
56 Ga0070709_10099188 3300005434 Unclassified 1937
57 Ga0070714_100054657 3300005435 Bacteria 3411
58 Ga0070713_100069420 3300005436 Unclassified 2971
59 Ga0070701_10040089 3300005438 Bacteria 2379
60 Ga0070701_10148322 3300005438 Bacteria 1348
61 Ga0070701_10194275 3300005438 Bacteria 1196
62 Ga0070711_100200363 3300005439 Bacteria 1540
63 Ga0070705_100022317 3300005440 Bacteria 3381
64 Ga0070700_100018153 3300005441 Bacteria 4039
65 Ga0070694_100012406 3300005444 Bacteria 5296
66 Ga0070694_100018659 3300005444 Bacteria 4405
67 Ga0070694_100049731 3300005444 Bacteria 2824
68 Ga0070694_100079716 3300005444 Bacteria 2274
69 Ga0070694_100402596 3300005444 Bacteria 1072
70 Ga0070708_100505920 3300005445 Unclassified 1139
71 Ga0070678_100003316 3300005456 Bacteria 8955
72 Ga0070678_100192055 3300005456 Bacteria 1679
73 Ga0070662_100094530 3300005457 Bacteria 2251
74 Ga0070662_100147453 3300005457 Bacteria 1829
75 Ga0070662_100242114 3300005457 Bacteria 1447
76 Ga0070681_10427219 3300005458 Unclassified 1237
77 Ga0068867_100002075 3300005459 Bacteria 14042
78 Ga0068867_100006297 3300005459 Bacteria 8396
79 Ga0068867_100008030 3300005459 Bacteria 7459
80 Ga0068867_100084626 3300005459 Bacteria 2396
81 Ga0070706_100011704 3300005467 Bacteria 8143
82 Ga0070706_100012509 3300005467 Bacteria 7860
83 Ga0070706_100192377 3300005467 Bacteria 1906
84 Ga0070706_100310088 3300005467 Bacteria 1472
85 Ga0070707_100014338 3300005468 Bacteria 7430
86 Ga0070707_100220807 3300005468 Bacteria 1846
87 Ga0070698_100019157 3300005471 Bacteria 7194
88 Ga0070698_100019232 3300005471 Bacteria 7176
89 Ga0070698_100028041 3300005471 Bacteria 5852
90 Ga0070698_100032063 3300005471 Bacteria 5445
91 Ga0070698_100200224 3300005471 Bacteria 1933
92 Ga0070699_100001478 3300005518 Bacteria 21521
93 Ga0070699_100004519 3300005518 Bacteria 12311
94 Ga0070699_100032818 3300005518 Bacteria 4484
95 Ga0070699_100071834 3300005518 Bacteria 3010
96 Ga0070699_100110423 3300005518 Bacteria 2414
97 Ga0070679_100219458 3300005530 Bacteria 1863
98 Ga0070684_100181808 3300005535 Bacteria 1912
99 Ga0070697_100020652 3300005536 Bacteria 5213
100 Ga0070697_100092703 3300005536 Bacteria 2500
101 Ga0070697_100095605 3300005536 Bacteria 2464
102 Ga0070697_100394030 3300005536 Bacteria 1201
103 Ga0068853_100278383 3300005539 Bacteria 1542
104 Ga0068853_100678191 3300005539 Bacteria 982
105 Ga0070672_100028622 3300005543 Bacteria 4170
106 Ga0070672_100062270 3300005543 Bacteria 2944
107 Ga0070672_100094880 3300005543 Bacteria 2412
108 Ga0070672_100247451 3300005543 Bacteria 1501
109 Ga0070672_100379155 3300005543 Bacteria 1209
110 Ga0070672_100500864 3300005543 Bacteria 1051
111 Ga0070686_100000389 3300005544 Bacteria 28031
112 Ga0070686_100009670 3300005544 Bacteria 5421
113 Ga0070686_100068212 3300005544 Bacteria 2319
114 Ga0070695_100006557 3300005545 Bacteria 6878
115 Ga0070695_100008088 3300005545 Bacteria 6231
116 Ga0070695_100009348 3300005545 Bacteria 5832
117 Ga0070695_100050006 3300005545 Bacteria 2678
118 Ga0070696_100014340 3300005546 Bacteria 5315
119 Ga0070696_100037917 3300005546 Bacteria 3325
120 Ga0070696_100084821 3300005546 Bacteria 2248
121 Ga0070696_100206394 3300005546 Bacteria 1469
122 Ga0070696_100276345 3300005546 Bacteria 1279
123 Ga0070693_100128802 3300005547 Bacteria 1579
124 Ga0070665_100001535 3300005548 Bacteria 26671
125 Ga0070665_100005633 3300005548 Bacteria 12877
126 Ga0070665_100464003 3300005548 Bacteria 1277
127 Ga0070704_100003916 3300005549 Bacteria 8569
128 Ga0070704_100023161 3300005549 Bacteria 4050
129 Ga0070704_100050537 3300005549 Bacteria 2923
130 Ga0070704_100080914 3300005549 Bacteria 2391
131 Ga0070704_100146523 3300005549 Bacteria 1851
132 Ga0070704_100378791 3300005549 Unclassified 1201
133 Ga0070664_100018344 3300005564 Bacteria 5747
134 Ga0068857_100142398 3300005577 Bacteria 2168
135 Ga0068857_100524412 3300005577 Bacteria 1114
136 Ga0068854_100011771 3300005578 Bacteria 5710
137 Ga0068854_100034635 3300005578 Bacteria 3528
138 Ga0068854_100224822 3300005578 Bacteria 1487
139 Ga0068856_100020616 3300005614 Bacteria 6405
140 Ga0070702_100000153 3300005615 Bacteria 21550
141 Ga0070702_100076128 3300005615 Bacteria 1997
142 Ga0070702_100139383 3300005615 Bacteria 1543
143 Ga0068859_100002430 3300005617 Bacteria 18973
144 Ga0068859_100010205 3300005617 Bacteria 9453
145 Ga0068859_100010819 3300005617 Bacteria 9184
146 Ga0068859_100076006 3300005617 Bacteria 3399
147 Ga0068859_100213567 3300005617 Bacteria 2016
148 Ga0068859_100401924 3300005617 Bacteria 1466
149 Ga0068859_100862943 3300005617 Bacteria 991
150 Ga0068864_100017239 3300005618 Bacteria 6022
151 Ga0068864_100468257 3300005618 Bacteria 1208
152 Ga0068864_100649680 3300005618 Bacteria 1027
153 Ga0068861_100009190 3300005719 Bacteria 6816
154 Ga0068861_100039211 3300005719 Bacteria 3534
155 Ga0068861_100258100 3300005719 Bacteria 1491
156 Ga0068870_10003571 3300005840 Bacteria 6593
157 Ga0068870_10211075 3300005840 Bacteria 1183
158 Ga0068863_100007204 3300005841 Bacteria 10910
159 Ga0068863_100075448 3300005841 Bacteria 3190
160 Ga0068863_100083398 3300005841 Bacteria 3029
161 Ga0068863_100176568 3300005841 Bacteria 2050
162 Ga0068863_100700121 3300005841 Bacteria 1007
163 Ga0068858_100017801 3300005842 Bacteria 6652
164 Ga0068858_100021737 3300005842 Bacteria 5994
165 Ga0068858_100022246 3300005842 Bacteria 5920
166 Ga0068858_100062574 3300005842 Bacteria 3441
167 Ga0068858_100079687 3300005842 Bacteria 3043
168 Ga0068858_100175688 3300005842 Bacteria 2021
169 Ga0068858_100214731 3300005842 Bacteria 1821
170 Ga0068860_100017112 3300005843 Bacteria 7067
171 Ga0068860_100084173 3300005843 Bacteria 3025
172 Ga0068860_100237809 3300005843 Unclassified 1771
173 Ga0068860_100690453 3300005843 Bacteria 1030
174 Ga0068862_100039812 3300005844 Bacteria 3994
175 Ga0068862_100053930 3300005844 Bacteria 3442
176 Ga0068862_100115564 3300005844 Bacteria 2360
177 Ga0068862_100116919 3300005844 Bacteria 2346
178 Ga0068862_100202123 3300005844 Bacteria 1792
179 Ga0068862_100307396 3300005844 Unclassified 1460
180 Ga0068862_100309333 3300005844 Bacteria 1456
181 Ga0068862_100448362 3300005844 Bacteria 1216
182 Ga0068862_100479580 3300005844 Bacteria 1177
183 Ga0068862_100600230 3300005844 Bacteria 1057
184 Ga0081455_10073814 3300005937 Bacteria 2819
185 Ga0081455_10152618 3300005937 Unclassified 1779
186 Ga0081538_10046027 3300005981 Bacteria 2697
187 Ga0081539_10000093 3300005985 Bacteria 207314
188 Ga0081539_10018173 3300005985 Bacteria 4893
189 Ga0075365_10001234 3300006038 Bacteria 11312
190 Ga0075368_10015337 3300006042 Bacteria 2842
191 Ga0075363_100024048 3300006048 Bacteria 3094
192 Ga0075363_100127602 3300006048 Bacteria 1425
193 Ga0075364_10016789 3300006051 Bacteria 4560
194 Ga0075364_10052859 3300006051 Bacteria 2655
195 Ga0075364_10068331 3300006051 Unclassified 2337
196 Ga0075364_10158757 3300006051 Bacteria 1526
197 Ga0070712_100413800 3300006175 Bacteria 1116
198 Ga0075367_10000879 3300006178 Bacteria 12052
199 Ga0075367_10001875 3300006178 Bacteria 9299
200 Ga0075366_10000322 3300006195 Bacteria 21867
201 Ga0097621_100022037 3300006237 Bacteria 4940
202 Ga0097621_100025087 3300006237 Bacteria 4662
203 Ga0097621_100050591 3300006237 Bacteria 3379
204 Ga0097621_100051939 3300006237 Bacteria 3337
205 Ga0097621_100474135 3300006237 Bacteria 1130
206 Ga0075370_10112040 3300006353 Unclassified 1585
207 Ga0068871_100002675 3300006358 Bacteria 12162
208 Ga0068871_100005949 3300006358 Bacteria 8586
209 Ga0068871_100010750 3300006358 Bacteria 6694
210 Ga0068871_100055165 3300006358 Bacteria 3226
211 Ga0068871_100220821 3300006358 Bacteria 1642
212 Ga0075428_100000185 3300006844 Bacteria 58526
213 Ga0075428_100001446 3300006844 Bacteria 25375
214 Ga0075428_100006198 3300006844 Bacteria 13304
215 Ga0075428_100009291 3300006844 Bacteria 10901
216 Ga0075428_100035422 3300006844 Bacteria 5503
217 Ga0075428_100044494 3300006844 Bacteria 4879
218 Ga0075428_100049566 3300006844 Bacteria 4607
219 Ga0075428_100121374 3300006844 Bacteria 2846
220 Ga0075428_100125903 3300006844 Bacteria 2788
221 Ga0075428_100235005 3300006844 Bacteria 1978
222 Ga0075428_100322682 3300006844 Bacteria 1659
223 Ga0075430_100029567 3300006846 Bacteria 4649
224 Ga0075430_100041017 3300006846 Bacteria 3917
225 Ga0075431_100000373 3300006847 Bacteria 35683
226 Ga0075431_100200574 3300006847 Unclassified 2041
227 Ga0075433_10002985 3300006852 Bacteria 12993
228 Ga0075433_10021172 3300006852 Bacteria 5449
229 Ga0075433_10119754 3300006852 Bacteria 2337
230 Ga0075433_10196348 3300006852 Bacteria 1795
231 Ga0075433_10362897 3300006852 Bacteria 1279
232 Ga0075434_100018881 3300006871 Bacteria 6665
233 Ga0075434_100046329 3300006871 Bacteria 4315
234 Ga0075434_100055954 3300006871 Bacteria 3920
235 Ga0075434_100078644 3300006871 Bacteria 3294
236 Ga0075434_100088081 3300006871 Bacteria 3105
237 Ga0075434_100103133 3300006871 Bacteria 2860
238 Ga0075434_100116335 3300006871 Bacteria 2687
239 Ga0075434_100139413 3300006871 Bacteria 2444
240 Ga0075434_100147879 3300006871 Bacteria 2370
241 Ga0075434_100213999 3300006871 Bacteria 1947
242 Ga0075434_100232096 3300006871 Bacteria 1865
243 Ga0075434_100686417 3300006871 Bacteria 1042
244 Ga0075429_100004956 3300006880 Bacteria 11469
245 Ga0075429_100021887 3300006880 Bacteria 5542
246 Ga0075429_100057532 3300006880 Unclassified 3385
247 Ga0075429_100059596 3300006880 Bacteria 3325
248 Ga0075429_100182682 3300006880 Bacteria 1838
249 Ga0068865_100014920 3300006881 Bacteria 4946
250 Ga0068865_100052129 3300006881 Bacteria 2835
251 Ga0068865_100079374 3300006881 Bacteria 2351
252 Ga0068865_100118849 3300006881 Unclassified 1962
253 Ga0068865_100196771 3300006881 Bacteria 1562
254 Ga0068865_100411148 3300006881 Bacteria 1110
255 Ga0068865_100454968 3300006881 Bacteria 1059
256 Ga0075436_100001874 3300006914 Bacteria 14448
257 Ga0075436_100009966 3300006914 Bacteria 6501
258 Ga0075436_100029447 3300006914 Bacteria 3776
259 Ga0075436_100043595 3300006914 Bacteria 3093
260 Ga0075436_100058963 3300006914 Bacteria 2651
261 Ga0097620_100002430 3300006931 Bacteria 18973
262 Ga0097620_100010205 3300006931 Bacteria 9453
263 Ga0097620_100010819 3300006931 Bacteria 9184
264 Ga0097620_100076008 3300006931 Bacteria 3399
265 Ga0097620_100213557 3300006931 Bacteria 2016
266 Ga0097620_100401942 3300006931 Bacteria 1466
267 Ga0097620_100863149 3300006931 Bacteria 991
268 Ga0075435_100000052 3300007076 Bacteria 58955
269 Ga0075435_100000404 3300007076 Bacteria 26487
270 Ga0075435_100003568 3300007076 Bacteria 10570
271 Ga0075435_100003713 3300007076 Bacteria 10397
272 Ga0075435_100015716 3300007076 Bacteria 5694
273 Ga0075435_100089258 3300007076 Bacteria 2541
274 Ga0075435_100529093 3300007076 Bacteria 1020
275 Ga0099794_10047989 3300007265 Bacteria 2049
276 Ga0105240_10080775 3300009093 Bacteria 3997
277 Ga0105240_10092713 3300009093 Bacteria 3688
278 Ga0105240_10243836 3300009093 Bacteria 2082
279 Ga0105240_10262018 3300009093 Bacteria 1994
280 Ga0105240_10558426 3300009093 Unclassified 1266
281 Ga0105240_10646204 3300009093 Bacteria 1160
282 Ga0111539_10000156 3300009094 Bacteria 77946
283 Ga0111539_10000160 3300009094 Bacteria 76643
284 Ga0111539_10000602 3300009094 Bacteria 46554
285 Ga0111539_10000696 3300009094 Bacteria 43539
286 Ga0111539_10001042 3300009094 Bacteria 36422
287 Ga0111539_10004422 3300009094 Bacteria 18377
288 Ga0111539_10006977 3300009094 Bacteria 14496
289 Ga0111539_10008296 3300009094 Bacteria 13224
290 Ga0111539_10013117 3300009094 Bacteria 10365
291 Ga0111539_10060587 3300009094 Bacteria 4485
292 Ga0111539_10175052 3300009094 Bacteria 2506
293 Ga0111539_10194097 3300009094 Bacteria 2368
294 Ga0111539_10248669 3300009094 Unclassified 2070
295 Ga0111539_10358186 3300009094 Unclassified 1698
296 Ga0111539_10392133 3300009094 Bacteria 1617
297 Ga0105245_10011551 3300009098 Bacteria 7692
298 Ga0105245_10128529 3300009098 Bacteria 2374
299 Ga0105247_10009155 3300009101 Bacteria 6027
300 Ga0114129_10000307 3300009147 Bacteria 57086
301 Ga0114129_10000789 3300009147 Bacteria 40604
302 Ga0114129_10022026 3300009147 Bacteria 9044
303 Ga0114129_10031216 3300009147 Bacteria 7534
304 Ga0114129_10041136 3300009147 Bacteria 6515
305 Ga0114129_10072173 3300009147 Bacteria 4813
306 Ga0114129_10074016 3300009147 Bacteria 4745
307 Ga0114129_10105727 3300009147 Bacteria 3889
308 Ga0114129_10187299 3300009147 Bacteria 2812
309 Ga0114129_10190198 3300009147 Bacteria 2788
310 Ga0114129_10205497 3300009147 Bacteria 2665
311 Ga0114129_10233471 3300009147 Bacteria 2476
312 Ga0114129_10306477 3300009147 Bacteria 2115
313 Ga0114129_10373801 3300009147 Unclassified 1883
314 Ga0114129_10609664 3300009147 Bacteria 1413
315 Ga0114129_10764197 3300009147 Unclassified 1236
316 Ga0105243_10026757 3300009148 Bacteria 4417
317 Ga0105243_10032527 3300009148 Bacteria 4031
318 Ga0105242_10009242 3300009176 Bacteria 7563
319 Ga0105242_10014541 3300009176 Bacteria 6098
320 Ga0105242_10026694 3300009176 Bacteria 4578
321 Ga0105242_10046424 3300009176 Bacteria 3523
322 Ga0105242_10166914 3300009176 Bacteria 1932
323 Ga0105242_10211456 3300009176 Bacteria 1729
324 Ga0105242_10626399 3300009176 Bacteria 1043
325 Ga0105248_10000664 3300009177 Bacteria 39095
326 Ga0105248_10013204 3300009177 Bacteria 9093
327 Ga0105248_10022913 3300009177 Bacteria 6935
328 Ga0105248_10036959 3300009177 Bacteria 5462
329 Ga0105248_10076990 3300009177 Bacteria 3749
330 Ga0105248_10085756 3300009177 Bacteria 3543
331 Ga0105248_10093898 3300009177 Bacteria 3379
332 Ga0105248_10098891 3300009177 Bacteria 3287
333 Ga0105248_10102078 3300009177 Bacteria 3233
334 Ga0105248_10781633 3300009177 Bacteria 1077
335 Ga0105237_10163863 3300009545 Bacteria 2222
336 Ga0105238_10209861 3300009551 Bacteria 1923
337 Ga0105249_10174424 3300009553 Bacteria 2087
338 Ga0105249_10201704 3300009553 Unclassified 1947
339 Ga0105239_10408535 3300010375 Unclassified 1537
340 Ga0157374_10002073 3300013296 Bacteria 16874
341 Ga0163162_10300551 3300013306 Unclassified 1737
342 Ga0157375_10231243 3300013308 Bacteria 2008
343 Ga0157375_10261724 3300013308 Bacteria 1891
344 Ga0157375_10504432 3300013308 Bacteria 1374
345 Ga0157375_10595022 3300013308 Bacteria 1265
346 Ga0157375_11017378 3300013308 Bacteria 968
347 Ga0163163_10000071 3300014325 Bacteria 112778
348 Ga0163163_10015069 3300014325 Bacteria 7131
349 Ga0163163_10068131 3300014325 Bacteria 3540
350 Ga0163163_10298179 3300014325 Unclassified 1664
351 Ga0157380_10013458 3300014326 Bacteria 5964
352 Ga0157380_10037774 3300014326 Bacteria 3744
353 Ga0157380_10095651 3300014326 Bacteria 2461
354 Ga0157380_10170281 3300014326 Bacteria 1902
355 Ga0157380_10356277 3300014326 Bacteria 1371
356 Ga0157377_10019370 3300014745 Bacteria 3554
357 Ga0157379_10033107 3300014968 Bacteria 4608
358 Ga0157379_10033243 3300014968 Bacteria 4600
359 Ga0157379_10044852 3300014968 Bacteria 3946
360 Ga0157379_10172233 3300014968 Bacteria 1954
361 Ga0157376_10019635 3300014969 Bacteria 5214
362 Ga0157376_10036751 3300014969 Bacteria 3970
363 Ga0157376_10144372 3300014969 Bacteria 2139
364 Ga0157376_10148821 3300014969 Bacteria 2109
365 Ga0157376_10338809 3300014969 Bacteria 1435
366 Ga0157376_10341882 3300014969 Bacteria 1429
367 Ga0157376_10669417 3300014969 Bacteria 1040
368 Ga0207697_10080375 3300025315 Bacteria 1373
369 Ga0207697_10100482 3300025315 Bacteria 1232
370 Ga0207653_10021645 3300025885 Unclassified 2039
371 Ga0207642_10019615 3300025899 Bacteria 2622
372 Ga0207710_10052606 3300025900 Bacteria 1831
373 Ga0207688_10038394 3300025901 Bacteria 2657
374 Ga0207680_10100316 3300025903 Bacteria 1859
375 Ga0207680_10268807 3300025903 Unclassified 1182
376 Ga0207680_10395067 3300025903 Bacteria 976
377 Ga0207685_10073529 3300025905 Bacteria 1393
378 Ga0207645_10000703 3300025907 Bacteria 27863
379 Ga0207645_10020740 3300025907 Bacteria 4297
380 Ga0207643_10003545 3300025908 Bacteria 8401
381 Ga0207643_10038629 3300025908 Bacteria 2682
382 Ga0207684_10002365 3300025910 Bacteria 19093
383 Ga0207684_10011424 3300025910 Bacteria 7769
384 Ga0207684_10057251 3300025910 Bacteria 3307
385 Ga0207684_10166296 3300025910 Bacteria 1901
386 Ga0207695_10206287 3300025913 Bacteria 1878
387 Ga0207695_10306351 3300025913 Bacteria 1479
388 Ga0207662_10010058 3300025918 Bacteria 5215
389 Ga0207662_10011304 3300025918 Bacteria 4945
390 Ga0207662_10072333 3300025918 Bacteria 2089
391 Ga0207662_10124767 3300025918 Bacteria 1618
392 Ga0207662_10217663 3300025918 Bacteria 1242
393 Ga0207662_10363168 3300025918 Bacteria 975
394 Ga0207652_10196227 3300025921 Bacteria 1816
395 Ga0207646_10038448 3300025922 Bacteria 4310
396 Ga0207646_10082584 3300025922 Bacteria 2873
397 Ga0207646_10099480 3300025922 Bacteria 2606
398 Ga0207646_10159188 3300025922 Bacteria 2037
399 Ga0207681_10025744 3300025923 Bacteria 3787
400 Ga0207681_10064591 3300025923 Bacteria 2528
401 Ga0207681_10110831 3300025923 Bacteria 1996
402 Ga0207681_10255692 3300025923 Bacteria 1369
403 Ga0207681_10361668 3300025923 Bacteria 1164
404 Ga0207650_10003830 3300025925 Bacteria 10286
405 Ga0207659_10000076 3300025926 Bacteria 62373
406 Ga0207659_10448836 3300025926 Bacteria 1086
407 Ga0207687_10008761 3300025927 Bacteria 6612
408 Ga0207687_10009881 3300025927 Bacteria 6247
409 Ga0207700_10036920 3300025928 Bacteria 3534
410 Ga0207664_10076262 3300025929 Bacteria 2713
411 Ga0207644_10380629 3300025931 Bacteria 1151
412 Ga0207706_10040920 3300025933 Bacteria 4108
413 Ga0207706_10105559 3300025933 Bacteria 2479
414 Ga0207706_10252015 3300025933 Bacteria 1542
415 Ga0207686_10004368 3300025934 Bacteria 7578
416 Ga0207686_10049941 3300025934 Bacteria 2599
417 Ga0207686_10054142 3300025934 Bacteria 2512
418 Ga0207686_10223851 3300025934 Bacteria 1360
419 Ga0207709_10028376 3300025935 Bacteria 3235
420 Ga0207670_10028759 3300025936 Bacteria 3534
421 Ga0207670_10063060 3300025936 Bacteria 2535
422 Ga0207670_10154530 3300025936 Bacteria 1706
423 Ga0207670_10257510 3300025936 Bacteria 1351
424 Ga0207670_10373440 3300025936 Bacteria 1134
425 Ga0207669_10023792 3300025937 Bacteria 3279
426 Ga0207669_10030630 3300025937 Bacteria 2992
427 Ga0207669_10058849 3300025937 Bacteria 2347
428 Ga0207669_10375172 3300025937 Bacteria 1107
429 Ga0207669_10411576 3300025937 Bacteria 1062
430 Ga0207704_10014182 3300025938 Bacteria 4017
431 Ga0207704_10045320 3300025938 Bacteria 2612
432 Ga0207691_10022611 3300025940 Bacteria 5929
433 Ga0207691_10084145 3300025940 Bacteria 2856
434 Ga0207691_10087212 3300025940 Bacteria 2800
435 Ga0207691_10131951 3300025940 Bacteria 2206
436 Ga0207691_10390183 3300025940 Bacteria 1188
437 Ga0207711_10033049 3300025941 Bacteria 4376
438 Ga0207711_10077122 3300025941 Unclassified 2904
439 Ga0207711_10100385 3300025941 Bacteria 2560
440 Ga0207711_10129375 3300025941 Bacteria 2262
441 Ga0207711_10427666 3300025941 Bacteria 1232
442 Ga0207689_10005018 3300025942 Bacteria 11923
443 Ga0207689_10067106 3300025942 Bacteria 2949
444 Ga0207689_10067247 3300025942 Bacteria 2945
445 Ga0207689_10106293 3300025942 Unclassified 2306
446 Ga0207679_10010589 3300025945 Bacteria 5941
447 Ga0207679_10074596 3300025945 Bacteria 2571
448 Ga0207651_10050157 3300025960 Bacteria 2832
449 Ga0207651_10056443 3300025960 Bacteria 2703
450 Ga0207651_10181184 3300025960 Bacteria 1671
451 Ga0207712_10051925 3300025961 Unclassified 2869
452 Ga0207712_10249743 3300025961 Bacteria 1433
453 Ga0207640_10014136 3300025981 Bacteria 4589
454 Ga0207640_10284612 3300025981 Bacteria 1300
455 Ga0207658_10357747 3300025986 Bacteria 1273
456 Ga0207658_10465473 3300025986 Unclassified 1121
457 Ga0207677_10113727 3300026023 Bacteria 2021
458 Ga0207677_10138745 3300026023 Bacteria 1858
459 Ga0207703_10008893 3300026035 Bacteria 7913
460 Ga0207703_10021021 3300026035 Bacteria 5107
461 Ga0207703_10024671 3300026035 Bacteria 4731
462 Ga0207703_10046292 3300026035 Bacteria 3503
463 Ga0207703_10100743 3300026035 Bacteria 2448
464 Ga0207703_10242630 3300026035 Bacteria 1620
465 Ga0207703_10543874 3300026035 Bacteria 1094
466 Ga0207703_10702541 3300026035 Unclassified 962
467 Ga0207639_10597866 3300026041 Bacteria 1017
468 Ga0207708_10007104 3300026075 Bacteria 8270
469 Ga0207708_10022108 3300026075 Bacteria 4803
470 Ga0207708_10053476 3300026075 Bacteria 3077
471 Ga0207708_10166396 3300026075 Bacteria 1743
472 Ga0207702_10154700 3300026078 Bacteria 2089
473 Ga0207641_10002582 3300026088 Bacteria 16638
474 Ga0207641_10067332 3300026088 Unclassified 3067
475 Ga0207641_10123881 3300026088 Bacteria 2311
476 Ga0207641_10211034 3300026088 Bacteria 1796
477 Ga0207641_10360096 3300026088 Bacteria 1389
478 Ga0207641_10541862 3300026088 Bacteria 1134
479 Ga0207648_10021347 3300026089 Bacteria 5820
480 Ga0207648_10024283 3300026089 Bacteria 5414
481 Ga0207648_10126285 3300026089 Unclassified 2250
482 Ga0207648_10184678 3300026089 Bacteria 1846
483 Ga0207648_10209558 3300026089 Bacteria 1730
484 Ga0207648_10496780 3300026089 Bacteria 1116
485 Ga0207676_10014449 3300026095 Bacteria 5681
486 Ga0207676_10107590 3300026095 Bacteria 2326
487 Ga0207676_10615925 3300026095 Bacteria 1044
488 Ga0207674_10226012 3300026116 Bacteria 1820
489 Ga0207674_10374976 3300026116 Bacteria 1375
490 Ga0207675_100012476 3300026118 Bacteria 7937
491 Ga0207675_100060424 3300026118 Bacteria 3538
492 Ga0207675_100062193 3300026118 Bacteria 3486
493 Ga0207675_100140677 3300026118 Bacteria 2293
494 Ga0207675_100177556 3300026118 Bacteria 2038
495 Ga0207683_10026222 3300026121 Bacteria 5031
496 Ga0207683_10081641 3300026121 Bacteria 2870
497 Ga0207683_10228387 3300026121 Bacteria 1697
498 Ga0207683_10342453 3300026121 Bacteria 1371
499 Ga0207428_10000070 3300027907 Bacteria 147650
500 Ga0207428_10000234 3300027907 Bacteria 76592
501 Ga0207428_10000400 3300027907 Bacteria 53869
502 Ga0207428_10001302 3300027907 Bacteria 26596
503 Ga0207428_10018313 3300027907 Bacteria 5984
504 Ga0207428_10058479 3300027907 Bacteria 3059
505 Ga0207428_10265195 3300027907 Bacteria 1278
506 Ga0268266_10003216 3300028379 Bacteria 16509
507 Ga0268265_10016423 3300028380 Bacteria 5085
508 Ga0268265_10027810 3300028380 Bacteria 4041
509 Ga0268265_10162126 3300028380 Bacteria 1901
510 Ga0268265_10199289 3300028380 Bacteria 1735
511 Ga0268265_10227279 3300028380 Bacteria 1637
512 Ga0268265_10450452 3300028380 Bacteria 1202
513 Ga0268265_10532082 3300028380 Bacteria 1113
514 Ga0268264_10043485 3300028381 Bacteria 3722
515 Ga0268264_10108713 3300028381 Bacteria 2425
516 Ga0268264_10133144 3300028381 Bacteria 2207
517 Ga0268264_10158713 3300028381 Bacteria 2035
518 Ga0268264_10317624 3300028381 Bacteria 1472
519 Ga0265316_10157511 3300031344 Bacteria 1699
520 Ga0307408_100044867 3300031548 Bacteria 3153
521 Ga0307408_100076075 3300031548 Bacteria 2496
522 Ga0307408_100169148 3300031548 Bacteria 1744
523 Ga0265314_10129545 3300031711 Bacteria 1576
524 Ga0307409_100043273 3300031995 Bacteria 3380
525 Ga0307409_100130442 3300031995 Bacteria 2147
526 Ga0307416_100144179 3300032002 Bacteria 2171
527 Ga0307416_100218624 3300032002 Unclassified 1825
528 Ga0307411_10157774 3300032005 Bacteria 1695
529 Ga0307411_10356225 3300032005 Bacteria 1195
530 Ga0307415_100230100 3300032126 Bacteria 1492
531 Ga0373930_0000070 3300034816 Bacteria 9941
532 Ga0373948_0008242 3300034817 Bacteria 1770
533 Ga0373958_0000542 3300034819 Bacteria 4712
534 Ga0373934_0000325 3300035086 Bacteria 16805
535 Ga0373940_0000640 3300035088 Bacteria 5594
536 Ga0373949_0000540 3300035090 Bacteria 12471
537 Ga0373951_0000475 3300035091 Bacteria 11487
538 Ga0373952_0001255 3300035092 Bacteria 4629
539 Ga0373939_0005973 3300035114 Bacteria 2917
540 Ga0373939_0010136 3300035114 Bacteria 2349
541 Ga0373941_0004778 3300035115 Bacteria 3151
542 Ga0373956_0046774 3300035119 Bacteria 1934
543 Ga0373957_0004234 3300035120 Bacteria 4349
544 Ga0373946_0066593 3300035171 Bacteria 1545
545 Ga0373942_0000397 3300035207 Bacteria 12081
546 Ga0373961_0001526 3300035241 Bacteria 6709
547 Ga0373962_0000747 3300035242 Bacteria 7374
548 Ga0373924_0079333 3300035410 Bacteria 1394
549 Ga0373931_0000745 3300035691 Bacteria 13573
550 Ga0373931_0098264 3300035691 Bacteria 1643
551 Ga0373933_0082877 3300035724 Bacteria 1969
552 Ga0373933_0300647 3300035724 Unclassified 1039
553 Ga0373947_0155390 3300035725 Bacteria 1476
554 Ga0373937_0000553 3300036401 Bacteria 33171
555 Ga0373937_0061534 3300036401 Bacteria 3451
556 Ga0373937_0099930 3300036401 Bacteria 2691
557 Ga0373937_0153381 3300036401 Bacteria 2159
558 Ga0373937_0283328 3300036401 Unclassified 1565
559 Ga0373937_0386871 3300036401 Bacteria 1327
560 Ga0373925_0086098 3300037068 Bacteria 2397
561 Ga0373925_0140146 3300037068 Bacteria 1892
562 Ga0395901_0413018 3300038443 Unclassified 1385
563 Ga0450923_006411 3300042125 Bacteria 1950
564 Ga0451577_0286690 3300042876 Unclassified 1492
565 Ga0453684_0089560 3300044712 Bacteria 3805
566 Ga0451576_0219836 3300045051 Bacteria 1983
567 Ga0451576_0789040 3300045051 Bacteria 997
568 Ga0466967_0246898 3300045976 Bacteria 1704
569 Ga0495629_0286003 3300046459 Bacteria 1131
570 Ga0495638_0015021 3300046460 Bacteria 5213
571 Ga0495580_0079243 3300046472 Bacteria 2291
572 Ga0495580_0164754 3300046472 Bacteria 1534
573 Ga0495608_0003061 3300046511 Bacteria 11950
574 Ga0495628_0032621 3300046516 Bacteria 4203
575 Ga0495628_0090587 3300046516 Unclassified 2368
576 Ga0495630_0003233 3300046517 Bacteria 11349
577 Ga0495643_0005940 3300046522 Bacteria 8145
578 Ga0495652_0105738 3300046529 Bacteria 2274
579 Ga0495586_0068635 3300046535 Bacteria 1934
580 Ga0495645_0000493 3300046543 Bacteria 27347
581 Ga0495633_0117561 3300046558 Bacteria 1232
582 Ga0495656_0095683 3300046615 Bacteria 1366
583 Ga0495634_0250667 3300046642 Bacteria 1083
584 Ga0495635_0048819 3300046663 Bacteria 2918
585 Ga0495659_0112090 3300046664 Bacteria 1066
586 Ga0495588_0023407 3300046674 Bacteria 3058
587 Ga0495599_0296464 3300046678 Bacteria 977
588 Ga0495647_0100015 3300046681 Bacteria 1200
589 Ga0495658_0038388 3300046683 Bacteria 2652
590 Ga0495669_0007871 3300046684 Bacteria 4471
591 Ga0495613_0001719 3300046689 Bacteria 16660
592 Ga0495581_0154224 3300047315 Bacteria 1342
593 Ga0495674_0046339 3300047319 Bacteria 3859
594 Ga0495674_0054062 3300047319 Bacteria 3528
595 Ga0495674_0412679 3300047319 Unclassified 1089
596 Ga0495672_0000242 3300047320 Bacteria 76766
597 Ga0495672_0099714 3300047320 Bacteria 1578
598 Ga0495676_0147614 3300047321 Bacteria 1678
599 Ga0495680_0109726 3300047322 Bacteria 2046
600 Ga0495684_0000189 3300047471 Bacteria 47374
601 Ga0495684_0009207 3300047471 Bacteria 7622
602 Ga0496100_0069187 3300048903 Unclassified 2350
603 Ga0496101_0001075 3300048904 Bacteria 16188
604 Ga0496101_0083968 3300048904 Bacteria 2358
605 Ga0496101_0292003 3300048904 Bacteria 1276
606 Ga0496102_0022264 3300048905 Bacteria 5615
607 Ga0496102_0144120 3300048905 Bacteria 2235
608 Ga0496102_0185098 3300048905 Bacteria 1963
609 Ga0496104_0002797 3300048907 Bacteria 15033
610 Ga0496104_0082849 3300048907 Bacteria 3059
611 Ga0496104_0203622 3300048907 Unclassified 1891
612 Ga0496104_0484677 3300048907 Bacteria 1148
613 Ga0496105_0099450 3300048908 Bacteria 2402
614 Ga0496106_0025090 3300048909 Bacteria 4434
615 Ga0496106_0149327 3300048909 Bacteria 1843
616 Ga0496108_0006264 3300048911 Bacteria 9640
617 Ga0496109_0036244 3300048912 Bacteria 4453
618 Ga0496109_0078971 3300048912 Bacteria 3031
619 Ga0496110_0042319 3300048913 Bacteria 3976
620 Ga0496110_0083633 3300048913 Bacteria 2848
621 Ga0496112_0056169 3300048915 Bacteria 3874
622 Ga0496112_0141479 3300048915 Bacteria 2375
623 Ga0496113_0007690 3300048916 Bacteria 6955
624 Ga0496114_0025974 3300048917 Bacteria 4792
625 Ga0501031_0330088 3300049568 Bacteria 988
626 Ga0501034_0185918 3300049571 Bacteria 2041
627 Ga0501036_0017503 3300049572 Bacteria 5993
628 Ga0501036_0031898 3300049572 Bacteria 4451
629 Ga0501036_0042741 3300049572 Bacteria 3837
630 Ga0501040_0440721 3300049576 Bacteria 937
631 Ga0501041_0011415 3300049577 Bacteria 5250
632 Ga0501041_0039182 3300049577 Bacteria 2876
633 Ga0501041_0041088 3300049577 Bacteria 2808
634 Ga0501041_0094191 3300049577 Bacteria 1850
635 Ga0501042_0062972 3300049578 Bacteria 2651
636 Ga0501042_0096475 3300049578 Unclassified 2124
637 Ga0501046_0229602 3300049580 Bacteria 1372
638 Ga0501047_0032690 3300049581 Bacteria 5023
639 Ga0501048_0019805 3300049582 Bacteria 4934
640 Ga0501048_0077509 3300049582 Bacteria 2346
641 Ga0501068_0029322 3300049584 Bacteria 3257
642 Ga0501070_0236651 3300049586 Bacteria 1495
643 Ga0501071_0234230 3300049587 Bacteria 1384
644 Ga0501071_0477442 3300049587 Bacteria 955
645 Ga0501072_0055293 3300049588 Bacteria 3128
646 Ga0501072_0266474 3300049588 Bacteria 1363
647 Ga0501072_0314510 3300049588 Bacteria 1244
648 Ga0501074_0030646 3300049590 Bacteria 3898
649 Ga0501075_0120646 3300049591 Bacteria 1995
650 Ga0501075_0207427 3300049591 Bacteria 1495
651 Ga0501075_0247947 3300049591 Unclassified 1357
652 Ga0501076_0005951 3300049592 Bacteria 8808
653 Ga0501076_0016675 3300049592 Bacteria 5571
654 Ga0501076_0036858 3300049592 Bacteria 3834
655 Ga0501076_0046145 3300049592 Bacteria 3442
656 Ga0501077_0214540 3300049593 Bacteria 1223
657 Ga0501079_0017221 3300049741 Bacteria 5517
658 Ga0501079_0207115 3300049741 Bacteria 1532
659 Ga0501079_0426243 3300049741 Bacteria 1041
660 Ga0501080_0073196 3300049742 Bacteria 3187
661 Ga0501081_0065096 3300049743 Bacteria 2533
662 Ga0501081_0070876 3300049743 Bacteria 2429
663 Ga0501081_0110545 3300049743 Bacteria 1950
664 Ga0501083_0020813 3300049744 Bacteria 4560
665 Ga0501044_0357331 3300049823 Bacteria 1379
666 Ga0501045_0024604 3300049824 Bacteria 4324
667 Ga0501045_0031651 3300049824 Bacteria 3831
668 Ga0501045_0074879 3300049824 Bacteria 2493
669 nmdc:mga03n38_109712_c1 3300050490 Bacteria 1342
670 nmdc:mga00v17_14970_c1 3300050491 Bacteria 4344
671 nmdc:mga00v17_77327_c1 3300050491 Unclassified 2072
672 nmdc:mga0yw44_115556_c1 3300050492 Unclassified 1724
673 nmdc:mga0k408_1023_c1 3300050493 Bacteria 15335
674 nmdc:mga0k408_274502_c1 3300050493 Bacteria 1006
675 nmdc:mga0k408_48248_c1 3300050493 Bacteria 2462
676 nmdc:mga06z11_2066_c1 3300050494 Bacteria 7623
677 nmdc:mga06z11_48067_c1 3300050494 Bacteria 2170
678 nmdc:mga04h51_112180_c1 3300050495 Unclassified 1006
679 nmdc:mga07m45_110212_c1 3300050496 Unclassified 1585
680 nmdc:mga05p37_115943_c1 3300050507 Bacteria 3292
681 nmdc:mga05p37_118376_c1 3300050507 Bacteria 3255
682 nmdc:mga05p37_14644_c2 3300050507 Bacteria 8790
683 nmdc:mga05p37_158217_c1 3300050507 Bacteria 2768
684 nmdc:mga05p37_18019_c1 3300050507 Bacteria 8529
685 nmdc:mga05p37_18668_c1 3300050507 Bacteria 8381
686 nmdc:mga05p37_217260_c1 3300050507 Unclassified 2308
687 nmdc:mga05p37_225835_c1 3300050507 Bacteria 2258
688 nmdc:mga05p37_296188_c1 3300050507 Bacteria 1924
689 nmdc:mga05p37_34620_c1 3300050507 Bacteria 6187
690 nmdc:mga05p37_478104_c1 3300050507 Bacteria 1436
691 nmdc:mga05p37_56987_c1 3300050507 Bacteria 4812
692 nmdc:mga05p37_6282_c1 3300050507 Bacteria 13986
693 nmdc:mga05p37_639316_c1 3300050507 Bacteria 1194
694 nmdc:mga05p37_66740_c1 3300050507 Bacteria 4425
695 nmdc:mga05p37_6700_c1 3300050507 Bacteria 13572
696 nmdc:mga05p37_83007_c1 3300050507 Bacteria 3948
697 nmdc:mga05p37_96163_c2 3300050507 Bacteria 3055
698 nmdc:mga09592_2118_c1 3300050508 Bacteria 16016
699 nmdc:mga09592_21193_c1 3300050508 Bacteria 5355
700 nmdc:mga09592_21228_c1 3300050508 Bacteria 5351
701 nmdc:mga09592_39944_c1 3300050508 Bacteria 3942
702 nmdc:mga09592_447066_c1 3300050508 Bacteria 1115
703 nmdc:mga0qj67_9878_c1 3300050509 Bacteria 7115
704 nmdc:mga06r32_1608_c1 3300050510 Bacteria 20365
705 nmdc:mga06r32_239846_c1 3300050510 Bacteria 1801
706 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
707 nmdc:mga08y16_12823_c1 3300050511 Bacteria 8812
708 nmdc:mga08y16_15573_c1 3300050511 Bacteria 7995
709 nmdc:mga08y16_173550_c1 3300050511 Unclassified 2239
710 nmdc:mga08y16_1915_c1 3300050511 Bacteria 21221
711 nmdc:mga08y16_26035_c1 3300050511 Bacteria 6170
712 nmdc:mga08y16_280484_c1 3300050511 Bacteria 1719
713 nmdc:mga08y16_35677_c1 3300050511 Bacteria 5223
714 nmdc:mga08y16_389_c1 3300050511 Bacteria 40159
715 nmdc:mga08y16_5423_c1 3300050511 Bacteria 13335
716 nmdc:mga08y16_5683_c1 3300050511 Bacteria 13067
717 nmdc:mga08y16_594705_c1 3300050511 Bacteria 1116
718 nmdc:mga08y16_616171_c1 3300050511 Bacteria 1093
719 nmdc:mga08y16_882_c1 3300050511 Bacteria 28902
720 nmdc:mga0n895_101653_c1 3300050512 Bacteria 2885
721 nmdc:mga0n895_106475_c1 3300050512 Bacteria 2817
722 nmdc:mga0n895_223635_c1 3300050512 Bacteria 1911
723 nmdc:mga0n895_228054_c1 3300050512 Bacteria 1891
724 nmdc:mga0n895_312407_c1 3300050512 Bacteria 1593
725 nmdc:mga0n895_389462_c1 3300050512 Bacteria 1410
726 nmdc:mga0n895_49179_c1 3300050512 Bacteria 4130
727 nmdc:mga0n895_57664_c1 3300050512 Bacteria 3828
728 nmdc:mga0n895_61907_c1 3300050512 Bacteria 3696
729 nmdc:mga0n895_620916_c1 3300050512 Bacteria 1082
730 nmdc:mga0n895_66748_c1 3300050512 Bacteria 3562
731 nmdc:mga0n895_8_c1 3300050512 Bacteria 121439
732 nmdc:mga0rr50_131113_c1 3300050513 Bacteria 2007
733 nmdc:mga0rr50_183809_c1 3300050513 Bacteria 1710
734 nmdc:mga0rr50_23_c1 3300050513 Bacteria 116800
735 nmdc:mga0rr50_32880_c1 3300050513 Bacteria 3701
736 nmdc:mga0rr50_36661_c1 3300050513 Bacteria 3534
737 nmdc:mga0rr50_399644_c1 3300050513 Bacteria 1161
738 nmdc:mga0rr50_618_c1 3300050513 Bacteria 19051
739 nmdc:mga0rr50_629376_c1 3300050513 Bacteria 915
740 nmdc:mga0rr50_93444_c1 3300050513 Bacteria 2347
741 nmdc:mga08x19_100971_c1 3300050514 Bacteria 1914
742 nmdc:mga08x19_12493_c1 3300050514 Bacteria 5119
743 nmdc:mga08x19_165_c1 3300050514 Bacteria 54991
744 nmdc:mga08x19_9112_c1 3300050514 Bacteria 5925
745 nmdc:mga08x19_98642_c1 3300050514 Bacteria 1936
746 nmdc:mga0a205_132634_c1 3300050515 Bacteria 2391
747 nmdc:mga0a205_17674_c1 3300050515 Bacteria 6693
748 nmdc:mga0a205_182600_c1 3300050515 Bacteria 1991
749 nmdc:mga0a205_211484_c1 3300050515 Bacteria 1828
750 nmdc:mga0a205_255077_c1 3300050515 Bacteria 1633
751 nmdc:mga0a205_286039_c1 3300050515 Bacteria 1524
752 nmdc:mga0a205_390141_c1 3300050515 Unclassified 1257
753 nmdc:mga0a205_41360_c1 3300050515 Bacteria 4438
754 Ga0495601_0026265 3300053077 Bacteria 3594
755 Ga0495601_0056226 3300053077 Bacteria 2492
756 Ga0495601_0074765 3300053077 Bacteria 2168
757 Ga0495619_0004868 3300053085 Bacteria 8524
758 Ga0495619_0301359 3300053085 Unclassified 1110
759 Ga0500651_0242992 3300053093 Unclassified 1049
760 Ga0500555_022300 3300053103 Bacteria 1820
761 Ga0500568_0008892 3300053139 Bacteria 4804
762 Ga0501084_0038281 3300054114 Bacteria 4009
763 Ga0590071_000286 3300059421 Bacteria 14746
764 Ga0590074_002198 3300059423 Bacteria 3202
765 Ga0590077_000879 3300059426 Bacteria 7697
766 Ga0501082_0189629 3300060353 Bacteria 1789
767 Ga0501082_0196572 3300060353 Bacteria 1754
768 Ga0501082_0304890 3300060353 Bacteria 1387
769 Ga0501082_0420906 3300060353 Bacteria 1166
770 Ga0530510_0018199 3300061734 Bacteria 4981
771 Ga0530510_0039134 3300061734 Bacteria 3423
772 Ga0530510_0092617 3300061734 Bacteria 2206
773 Ga0530510_0126753 3300061734 Bacteria 1877
774 Ga0075434_100000731
775 JGI25406J46586_10009006
776 Ga0065714_10138713
777 Ga0065712_10001067
778 Ga0065712_10072264
779 Ga0065712_10107967
780 Ga0065712_10207944
781 Ga0065715_10001723
782 Ga0065715_10270509
783 Ga0065707_10000798
784 Ga0065707_10284468
785 Ga0070676_10000699
786 Ga0070676_10017521
787 Ga0070676_10068840
788 Ga0070683_100112517
789 Ga0070690_100033059
790 Ga0070690_100039162
791 Ga0070670_100098656
792 Ga0070670_100238307
793 Ga0068869_100000964
794 Ga0070666_10106778
795 Ga0068868_100136478
796 Ga0070689_100007688
797 Ga0070689_100164729
798 Ga0070689_100219068
799 Ga0070689_100380007
800 Ga0070691_10003375
801 Ga0070687_100038685
802 Ga0070687_100168436
803 Ga0070668_100103380
804 Ga0070669_100031922
805 Ga0070669_100043051
806 Ga0070669_100097555
807 Ga0070669_100137527
808 Ga0070669_100397713
809 Ga0070675_100005236
810 Ga0070675_100053786
811 Ga0070675_100126870
812 Ga0070675_100573310
813 Ga0070671_100026568
814 Ga0070674_100001871
815 Ga0070674_100059259
816 Ga0070674_100417024
817 Ga0070673_100041377
818 Ga0070673_100445383
819 Ga0070688_100007851
820 Ga0070688_100026468
821 Ga0070688_100034875
822 Ga0070688_100169452
823 Ga0070688_100250071
824 Ga0070667_100022288
825 Ga0070667_100057268
826 Ga0070667_100205627
827 Ga0070703_10030703
828 Ga0070709_10071049
829 Ga0070709_10099188
830 Ga0070714_100054657
831 Ga0070713_100069420
832 Ga0070701_10040089
833 Ga0070701_10148322
834 Ga0070701_10194275
835 Ga0070711_100200363
836 Ga0070705_100022317
837 Ga0070700_100018153
838 Ga0070694_100012406
839 Ga0070694_100018659
840 Ga0070694_100049731
841 Ga0070694_100079716
842 Ga0070694_100402596
843 Ga0070708_100505920
844 Ga0070678_100003316
845 Ga0070678_100192055
846 Ga0070662_100094530
847 Ga0070662_100147453
848 Ga0070662_100242114
849 Ga0070681_10427219
850 Ga0068867_100002075
851 Ga0068867_100006297
852 Ga0068867_100008030
853 Ga0068867_100084626
854 Ga0070706_100011704
855 Ga0070706_100012509
856 Ga0070706_100192377
857 Ga0070706_100310088
858 Ga0070707_100014338
859 Ga0070707_100220807
860 Ga0070698_100019157
861 Ga0070698_100019232
862 Ga0070698_100028041
863 Ga0070698_100032063
864 Ga0070698_100200224
865 Ga0070699_100001478
866 Ga0070699_100004519
867 Ga0070699_100032818
868 Ga0070699_100071834
869 Ga0070699_100110423
870 Ga0070679_100219458
871 Ga0070684_100181808
872 Ga0070697_100020652
873 Ga0070697_100092703
874 Ga0070697_100095605
875 Ga0070697_100394030
876 Ga0068853_100278383
877 Ga0068853_100678191
878 Ga0070672_100028622
879 Ga0070672_100062270
880 Ga0070672_100094880
881 Ga0070672_100247451
882 Ga0070672_100379155
883 Ga0070672_100500864
884 Ga0070686_100000389
885 Ga0070686_100009670
886 Ga0070686_100068212
887 Ga0070695_100006557
888 Ga0070695_100008088
889 Ga0070695_100009348
890 Ga0070695_100050006
891 Ga0070696_100014340
892 Ga0070696_100037917
893 Ga0070696_100084821
894 Ga0070696_100206394
895 Ga0070696_100276345
896 Ga0070693_100128802
897 Ga0070665_100001535
898 Ga0070665_100005633
899 Ga0070665_100464003
900 Ga0070704_100003916
901 Ga0070704_100023161
902 Ga0070704_100050537
903 Ga0070704_100080914
904 Ga0070704_100146523
905 Ga0070704_100378791
906 Ga0070664_100018344
907 Ga0068857_100142398
908 Ga0068857_100524412
909 Ga0068854_100011771
910 Ga0068854_100034635
911 Ga0068854_100224822
912 Ga0068856_100020616
913 Ga0070702_100000153
914 Ga0070702_100076128
915 Ga0070702_100139383
916 Ga0068859_100002430
917 Ga0068859_100010205
918 Ga0068859_100010819
919 Ga0068859_100076006
920 Ga0068859_100213567
921 Ga0068859_100401924
922 Ga0068859_100862943
923 Ga0068864_100017239
924 Ga0068864_100468257
925 Ga0068864_100649680
926 Ga0068861_100009190
927 Ga0068861_100039211
928 Ga0068861_100258100
929 Ga0068870_10003571
930 Ga0068870_10211075
931 Ga0068863_100007204
932 Ga0068863_100075448
933 Ga0068863_100083398
934 Ga0068863_100176568
935 Ga0068863_100700121
936 Ga0068858_100017801
937 Ga0068858_100021737
938 Ga0068858_100022246
939 Ga0068858_100062574
940 Ga0068858_100079687
941 Ga0068858_100175688
942 Ga0068858_100214731
943 Ga0068860_100017112
944 Ga0068860_100084173
945 Ga0068860_100237809
946 Ga0068860_100690453
947 Ga0068862_100039812
948 Ga0068862_100053930
949 Ga0068862_100115564
950 Ga0068862_100116919
951 Ga0068862_100202123
952 Ga0068862_100307396
953 Ga0068862_100309333
954 Ga0068862_100448362
955 Ga0068862_100479580
956 Ga0068862_100600230
957 Ga0081455_10073814
958 Ga0081455_10152618
959 Ga0081538_10046027
960 Ga0081539_10000093
961 Ga0081539_10018173
962 Ga0075365_10001234
963 Ga0075368_10015337
964 Ga0075363_100024048
965 Ga0075363_100127602
966 Ga0075364_10016789
967 Ga0075364_10052859
968 Ga0075364_10068331
969 Ga0075364_10158757
970 Ga0070712_100413800
971 Ga0075367_10000879
972 Ga0075367_10001875
973 Ga0075366_10000322
974 Ga0097621_100022037
975 Ga0097621_100025087
976 Ga0097621_100050591
977 Ga0097621_100051939
978 Ga0097621_100474135
979 Ga0075370_10112040
980 Ga0068871_100002675
981 Ga0068871_100005949
982 Ga0068871_100010750
983 Ga0068871_100055165
984 Ga0068871_100220821
985 Ga0075428_100000185
986 Ga0075428_100001446
987 Ga0075428_100006198
988 Ga0075428_100009291
989 Ga0075428_100035422
990 Ga0075428_100044494
991 Ga0075428_100049566
992 Ga0075428_100121374
993 Ga0075428_100125903
994 Ga0075428_100235005
995 Ga0075428_100322682
996 Ga0075430_100029567
997 Ga0075430_100041017
998 Ga0075431_100000373
999 Ga0075431_100200574
1000 Ga0075433_10002985
1001 Ga0075433_10021172
1002 Ga0075433_10119754
1003 Ga0075433_10196348
1004 Ga0075433_10362897
1005 Ga0075434_100018881
1006 Ga0075434_100046329
1007 Ga0075434_100055954
1008 Ga0075434_100078644
1009 Ga0075434_100088081
1010 Ga0075434_100103133
1011 Ga0075434_100116335
1012 Ga0075434_100139413
1013 Ga0075434_100147879
1014 Ga0075434_100213999
1015 Ga0075434_100232096
1016 Ga0075434_100686417
1017 Ga0075429_100004956
1018 Ga0075429_100021887
1019 Ga0075429_100057532
1020 Ga0075429_100059596
1021 Ga0075429_100182682
1022 Ga0068865_100014920
1023 Ga0068865_100052129
1024 Ga0068865_100079374
1025 Ga0068865_100118849
1026 Ga0068865_100196771
1027 Ga0068865_100411148
1028 Ga0068865_100454968
1029 Ga0075436_100001874
1030 Ga0075436_100009966
1031 Ga0075436_100029447
1032 Ga0075436_100043595
1033 Ga0075436_100058963
1034 Ga0097620_100002430
1035 Ga0097620_100010205
1036 Ga0097620_100010819
1037 Ga0097620_100076008
1038 Ga0097620_100213557
1039 Ga0097620_100401942
1040 Ga0097620_100863149
1041 Ga0075435_100000052
1042 Ga0075435_100000404
1043 Ga0075435_100003568
1044 Ga0075435_100003713
1045 Ga0075435_100015716
1046 Ga0075435_100089258
1047 Ga0075435_100529093
1048 Ga0099794_10047989
1049 Ga0105240_10080775
1050 Ga0105240_10092713
1051 Ga0105240_10243836
1052 Ga0105240_10262018
1053 Ga0105240_10558426
1054 Ga0105240_10646204
1055 Ga0111539_10000156
1056 Ga0111539_10000160
1057 Ga0111539_10000602
1058 Ga0111539_10000696
1059 Ga0111539_10001042
1060 Ga0111539_10004422
1061 Ga0111539_10006977
1062 Ga0111539_10008296
1063 Ga0111539_10013117
1064 Ga0111539_10060587
1065 Ga0111539_10175052
1066 Ga0111539_10194097
1067 Ga0111539_10248669
1068 Ga0111539_10358186
1069 Ga0111539_10392133
1070 Ga0105245_10011551
1071 Ga0105245_10128529
1072 Ga0105247_10009155
1073 Ga0114129_10000307
1074 Ga0114129_10000789
1075 Ga0114129_10022026
1076 Ga0114129_10031216
1077 Ga0114129_10041136
1078 Ga0114129_10072173
1079 Ga0114129_10074016
1080 Ga0114129_10105727
1081 Ga0114129_10187299
1082 Ga0114129_10190198
1083 Ga0114129_10205497
1084 Ga0114129_10233471
1085 Ga0114129_10306477
1086 Ga0114129_10373801
1087 Ga0114129_10609664
1088 Ga0114129_10764197
1089 Ga0105243_10026757
1090 Ga0105243_10032527
1091 Ga0105242_10009242
1092 Ga0105242_10014541
1093 Ga0105242_10026694
1094 Ga0105242_10046424
1095 Ga0105242_10166914
1096 Ga0105242_10211456
1097 Ga0105242_10626399
1098 Ga0105248_10000664
1099 Ga0105248_10013204
1100 Ga0105248_10022913
1101 Ga0105248_10036959
1102 Ga0105248_10076990
1103 Ga0105248_10085756
1104 Ga0105248_10093898
1105 Ga0105248_10098891
1106 Ga0105248_10102078
1107 Ga0105248_10781633
1108 Ga0105237_10163863
1109 Ga0105238_10209861
1110 Ga0105249_10174424
1111 Ga0105249_10201704
1112 Ga0105239_10408535
1113 Ga0157374_10002073
1114 Ga0163162_10300551
1115 Ga0157375_10231243
1116 Ga0157375_10261724
1117 Ga0157375_10504432
1118 Ga0157375_10595022
1119 Ga0157375_11017378
1120 Ga0163163_10000071
1121 Ga0163163_10015069
1122 Ga0163163_10068131
1123 Ga0163163_10298179
1124 Ga0157380_10013458
1125 Ga0157380_10037774
1126 Ga0157380_10095651
1127 Ga0157380_10170281
1128 Ga0157380_10356277
1129 Ga0157377_10019370
1130 Ga0157379_10033107
1131 Ga0157379_10033243
1132 Ga0157379_10044852
1133 Ga0157379_10172233
1134 Ga0157376_10019635
1135 Ga0157376_10036751
1136 Ga0157376_10144372
1137 Ga0157376_10148821
1138 Ga0157376_10338809
1139 Ga0157376_10341882
1140 Ga0157376_10669417
1141 Ga0207697_10080375
1142 Ga0207697_10100482
1143 Ga0207653_10021645
1144 Ga0207642_10019615
1145 Ga0207710_10052606
1146 Ga0207688_10038394
1147 Ga0207680_10100316
1148 Ga0207680_10268807
1149 Ga0207680_10395067
1150 Ga0207685_10073529
1151 Ga0207645_10000703
1152 Ga0207645_10020740
1153 Ga0207643_10003545
1154 Ga0207643_10038629
1155 Ga0207684_10002365
1156 Ga0207684_10011424
1157 Ga0207684_10057251
1158 Ga0207684_10166296
1159 Ga0207695_10206287
1160 Ga0207695_10306351
1161 Ga0207662_10010058
1162 Ga0207662_10011304
1163 Ga0207662_10072333
1164 Ga0207662_10124767
1165 Ga0207662_10217663
1166 Ga0207662_10363168
1167 Ga0207652_10196227
1168 Ga0207646_10038448
1169 Ga0207646_10082584
1170 Ga0207646_10099480
1171 Ga0207646_10159188
1172 Ga0207681_10025744
1173 Ga0207681_10064591
1174 Ga0207681_10110831
1175 Ga0207681_10255692
1176 Ga0207681_10361668
1177 Ga0207650_10003830
1178 Ga0207659_10000076
1179 Ga0207659_10448836
1180 Ga0207687_10008761
1181 Ga0207687_10009881
1182 Ga0207700_10036920
1183 Ga0207664_10076262
1184 Ga0207644_10380629
1185 Ga0207706_10040920
1186 Ga0207706_10105559
1187 Ga0207706_10252015
1188 Ga0207686_10004368
1189 Ga0207686_10049941
1190 Ga0207686_10054142
1191 Ga0207686_10223851
1192 Ga0207709_10028376
1193 Ga0207670_10028759
1194 Ga0207670_10063060
1195 Ga0207670_10154530
1196 Ga0207670_10257510
1197 Ga0207670_10373440
1198 Ga0207669_10023792
1199 Ga0207669_10030630
1200 Ga0207669_10058849
1201 Ga0207669_10375172
1202 Ga0207669_10411576
1203 Ga0207704_10014182
1204 Ga0207704_10045320
1205 Ga0207691_10022611
1206 Ga0207691_10084145
1207 Ga0207691_10087212
1208 Ga0207691_10131951
1209 Ga0207691_10390183
1210 Ga0207711_10033049
1211 Ga0207711_10077122
1212 Ga0207711_10100385
1213 Ga0207711_10129375
1214 Ga0207711_10427666
1215 Ga0207689_10005018
1216 Ga0207689_10067106
1217 Ga0207689_10067247
1218 Ga0207689_10106293
1219 Ga0207679_10010589
1220 Ga0207679_10074596
1221 Ga0207651_10050157
1222 Ga0207651_10056443
1223 Ga0207651_10181184
1224 Ga0207712_10051925
1225 Ga0207712_10249743
1226 Ga0207640_10014136
1227 Ga0207640_10284612
1228 Ga0207658_10357747
1229 Ga0207658_10465473
1230 Ga0207677_10113727
1231 Ga0207677_10138745
1232 Ga0207703_10008893
1233 Ga0207703_10021021
1234 Ga0207703_10024671
1235 Ga0207703_10046292
1236 Ga0207703_10100743
1237 Ga0207703_10242630
1238 Ga0207703_10543874
1239 Ga0207703_10702541
1240 Ga0207639_10597866
1241 Ga0207708_10007104
1242 Ga0207708_10022108
1243 Ga0207708_10053476
1244 Ga0207708_10166396
1245 Ga0207702_10154700
1246 Ga0207641_10002582
1247 Ga0207641_10067332
1248 Ga0207641_10123881
1249 Ga0207641_10211034
1250 Ga0207641_10360096
1251 Ga0207641_10541862
1252 Ga0207648_10021347
1253 Ga0207648_10024283
1254 Ga0207648_10126285
1255 Ga0207648_10184678
1256 Ga0207648_10209558
1257 Ga0207648_10496780
1258 Ga0207676_10014449
1259 Ga0207676_10107590
1260 Ga0207676_10615925
1261 Ga0207674_10226012
1262 Ga0207674_10374976
1263 Ga0207675_100012476
1264 Ga0207675_100060424
1265 Ga0207675_100062193
1266 Ga0207675_100140677
1267 Ga0207675_100177556
1268 Ga0207683_10026222
1269 Ga0207683_10081641
1270 Ga0207683_10228387
1271 Ga0207683_10342453
1272 Ga0207428_10000070
1273 Ga0207428_10000234
1274 Ga0207428_10000400
1275 Ga0207428_10001302
1276 Ga0207428_10018313
1277 Ga0207428_10058479
1278 Ga0207428_10265195
1279 Ga0268266_10003216
1280 Ga0268265_10016423
1281 Ga0268265_10027810
1282 Ga0268265_10162126
1283 Ga0268265_10199289
1284 Ga0268265_10227279
1285 Ga0268265_10450452
1286 Ga0268265_10532082
1287 Ga0268264_10043485
1288 Ga0268264_10108713
1289 Ga0268264_10133144
1290 Ga0268264_10158713
1291 Ga0268264_10317624
1292 Ga0265316_10157511
1293 Ga0307408_100044867
1294 Ga0307408_100076075
1295 Ga0307408_100169148
1296 Ga0265314_10129545
1297 Ga0307409_100043273
1298 Ga0307409_100130442
1299 Ga0307416_100144179
1300 Ga0307416_100218624
1301 Ga0307411_10157774
1302 Ga0307411_10356225
1303 Ga0307415_100230100
1304 Ga0373930_0000070
1305 Ga0373948_0008242
1306 Ga0373958_0000542
1307 Ga0373934_0000325
1308 Ga0373940_0000640
1309 Ga0373949_0000540
1310 Ga0373951_0000475
1311 Ga0373952_0001255
1312 Ga0373939_0005973
1313 Ga0373939_0010136
1314 Ga0373941_0004778
1315 Ga0373956_0046774
1316 Ga0373957_0004234
1317 Ga0373946_0066593
1318 Ga0373942_0000397
1319 Ga0373961_0001526
1320 Ga0373962_0000747
1321 Ga0373924_0079333
1322 Ga0373931_0000745
1323 Ga0373931_0098264
1324 Ga0373933_0082877
1325 Ga0373933_0300647
1326 Ga0373947_0155390
1327 Ga0373937_0000553
1328 Ga0373937_0061534
1329 Ga0373937_0099930
1330 Ga0373937_0153381
1331 Ga0373937_0283328
1332 Ga0373937_0386871
1333 Ga0373925_0086098
1334 Ga0373925_0140146
1335 Ga0395901_0413018
1336 Ga0450923_006411
1337 Ga0451577_0286690
1338 Ga0453684_0089560
1339 Ga0451576_0219836
1340 Ga0451576_0789040
1341 Ga0466967_0246898
1342 Ga0495629_0286003
1343 Ga0495638_0015021
1344 Ga0495580_0079243
1345 Ga0495580_0164754
1346 Ga0495608_0003061
1347 Ga0495628_0032621
1348 Ga0495628_0090587
1349 Ga0495630_0003233
1350 Ga0495643_0005940
1351 Ga0495652_0105738
1352 Ga0495586_0068635
1353 Ga0495645_0000493
1354 Ga0495633_0117561
1355 Ga0495656_0095683
1356 Ga0495634_0250667
1357 Ga0495635_0048819
1358 Ga0495659_0112090
1359 Ga0495588_0023407
1360 Ga0495599_0296464
1361 Ga0495647_0100015
1362 Ga0495658_0038388
1363 Ga0495669_0007871
1364 Ga0495613_0001719
1365 Ga0495581_0154224
1366 Ga0495674_0046339
1367 Ga0495674_0054062
1368 Ga0495674_0412679
1369 Ga0495672_0000242
1370 Ga0495672_0099714
1371 Ga0495676_0147614
1372 Ga0495680_0109726
1373 Ga0495684_0000189
1374 Ga0495684_0009207
1375 Ga0496100_0069187
1376 Ga0496101_0001075
1377 Ga0496101_0083968
1378 Ga0496101_0292003
1379 Ga0496102_0022264
1380 Ga0496102_0144120
1381 Ga0496102_0185098
1382 Ga0496104_0002797
1383 Ga0496104_0082849
1384 Ga0496104_0203622
1385 Ga0496104_0484677
1386 Ga0496105_0099450
1387 Ga0496106_0025090
1388 Ga0496106_0149327
1389 Ga0496108_0006264
1390 Ga0496109_0036244
1391 Ga0496109_0078971
1392 Ga0496110_0042319
1393 Ga0496110_0083633
1394 Ga0496112_0056169
1395 Ga0496112_0141479
1396 Ga0496113_0007690
1397 Ga0496114_0025974
1398 Ga0501031_0330088
1399 Ga0501034_0185918
1400 Ga0501036_0017503
1401 Ga0501036_0031898
1402 Ga0501036_0042741
1403 Ga0501040_0440721
1404 Ga0501041_0011415
1405 Ga0501041_0039182
1406 Ga0501041_0041088
1407 Ga0501041_0094191
1408 Ga0501042_0062972
1409 Ga0501042_0096475
1410 Ga0501046_0229602
1411 Ga0501047_0032690
1412 Ga0501048_0019805
1413 Ga0501048_0077509
1414 Ga0501068_0029322
1415 Ga0501070_0236651
1416 Ga0501071_0234230
1417 Ga0501071_0477442
1418 Ga0501072_0055293
1419 Ga0501072_0266474
1420 Ga0501072_0314510
1421 Ga0501074_0030646
1422 Ga0501075_0120646
1423 Ga0501075_0207427
1424 Ga0501075_0247947
1425 Ga0501076_0005951
1426 Ga0501076_0016675
1427 Ga0501076_0036858
1428 Ga0501076_0046145
1429 Ga0501077_0214540
1430 Ga0501079_0017221
1431 Ga0501079_0207115
1432 Ga0501079_0426243
1433 Ga0501080_0073196
1434 Ga0501081_0065096
1435 Ga0501081_0070876
1436 Ga0501081_0110545
1437 Ga0501083_0020813
1438 Ga0501044_0357331
1439 Ga0501045_0024604
1440 Ga0501045_0031651
1441 Ga0501045_0074879
1442 nmdc:mga03n38_109712_c1
1443 nmdc:mga00v17_14970_c1
1444 nmdc:mga00v17_77327_c1
1445 nmdc:mga0yw44_115556_c1
1446 nmdc:mga0k408_1023_c1
1447 nmdc:mga0k408_274502_c1
1448 nmdc:mga0k408_48248_c1
1449 nmdc:mga06z11_2066_c1
1450 nmdc:mga06z11_48067_c1
1451 nmdc:mga04h51_112180_c1
1452 nmdc:mga07m45_110212_c1
1453 nmdc:mga05p37_115943_c1
1454 nmdc:mga05p37_118376_c1
1455 nmdc:mga05p37_14644_c2
1456 nmdc:mga05p37_158217_c1
1457 nmdc:mga05p37_18019_c1
1458 nmdc:mga05p37_18668_c1
1459 nmdc:mga05p37_217260_c1
1460 nmdc:mga05p37_225835_c1
1461 nmdc:mga05p37_296188_c1
1462 nmdc:mga05p37_34620_c1
1463 nmdc:mga05p37_478104_c1
1464 nmdc:mga05p37_56987_c1
1465 nmdc:mga05p37_6282_c1
1466 nmdc:mga05p37_639316_c1
1467 nmdc:mga05p37_66740_c1
1468 nmdc:mga05p37_6700_c1
1469 nmdc:mga05p37_83007_c1
1470 nmdc:mga05p37_96163_c2
1471 nmdc:mga09592_2118_c1
1472 nmdc:mga09592_21193_c1
1473 nmdc:mga09592_21228_c1
1474 nmdc:mga09592_39944_c1
1475 nmdc:mga09592_447066_c1
1476 nmdc:mga0qj67_9878_c1
1477 nmdc:mga06r32_1608_c1
1478 nmdc:mga06r32_239846_c1
1479 nmdc:mga08y16_10_c1
1480 nmdc:mga08y16_12823_c1
1481 nmdc:mga08y16_15573_c1
1482 nmdc:mga08y16_173550_c1
1483 nmdc:mga08y16_1915_c1
1484 nmdc:mga08y16_26035_c1
1485 nmdc:mga08y16_280484_c1
1486 nmdc:mga08y16_35677_c1
1487 nmdc:mga08y16_389_c1
1488 nmdc:mga08y16_5423_c1
1489 nmdc:mga08y16_5683_c1
1490 nmdc:mga08y16_594705_c1
1491 nmdc:mga08y16_616171_c1
1492 nmdc:mga08y16_882_c1
1493 nmdc:mga0n895_101653_c1
1494 nmdc:mga0n895_106475_c1
1495 nmdc:mga0n895_223635_c1
1496 nmdc:mga0n895_228054_c1
1497 nmdc:mga0n895_312407_c1
1498 nmdc:mga0n895_389462_c1
1499 nmdc:mga0n895_49179_c1
1500 nmdc:mga0n895_57664_c1
1501 nmdc:mga0n895_61907_c1
1502 nmdc:mga0n895_620916_c1
1503 nmdc:mga0n895_66748_c1
1504 nmdc:mga0n895_8_c1
1505 nmdc:mga0rr50_131113_c1
1506 nmdc:mga0rr50_183809_c1
1507 nmdc:mga0rr50_23_c1
1508 nmdc:mga0rr50_32880_c1
1509 nmdc:mga0rr50_36661_c1
1510 nmdc:mga0rr50_399644_c1
1511 nmdc:mga0rr50_618_c1
1512 nmdc:mga0rr50_629376_c1
1513 nmdc:mga0rr50_93444_c1
1514 nmdc:mga08x19_100971_c1
1515 nmdc:mga08x19_12493_c1
1516 nmdc:mga08x19_165_c1
1517 nmdc:mga08x19_9112_c1
1518 nmdc:mga08x19_98642_c1
1519 nmdc:mga0a205_132634_c1
1520 nmdc:mga0a205_17674_c1
1521 nmdc:mga0a205_182600_c1
1522 nmdc:mga0a205_211484_c1
1523 nmdc:mga0a205_255077_c1
1524 nmdc:mga0a205_286039_c1
1525 nmdc:mga0a205_390141_c1
1526 nmdc:mga0a205_41360_c1
1527 Ga0495601_0026265
1528 Ga0495601_0056226
1529 Ga0495601_0074765
1530 Ga0495619_0004868
1531 Ga0495619_0301359
1532 Ga0500651_0242992
1533 Ga0500555_022300
1534 Ga0500568_0008892
1535 Ga0501084_0038281
1536 Ga0590071_000286
1537 Ga0590074_002198
1538 Ga0590077_000879
1539 Ga0501082_0189629
1540 Ga0501082_0196572
1541 Ga0501082_0304890
1542 Ga0501082_0420906
1543 Ga0530510_0018199
1544 Ga0530510_0039134
1545 Ga0530510_0092617
1546 Ga0530510_0126753

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

24

178

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a0g-assembly1.cif.gz_DDD structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. 0.8384 224 279
4dec-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and phosphoglyceric acid (pga) 0.8186 6 220
7pe4-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp-glucose 0.8177 6 220
7pdo-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp 0.8175 6 220
5jqx-assembly1.cif.gz_A crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with phosphoglyceric acid (pga) - gpgs*pga 0.8162 6 220
ID Description Score Start End Superfamily
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8678 4 218 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8567 4 218 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8553 2 218 3.90.550.10
af_P40350_49_327_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8432 3 218 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8331 1 218 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7C3D639-F1-model_v4 Glycosyltransferase family 2 protein 0.9795 6 103 GO:0016757
AF-A0A7C1P333-F1-model_v4 deleted 0.9472 7 284
AF-A0A661JIX6-F1-model_v4 Glycosyltransferase family 2 protein 0.9407 2 115 GO:0016757
AF-A0A2E8LG35-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.939 5 218
AF-A0A3M1DRI3-F1-model_v4 Glycosyltransferase family 2 protein 0.9333 7 173 GO:0016757

Map