F480126
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 772 | 408 | 772 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300042016|Ga0439463_090554|Ga0439463_090554_93_572 |
| Length | 159 |
| Sequence | VNFVRSSILRNLVTENIKARSLAPNLEETEMSIKKKASAHWEGDLKTGLGSISTETGVLKNSPYGFKARFEGGPGTNPEELIGAAHAGCFSMAFSMILEVTLDQVDGGFAITAVHLTLKAKIPGATQQQFEELSTKAKEGCPVSKVLNAKITLDGTLVN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 17 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 128 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 201 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 205 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 213 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 215 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 216 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 233 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 234 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 235 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 236 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 238 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 239 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 240 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 241 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 242 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 243 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 244 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 245 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 246 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 247 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 248 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 249 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 250 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 251 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 252 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 253 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 254 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 255 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 256 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 257 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 258 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 259 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 260 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 261 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 349 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 354 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 355 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 356 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 357 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 358 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 359 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 360 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 361 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 362 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 371 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 374 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 375 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 376 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 379 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 380 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 389 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 393 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 394 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 395 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 396 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 397 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 398 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 399 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 400 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 401 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 403 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 404 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 405 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.83 |
| Metatranscriptomes | 1.17 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.16 |
| Nodule | 0.13 |
| Rhizoplane | 5.96 |
| Rhizosphere | 80.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1025345 | 3300001976 | Bacteria | 778 |
| 2 | JGI24739J22299_10044412 | 3300001989 | Bacteria | 1463 |
| 3 | JGI24737J22298_10061775 | 3300001990 | Bacteria | 1126 |
| 4 | JGI24750J21931_1015625 | 3300002070 | Bacteria | 1027 |
| 5 | JGI24745J21846_1029239 | 3300002073 | Bacteria | 662 |
| 6 | JGI24738J21930_10012000 | 3300002075 | Bacteria | 1897 |
| 7 | JGI24744J21845_10030291 | 3300002077 | Bacteria | 1037 |
| 8 | JGI24034J26672_10088205 | 3300002239 | Bacteria | 573 |
| 9 | JGI24751J29686_10007457 | 3300002459 | Bacteria | 2233 |
| 10 | JGI25162J39368_1000219 | 3300002737 | Bacteria | 59530 |
| 11 | JGI25163J39215_1000823 | 3300002771 | Bacteria | 7445 |
| 12 | JGI25163J39215_1000834 | 3300002771 | Bacteria | 7381 |
| 13 | JGI25164J39214_1000175 | 3300002772 | Bacteria | 59290 |
| 14 | JGI25164J39214_1000357 | 3300002772 | Bacteria | 28322 |
| 15 | JGI25165J46597_1000175 | 3300003214 | Bacteria | 100117 |
| 16 | JGI25165J46597_1000193 | 3300003214 | Bacteria | 91069 |
| 17 | Ga0055530_10000159 | 3300003791 | Bacteria | 61131 |
| 18 | Ga0055540_1000725 | 3300003792 | Bacteria | 22486 |
| 19 | Ga0058692_1001767 | 3300003856 | Bacteria | 7656 |
| 20 | Ga0058862_12223391 | 3300004803 | Bacteria | 606 |
| 21 | Ga0065714_10067824 | 3300005288 | Bacteria | 5173 |
| 22 | Ga0065714_10143055 | 3300005288 | Bacteria | 1157 |
| 23 | Ga0065704_10273505 | 3300005289 | Bacteria | 932 |
| 24 | Ga0065712_10088919 | 3300005290 | Bacteria | 2495 |
| 25 | Ga0070676_11122110 | 3300005328 | Bacteria | 595 |
| 26 | Ga0070683_100000263 | 3300005329 | Bacteria | 36252 |
| 27 | Ga0070690_100239646 | 3300005330 | Bacteria | 1278 |
| 28 | Ga0070670_100232450 | 3300005331 | Bacteria | 1604 |
| 29 | Ga0070670_100437988 | 3300005331 | Bacteria | 1157 |
| 30 | Ga0070666_10085241 | 3300005335 | Bacteria | 2163 |
| 31 | Ga0070666_10969083 | 3300005335 | Bacteria | 630 |
| 32 | Ga0070680_100013453 | 3300005336 | Bacteria | 6374 |
| 33 | Ga0070680_100124899 | 3300005336 | Bacteria | 2150 |
| 34 | Ga0070680_100133269 | 3300005336 | Bacteria | 2080 |
| 35 | Ga0070680_100877116 | 3300005336 | Bacteria | 774 |
| 36 | Ga0070682_100046230 | 3300005337 | Bacteria | 2700 |
| 37 | Ga0068868_100019489 | 3300005338 | Bacteria | 5083 |
| 38 | Ga0070660_100762924 | 3300005339 | Bacteria | 812 |
| 39 | Ga0070660_101243358 | 3300005339 | Bacteria | 632 |
| 40 | Ga0070689_100199650 | 3300005340 | Bacteria | 1632 |
| 41 | Ga0070689_100541207 | 3300005340 | Bacteria | 1002 |
| 42 | Ga0070687_100279908 | 3300005343 | Bacteria | 1049 |
| 43 | Ga0070692_10140811 | 3300005345 | Bacteria | 1365 |
| 44 | Ga0070668_100388968 | 3300005347 | Bacteria | 1188 |
| 45 | Ga0070668_101855242 | 3300005347 | Bacteria | 555 |
| 46 | Ga0070675_100112311 | 3300005354 | Bacteria | 2307 |
| 47 | Ga0070674_100543955 | 3300005356 | Bacteria | 973 |
| 48 | Ga0070688_100019851 | 3300005365 | Bacteria | 3898 |
| 49 | Ga0070659_100361501 | 3300005366 | Bacteria | 1219 |
| 50 | Ga0070667_102066040 | 3300005367 | Bacteria | 537 |
| 51 | Ga0070709_11574271 | 3300005434 | Bacteria | 535 |
| 52 | Ga0070714_100298184 | 3300005435 | Bacteria | 1502 |
| 53 | Ga0070713_100034303 | 3300005436 | Bacteria | 4075 |
| 54 | Ga0070713_101510749 | 3300005436 | Bacteria | 652 |
| 55 | Ga0070710_11173123 | 3300005437 | Bacteria | 567 |
| 56 | Ga0070701_10253487 | 3300005438 | Bacteria | 1064 |
| 57 | Ga0070705_100125536 | 3300005440 | Bacteria | 1665 |
| 58 | Ga0070700_100010193 | 3300005441 | Bacteria | 5182 |
| 59 | Ga0070694_100131149 | 3300005444 | Bacteria | 1810 |
| 60 | Ga0070663_100194130 | 3300005455 | Bacteria | 1581 |
| 61 | Ga0070663_100407557 | 3300005455 | Bacteria | 1113 |
| 62 | Ga0070678_100414740 | 3300005456 | Bacteria | 1172 |
| 63 | Ga0070662_100419730 | 3300005457 | Bacteria | 1106 |
| 64 | Ga0070681_10199302 | 3300005458 | Bacteria | 1920 |
| 65 | Ga0070681_10578418 | 3300005458 | Bacteria | 1037 |
| 66 | Ga0068867_100031608 | 3300005459 | Bacteria | 3823 |
| 67 | Ga0070685_10017568 | 3300005466 | Bacteria | 3830 |
| 68 | Ga0070706_100903005 | 3300005467 | Bacteria | 816 |
| 69 | Ga0070706_101656337 | 3300005467 | Bacteria | 583 |
| 70 | Ga0070679_100011942 | 3300005530 | Bacteria | 8292 |
| 71 | Ga0070679_100017438 | 3300005530 | Bacteria | 6949 |
| 72 | Ga0070679_100303496 | 3300005530 | Bacteria | 1547 |
| 73 | Ga0070679_100374494 | 3300005530 | Bacteria | 1371 |
| 74 | Ga0070679_100556141 | 3300005530 | Bacteria | 1091 |
| 75 | Ga0070679_101713278 | 3300005530 | Bacteria | 576 |
| 76 | Ga0070684_100004996 | 3300005535 | Bacteria | 10131 |
| 77 | Ga0070684_100023697 | 3300005535 | Bacteria | 5138 |
| 78 | Ga0070684_100421689 | 3300005535 | Bacteria | 1232 |
| 79 | Ga0068853_100108458 | 3300005539 | Bacteria | 2463 |
| 80 | Ga0068853_100177218 | 3300005539 | Bacteria | 1932 |
| 81 | Ga0070672_100595364 | 3300005543 | Bacteria | 963 |
| 82 | Ga0070693_100509832 | 3300005547 | Bacteria | 855 |
| 83 | Ga0070665_100001096 | 3300005548 | Bacteria | 33479 |
| 84 | Ga0070665_100021887 | 3300005548 | Bacteria | 6430 |
| 85 | Ga0070665_101167384 | 3300005548 | Bacteria | 781 |
| 86 | Ga0070704_100212767 | 3300005549 | Bacteria | 1567 |
| 87 | Ga0068855_100000864 | 3300005563 | Bacteria | 37644 |
| 88 | Ga0068855_100046181 | 3300005563 | Bacteria | 5149 |
| 89 | Ga0068855_100304213 | 3300005563 | Bacteria | 1765 |
| 90 | Ga0068855_101594534 | 3300005563 | Bacteria | 668 |
| 91 | Ga0070664_100178286 | 3300005564 | Bacteria | 1888 |
| 92 | Ga0068856_100342271 | 3300005614 | Bacteria | 1514 |
| 93 | Ga0068856_101997965 | 3300005614 | Unclassified | 590 |
| 94 | Ga0070702_100023459 | 3300005615 | Bacteria | 3278 |
| 95 | Ga0068859_100071130 | 3300005617 | Bacteria | 3514 |
| 96 | Ga0068866_10048567 | 3300005718 | Bacteria | 2146 |
| 97 | Ga0068861_100024510 | 3300005719 | Bacteria | 4364 |
| 98 | Ga0068870_10021857 | 3300005840 | Bacteria | 3136 |
| 99 | Ga0068863_100169063 | 3300005841 | Bacteria | 2096 |
| 100 | Ga0068858_100202545 | 3300005842 | Bacteria | 1877 |
| 101 | Ga0068860_100219620 | 3300005843 | Bacteria | 1845 |
| 102 | Ga0068860_100625520 | 3300005843 | Bacteria | 1083 |
| 103 | Ga0068862_100319867 | 3300005844 | Bacteria | 1432 |
| 104 | Ga0081540_1160365 | 3300005983 | Bacteria | 873 |
| 105 | Ga0070717_10026052 | 3300006028 | Bacteria | 4660 |
| 106 | Ga0075365_10012970 | 3300006038 | Bacteria | 4970 |
| 107 | Ga0075365_10045859 | 3300006038 | Bacteria | 2869 |
| 108 | Ga0075365_10050058 | 3300006038 | Bacteria | 2755 |
| 109 | Ga0075365_10055835 | 3300006038 | Bacteria | 2623 |
| 110 | Ga0075365_10075051 | 3300006038 | Bacteria | 2281 |
| 111 | Ga0075365_10519755 | 3300006038 | Bacteria | 842 |
| 112 | Ga0075363_100374683 | 3300006048 | Bacteria | 834 |
| 113 | Ga0075363_100843408 | 3300006048 | Bacteria | 559 |
| 114 | Ga0075364_10307385 | 3300006051 | Bacteria | 1080 |
| 115 | Ga0075432_10002880 | 3300006058 | Bacteria | 5782 |
| 116 | Ga0070715_10087767 | 3300006163 | Bacteria | 1425 |
| 117 | Ga0070715_10087878 | 3300006163 | Bacteria | 1424 |
| 118 | Ga0070712_100019927 | 3300006175 | Bacteria | 4385 |
| 119 | Ga0075369_10224211 | 3300006186 | Bacteria | 870 |
| 120 | Ga0097621_100098648 | 3300006237 | Bacteria | 2454 |
| 121 | Ga0097621_100727441 | 3300006237 | Bacteria | 915 |
| 122 | Ga0068871_100043906 | 3300006358 | Bacteria | 3592 |
| 123 | Ga0068871_100420306 | 3300006358 | Bacteria | 1194 |
| 124 | Ga0068871_100670937 | 3300006358 | Bacteria | 948 |
| 125 | Ga0075428_100017465 | 3300006844 | Bacteria | 7929 |
| 126 | Ga0075428_102406712 | 3300006844 | Bacteria | 541 |
| 127 | Ga0075431_100226723 | 3300006847 | Bacteria | 1905 |
| 128 | Ga0075431_100659891 | 3300006847 | Bacteria | 1026 |
| 129 | Ga0075434_100537446 | 3300006871 | Bacteria | 1189 |
| 130 | Ga0068865_100047115 | 3300006881 | Bacteria | 2960 |
| 131 | Ga0068865_100066208 | 3300006881 | Bacteria | 2548 |
| 132 | Ga0075436_100023659 | 3300006914 | Bacteria | 4219 |
| 133 | Ga0097620_100071126 | 3300006931 | Bacteria | 3514 |
| 134 | Ga0099794_10068552 | 3300007265 | Bacteria | 1735 |
| 135 | Ga0105251_10000068 | 3300009011 | Bacteria | 98955 |
| 136 | Ga0105251_10001441 | 3300009011 | Bacteria | 20465 |
| 137 | Ga0105251_10026993 | 3300009011 | Bacteria | 2917 |
| 138 | Ga0105244_10106077 | 3300009036 | Bacteria | 1371 |
| 139 | Ga0105250_10040925 | 3300009092 | Bacteria | 1858 |
| 140 | Ga0105240_10002346 | 3300009093 | Bacteria | 30550 |
| 141 | Ga0105240_10044867 | 3300009093 | Bacteria | 5612 |
| 142 | Ga0105240_10079592 | 3300009093 | Bacteria | 4032 |
| 143 | Ga0105240_10382137 | 3300009093 | Bacteria | 1590 |
| 144 | Ga0105240_10436904 | 3300009093 | Bacteria | 1467 |
| 145 | Ga0105240_11177781 | 3300009093 | Bacteria | 812 |
| 146 | Ga0111539_10762432 | 3300009094 | Bacteria | 1126 |
| 147 | Ga0105245_12567754 | 3300009098 | Bacteria | 563 |
| 148 | Ga0105247_10011015 | 3300009101 | Bacteria | 5457 |
| 149 | Ga0114129_10341077 | 3300009147 | Bacteria | 1987 |
| 150 | Ga0114129_10990197 | 3300009147 | Bacteria | 1059 |
| 151 | Ga0114129_11238620 | 3300009147 | Bacteria | 928 |
| 152 | Ga0105243_10000075 | 3300009148 | Bacteria | 112098 |
| 153 | Ga0105243_10008056 | 3300009148 | Bacteria | 8089 |
| 154 | Ga0105243_10128441 | 3300009148 | Bacteria | 2147 |
| 155 | Ga0105241_10373160 | 3300009174 | Bacteria | 1244 |
| 156 | Ga0105241_10758247 | 3300009174 | Bacteria | 890 |
| 157 | Ga0105241_10920068 | 3300009174 | Bacteria | 813 |
| 158 | Ga0105241_11257498 | 3300009174 | Bacteria | 703 |
| 159 | Ga0105242_10102407 | 3300009176 | Bacteria | 2428 |
| 160 | Ga0105237_10042538 | 3300009545 | Bacteria | 4580 |
| 161 | Ga0105237_10044603 | 3300009545 | Bacteria | 4465 |
| 162 | Ga0105237_10167677 | 3300009545 | Bacteria | 2195 |
| 163 | Ga0105237_10275599 | 3300009545 | Bacteria | 1685 |
| 164 | Ga0105237_10793015 | 3300009545 | Bacteria | 954 |
| 165 | Ga0105238_10051481 | 3300009551 | Bacteria | 4142 |
| 166 | Ga0105238_10096225 | 3300009551 | Bacteria | 2947 |
| 167 | Ga0105238_10240552 | 3300009551 | Bacteria | 1787 |
| 168 | Ga0105238_10454153 | 3300009551 | Bacteria | 1278 |
| 169 | Ga0105238_11507084 | 3300009551 | Bacteria | 701 |
| 170 | Ga0105249_10021961 | 3300009553 | Bacteria | 5716 |
| 171 | Ga0105249_10408900 | 3300009553 | Bacteria | 1389 |
| 172 | Ga0105239_10039857 | 3300010375 | Bacteria | 5146 |
| 173 | Ga0105239_10140201 | 3300010375 | Bacteria | 2694 |
| 174 | Ga0105239_10417763 | 3300010375 | Bacteria | 1519 |
| 175 | Ga0105239_10549968 | 3300010375 | Bacteria | 1315 |
| 176 | Ga0105239_10764342 | 3300010375 | Bacteria | 1106 |
| 177 | Ga0105246_10199646 | 3300011119 | Bacteria | 1554 |
| 178 | Ga0157373_10047780 | 3300013100 | Bacteria | 3052 |
| 179 | Ga0157373_10525281 | 3300013100 | Bacteria | 857 |
| 180 | Ga0157373_11366187 | 3300013100 | Bacteria | 538 |
| 181 | Ga0157371_10001263 | 3300013102 | Bacteria | 26673 |
| 182 | Ga0157371_10091888 | 3300013102 | Bacteria | 2150 |
| 183 | Ga0157370_10155314 | 3300013104 | Bacteria | 2129 |
| 184 | Ga0157369_10110463 | 3300013105 | Bacteria | 2923 |
| 185 | Ga0157369_10341863 | 3300013105 | Bacteria | 1554 |
| 186 | Ga0157369_10406448 | 3300013105 | Bacteria | 1412 |
| 187 | Ga0157369_10605458 | 3300013105 | Bacteria | 1131 |
| 188 | Ga0157369_10650949 | 3300013105 | Bacteria | 1086 |
| 189 | Ga0157374_10099656 | 3300013296 | Bacteria | 2784 |
| 190 | Ga0157374_10135288 | 3300013296 | Bacteria | 2389 |
| 191 | Ga0157378_10534885 | 3300013297 | Bacteria | 1175 |
| 192 | Ga0163162_10140237 | 3300013306 | Bacteria | 2530 |
| 193 | Ga0157372_11360476 | 3300013307 | Bacteria | 819 |
| 194 | Ga0157372_11493887 | 3300013307 | Bacteria | 778 |
| 195 | Ga0163163_10785643 | 3300014325 | Bacteria | 1015 |
| 196 | Ga0163163_10854098 | 3300014325 | Bacteria | 974 |
| 197 | Ga0163163_13098522 | 3300014325 | Bacteria | 518 |
| 198 | Ga0157380_11520624 | 3300014326 | Bacteria | 723 |
| 199 | Ga0182008_10000367 | 3300014497 | Bacteria | 35146 |
| 200 | Ga0182008_10084657 | 3300014497 | Bacteria | 1561 |
| 201 | Ga0157377_10047696 | 3300014745 | Bacteria | 2400 |
| 202 | Ga0157379_10079167 | 3300014968 | Bacteria | 2943 |
| 203 | Ga0157379_11183755 | 3300014968 | Bacteria | 735 |
| 204 | Ga0157376_10196836 | 3300014969 | Bacteria | 1852 |
| 205 | Ga0157376_10308476 | 3300014969 | Bacteria | 1501 |
| 206 | Ga0182006_1017252 | 3300015261 | Bacteria | 3069 |
| 207 | Ga0163161_10048658 | 3300017792 | Bacteria | 3062 |
| 208 | Ga0206356_11524923 | 3300020070 | Bacteria | 1067 |
| 209 | Ga0206352_10477851 | 3300020078 | Bacteria | 530 |
| 210 | Ga0206350_10752306 | 3300020080 | Bacteria | 543 |
| 211 | Ga0206353_10249946 | 3300020082 | Bacteria | 676 |
| 212 | Ga0213873_10004171 | 3300021358 | Bacteria | 2673 |
| 213 | Ga0209760_100020 | 3300025207 | Bacteria | 169879 |
| 214 | Ga0209760_100082 | 3300025207 | Bacteria | 76168 |
| 215 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 216 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 217 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 218 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 219 | Ga0209759_1001572 | 3300025256 | Bacteria | 12431 |
| 220 | Ga0209759_1020334 | 3300025256 | Bacteria | 1543 |
| 221 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 222 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 223 | Ga0209130_1056706 | 3300025284 | Bacteria | 693 |
| 224 | Ga0209676_1000222 | 3300025292 | Bacteria | 124695 |
| 225 | Ga0209050_1000296 | 3300025298 | Bacteria | 104732 |
| 226 | Ga0209051_1000295 | 3300025303 | Bacteria | 79621 |
| 227 | Ga0209051_1008357 | 3300025303 | Bacteria | 5489 |
| 228 | Ga0207655_1000135 | 3300025728 | Bacteria | 143597 |
| 229 | Ga0207655_1002411 | 3300025728 | Bacteria | 15220 |
| 230 | Ga0207713_1000103 | 3300025735 | Bacteria | 138415 |
| 231 | Ga0207713_1002728 | 3300025735 | Bacteria | 12593 |
| 232 | Ga0207692_10088135 | 3300025898 | Bacteria | 1677 |
| 233 | Ga0207642_10004044 | 3300025899 | Bacteria | 4693 |
| 234 | Ga0207710_10009561 | 3300025900 | Bacteria | 4077 |
| 235 | Ga0207688_10028197 | 3300025901 | Bacteria | 3090 |
| 236 | Ga0207688_10481329 | 3300025901 | Bacteria | 776 |
| 237 | Ga0207680_10074756 | 3300025903 | Bacteria | 2111 |
| 238 | Ga0207647_10034457 | 3300025904 | Bacteria | 3231 |
| 239 | Ga0207685_10084454 | 3300025905 | Bacteria | 1322 |
| 240 | Ga0207699_10699185 | 3300025906 | Bacteria | 742 |
| 241 | Ga0207645_10014566 | 3300025907 | Bacteria | 5260 |
| 242 | Ga0207643_10030491 | 3300025908 | Bacteria | 3002 |
| 243 | Ga0207705_10941986 | 3300025909 | Bacteria | 668 |
| 244 | Ga0207684_10914017 | 3300025910 | Bacteria | 737 |
| 245 | Ga0207684_11561944 | 3300025910 | Bacteria | 535 |
| 246 | Ga0207707_10256395 | 3300025912 | Bacteria | 1518 |
| 247 | Ga0207695_10005133 | 3300025913 | Bacteria | 17531 |
| 248 | Ga0207695_10013476 | 3300025913 | Bacteria | 9748 |
| 249 | Ga0207695_10014260 | 3300025913 | Bacteria | 9427 |
| 250 | Ga0207695_10021679 | 3300025913 | Bacteria | 7323 |
| 251 | Ga0207695_10094384 | 3300025913 | Bacteria | 2999 |
| 252 | Ga0207695_10621431 | 3300025913 | Bacteria | 961 |
| 253 | Ga0207671_10049367 | 3300025914 | Bacteria | 3115 |
| 254 | Ga0207671_10148853 | 3300025914 | Bacteria | 1808 |
| 255 | Ga0207671_10166274 | 3300025914 | Bacteria | 1710 |
| 256 | Ga0207671_10469368 | 3300025914 | Bacteria | 1003 |
| 257 | Ga0207671_10495829 | 3300025914 | Bacteria | 974 |
| 258 | Ga0207693_10004673 | 3300025915 | Bacteria | 11541 |
| 259 | Ga0207693_10460319 | 3300025915 | Bacteria | 994 |
| 260 | Ga0207663_10069742 | 3300025916 | Bacteria | 2262 |
| 261 | Ga0207663_11333207 | 3300025916 | Bacteria | 578 |
| 262 | Ga0207660_10011193 | 3300025917 | Bacteria | 5831 |
| 263 | Ga0207660_10155592 | 3300025917 | Bacteria | 1759 |
| 264 | Ga0207662_10185203 | 3300025918 | Bacteria | 1341 |
| 265 | Ga0207657_10007091 | 3300025919 | Bacteria | 11517 |
| 266 | Ga0207657_10094810 | 3300025919 | Bacteria | 2484 |
| 267 | Ga0207649_10216147 | 3300025920 | Bacteria | 1363 |
| 268 | Ga0207652_10054008 | 3300025921 | Bacteria | 3452 |
| 269 | Ga0207652_10266973 | 3300025921 | Bacteria | 1544 |
| 270 | Ga0207652_10316721 | 3300025921 | Bacteria | 1408 |
| 271 | Ga0207652_11147904 | 3300025921 | Bacteria | 678 |
| 272 | Ga0207652_11164911 | 3300025921 | Bacteria | 672 |
| 273 | Ga0207694_10087928 | 3300025924 | Bacteria | 2449 |
| 274 | Ga0207694_10098667 | 3300025924 | Bacteria | 2313 |
| 275 | Ga0207694_10387483 | 3300025924 | Bacteria | 1161 |
| 276 | Ga0207650_10005007 | 3300025925 | Bacteria | 9049 |
| 277 | Ga0207659_10530156 | 3300025926 | Bacteria | 999 |
| 278 | Ga0207659_11578413 | 3300025926 | Bacteria | 560 |
| 279 | Ga0207687_10023734 | 3300025927 | Bacteria | 4091 |
| 280 | Ga0207700_10014790 | 3300025928 | Bacteria | 5124 |
| 281 | Ga0207700_10032139 | 3300025928 | Bacteria | 3739 |
| 282 | Ga0207706_10085584 | 3300025933 | Bacteria | 2772 |
| 283 | Ga0207686_10046064 | 3300025934 | Bacteria | 2687 |
| 284 | Ga0207709_10000269 | 3300025935 | Bacteria | 61223 |
| 285 | Ga0207709_10004904 | 3300025935 | Bacteria | 7658 |
| 286 | Ga0207709_10027842 | 3300025935 | Bacteria | 3261 |
| 287 | Ga0207709_10070325 | 3300025935 | Bacteria | 2219 |
| 288 | Ga0207670_10145300 | 3300025936 | Bacteria | 1753 |
| 289 | Ga0207670_11111440 | 3300025936 | Bacteria | 667 |
| 290 | Ga0207704_10574844 | 3300025938 | Bacteria | 919 |
| 291 | Ga0207665_10103495 | 3300025939 | Bacteria | 1991 |
| 292 | Ga0207691_10012861 | 3300025940 | Bacteria | 8012 |
| 293 | Ga0207711_10084825 | 3300025941 | Bacteria | 2773 |
| 294 | Ga0207661_10001051 | 3300025944 | Bacteria | 18329 |
| 295 | Ga0207679_10109463 | 3300025945 | Bacteria | 2177 |
| 296 | Ga0207667_10008319 | 3300025949 | Bacteria | 12339 |
| 297 | Ga0207667_10103750 | 3300025949 | Bacteria | 2932 |
| 298 | Ga0207667_10234293 | 3300025949 | Bacteria | 1879 |
| 299 | Ga0207667_11443062 | 3300025949 | Bacteria | 661 |
| 300 | Ga0207651_11000103 | 3300025960 | Bacteria | 747 |
| 301 | Ga0207712_10031539 | 3300025961 | Bacteria | 3570 |
| 302 | Ga0207712_10062056 | 3300025961 | Bacteria | 2655 |
| 303 | Ga0207668_10227836 | 3300025972 | Bacteria | 1500 |
| 304 | Ga0207640_10073028 | 3300025981 | Bacteria | 2316 |
| 305 | Ga0207658_10124884 | 3300025986 | Bacteria | 2058 |
| 306 | Ga0207658_10417866 | 3300025986 | Bacteria | 1182 |
| 307 | Ga0207658_11535943 | 3300025986 | Bacteria | 609 |
| 308 | Ga0207677_10057915 | 3300026023 | Bacteria | 2664 |
| 309 | Ga0207703_10234808 | 3300026035 | Bacteria | 1646 |
| 310 | Ga0207639_10268333 | 3300026041 | Bacteria | 1496 |
| 311 | Ga0207639_10455088 | 3300026041 | Bacteria | 1162 |
| 312 | Ga0207639_10809664 | 3300026041 | Bacteria | 873 |
| 313 | Ga0207678_10054141 | 3300026067 | Bacteria | 3456 |
| 314 | Ga0207708_10015207 | 3300026075 | Bacteria | 5769 |
| 315 | Ga0207648_10001979 | 3300026089 | Bacteria | 22372 |
| 316 | Ga0207676_10159670 | 3300026095 | Bacteria | 1951 |
| 317 | Ga0207674_10191341 | 3300026116 | Unclassified | 1996 |
| 318 | Ga0207674_10400244 | 3300026116 | Bacteria | 1327 |
| 319 | Ga0207675_100025355 | 3300026118 | Bacteria | 5518 |
| 320 | Ga0207683_10038505 | 3300026121 | Bacteria | 4168 |
| 321 | Ga0207698_10167884 | 3300026142 | Bacteria | 1928 |
| 322 | Ga0207698_10835255 | 3300026142 | Bacteria | 925 |
| 323 | Ga0207698_11646952 | 3300026142 | Bacteria | 657 |
| 324 | Ga0209281_1000091 | 3300027111 | Bacteria | 242588 |
| 325 | Ga0209371_1000032 | 3300027312 | Bacteria | 392355 |
| 326 | Ga0209813_10052421 | 3300027866 | Bacteria | 1279 |
| 327 | Ga0209813_10067027 | 3300027866 | Bacteria | 1159 |
| 328 | Ga0207428_10371206 | 3300027907 | Bacteria | 1051 |
| 329 | Ga0268266_10000159 | 3300028379 | Bacteria | 126969 |
| 330 | Ga0268266_10022361 | 3300028379 | Bacteria | 5390 |
| 331 | Ga0268266_10086781 | 3300028379 | Bacteria | 2736 |
| 332 | Ga0268266_10116245 | 3300028379 | Bacteria | 2375 |
| 333 | Ga0268266_10197540 | 3300028379 | Bacteria | 1839 |
| 334 | Ga0268265_10138337 | 3300028380 | Bacteria | 2035 |
| 335 | Ga0268264_10586842 | 3300028381 | Bacteria | 1097 |
| 336 | Ga0268264_11651104 | 3300028381 | Bacteria | 651 |
| 337 | Ga0307517_10411909 | 3300028786 | Bacteria | 712 |
| 338 | Ga0307515_10671684 | 3300028794 | Bacteria | 650 |
| 339 | Ga0265338_10049552 | 3300028800 | Bacteria | 3806 |
| 340 | Ga0265338_10205713 | 3300028800 | Bacteria | 1481 |
| 341 | Ga0268256_1000050 | 3300030500 | Bacteria | 300675 |
| 342 | Ga0307511_10000028 | 3300030521 | Bacteria | 109328 |
| 343 | Ga0307511_10067948 | 3300030521 | Bacteria | 2638 |
| 344 | Ga0307511_10103544 | 3300030521 | Bacteria | 1853 |
| 345 | Ga0265330_10133376 | 3300031235 | Bacteria | 1057 |
| 346 | Ga0265325_10001594 | 3300031241 | Bacteria | 15822 |
| 347 | Ga0265331_10016868 | 3300031250 | Bacteria | 3822 |
| 348 | Ga0265331_10033379 | 3300031250 | Bacteria | 2545 |
| 349 | Ga0265331_10540687 | 3300031250 | Unclassified | 525 |
| 350 | Ga0265316_10068870 | 3300031344 | Bacteria | 2732 |
| 351 | Ga0307509_10556846 | 3300031507 | Bacteria | 824 |
| 352 | Ga0307408_100000028 | 3300031548 | Bacteria | 233440 |
| 353 | Ga0265313_10011247 | 3300031595 | Bacteria | 5577 |
| 354 | Ga0307508_10774739 | 3300031616 | Bacteria | 574 |
| 355 | Ga0265314_10009427 | 3300031711 | Bacteria | 8232 |
| 356 | Ga0265314_10208585 | 3300031711 | Bacteria | 1149 |
| 357 | Ga0307414_10023320 | 3300032004 | Bacteria | 3923 |
| 358 | Ga0307510_10229940 | 3300033180 | Bacteria | 1358 |
| 359 | Ga0373923_0131074 | 3300035111 | Bacteria | 1127 |
| 360 | Ga0373932_0218218 | 3300035112 | Bacteria | 684 |
| 361 | Ga0373936_0306270 | 3300035113 | Bacteria | 718 |
| 362 | Ga0373953_0034897 | 3300035117 | Bacteria | 1974 |
| 363 | Ga0373957_0050160 | 3300035120 | Bacteria | 1594 |
| 364 | Ga0373957_0416837 | 3300035120 | Bacteria | 579 |
| 365 | Ga0373955_0051409 | 3300035172 | Bacteria | 2244 |
| 366 | Ga0373924_0580013 | 3300035410 | Bacteria | 506 |
| 367 | Ga0373935_0070547 | 3300035692 | Bacteria | 2252 |
| 368 | Ga0373933_0009993 | 3300035724 | Bacteria | 5196 |
| 369 | Ga0373937_0022169 | 3300036401 | Bacteria | 5706 |
| 370 | Ga0373925_0029840 | 3300037068 | Bacteria | 4000 |
| 371 | Ga0395898_0097924 | 3300037466 | Bacteria | 2816 |
| 372 | Ga0395905_0244439 | 3300037471 | Bacteria | 1677 |
| 373 | Ga0395901_0172942 | 3300038443 | Bacteria | 2266 |
| 374 | Ga0436360_0592298 | 3300039438 | Bacteria | 6810 |
| 375 | Ga0436361_0051944 | 3300039447 | Bacteria | 2094 |
| 376 | Ga0436362_0951072 | 3300039453 | Bacteria | 2922 |
| 377 | Ga0439447_051133 | 3300041407 | Bacteria | 986 |
| 378 | Ga0439461_0040096 | 3300041410 | Bacteria | 1009 |
| 379 | Ga0439466_0000697 | 3300041411 | Bacteria | 12686 |
| 380 | Ga0451795_1176480 | 3300041456 | Bacteria | 1512 |
| 381 | Ga0451807_0352186 | 3300041486 | Unclassified | 570 |
| 382 | Ga0451807_2174716 | 3300041486 | Bacteria | 889 |
| 383 | Ga0439437_007132 | 3300042000 | Bacteria | 1246 |
| 384 | Ga0439432_003995 | 3300042006 | Bacteria | 5420 |
| 385 | Ga0439432_006470 | 3300042006 | Bacteria | 4182 |
| 386 | Ga0439451_045285 | 3300042009 | Bacteria | 881 |
| 387 | Ga0439452_003511 | 3300042010 | Bacteria | 5478 |
| 388 | Ga0439452_021061 | 3300042010 | Bacteria | 1703 |
| 389 | Ga0439455_0031217 | 3300042012 | Bacteria | 1325 |
| 390 | Ga0439456_001509 | 3300042013 | Bacteria | 4688 |
| 391 | Ga0439456_009962 | 3300042013 | Bacteria | 1962 |
| 392 | Ga0439456_018372 | 3300042013 | Bacteria | 1468 |
| 393 | Ga0439463_000065 | 3300042016 | Bacteria | 23115 |
| 394 | Ga0439463_000640 | 3300042016 | Bacteria | 9679 |
| 395 | Ga0439463_090554 | 3300042016 | Bacteria | 787 |
| 396 | Ga0450911_000055 | 3300042115 | Bacteria | 47324 |
| 397 | Ga0450911_033868 | 3300042115 | Bacteria | 663 |
| 398 | Ga0450917_001876 | 3300042120 | Bacteria | 1493 |
| 399 | Ga0450904_000368 | 3300042139 | Bacteria | 9498 |
| 400 | Ga0450905_021833 | 3300042142 | Bacteria | 949 |
| 401 | Ga0450906_053331 | 3300042145 | Bacteria | 715 |
| 402 | Ga0439446_0001744 | 3300042156 | Bacteria | 5059 |
| 403 | Ga0439459_0062860 | 3300042438 | Bacteria | 842 |
| 404 | Ga0439464_0003176 | 3300042439 | Bacteria | 4121 |
| 405 | Ga0439464_0008637 | 3300042439 | Bacteria | 2669 |
| 406 | Ga0439464_0048587 | 3300042439 | Bacteria | 1223 |
| 407 | Ga0450916_007552 | 3300042530 | Bacteria | 1308 |
| 408 | Ga0450893_0000923 | 3300042532 | Bacteria | 4402 |
| 409 | Ga0439440_0000879 | 3300042993 | Bacteria | 5249 |
| 410 | Ga0466969_0003690 | 3300044656 | Bacteria | 8151 |
| 411 | Ga0466972_0132793 | 3300044658 | Bacteria | 1172 |
| 412 | Ga0466966_0056001 | 3300044684 | Bacteria | 2495 |
| 413 | Ga0466963_0822848 | 3300044694 | Bacteria | 655 |
| 414 | Ga0466959_0023434 | 3300045049 | Bacteria | 4568 |
| 415 | Ga0495617_000380 | 3300046452 | Bacteria | 24621 |
| 416 | Ga0495617_014471 | 3300046452 | Bacteria | 2681 |
| 417 | Ga0495617_018659 | 3300046452 | Bacteria | 2346 |
| 418 | Ga0495627_000296 | 3300046453 | Bacteria | 49348 |
| 419 | Ga0495627_007017 | 3300046453 | Bacteria | 4367 |
| 420 | Ga0495627_121323 | 3300046453 | Bacteria | 738 |
| 421 | Ga0495590_0012679 | 3300046457 | Bacteria | 3122 |
| 422 | Ga0495591_000164 | 3300046458 | Bacteria | 70760 |
| 423 | Ga0495591_000344 | 3300046458 | Bacteria | 41220 |
| 424 | Ga0495591_004911 | 3300046458 | Bacteria | 6352 |
| 425 | Ga0495591_005358 | 3300046458 | Bacteria | 5960 |
| 426 | Ga0495591_009013 | 3300046458 | Bacteria | 4014 |
| 427 | Ga0495591_018968 | 3300046458 | Bacteria | 2316 |
| 428 | Ga0495638_0045171 | 3300046460 | Bacteria | 2772 |
| 429 | Ga0495638_0053112 | 3300046460 | Bacteria | 2522 |
| 430 | Ga0495638_0136375 | 3300046460 | Bacteria | 1436 |
| 431 | Ga0495638_0165539 | 3300046460 | Bacteria | 1272 |
| 432 | Ga0495653_0091857 | 3300046463 | Bacteria | 2218 |
| 433 | Ga0495650_0000402 | 3300046471 | Bacteria | 72128 |
| 434 | Ga0495650_0006144 | 3300046471 | Bacteria | 7554 |
| 435 | Ga0495650_0007734 | 3300046471 | Bacteria | 6400 |
| 436 | Ga0495582_0017955 | 3300046473 | Bacteria | 3867 |
| 437 | Ga0495605_0000302 | 3300046474 | Bacteria | 53003 |
| 438 | Ga0495605_0000316 | 3300046474 | Bacteria | 50684 |
| 439 | Ga0495605_0000813 | 3300046474 | Bacteria | 22279 |
| 440 | Ga0495605_0001296 | 3300046474 | Bacteria | 16598 |
| 441 | Ga0495605_0007839 | 3300046474 | Bacteria | 6049 |
| 442 | Ga0495605_0010401 | 3300046474 | Bacteria | 5207 |
| 443 | Ga0495605_0010763 | 3300046474 | Bacteria | 5111 |
| 444 | Ga0495605_0230157 | 3300046474 | Bacteria | 798 |
| 445 | Ga0495605_0260902 | 3300046474 | Bacteria | 739 |
| 446 | Ga0495605_0272638 | 3300046474 | Bacteria | 720 |
| 447 | Ga0495639_0087624 | 3300046475 | Bacteria | 1457 |
| 448 | Ga0495639_0541688 | 3300046475 | Bacteria | 596 |
| 449 | Ga0495662_0265452 | 3300046476 | Bacteria | 845 |
| 450 | Ga0495584_0013224 | 3300046491 | Bacteria | 4212 |
| 451 | Ga0495584_0015365 | 3300046491 | Bacteria | 3900 |
| 452 | Ga0495584_0146184 | 3300046491 | Bacteria | 1201 |
| 453 | Ga0495584_0304970 | 3300046491 | Bacteria | 809 |
| 454 | Ga0495584_0321154 | 3300046491 | Bacteria | 786 |
| 455 | Ga0495585_0021381 | 3300046492 | Bacteria | 3715 |
| 456 | Ga0495585_0038473 | 3300046492 | Bacteria | 2692 |
| 457 | Ga0495585_0116338 | 3300046492 | Bacteria | 1418 |
| 458 | Ga0495585_0300004 | 3300046492 | Bacteria | 790 |
| 459 | Ga0495594_0017748 | 3300046499 | Bacteria | 3763 |
| 460 | Ga0495596_0060506 | 3300046500 | Bacteria | 1475 |
| 461 | Ga0495607_0000268 | 3300046501 | Bacteria | 55932 |
| 462 | Ga0495607_0000365 | 3300046501 | Bacteria | 46525 |
| 463 | Ga0495607_0000762 | 3300046501 | Bacteria | 30848 |
| 464 | Ga0495607_0002401 | 3300046501 | Bacteria | 15280 |
| 465 | Ga0495607_0015307 | 3300046501 | Bacteria | 4973 |
| 466 | Ga0495607_0036943 | 3300046501 | Bacteria | 2938 |
| 467 | Ga0495607_0052223 | 3300046501 | Bacteria | 2368 |
| 468 | Ga0495607_0137583 | 3300046501 | Bacteria | 1263 |
| 469 | Ga0495607_0161577 | 3300046501 | Bacteria | 1138 |
| 470 | Ga0495607_0252004 | 3300046501 | Bacteria | 849 |
| 471 | Ga0495607_0377139 | 3300046501 | Bacteria | 649 |
| 472 | Ga0495583_0000409 | 3300046506 | Bacteria | 65136 |
| 473 | Ga0495583_0004250 | 3300046506 | Bacteria | 10386 |
| 474 | Ga0495583_0004296 | 3300046506 | Bacteria | 10311 |
| 475 | Ga0495583_0004393 | 3300046506 | Bacteria | 10118 |
| 476 | Ga0495583_0006517 | 3300046506 | Bacteria | 7616 |
| 477 | Ga0495583_0011885 | 3300046506 | Bacteria | 4968 |
| 478 | Ga0495606_0000084 | 3300046507 | Bacteria | 158428 |
| 479 | Ga0495606_0000115 | 3300046507 | Bacteria | 135589 |
| 480 | Ga0495606_0000285 | 3300046507 | Bacteria | 87775 |
| 481 | Ga0495606_0004641 | 3300046507 | Bacteria | 13591 |
| 482 | Ga0495608_0157050 | 3300046511 | Bacteria | 1447 |
| 483 | Ga0495610_0010122 | 3300046512 | Bacteria | 5887 |
| 484 | Ga0495610_0027408 | 3300046512 | Bacteria | 3028 |
| 485 | Ga0495616_0001775 | 3300046513 | Bacteria | 14672 |
| 486 | Ga0495616_0007207 | 3300046513 | Bacteria | 6665 |
| 487 | Ga0495620_0000376 | 3300046515 | Bacteria | 30597 |
| 488 | Ga0495620_0069093 | 3300046515 | Bacteria | 1449 |
| 489 | Ga0495630_0120098 | 3300046517 | Bacteria | 1994 |
| 490 | Ga0495630_0129671 | 3300046517 | Bacteria | 1915 |
| 491 | Ga0495631_0002659 | 3300046518 | Bacteria | 9963 |
| 492 | Ga0495631_0009813 | 3300046518 | Bacteria | 4766 |
| 493 | Ga0495631_0314937 | 3300046518 | Bacteria | 666 |
| 494 | Ga0495632_0000952 | 3300046519 | Bacteria | 25300 |
| 495 | Ga0495632_0004049 | 3300046519 | Bacteria | 10117 |
| 496 | Ga0495632_0011397 | 3300046519 | Bacteria | 5188 |
| 497 | Ga0495632_0014524 | 3300046519 | Bacteria | 4450 |
| 498 | Ga0495632_0111591 | 3300046519 | Bacteria | 1283 |
| 499 | Ga0495632_0206563 | 3300046519 | Bacteria | 892 |
| 500 | Ga0495637_0000054 | 3300046520 | Bacteria | 99531 |
| 501 | Ga0495637_0001318 | 3300046520 | Bacteria | 14888 |
| 502 | Ga0495637_0004745 | 3300046520 | Bacteria | 7013 |
| 503 | Ga0495637_0005807 | 3300046520 | Bacteria | 6250 |
| 504 | Ga0495637_0025174 | 3300046520 | Bacteria | 2683 |
| 505 | Ga0495637_0161772 | 3300046520 | Bacteria | 839 |
| 506 | Ga0495637_0369267 | 3300046520 | Bacteria | 501 |
| 507 | Ga0495643_0010329 | 3300046522 | Bacteria | 5748 |
| 508 | Ga0495643_0060533 | 3300046522 | Bacteria | 2009 |
| 509 | Ga0495643_0069977 | 3300046522 | Bacteria | 1843 |
| 510 | Ga0495644_0000830 | 3300046523 | Bacteria | 12764 |
| 511 | Ga0495644_0002746 | 3300046523 | Bacteria | 6987 |
| 512 | Ga0495648_0002978 | 3300046524 | Bacteria | 15198 |
| 513 | Ga0495648_0010691 | 3300046524 | Bacteria | 6971 |
| 514 | Ga0495648_0061037 | 3300046524 | Bacteria | 2240 |
| 515 | Ga0495663_0026053 | 3300046525 | Bacteria | 1710 |
| 516 | Ga0495666_0218711 | 3300046526 | Bacteria | 873 |
| 517 | Ga0495642_0000824 | 3300046528 | Bacteria | 14888 |
| 518 | Ga0495652_0822788 | 3300046529 | Bacteria | 617 |
| 519 | Ga0495654_0003754 | 3300046530 | Bacteria | 9195 |
| 520 | Ga0495654_0013167 | 3300046530 | Bacteria | 4430 |
| 521 | Ga0495654_0019147 | 3300046530 | Bacteria | 3580 |
| 522 | Ga0495654_0032890 | 3300046530 | Bacteria | 2627 |
| 523 | Ga0495654_0036512 | 3300046530 | Bacteria | 2468 |
| 524 | Ga0495654_0042046 | 3300046530 | Bacteria | 2270 |
| 525 | Ga0495587_0021388 | 3300046536 | Bacteria | 3989 |
| 526 | Ga0495598_0090404 | 3300046537 | Bacteria | 997 |
| 527 | Ga0495609_0000061 | 3300046538 | Bacteria | 139848 |
| 528 | Ga0495609_0000100 | 3300046538 | Bacteria | 100831 |
| 529 | Ga0495609_0000756 | 3300046538 | Bacteria | 24390 |
| 530 | Ga0495609_0056203 | 3300046538 | Bacteria | 1744 |
| 531 | Ga0495609_0065176 | 3300046538 | Bacteria | 1606 |
| 532 | Ga0495621_0135109 | 3300046539 | Bacteria | 962 |
| 533 | Ga0495597_0000121 | 3300046542 | Bacteria | 70801 |
| 534 | Ga0495597_0004514 | 3300046542 | Bacteria | 7619 |
| 535 | Ga0495597_0016759 | 3300046542 | Bacteria | 3458 |
| 536 | Ga0495597_0119652 | 3300046542 | Bacteria | 1098 |
| 537 | Ga0495622_0023789 | 3300046557 | Bacteria | 2858 |
| 538 | Ga0495622_0097739 | 3300046557 | Bacteria | 1347 |
| 539 | Ga0495622_0197102 | 3300046557 | Bacteria | 898 |
| 540 | Ga0495667_0040905 | 3300046559 | Bacteria | 3075 |
| 541 | Ga0495667_0227325 | 3300046559 | Unclassified | 1190 |
| 542 | Ga0495656_0017067 | 3300046615 | Bacteria | 2764 |
| 543 | Ga0495656_0035535 | 3300046615 | Bacteria | 2048 |
| 544 | Ga0495656_0802309 | 3300046615 | Bacteria | 509 |
| 545 | Ga0495668_0025762 | 3300046616 | Bacteria | 3340 |
| 546 | Ga0495668_0045844 | 3300046616 | Bacteria | 2430 |
| 547 | Ga0495668_0047143 | 3300046616 | Bacteria | 2392 |
| 548 | Ga0495634_0464057 | 3300046642 | Bacteria | 746 |
| 549 | Ga0495611_0001663 | 3300046648 | Bacteria | 10773 |
| 550 | Ga0495611_0002835 | 3300046648 | Bacteria | 7745 |
| 551 | Ga0495611_0010434 | 3300046648 | Bacteria | 3931 |
| 552 | Ga0495611_0310019 | 3300046648 | Bacteria | 727 |
| 553 | Ga0495625_0000147 | 3300046660 | Bacteria | 107983 |
| 554 | Ga0495625_0002431 | 3300046660 | Bacteria | 20158 |
| 555 | Ga0495625_0028100 | 3300046660 | Bacteria | 4221 |
| 556 | Ga0495635_0117825 | 3300046663 | Bacteria | 1812 |
| 557 | Ga0495635_0427352 | 3300046663 | Bacteria | 878 |
| 558 | Ga0495659_0155962 | 3300046664 | Bacteria | 919 |
| 559 | Ga0495661_0000153 | 3300046665 | Bacteria | 81096 |
| 560 | Ga0495661_0000315 | 3300046665 | Bacteria | 54229 |
| 561 | Ga0495661_0011035 | 3300046665 | Bacteria | 6138 |
| 562 | Ga0495661_0017783 | 3300046665 | Bacteria | 4686 |
| 563 | Ga0495657_0031141 | 3300046675 | Bacteria | 3732 |
| 564 | Ga0495623_0052450 | 3300046679 | Bacteria | 2577 |
| 565 | Ga0495647_0013135 | 3300046681 | Bacteria | 2864 |
| 566 | Ga0495669_0017432 | 3300046684 | Bacteria | 3083 |
| 567 | Ga0495670_0008294 | 3300046691 | Bacteria | 5108 |
| 568 | Ga0495670_0054910 | 3300046691 | Bacteria | 1997 |
| 569 | Ga0495670_0129738 | 3300046691 | Bacteria | 1313 |
| 570 | Ga0495670_0176228 | 3300046691 | Bacteria | 1127 |
| 571 | Ga0495671_0006513 | 3300046692 | Bacteria | 6741 |
| 572 | Ga0495671_0008015 | 3300046692 | Bacteria | 5968 |
| 573 | Ga0495671_0257764 | 3300046692 | Bacteria | 841 |
| 574 | Ga0495671_0305644 | 3300046692 | Bacteria | 765 |
| 575 | Ga0495649_0000686 | 3300046694 | Bacteria | 27567 |
| 576 | Ga0495649_0002690 | 3300046694 | Bacteria | 12380 |
| 577 | Ga0495649_0107230 | 3300046694 | Bacteria | 1482 |
| 578 | Ga0495649_0162840 | 3300046694 | Bacteria | 1169 |
| 579 | Ga0495649_0283466 | 3300046694 | Bacteria | 846 |
| 580 | Ga0495589_0011002 | 3300046794 | Bacteria | 4697 |
| 581 | Ga0495589_0018291 | 3300046794 | Bacteria | 3595 |
| 582 | Ga0495589_0088343 | 3300046794 | Bacteria | 1505 |
| 583 | Ga0495600_0020460 | 3300046809 | Bacteria | 4232 |
| 584 | Ga0495660_0000813 | 3300046810 | Bacteria | 23314 |
| 585 | Ga0495660_0001072 | 3300046810 | Bacteria | 19628 |
| 586 | Ga0495660_0002689 | 3300046810 | Bacteria | 11234 |
| 587 | Ga0495660_0017784 | 3300046810 | Bacteria | 4089 |
| 588 | Ga0495660_0036756 | 3300046810 | Bacteria | 2730 |
| 589 | Ga0495660_0133744 | 3300046810 | Bacteria | 1241 |
| 590 | Ga0495660_0170790 | 3300046810 | Bacteria | 1059 |
| 591 | Ga0495660_0467728 | 3300046810 | Bacteria | 543 |
| 592 | Ga0495581_0180106 | 3300047315 | Bacteria | 1236 |
| 593 | Ga0495604_0209638 | 3300047317 | Bacteria | 1347 |
| 594 | Ga0495636_0000767 | 3300047318 | Bacteria | 11818 |
| 595 | Ga0495674_0038624 | 3300047319 | Bacteria | 4284 |
| 596 | Ga0495672_0001274 | 3300047320 | Bacteria | 25229 |
| 597 | Ga0495672_0003072 | 3300047320 | Bacteria | 14614 |
| 598 | Ga0495672_0003235 | 3300047320 | Bacteria | 14138 |
| 599 | Ga0495672_0006475 | 3300047320 | Bacteria | 9056 |
| 600 | Ga0495672_0010264 | 3300047320 | Bacteria | 6689 |
| 601 | Ga0495672_0018222 | 3300047320 | Bacteria | 4671 |
| 602 | Ga0495672_0025075 | 3300047320 | Bacteria | 3825 |
| 603 | Ga0495672_0064038 | 3300047320 | Bacteria | 2107 |
| 604 | Ga0495676_0000027 | 3300047321 | Bacteria | 141955 |
| 605 | Ga0495676_0024454 | 3300047321 | Bacteria | 5229 |
| 606 | Ga0495683_0014876 | 3300047323 | Bacteria | 4051 |
| 607 | Ga0495683_0027940 | 3300047323 | Bacteria | 2885 |
| 608 | Ga0495687_001396 | 3300047443 | Bacteria | 22282 |
| 609 | Ga0495675_0271091 | 3300047444 | Bacteria | 1014 |
| 610 | Ga0495679_000096 | 3300047446 | Bacteria | 80131 |
| 611 | Ga0495679_080819 | 3300047446 | Bacteria | 923 |
| 612 | Ga0495685_271216 | 3300047447 | Bacteria | 536 |
| 613 | Ga0495673_0002023 | 3300047469 | Bacteria | 14906 |
| 614 | Ga0495673_0002635 | 3300047469 | Bacteria | 12426 |
| 615 | Ga0495673_0003580 | 3300047469 | Bacteria | 10192 |
| 616 | Ga0495673_0010013 | 3300047469 | Bacteria | 5193 |
| 617 | Ga0495673_0012324 | 3300047469 | Bacteria | 4544 |
| 618 | Ga0495673_0012824 | 3300047469 | Bacteria | 4424 |
| 619 | Ga0495673_0024649 | 3300047469 | Bacteria | 2901 |
| 620 | Ga0495681_0000737 | 3300047470 | Bacteria | 25128 |
| 621 | Ga0495681_0001170 | 3300047470 | Bacteria | 19933 |
| 622 | Ga0495681_0015002 | 3300047470 | Bacteria | 4406 |
| 623 | Ga0495686_0434768 | 3300047472 | Bacteria | 699 |
| 624 | Ga0495593_0360933 | 3300047673 | Bacteria | 726 |
| 625 | Ga0495602_0424678 | 3300048088 | Bacteria | 943 |
| 626 | Ga0495626_0000067 | 3300048091 | Bacteria | 139969 |
| 627 | Ga0495626_0006295 | 3300048091 | Bacteria | 6773 |
| 628 | Ga0495626_0165075 | 3300048091 | Bacteria | 926 |
| 629 | Ga0496100_0219526 | 3300048903 | Bacteria | 1394 |
| 630 | Ga0496100_0292904 | 3300048903 | Bacteria | 1216 |
| 631 | Ga0496100_0342503 | 3300048903 | Bacteria | 1127 |
| 632 | Ga0496101_0296607 | 3300048904 | Bacteria | 1265 |
| 633 | Ga0496102_0049571 | 3300048905 | Bacteria | 3820 |
| 634 | Ga0496102_0065808 | 3300048905 | Bacteria | 3322 |
| 635 | Ga0496102_0172014 | 3300048905 | Bacteria | 2039 |
| 636 | Ga0496102_0320457 | 3300048905 | Bacteria | 1460 |
| 637 | Ga0496102_0641304 | 3300048905 | Bacteria | 985 |
| 638 | Ga0496103_0109288 | 3300048906 | Bacteria | 1755 |
| 639 | Ga0496103_0347895 | 3300048906 | Bacteria | 953 |
| 640 | Ga0496103_0610647 | 3300048906 | Bacteria | 694 |
| 641 | Ga0496104_0057291 | 3300048907 | Bacteria | 3686 |
| 642 | Ga0496105_0010046 | 3300048908 | Bacteria | 7428 |
| 643 | Ga0496105_0323943 | 3300048908 | Bacteria | 1234 |
| 644 | Ga0496106_0048331 | 3300048909 | Bacteria | 3204 |
| 645 | Ga0496106_0420939 | 3300048909 | Bacteria | 1073 |
| 646 | Ga0496107_0079288 | 3300048910 | Bacteria | 2393 |
| 647 | Ga0496107_0089233 | 3300048910 | Bacteria | 2251 |
| 648 | Ga0496107_0941911 | 3300048910 | Bacteria | 628 |
| 649 | Ga0496108_0018674 | 3300048911 | Bacteria | 5681 |
| 650 | Ga0496108_0080402 | 3300048911 | Bacteria | 2760 |
| 651 | Ga0496108_0896472 | 3300048911 | Bacteria | 761 |
| 652 | Ga0496109_0001072 | 3300048912 | Bacteria | 22689 |
| 653 | Ga0496109_0014915 | 3300048912 | Bacteria | 6763 |
| 654 | Ga0496110_0078265 | 3300048913 | Bacteria | 2944 |
| 655 | Ga0496110_0110524 | 3300048913 | Bacteria | 2469 |
| 656 | Ga0496110_0322353 | 3300048913 | Bacteria | 1407 |
| 657 | Ga0496110_0597113 | 3300048913 | Bacteria | 1002 |
| 658 | Ga0496111_0040397 | 3300048914 | Bacteria | 3346 |
| 659 | Ga0496111_0124538 | 3300048914 | Bacteria | 1905 |
| 660 | Ga0496111_0318577 | 3300048914 | Bacteria | 1152 |
| 661 | Ga0496112_0040329 | 3300048915 | Bacteria | 4565 |
| 662 | Ga0496112_0098618 | 3300048915 | Bacteria | 2891 |
| 663 | Ga0496112_0152673 | 3300048915 | Bacteria | 2277 |
| 664 | Ga0496112_0456399 | 3300048915 | Bacteria | 1215 |
| 665 | Ga0496113_0004347 | 3300048916 | Bacteria | 8683 |
| 666 | Ga0496113_0505259 | 3300048916 | Bacteria | 971 |
| 667 | Ga0496114_0101103 | 3300048917 | Bacteria | 2461 |
| 668 | Ga0496114_0101243 | 3300048917 | Bacteria | 2459 |
| 669 | Ga0496114_0210682 | 3300048917 | Bacteria | 1704 |
| 670 | Ga0496115_0008641 | 3300048918 | Bacteria | 7542 |
| 671 | Ga0496115_0105748 | 3300048918 | Bacteria | 2310 |
| 672 | Ga0496116_0000242 | 3300048919 | Bacteria | 99455 |
| 673 | Ga0496116_0007472 | 3300048919 | Bacteria | 9684 |
| 674 | Ga0496117_0000270 | 3300048920 | Bacteria | 97077 |
| 675 | Ga0496117_0093775 | 3300048920 | Bacteria | 1924 |
| 676 | Ga0496118_0043014 | 3300048921 | Bacteria | 3556 |
| 677 | Ga0496118_0101036 | 3300048921 | Bacteria | 1949 |
| 678 | Ga0496118_0108973 | 3300048921 | Bacteria | 1844 |
| 679 | Ga0496118_0617721 | 3300048921 | Bacteria | 515 |
| 680 | Ga0496121_0000318 | 3300048924 | Bacteria | 100833 |
| 681 | Ga0496121_0001431 | 3300048924 | Bacteria | 40302 |
| 682 | Ga0496121_0003842 | 3300048924 | Bacteria | 20894 |
| 683 | Ga0496121_0598581 | 3300048924 | Bacteria | 681 |
| 684 | Ga0496122_0000517 | 3300048925 | Bacteria | 79890 |
| 685 | Ga0496122_0018570 | 3300048925 | Bacteria | 6413 |
| 686 | Ga0496122_0239956 | 3300048925 | Bacteria | 1023 |
| 687 | Ga0496123_0000243 | 3300048926 | Bacteria | 109767 |
| 688 | Ga0496123_0005798 | 3300048926 | Bacteria | 12263 |
| 689 | Ga0496123_0014129 | 3300048926 | Bacteria | 6640 |
| 690 | Ga0496123_0248984 | 3300048926 | Bacteria | 878 |
| 691 | Ga0496124_0000751 | 3300048927 | Bacteria | 53223 |
| 692 | Ga0496124_0009781 | 3300048927 | Bacteria | 9811 |
| 693 | Ga0496124_0042538 | 3300048927 | Bacteria | 3911 |
| 694 | Ga0496124_0562764 | 3300048927 | Bacteria | 750 |
| 695 | Ga0496125_0338035 | 3300048928 | Bacteria | 905 |
| 696 | Ga0496126_0089688 | 3300048929 | Bacteria | 2706 |
| 697 | Ga0496126_0109567 | 3300048929 | Bacteria | 2407 |
| 698 | Ga0496126_0430335 | 3300048929 | Bacteria | 1065 |
| 699 | Ga0495678_000510 | 3300049459 | Bacteria | 37954 |
| 700 | Ga0495678_002035 | 3300049459 | Bacteria | 14480 |
| 701 | Ga0495678_007465 | 3300049459 | Bacteria | 5661 |
| 702 | Ga0495678_026173 | 3300049459 | Bacteria | 2494 |
| 703 | Ga0495682_0000413 | 3300049460 | Bacteria | 30397 |
| 704 | Ga0495682_0090326 | 3300049460 | Bacteria | 1100 |
| 705 | Ga0501033_0015112 | 3300049570 | Bacteria | 5858 |
| 706 | Ga0501033_0038285 | 3300049570 | Bacteria | 3587 |
| 707 | Ga0501034_0282628 | 3300049571 | Bacteria | 1599 |
| 708 | Ga0501034_1344320 | 3300049571 | Bacteria | 590 |
| 709 | Ga0501038_0030302 | 3300049574 | Bacteria | 4789 |
| 710 | Ga0501038_0946911 | 3300049574 | Bacteria | 634 |
| 711 | Ga0501043_0731533 | 3300049579 | Bacteria | 721 |
| 712 | Ga0501047_0219102 | 3300049581 | Bacteria | 1760 |
| 713 | Ga0501047_0283863 | 3300049581 | Bacteria | 1500 |
| 714 | Ga0501047_0816699 | 3300049581 | Bacteria | 747 |
| 715 | Ga0501076_0328968 | 3300049592 | Bacteria | 1254 |
| 716 | Ga0501227_044144 | 3300049665 | Bacteria | 1109 |
| 717 | Ga0501035_0008321 | 3300049822 | Bacteria | 9658 |
| 718 | Ga0501035_0183376 | 3300049822 | Bacteria | 1802 |
| 719 | Ga0501044_0011238 | 3300049823 | Bacteria | 9706 |
| 720 | Ga0501044_0449883 | 3300049823 | Bacteria | 1195 |
| 721 | Ga0501044_0519598 | 3300049823 | Bacteria | 1090 |
| 722 | Ga0501044_1619598 | 3300049823 | Bacteria | 512 |
| 723 | Ga0501226_000008 | 3300049853 | Bacteria | 199119 |
| 724 | nmdc:mga03n38_304178_c1 | 3300050490 | Bacteria | 857 |
| 725 | nmdc:mga00v17_53855_c1 | 3300050491 | Bacteria | 2453 |
| 726 | nmdc:mga0yw44_14347_c1 | 3300050492 | Bacteria | 4206 |
| 727 | nmdc:mga0yw44_149299_c1 | 3300050492 | Bacteria | 1524 |
| 728 | nmdc:mga0yw44_20308_c1 | 3300050492 | Bacteria | 3684 |
| 729 | nmdc:mga0yw44_20423_c1 | 3300050492 | Bacteria | 3675 |
| 730 | nmdc:mga0yw44_231739_c1 | 3300050492 | Bacteria | 1226 |
| 731 | nmdc:mga0yw44_373041_c1 | 3300050492 | Bacteria | 963 |
| 732 | nmdc:mga06z11_475551_c1 | 3300050494 | Bacteria | 756 |
| 733 | nmdc:mga06z11_828402_c1 | 3300050494 | Bacteria | 564 |
| 734 | nmdc:mga04h51_55881_c1 | 3300050495 | Bacteria | 1338 |
| 735 | nmdc:mga04h51_79937_c1 | 3300050495 | Bacteria | 1158 |
| 736 | nmdc:mga07m45_366288_c1 | 3300050496 | Bacteria | 837 |
| 737 | nmdc:mga05p37_8309_c1 | 3300050507 | Bacteria | 12274 |
| 738 | nmdc:mga09592_1276293_c1 | 3300050508 | Bacteria | 604 |
| 739 | nmdc:mga06r32_191090_c1 | 3300050510 | Bacteria | 2035 |
| 740 | nmdc:mga08y16_75071_c1 | 3300050511 | Bacteria | 3524 |
| 741 | nmdc:mga08y16_86982_c1 | 3300050511 | Bacteria | 3256 |
| 742 | nmdc:mga0n895_1238613_c1 | 3300050512 | Bacteria | 719 |
| 743 | nmdc:mga0n895_124780_c1 | 3300050512 | Bacteria | 2598 |
| 744 | nmdc:mga08x19_61579_c1 | 3300050514 | Bacteria | 2432 |
| 745 | nmdc:mga08x19_650715_c1 | 3300050514 | Bacteria | 747 |
| 746 | Ga0495601_0016682 | 3300053077 | Bacteria | 4452 |
| 747 | Ga0495601_0043456 | 3300053077 | Bacteria | 2822 |
| 748 | Ga0495612_0022629 | 3300053078 | Bacteria | 2518 |
| 749 | Ga0500635_0030792 | 3300053080 | Bacteria | 1732 |
| 750 | Ga0495655_0009483 | 3300053083 | Bacteria | 1889 |
| 751 | Ga0495595_0001461 | 3300053084 | Bacteria | 9232 |
| 752 | Ga0495619_0060061 | 3300053085 | Bacteria | 2526 |
| 753 | Ga0495619_0209617 | 3300053085 | Bacteria | 1349 |
| 754 | Ga0500651_0154621 | 3300053093 | Bacteria | 1375 |
| 755 | Ga0500650_0133192 | 3300053098 | Bacteria | 1155 |
| 756 | Ga0500593_023431 | 3300053117 | Bacteria | 2733 |
| 757 | Ga0500595_187160 | 3300053119 | Bacteria | 573 |
| 758 | Ga0500608_085477 | 3300053122 | Bacteria | 1482 |
| 759 | Ga0500559_0000012 | 3300053136 | Bacteria | 164222 |
| 760 | Ga0500568_0000002 | 3300053139 | Bacteria | 880601 |
| 761 | Ga0500573_0071125 | 3300053140 | Bacteria | 1984 |
| 762 | Ga0500586_150085 | 3300053145 | Bacteria | 796 |
| 763 | Ga0500636_0250802 | 3300053177 | Bacteria | 902 |
| 764 | Ga0500637_0009309 | 3300053178 | Bacteria | 4995 |
| 765 | Ga0500637_0376567 | 3300053178 | Bacteria | 746 |
| 766 | Ga0500645_000469 | 3300053730 | Bacteria | 27530 |
| 767 | Ga0500661_001487 | 3300055283 | Bacteria | 4400 |
| 768 | Ga0500661_015672 | 3300055283 | Bacteria | 1358 |
| 769 | Ga0587073_0146454 | 3300059492 | Bacteria | 664 |
| 770 | Ga0587083_0160926 | 3300059505 | Bacteria | 614 |
| 771 | Ga0587079_060033 | 3300059647 | Bacteria | 822 |
| 772 | Ga0587071_188178 | 3300060344 | Bacteria | 534 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042016 | Ga0439463_090554 | Ga0439463_090554_93_572 | 128 |
| 2 | 3300005328 | Ga0070676_11122110 | Ga0070676_111221101 | 140 |
| 3 | 3300005336 | Ga0070680_100124899 | Ga0070680_1001248991 | 140 |
| 4 | 3300005339 | Ga0070660_100762924 | Ga0070660_1007629241 | 140 |
| 5 | 3300005356 | Ga0070674_100543955 | Ga0070674_1005439552 | 140 |
| 6 | 3300005367 | Ga0070667_102066040 | Ga0070667_1020660401 | 140 |
| 7 | 3300005458 | Ga0070681_10578418 | Ga0070681_105784182 | 140 |
| 8 | 3300005530 | Ga0070679_100017438 | Ga0070679_1000174383 | 140 |
| 9 | 3300005539 | Ga0068853_100177218 | Ga0068853_1001772182 | 140 |
| 10 | 3300005548 | Ga0070665_101167384 | Ga0070665_1011673841 | 140 |
| 11 | 3300005563 | Ga0068855_100046181 | Ga0068855_1000461812 | 140 |
| 12 | 3300006358 | Ga0068871_100670937 | Ga0068871_1006709372 | 140 |
| 13 | 3300006881 | Ga0068865_100047115 | Ga0068865_1000471154 | 140 |
| 14 | 3300009093 | Ga0105240_10079592 | Ga0105240_100795923 | 140 |
| 15 | 3300009093 | Ga0105240_10436904 | Ga0105240_104369044 | 140 |
| 16 | 3300009093 | Ga0105240_11177781 | Ga0105240_111777812 | 140 |
| 17 | 3300009174 | Ga0105241_10373160 | Ga0105241_103731601 | 140 |
| 18 | 3300009174 | Ga0105241_10758247 | Ga0105241_107582471 | 140 |
| 19 | 3300009545 | Ga0105237_10044603 | Ga0105237_100446031 | 140 |
| 20 | 3300009551 | Ga0105238_10051481 | Ga0105238_100514814 | 140 |
| 21 | 3300010375 | Ga0105239_10140201 | Ga0105239_101402012 | 140 |
| 22 | 3300013105 | Ga0157369_10650949 | Ga0157369_106509492 | 140 |
| 23 | 3300013307 | Ga0157372_11360476 | Ga0157372_113604761 | 140 |
| 24 | 3300014325 | Ga0163163_10854098 | Ga0163163_108540982 | 140 |
| 25 | 3300014969 | Ga0157376_10308476 | Ga0157376_103084764 | 140 |
| 26 | 3300025912 | Ga0207707_10256395 | Ga0207707_102563952 | 140 |
| 27 | 3300025913 | Ga0207695_10005133 | Ga0207695_100051335 | 140 |
| 28 | 3300025913 | Ga0207695_10094384 | Ga0207695_100943842 | 140 |
| 29 | 3300025913 | Ga0207695_10621431 | Ga0207695_106214312 | 140 |
| 30 | 3300025914 | Ga0207671_10148853 | Ga0207671_101488532 | 140 |
| 31 | 3300025921 | Ga0207652_11164911 | Ga0207652_111649111 | 140 |
| 32 | 3300025924 | Ga0207694_10098667 | Ga0207694_100986672 | 140 |
| 33 | 3300025924 | Ga0207694_10387483 | Ga0207694_103874831 | 140 |
| 34 | 3300025938 | Ga0207704_10574844 | Ga0207704_105748442 | 140 |
| 35 | 3300025949 | Ga0207667_10103750 | Ga0207667_101037503 | 140 |
| 36 | 3300025986 | Ga0207658_11535943 | Ga0207658_115359431 | 140 |
| 37 | 3300026041 | Ga0207639_10268333 | Ga0207639_102683331 | 140 |
| 38 | 3300028379 | Ga0268266_10197540 | Ga0268266_101975404 | 140 |
| 39 | 3300028800 | Ga0265338_10205713 | Ga0265338_102057133 | 140 |
| 40 | 3300031235 | Ga0265330_10133376 | Ga0265330_101333762 | 140 |
| 41 | 3300031241 | Ga0265325_10001594 | Ga0265325_100015945 | 140 |
| 42 | 3300031250 | Ga0265331_10033379 | Ga0265331_100333794 | 140 |
| 43 | 3300031344 | Ga0265316_10068870 | Ga0265316_100688702 | 140 |
| 44 | 3300031595 | Ga0265313_10011247 | Ga0265313_100112479 | 140 |
| 45 | 3300031711 | Ga0265314_10208585 | Ga0265314_102085852 | 140 |
| 46 | 3300037466 | Ga0395898_0097924 | Ga0395898_0097924_68_490 | 140 |
| 47 | 3300037471 | Ga0395905_0244439 | Ga0395905_0244439_581_1003 | 140 |
| 48 | 3300038443 | Ga0395901_0172942 | Ga0395901_0172942_1425_1847 | 140 |
| 49 | 3300046794 | Ga0495589_0018291 | Ga0495589_0018291_1160_1582 | 140 |
| 50 | 3300048088 | Ga0495602_0424678 | Ga0495602_0424678_52_474 | 140 |
| 51 | 3300048921 | Ga0496118_0617721 | Ga0496118_0617721_44_466 | 140 |
| 52 | 3300049570 | Ga0501033_0015112 | Ga0501033_0015112_5413_5835 | 140 |
| 53 | 3300049570 | Ga0501033_0038285 | Ga0501033_0038285_1629_2051 | 140 |
| 54 | 3300049571 | Ga0501034_1344320 | Ga0501034_1344320_95_520 | 140 |
| 55 | 3300049574 | Ga0501038_0030302 | Ga0501038_0030302_2234_2656 | 140 |
| 56 | 3300049574 | Ga0501038_0946911 | Ga0501038_0946911_20_442 | 140 |
| 57 | 3300049581 | Ga0501047_0219102 | Ga0501047_0219102_149_571 | 140 |
| 58 | 3300049581 | Ga0501047_0283863 | Ga0501047_0283863_360_782 | 140 |
| 59 | 3300049822 | Ga0501035_0008321 | Ga0501035_0008321_2011_2433 | 140 |
| 60 | 3300049822 | Ga0501035_0183376 | Ga0501035_0183376_1284_1706 | 140 |
| 61 | 3300049823 | Ga0501044_0011238 | Ga0501044_0011238_8096_8518 | 140 |
| 62 | 3300049823 | Ga0501044_0519598 | Ga0501044_0519598_252_674 | 140 |
| 63 | 3300003856 | Ga0058692_1001767 | Ga0058692_10017676 | 141 |
| 64 | 3300005290 | Ga0065712_10088919 | Ga0065712_100889193 | 141 |
| 65 | 3300005329 | Ga0070683_100000263 | Ga0070683_10000026322 | 141 |
| 66 | 3300005336 | Ga0070680_100133269 | Ga0070680_1001332692 | 141 |
| 67 | 3300005340 | Ga0070689_100541207 | Ga0070689_1005412071 | 141 |
| 68 | 3300005435 | Ga0070714_100298184 | Ga0070714_1002981841 | 141 |
| 69 | 3300005436 | Ga0070713_100034303 | Ga0070713_1000343035 | 141 |
| 70 | 3300005436 | Ga0070713_101510749 | Ga0070713_1015107491 | 141 |
| 71 | 3300005467 | Ga0070706_100903005 | Ga0070706_1009030052 | 141 |
| 72 | 3300005467 | Ga0070706_101656337 | Ga0070706_1016563372 | 141 |
| 73 | 3300005530 | Ga0070679_100374494 | Ga0070679_1003744942 | 141 |
| 74 | 3300005530 | Ga0070679_100556141 | Ga0070679_1005561412 | 141 |
| 75 | 3300005535 | Ga0070684_100004996 | Ga0070684_10000499610 | 141 |
| 76 | 3300005539 | Ga0068853_100108458 | Ga0068853_1001084583 | 141 |
| 77 | 3300005563 | Ga0068855_100304213 | Ga0068855_1003042133 | 141 |
| 78 | 3300005614 | Ga0068856_101997965 | Ga0068856_1019979651 | 141 |
| 79 | 3300005843 | Ga0068860_100625520 | Ga0068860_1006255201 | 141 |
| 80 | 3300005983 | Ga0081540_1160365 | Ga0081540_11603653 | 141 |
| 81 | 3300006028 | Ga0070717_10026052 | Ga0070717_100260525 | 141 |
| 82 | 3300006038 | Ga0075365_10045859 | Ga0075365_100458591 | 141 |
| 83 | 3300006038 | Ga0075365_10055835 | Ga0075365_100558354 | 141 |
| 84 | 3300006038 | Ga0075365_10519755 | Ga0075365_105197552 | 141 |
| 85 | 3300006051 | Ga0075364_10307385 | Ga0075364_103073852 | 141 |
| 86 | 3300006163 | Ga0070715_10087767 | Ga0070715_100877671 | 141 |
| 87 | 3300006175 | Ga0070712_100019927 | Ga0070712_1000199272 | 141 |
| 88 | 3300006847 | Ga0075431_100659891 | Ga0075431_1006598911 | 141 |
| 89 | 3300006871 | Ga0075434_100537446 | Ga0075434_1005374463 | 141 |
| 90 | 3300007265 | Ga0099794_10068552 | Ga0099794_100685523 | 141 |
| 91 | 3300009147 | Ga0114129_10341077 | Ga0114129_103410772 | 141 |
| 92 | 3300009147 | Ga0114129_10990197 | Ga0114129_109901971 | 141 |
| 93 | 3300009147 | Ga0114129_11238620 | Ga0114129_112386201 | 141 |
| 94 | 3300009174 | Ga0105241_10920068 | Ga0105241_109200682 | 141 |
| 95 | 3300009551 | Ga0105238_10454153 | Ga0105238_104541532 | 141 |
| 96 | 3300009551 | Ga0105238_11507084 | Ga0105238_115070842 | 141 |
| 97 | 3300010375 | Ga0105239_10764342 | Ga0105239_107643422 | 141 |
| 98 | 3300013100 | Ga0157373_10047780 | Ga0157373_100477804 | 141 |
| 99 | 3300013100 | Ga0157373_10525281 | Ga0157373_105252812 | 141 |
| 100 | 3300013102 | Ga0157371_10091888 | Ga0157371_100918882 | 141 |
| 101 | 3300013105 | Ga0157369_10110463 | Ga0157369_101104632 | 141 |
| 102 | 3300013105 | Ga0157369_10341863 | Ga0157369_103418632 | 141 |
| 103 | 3300013105 | Ga0157369_10605458 | Ga0157369_106054582 | 141 |
| 104 | 3300015261 | Ga0182006_1017252 | Ga0182006_10172523 | 141 |
| 105 | 3300021358 | Ga0213873_10004171 | Ga0213873_100041713 | 141 |
| 106 | 3300025303 | Ga0209051_1008357 | Ga0209051_10083574 | 141 |
| 107 | 3300025898 | Ga0207692_10088135 | Ga0207692_100881352 | 141 |
| 108 | 3300025905 | Ga0207685_10084454 | Ga0207685_100844542 | 141 |
| 109 | 3300025906 | Ga0207699_10699185 | Ga0207699_106991851 | 141 |
| 110 | 3300025909 | Ga0207705_10941986 | Ga0207705_109419861 | 141 |
| 111 | 3300025910 | Ga0207684_10914017 | Ga0207684_109140171 | 141 |
| 112 | 3300025910 | Ga0207684_11561944 | Ga0207684_115619441 | 141 |
| 113 | 3300025915 | Ga0207693_10004673 | Ga0207693_100046735 | 141 |
| 114 | 3300025915 | Ga0207693_10460319 | Ga0207693_104603191 | 141 |
| 115 | 3300025916 | Ga0207663_11333207 | Ga0207663_113332071 | 141 |
| 116 | 3300025917 | Ga0207660_10155592 | Ga0207660_101555921 | 141 |
| 117 | 3300025919 | Ga0207657_10007091 | Ga0207657_100070918 | 141 |
| 118 | 3300025921 | Ga0207652_10316721 | Ga0207652_103167212 | 141 |
| 119 | 3300025928 | Ga0207700_10032139 | Ga0207700_100321392 | 141 |
| 120 | 3300025936 | Ga0207670_11111440 | Ga0207670_111114402 | 141 |
| 121 | 3300025939 | Ga0207665_10103495 | Ga0207665_101034953 | 141 |
| 122 | 3300025944 | Ga0207661_10001051 | Ga0207661_100010515 | 141 |
| 123 | 3300025949 | Ga0207667_10234293 | Ga0207667_102342932 | 141 |
| 124 | 3300025949 | Ga0207667_11443062 | Ga0207667_114430621 | 141 |
| 125 | 3300026041 | Ga0207639_10809664 | Ga0207639_108096641 | 141 |
| 126 | 3300026116 | Ga0207674_10400244 | Ga0207674_104002442 | 141 |
| 127 | 3300027312 | Ga0209371_1000032 | Ga0209371_1000032327 | 141 |
| 128 | 3300028379 | Ga0268266_10086781 | Ga0268266_100867812 | 141 |
| 129 | 3300028381 | Ga0268264_10586842 | Ga0268264_105868421 | 141 |
| 130 | 3300028381 | Ga0268264_11651104 | Ga0268264_116511041 | 141 |
| 131 | 3300028800 | Ga0265338_10049552 | Ga0265338_100495521 | 141 |
| 132 | 3300030500 | Ga0268256_1000050 | Ga0268256_1000050250 | 141 |
| 133 | 3300031548 | Ga0307408_100000028 | Ga0307408_100000028183 | 141 |
| 134 | 3300031711 | Ga0265314_10009427 | Ga0265314_100094274 | 141 |
| 135 | 3300032004 | Ga0307414_10023320 | Ga0307414_100233207 | 141 |
| 136 | 3300035117 | Ga0373953_0034897 | Ga0373953_0034897_846_1271 | 141 |
| 137 | 3300035120 | Ga0373957_0050160 | Ga0373957_0050160_952_1377 | 141 |
| 138 | 3300035172 | Ga0373955_0051409 | Ga0373955_0051409_427_852 | 141 |
| 139 | 3300035410 | Ga0373924_0580013 | Ga0373924_0580013_64_489 | 141 |
| 140 | 3300035724 | Ga0373933_0009993 | Ga0373933_0009993_2011_2436 | 141 |
| 141 | 3300036401 | Ga0373937_0022169 | Ga0373937_0022169_3792_4217 | 141 |
| 142 | 3300039438 | Ga0436360_0592298 | Ga0436360_0592298_1653_2078 | 141 |
| 143 | 3300039447 | Ga0436361_0051944 | Ga0436361_0051944_926_1351 | 141 |
| 144 | 3300039453 | Ga0436362_0951072 | Ga0436362_0951072_1274_1699 | 141 |
| 145 | 3300041486 | Ga0451807_0352186 | Ga0451807_0352186_113_538 | 141 |
| 146 | 3300042006 | Ga0439432_006470 | Ga0439432_006470_3409_3834 | 141 |
| 147 | 3300042439 | Ga0439464_0003176 | Ga0439464_0003176_1299_1724 | 141 |
| 148 | 3300042439 | Ga0439464_0008637 | Ga0439464_0008637_783_1208 | 141 |
| 149 | 3300042439 | Ga0439464_0048587 | Ga0439464_0048587_421_846 | 141 |
| 150 | 3300044694 | Ga0466963_0822848 | Ga0466963_0822848_15_440 | 141 |
| 151 | 3300046463 | Ga0495653_0091857 | Ga0495653_0091857_1218_1643 | 141 |
| 152 | 3300046475 | Ga0495639_0541688 | Ga0495639_0541688_53_478 | 141 |
| 153 | 3300046491 | Ga0495584_0304970 | Ga0495584_0304970_86_511 | 141 |
| 154 | 3300046507 | Ga0495606_0000084 | Ga0495606_0000084_84976_85401 | 141 |
| 155 | 3300046511 | Ga0495608_0157050 | Ga0495608_0157050_968_1393 | 141 |
| 156 | 3300046525 | Ga0495663_0026053 | Ga0495663_0026053_1195_1620 | 141 |
| 157 | 3300046529 | Ga0495652_0822788 | Ga0495652_0822788_14_439 | 141 |
| 158 | 3300046536 | Ga0495587_0021388 | Ga0495587_0021388_1436_1861 | 141 |
| 159 | 3300046559 | Ga0495667_0040905 | Ga0495667_0040905_2029_2454 | 141 |
| 160 | 3300046615 | Ga0495656_0035535 | Ga0495656_0035535_1464_1889 | 141 |
| 161 | 3300046663 | Ga0495635_0117825 | Ga0495635_0117825_348_773 | 141 |
| 162 | 3300046675 | Ga0495657_0031141 | Ga0495657_0031141_1177_1602 | 141 |
| 163 | 3300046679 | Ga0495623_0052450 | Ga0495623_0052450_288_713 | 141 |
| 164 | 3300046691 | Ga0495670_0054910 | Ga0495670_0054910_129_554 | 141 |
| 165 | 3300046809 | Ga0495600_0020460 | Ga0495600_0020460_444_869 | 141 |
| 166 | 3300047317 | Ga0495604_0209638 | Ga0495604_0209638_433_858 | 141 |
| 167 | 3300047444 | Ga0495675_0271091 | Ga0495675_0271091_416_841 | 141 |
| 168 | 3300048913 | Ga0496110_0597113 | Ga0496110_0597113_387_812 | 141 |
| 169 | 3300048916 | Ga0496113_0505259 | Ga0496113_0505259_511_936 | 141 |
| 170 | 3300048924 | Ga0496121_0598581 | Ga0496121_0598581_142_567 | 141 |
| 171 | 3300048925 | Ga0496122_0239956 | Ga0496122_0239956_526_951 | 141 |
| 172 | 3300048926 | Ga0496123_0248984 | Ga0496123_0248984_195_620 | 141 |
| 173 | 3300048929 | Ga0496126_0109567 | Ga0496126_0109567_779_1204 | 141 |
| 174 | 3300048929 | Ga0496126_0430335 | Ga0496126_0430335_155_580 | 141 |
| 175 | 3300049571 | Ga0501034_0282628 | Ga0501034_0282628_691_1116 | 141 |
| 176 | 3300049579 | Ga0501043_0731533 | Ga0501043_0731533_66_491 | 141 |
| 177 | 3300049581 | Ga0501047_0816699 | Ga0501047_0816699_258_683 | 141 |
| 178 | 3300049592 | Ga0501076_0328968 | Ga0501076_0328968_35_460 | 141 |
| 179 | 3300049823 | Ga0501044_0449883 | Ga0501044_0449883_709_1134 | 141 |
| 180 | 3300049823 | Ga0501044_1619598 | Ga0501044_1619598_59_484 | 141 |
| 181 | 3300050491 | nmdc:mga00v17_53855_c1 | nmdc:mga00v17_53855_c1_1818_2243 | 141 |
| 182 | 3300050492 | nmdc:mga0yw44_20423_c1 | nmdc:mga0yw44_20423_c1_2795_3220 | 141 |
| 183 | 3300050492 | nmdc:mga0yw44_231739_c1 | nmdc:mga0yw44_231739_c1_355_780 | 141 |
| 184 | 3300050492 | nmdc:mga0yw44_373041_c1 | nmdc:mga0yw44_373041_c1_341_766 | 141 |
| 185 | 3300050508 | nmdc:mga09592_1276293_c1 | nmdc:mga09592_1276293_c1_134_559 | 141 |
| 186 | 3300050512 | nmdc:mga0n895_1238613_c1 | nmdc:mga0n895_1238613_c1_66_491 | 141 |
| 187 | 3300053077 | Ga0495601_0016682 | Ga0495601_0016682_276_701 | 141 |
| 188 | 3300053078 | Ga0495612_0022629 | Ga0495612_0022629_1814_2239 | 141 |
| 189 | 3300053084 | Ga0495595_0001461 | Ga0495595_0001461_490_915 | 141 |
| 190 | 3300053085 | Ga0495619_0209617 | Ga0495619_0209617_434_859 | 141 |
| 191 | 3300053730 | Ga0500645_000469 | Ga0500645_000469_16870_17298 | 141 |
| 192 | 3300001976 | JGI24752J21851_1025345 | JGI24752J21851_10253452 | 142 |
| 193 | 3300001989 | JGI24739J22299_10044412 | JGI24739J22299_100444122 | 142 |
| 194 | 3300001990 | JGI24737J22298_10061775 | JGI24737J22298_100617752 | 142 |
| 195 | 3300002070 | JGI24750J21931_1015625 | JGI24750J21931_10156251 | 142 |
| 196 | 3300002073 | JGI24745J21846_1029239 | JGI24745J21846_10292391 | 142 |
| 197 | 3300002075 | JGI24738J21930_10012000 | JGI24738J21930_100120001 | 142 |
| 198 | 3300002077 | JGI24744J21845_10030291 | JGI24744J21845_100302912 | 142 |
| 199 | 3300002239 | JGI24034J26672_10088205 | JGI24034J26672_100882051 | 142 |
| 200 | 3300002459 | JGI24751J29686_10007457 | JGI24751J29686_100074571 | 142 |
| 201 | 3300002737 | JGI25162J39368_1000219 | JGI25162J39368_100021940 | 142 |
| 202 | 3300002771 | JGI25163J39215_1000823 | JGI25163J39215_10008236 | 142 |
| 203 | 3300002771 | JGI25163J39215_1000834 | JGI25163J39215_10008347 | 142 |
| 204 | 3300002772 | JGI25164J39214_1000175 | JGI25164J39214_100017539 | 142 |
| 205 | 3300002772 | JGI25164J39214_1000357 | JGI25164J39214_10003575 | 142 |
| 206 | 3300003214 | JGI25165J46597_1000175 | JGI25165J46597_100017574 | 142 |
| 207 | 3300003214 | JGI25165J46597_1000193 | JGI25165J46597_100019369 | 142 |
| 208 | 3300003791 | Ga0055530_10000159 | Ga0055530_1000015938 | 142 |
| 209 | 3300003792 | Ga0055540_1000725 | Ga0055540_10007252 | 142 |
| 210 | 3300004803 | Ga0058862_12223391 | Ga0058862_122233911 | 142 |
| 211 | 3300005288 | Ga0065714_10067824 | Ga0065714_100678245 | 142 |
| 212 | 3300005288 | Ga0065714_10143055 | Ga0065714_101430552 | 142 |
| 213 | 3300005289 | Ga0065704_10273505 | Ga0065704_102735052 | 142 |
| 214 | 3300005330 | Ga0070690_100239646 | Ga0070690_1002396462 | 142 |
| 215 | 3300005331 | Ga0070670_100232450 | Ga0070670_1002324502 | 142 |
| 216 | 3300005331 | Ga0070670_100437988 | Ga0070670_1004379881 | 142 |
| 217 | 3300005335 | Ga0070666_10085241 | Ga0070666_100852412 | 142 |
| 218 | 3300005335 | Ga0070666_10969083 | Ga0070666_109690831 | 142 |
| 219 | 3300005336 | Ga0070680_100013453 | Ga0070680_1000134538 | 142 |
| 220 | 3300005336 | Ga0070680_100877116 | Ga0070680_1008771162 | 142 |
| 221 | 3300005337 | Ga0070682_100046230 | Ga0070682_1000462304 | 142 |
| 222 | 3300005338 | Ga0068868_100019489 | Ga0068868_1000194895 | 142 |
| 223 | 3300005339 | Ga0070660_101243358 | Ga0070660_1012433581 | 142 |
| 224 | 3300005340 | Ga0070689_100199650 | Ga0070689_1001996501 | 142 |
| 225 | 3300005343 | Ga0070687_100279908 | Ga0070687_1002799082 | 142 |
| 226 | 3300005345 | Ga0070692_10140811 | Ga0070692_101408112 | 142 |
| 227 | 3300005347 | Ga0070668_100388968 | Ga0070668_1003889682 | 142 |
| 228 | 3300005347 | Ga0070668_101855242 | Ga0070668_1018552421 | 142 |
| 229 | 3300005354 | Ga0070675_100112311 | Ga0070675_1001123114 | 142 |
| 230 | 3300005365 | Ga0070688_100019851 | Ga0070688_1000198514 | 142 |
| 231 | 3300005366 | Ga0070659_100361501 | Ga0070659_1003615012 | 142 |
| 232 | 3300005434 | Ga0070709_11574271 | Ga0070709_115742711 | 142 |
| 233 | 3300005437 | Ga0070710_11173123 | Ga0070710_111731231 | 142 |
| 234 | 3300005438 | Ga0070701_10253487 | Ga0070701_102534872 | 142 |
| 235 | 3300005440 | Ga0070705_100125536 | Ga0070705_1001255362 | 142 |
| 236 | 3300005441 | Ga0070700_100010193 | Ga0070700_1000101935 | 142 |
| 237 | 3300005444 | Ga0070694_100131149 | Ga0070694_1001311492 | 142 |
| 238 | 3300005455 | Ga0070663_100194130 | Ga0070663_1001941301 | 142 |
| 239 | 3300005455 | Ga0070663_100407557 | Ga0070663_1004075572 | 142 |
| 240 | 3300005456 | Ga0070678_100414740 | Ga0070678_1004147402 | 142 |
| 241 | 3300005457 | Ga0070662_100419730 | Ga0070662_1004197301 | 142 |
| 242 | 3300005458 | Ga0070681_10199302 | Ga0070681_101993023 | 142 |
| 243 | 3300005459 | Ga0068867_100031608 | Ga0068867_1000316084 | 142 |
| 244 | 3300005466 | Ga0070685_10017568 | Ga0070685_100175684 | 142 |
| 245 | 3300005530 | Ga0070679_100011942 | Ga0070679_1000119423 | 142 |
| 246 | 3300005530 | Ga0070679_100303496 | Ga0070679_1003034961 | 142 |
| 247 | 3300005530 | Ga0070679_101713278 | Ga0070679_1017132781 | 142 |
| 248 | 3300005535 | Ga0070684_100023697 | Ga0070684_1000236975 | 142 |
| 249 | 3300005535 | Ga0070684_100421689 | Ga0070684_1004216891 | 142 |
| 250 | 3300005543 | Ga0070672_100595364 | Ga0070672_1005953642 | 142 |
| 251 | 3300005547 | Ga0070693_100509832 | Ga0070693_1005098321 | 142 |
| 252 | 3300005548 | Ga0070665_100001096 | Ga0070665_10000109617 | 142 |
| 253 | 3300005548 | Ga0070665_100021887 | Ga0070665_1000218875 | 142 |
| 254 | 3300005549 | Ga0070704_100212767 | Ga0070704_1002127672 | 142 |
| 255 | 3300005563 | Ga0068855_100000864 | Ga0068855_10000086414 | 142 |
| 256 | 3300005563 | Ga0068855_101594534 | Ga0068855_1015945341 | 142 |
| 257 | 3300005564 | Ga0070664_100178286 | Ga0070664_1001782861 | 142 |
| 258 | 3300005614 | Ga0068856_100342271 | Ga0068856_1003422712 | 142 |
| 259 | 3300005615 | Ga0070702_100023459 | Ga0070702_1000234594 | 142 |
| 260 | 3300005617 | Ga0068859_100071130 | Ga0068859_1000711302 | 142 |
| 261 | 3300005718 | Ga0068866_10048567 | Ga0068866_100485672 | 142 |
| 262 | 3300005719 | Ga0068861_100024510 | Ga0068861_1000245104 | 142 |
| 263 | 3300005840 | Ga0068870_10021857 | Ga0068870_100218573 | 142 |
| 264 | 3300005841 | Ga0068863_100169063 | Ga0068863_1001690632 | 142 |
| 265 | 3300005842 | Ga0068858_100202545 | Ga0068858_1002025452 | 142 |
| 266 | 3300005843 | Ga0068860_100219620 | Ga0068860_1002196202 | 142 |
| 267 | 3300005844 | Ga0068862_100319867 | Ga0068862_1003198672 | 142 |
| 268 | 3300006038 | Ga0075365_10012970 | Ga0075365_100129702 | 142 |
| 269 | 3300006038 | Ga0075365_10050058 | Ga0075365_100500582 | 142 |
| 270 | 3300006038 | Ga0075365_10075051 | Ga0075365_100750512 | 142 |
| 271 | 3300006048 | Ga0075363_100374683 | Ga0075363_1003746832 | 142 |
| 272 | 3300006048 | Ga0075363_100843408 | Ga0075363_1008434082 | 142 |
| 273 | 3300006058 | Ga0075432_10002880 | Ga0075432_100028802 | 142 |
| 274 | 3300006163 | Ga0070715_10087878 | Ga0070715_100878782 | 142 |
| 275 | 3300006186 | Ga0075369_10224211 | Ga0075369_102242111 | 142 |
| 276 | 3300006237 | Ga0097621_100098648 | Ga0097621_1000986482 | 142 |
| 277 | 3300006237 | Ga0097621_100727441 | Ga0097621_1007274411 | 142 |
| 278 | 3300006358 | Ga0068871_100043906 | Ga0068871_1000439064 | 142 |
| 279 | 3300006358 | Ga0068871_100420306 | Ga0068871_1004203062 | 142 |
| 280 | 3300006844 | Ga0075428_100017465 | Ga0075428_1000174655 | 142 |
| 281 | 3300006844 | Ga0075428_102406712 | Ga0075428_1024067121 | 142 |
| 282 | 3300006847 | Ga0075431_100226723 | Ga0075431_1002267233 | 142 |
| 283 | 3300006881 | Ga0068865_100066208 | Ga0068865_1000662082 | 142 |
| 284 | 3300006914 | Ga0075436_100023659 | Ga0075436_1000236594 | 142 |
| 285 | 3300006931 | Ga0097620_100071126 | Ga0097620_1000711262 | 142 |
| 286 | 3300009011 | Ga0105251_10000068 | Ga0105251_1000006827 | 142 |
| 287 | 3300009011 | Ga0105251_10001441 | Ga0105251_100014417 | 142 |
| 288 | 3300009011 | Ga0105251_10026993 | Ga0105251_100269934 | 142 |
| 289 | 3300009036 | Ga0105244_10106077 | Ga0105244_101060772 | 142 |
| 290 | 3300009092 | Ga0105250_10040925 | Ga0105250_100409252 | 142 |
| 291 | 3300009093 | Ga0105240_10002346 | Ga0105240_1000234613 | 142 |
| 292 | 3300009093 | Ga0105240_10044867 | Ga0105240_100448676 | 142 |
| 293 | 3300009093 | Ga0105240_10382137 | Ga0105240_103821371 | 142 |
| 294 | 3300009094 | Ga0111539_10762432 | Ga0111539_107624322 | 142 |
| 295 | 3300009098 | Ga0105245_12567754 | Ga0105245_125677541 | 142 |
| 296 | 3300009101 | Ga0105247_10011015 | Ga0105247_100110152 | 142 |
| 297 | 3300009148 | Ga0105243_10000075 | Ga0105243_1000007542 | 142 |
| 298 | 3300009148 | Ga0105243_10008056 | Ga0105243_100080562 | 142 |
| 299 | 3300009148 | Ga0105243_10128441 | Ga0105243_101284412 | 142 |
| 300 | 3300009174 | Ga0105241_11257498 | Ga0105241_112574981 | 142 |
| 301 | 3300009176 | Ga0105242_10102407 | Ga0105242_101024074 | 142 |
| 302 | 3300009545 | Ga0105237_10042538 | Ga0105237_100425382 | 142 |
| 303 | 3300009545 | Ga0105237_10167677 | Ga0105237_101676771 | 142 |
| 304 | 3300009545 | Ga0105237_10275599 | Ga0105237_102755992 | 142 |
| 305 | 3300009545 | Ga0105237_10793015 | Ga0105237_107930151 | 142 |
| 306 | 3300009551 | Ga0105238_10096225 | Ga0105238_100962253 | 142 |
| 307 | 3300009551 | Ga0105238_10240552 | Ga0105238_102405523 | 142 |
| 308 | 3300009553 | Ga0105249_10021961 | Ga0105249_100219618 | 142 |
| 309 | 3300009553 | Ga0105249_10408900 | Ga0105249_104089002 | 142 |
| 310 | 3300010375 | Ga0105239_10039857 | Ga0105239_100398574 | 142 |
| 311 | 3300010375 | Ga0105239_10417763 | Ga0105239_104177632 | 142 |
| 312 | 3300010375 | Ga0105239_10549968 | Ga0105239_105499682 | 142 |
| 313 | 3300011119 | Ga0105246_10199646 | Ga0105246_101996462 | 142 |
| 314 | 3300013100 | Ga0157373_11366187 | Ga0157373_113661871 | 142 |
| 315 | 3300013102 | Ga0157371_10001263 | Ga0157371_100012637 | 142 |
| 316 | 3300013104 | Ga0157370_10155314 | Ga0157370_101553143 | 142 |
| 317 | 3300013105 | Ga0157369_10406448 | Ga0157369_104064482 | 142 |
| 318 | 3300013296 | Ga0157374_10099656 | Ga0157374_100996562 | 142 |
| 319 | 3300013296 | Ga0157374_10135288 | Ga0157374_101352882 | 142 |
| 320 | 3300013297 | Ga0157378_10534885 | Ga0157378_105348852 | 142 |
| 321 | 3300013306 | Ga0163162_10140237 | Ga0163162_101402372 | 142 |
| 322 | 3300013307 | Ga0157372_11493887 | Ga0157372_114938872 | 142 |
| 323 | 3300014325 | Ga0163163_10785643 | Ga0163163_107856431 | 142 |
| 324 | 3300014325 | Ga0163163_13098522 | Ga0163163_130985221 | 142 |
| 325 | 3300014326 | Ga0157380_11520624 | Ga0157380_115206242 | 142 |
| 326 | 3300014497 | Ga0182008_10000367 | Ga0182008_100003677 | 142 |
| 327 | 3300014497 | Ga0182008_10084657 | Ga0182008_100846572 | 142 |
| 328 | 3300014745 | Ga0157377_10047696 | Ga0157377_100476963 | 142 |
| 329 | 3300014968 | Ga0157379_10079167 | Ga0157379_100791672 | 142 |
| 330 | 3300014968 | Ga0157379_11183755 | Ga0157379_111837552 | 142 |
| 331 | 3300014969 | Ga0157376_10196836 | Ga0157376_101968362 | 142 |
| 332 | 3300017792 | Ga0163161_10048658 | Ga0163161_100486584 | 142 |
| 333 | 3300020070 | Ga0206356_11524923 | Ga0206356_115249231 | 142 |
| 334 | 3300020078 | Ga0206352_10477851 | Ga0206352_104778511 | 142 |
| 335 | 3300020080 | Ga0206350_10752306 | Ga0206350_107523061 | 142 |
| 336 | 3300020082 | Ga0206353_10249946 | Ga0206353_102499461 | 142 |
| 337 | 3300025207 | Ga0209760_100020 | Ga0209760_10002025 | 142 |
| 338 | 3300025207 | Ga0209760_100082 | Ga0209760_1000829 | 142 |
| 339 | 3300025231 | Ga0207427_100005 | Ga0207427_100005674 | 142 |
| 340 | 3300025231 | Ga0207427_100006 | Ga0207427_10000673 | 142 |
| 341 | 3300025233 | Ga0209437_100013 | Ga0209437_10001373 | 142 |
| 342 | 3300025233 | Ga0209437_100018 | Ga0209437_100018584 | 142 |
| 343 | 3300025256 | Ga0209759_1001572 | Ga0209759_10015725 | 142 |
| 344 | 3300025256 | Ga0209759_1020334 | Ga0209759_10203342 | 142 |
| 345 | 3300025261 | Ga0209233_1000021 | Ga0209233_1000021674 | 142 |
| 346 | 3300025261 | Ga0209233_1000022 | Ga0209233_100002273 | 142 |
| 347 | 3300025284 | Ga0209130_1056706 | Ga0209130_10567061 | 142 |
| 348 | 3300025292 | Ga0209676_1000222 | Ga0209676_100022278 | 142 |
| 349 | 3300025298 | Ga0209050_1000296 | Ga0209050_100029678 | 142 |
| 350 | 3300025303 | Ga0209051_1000295 | Ga0209051_10002952 | 142 |
| 351 | 3300025728 | Ga0207655_1000135 | Ga0207655_100013564 | 142 |
| 352 | 3300025728 | Ga0207655_1002411 | Ga0207655_100241112 | 142 |
| 353 | 3300025735 | Ga0207713_1000103 | Ga0207713_100010359 | 142 |
| 354 | 3300025735 | Ga0207713_1002728 | Ga0207713_10027287 | 142 |
| 355 | 3300025899 | Ga0207642_10004044 | Ga0207642_100040444 | 142 |
| 356 | 3300025900 | Ga0207710_10009561 | Ga0207710_100095614 | 142 |
| 357 | 3300025901 | Ga0207688_10028197 | Ga0207688_100281972 | 142 |
| 358 | 3300025901 | Ga0207688_10481329 | Ga0207688_104813292 | 142 |
| 359 | 3300025903 | Ga0207680_10074756 | Ga0207680_100747562 | 142 |
| 360 | 3300025904 | Ga0207647_10034457 | Ga0207647_100344571 | 142 |
| 361 | 3300025907 | Ga0207645_10014566 | Ga0207645_100145665 | 142 |
| 362 | 3300025908 | Ga0207643_10030491 | Ga0207643_100304914 | 142 |
| 363 | 3300025913 | Ga0207695_10013476 | Ga0207695_100134769 | 142 |
| 364 | 3300025913 | Ga0207695_10014260 | Ga0207695_100142606 | 142 |
| 365 | 3300025913 | Ga0207695_10021679 | Ga0207695_100216796 | 142 |
| 366 | 3300025914 | Ga0207671_10049367 | Ga0207671_100493672 | 142 |
| 367 | 3300025914 | Ga0207671_10166274 | Ga0207671_101662742 | 142 |
| 368 | 3300025914 | Ga0207671_10469368 | Ga0207671_104693682 | 142 |
| 369 | 3300025914 | Ga0207671_10495829 | Ga0207671_104958292 | 142 |
| 370 | 3300025916 | Ga0207663_10069742 | Ga0207663_100697421 | 142 |
| 371 | 3300025917 | Ga0207660_10011193 | Ga0207660_100111935 | 142 |
| 372 | 3300025918 | Ga0207662_10185203 | Ga0207662_101852032 | 142 |
| 373 | 3300025919 | Ga0207657_10094810 | Ga0207657_100948104 | 142 |
| 374 | 3300025920 | Ga0207649_10216147 | Ga0207649_102161472 | 142 |
| 375 | 3300025921 | Ga0207652_10054008 | Ga0207652_100540082 | 142 |
| 376 | 3300025921 | Ga0207652_10266973 | Ga0207652_102669731 | 142 |
| 377 | 3300025921 | Ga0207652_11147904 | Ga0207652_111479042 | 142 |
| 378 | 3300025924 | Ga0207694_10087928 | Ga0207694_100879282 | 142 |
| 379 | 3300025925 | Ga0207650_10005007 | Ga0207650_100050074 | 142 |
| 380 | 3300025926 | Ga0207659_10530156 | Ga0207659_105301561 | 142 |
| 381 | 3300025926 | Ga0207659_11578413 | Ga0207659_115784131 | 142 |
| 382 | 3300025927 | Ga0207687_10023734 | Ga0207687_100237342 | 142 |
| 383 | 3300025928 | Ga0207700_10014790 | Ga0207700_100147902 | 142 |
| 384 | 3300025933 | Ga0207706_10085584 | Ga0207706_100855842 | 142 |
| 385 | 3300025934 | Ga0207686_10046064 | Ga0207686_100460642 | 142 |
| 386 | 3300025935 | Ga0207709_10000269 | Ga0207709_1000026945 | 142 |
| 387 | 3300025935 | Ga0207709_10004904 | Ga0207709_100049042 | 142 |
| 388 | 3300025935 | Ga0207709_10027842 | Ga0207709_100278422 | 142 |
| 389 | 3300025935 | Ga0207709_10070325 | Ga0207709_100703253 | 142 |
| 390 | 3300025936 | Ga0207670_10145300 | Ga0207670_101453003 | 142 |
| 391 | 3300025940 | Ga0207691_10012861 | Ga0207691_100128615 | 142 |
| 392 | 3300025941 | Ga0207711_10084825 | Ga0207711_100848254 | 142 |
| 393 | 3300025945 | Ga0207679_10109463 | Ga0207679_101094631 | 142 |
| 394 | 3300025949 | Ga0207667_10008319 | Ga0207667_100083199 | 142 |
| 395 | 3300025960 | Ga0207651_11000103 | Ga0207651_110001032 | 142 |
| 396 | 3300025961 | Ga0207712_10031539 | Ga0207712_100315396 | 142 |
| 397 | 3300025961 | Ga0207712_10062056 | Ga0207712_100620562 | 142 |
| 398 | 3300025972 | Ga0207668_10227836 | Ga0207668_102278362 | 142 |
| 399 | 3300025981 | Ga0207640_10073028 | Ga0207640_100730283 | 142 |
| 400 | 3300025986 | Ga0207658_10124884 | Ga0207658_101248842 | 142 |
| 401 | 3300025986 | Ga0207658_10417866 | Ga0207658_104178661 | 142 |
| 402 | 3300026023 | Ga0207677_10057915 | Ga0207677_100579152 | 142 |
| 403 | 3300026035 | Ga0207703_10234808 | Ga0207703_102348082 | 142 |
| 404 | 3300026041 | Ga0207639_10455088 | Ga0207639_104550882 | 142 |
| 405 | 3300026067 | Ga0207678_10054141 | Ga0207678_100541412 | 142 |
| 406 | 3300026075 | Ga0207708_10015207 | Ga0207708_100152072 | 142 |
| 407 | 3300026089 | Ga0207648_10001979 | Ga0207648_100019795 | 142 |
| 408 | 3300026095 | Ga0207676_10159670 | Ga0207676_101596702 | 142 |
| 409 | 3300026116 | Ga0207674_10191341 | Ga0207674_101913412 | 142 |
| 410 | 3300026118 | Ga0207675_100025355 | Ga0207675_1000253554 | 142 |
| 411 | 3300026121 | Ga0207683_10038505 | Ga0207683_100385052 | 142 |
| 412 | 3300026142 | Ga0207698_10167884 | Ga0207698_101678842 | 142 |
| 413 | 3300026142 | Ga0207698_10835255 | Ga0207698_108352552 | 142 |
| 414 | 3300026142 | Ga0207698_11646952 | Ga0207698_116469521 | 142 |
| 415 | 3300027111 | Ga0209281_1000091 | Ga0209281_1000091195 | 142 |
| 416 | 3300027866 | Ga0209813_10052421 | Ga0209813_100524212 | 142 |
| 417 | 3300027866 | Ga0209813_10067027 | Ga0209813_100670271 | 142 |
| 418 | 3300027907 | Ga0207428_10371206 | Ga0207428_103712061 | 142 |
| 419 | 3300028379 | Ga0268266_10000159 | Ga0268266_1000015933 | 142 |
| 420 | 3300028379 | Ga0268266_10022361 | Ga0268266_100223613 | 142 |
| 421 | 3300028379 | Ga0268266_10116245 | Ga0268266_101162452 | 142 |
| 422 | 3300028380 | Ga0268265_10138337 | Ga0268265_101383372 | 142 |
| 423 | 3300028786 | Ga0307517_10411909 | Ga0307517_104119091 | 142 |
| 424 | 3300028794 | Ga0307515_10671684 | Ga0307515_106716841 | 142 |
| 425 | 3300030521 | Ga0307511_10000028 | Ga0307511_1000002815 | 142 |
| 426 | 3300030521 | Ga0307511_10067948 | Ga0307511_100679481 | 142 |
| 427 | 3300030521 | Ga0307511_10103544 | Ga0307511_101035442 | 142 |
| 428 | 3300031250 | Ga0265331_10016868 | Ga0265331_100168682 | 142 |
| 429 | 3300031250 | Ga0265331_10540687 | Ga0265331_105406871 | 142 |
| 430 | 3300031507 | Ga0307509_10556846 | Ga0307509_105568461 | 142 |
| 431 | 3300031616 | Ga0307508_10774739 | Ga0307508_107747391 | 142 |
| 432 | 3300033180 | Ga0307510_10229940 | Ga0307510_102299402 | 142 |
| 433 | 3300035111 | Ga0373923_0131074 | Ga0373923_0131074_402_830 | 142 |
| 434 | 3300035112 | Ga0373932_0218218 | Ga0373932_0218218_123_554 | 142 |
| 435 | 3300035113 | Ga0373936_0306270 | Ga0373936_0306270_218_646 | 142 |
| 436 | 3300035120 | Ga0373957_0416837 | Ga0373957_0416837_129_557 | 142 |
| 437 | 3300035692 | Ga0373935_0070547 | Ga0373935_0070547_1597_2025 | 142 |
| 438 | 3300037068 | Ga0373925_0029840 | Ga0373925_0029840_1418_1846 | 142 |
| 439 | 3300041407 | Ga0439447_051133 | Ga0439447_051133_311_742 | 142 |
| 440 | 3300041410 | Ga0439461_0040096 | Ga0439461_0040096_464_895 | 142 |
| 441 | 3300041411 | Ga0439466_0000697 | Ga0439466_0000697_3866_4297 | 142 |
| 442 | 3300041456 | Ga0451795_1176480 | Ga0451795_1176480_828_1340 | 142 |
| 443 | 3300041486 | Ga0451807_2174716 | Ga0451807_2174716_404_832 | 142 |
| 444 | 3300042000 | Ga0439437_007132 | Ga0439437_007132_786_1217 | 142 |
| 445 | 3300042006 | Ga0439432_003995 | Ga0439432_003995_521_952 | 142 |
| 446 | 3300042009 | Ga0439451_045285 | Ga0439451_045285_109_540 | 142 |
| 447 | 3300042010 | Ga0439452_003511 | Ga0439452_003511_4703_5134 | 142 |
| 448 | 3300042010 | Ga0439452_021061 | Ga0439452_021061_233_664 | 142 |
| 449 | 3300042012 | Ga0439455_0031217 | Ga0439455_0031217_707_1138 | 142 |
| 450 | 3300042013 | Ga0439456_001509 | Ga0439456_001509_537_1058 | 142 |
| 451 | 3300042013 | Ga0439456_009962 | Ga0439456_009962_457_888 | 142 |
| 452 | 3300042013 | Ga0439456_018372 | Ga0439456_018372_240_671 | 142 |
| 453 | 3300042016 | Ga0439463_000065 | Ga0439463_000065_10640_11071 | 142 |
| 454 | 3300042016 | Ga0439463_000640 | Ga0439463_000640_5444_5875 | 142 |
| 455 | 3300042115 | Ga0450911_000055 | Ga0450911_000055_5394_5825 | 142 |
| 456 | 3300042115 | Ga0450911_033868 | Ga0450911_033868_52_483 | 142 |
| 457 | 3300042120 | Ga0450917_001876 | Ga0450917_001876_1019_1450 | 142 |
| 458 | 3300042139 | Ga0450904_000368 | Ga0450904_000368_3535_3966 | 142 |
| 459 | 3300042142 | Ga0450905_021833 | Ga0450905_021833_305_736 | 142 |
| 460 | 3300042145 | Ga0450906_053331 | Ga0450906_053331_90_521 | 142 |
| 461 | 3300042156 | Ga0439446_0001744 | Ga0439446_0001744_2937_3368 | 142 |
| 462 | 3300042438 | Ga0439459_0062860 | Ga0439459_0062860_362_793 | 142 |
| 463 | 3300042530 | Ga0450916_007552 | Ga0450916_007552_754_1185 | 142 |
| 464 | 3300042532 | Ga0450893_0000923 | Ga0450893_0000923_2820_3251 | 142 |
| 465 | 3300042993 | Ga0439440_0000879 | Ga0439440_0000879_2333_2764 | 142 |
| 466 | 3300044656 | Ga0466969_0003690 | Ga0466969_0003690_1776_2207 | 142 |
| 467 | 3300044658 | Ga0466972_0132793 | Ga0466972_0132793_539_970 | 142 |
| 468 | 3300044684 | Ga0466966_0056001 | Ga0466966_0056001_1164_1595 | 142 |
| 469 | 3300045049 | Ga0466959_0023434 | Ga0466959_0023434_2431_2862 | 142 |
| 470 | 3300046452 | Ga0495617_000380 | Ga0495617_000380_11483_11914 | 142 |
| 471 | 3300046452 | Ga0495617_014471 | Ga0495617_014471_2163_2594 | 142 |
| 472 | 3300046452 | Ga0495617_018659 | Ga0495617_018659_586_1017 | 142 |
| 473 | 3300046453 | Ga0495627_000296 | Ga0495627_000296_31260_31691 | 142 |
| 474 | 3300046453 | Ga0495627_007017 | Ga0495627_007017_1351_1782 | 142 |
| 475 | 3300046453 | Ga0495627_121323 | Ga0495627_121323_202_633 | 142 |
| 476 | 3300046457 | Ga0495590_0012679 | Ga0495590_0012679_2011_2442 | 142 |
| 477 | 3300046458 | Ga0495591_000164 | Ga0495591_000164_53960_54391 | 142 |
| 478 | 3300046458 | Ga0495591_000344 | Ga0495591_000344_34398_34829 | 142 |
| 479 | 3300046458 | Ga0495591_004911 | Ga0495591_004911_1352_1783 | 142 |
| 480 | 3300046458 | Ga0495591_005358 | Ga0495591_005358_2385_2816 | 142 |
| 481 | 3300046458 | Ga0495591_009013 | Ga0495591_009013_3510_3941 | 142 |
| 482 | 3300046458 | Ga0495591_018968 | Ga0495591_018968_775_1206 | 142 |
| 483 | 3300046460 | Ga0495638_0045171 | Ga0495638_0045171_1349_1780 | 142 |
| 484 | 3300046460 | Ga0495638_0053112 | Ga0495638_0053112_1703_2134 | 142 |
| 485 | 3300046460 | Ga0495638_0136375 | Ga0495638_0136375_822_1253 | 142 |
| 486 | 3300046460 | Ga0495638_0165539 | Ga0495638_0165539_808_1239 | 142 |
| 487 | 3300046471 | Ga0495650_0000402 | Ga0495650_0000402_34190_34621 | 142 |
| 488 | 3300046471 | Ga0495650_0006144 | Ga0495650_0006144_2995_3426 | 142 |
| 489 | 3300046471 | Ga0495650_0007734 | Ga0495650_0007734_4633_5064 | 142 |
| 490 | 3300046473 | Ga0495582_0017955 | Ga0495582_0017955_2979_3407 | 142 |
| 491 | 3300046474 | Ga0495605_0000302 | Ga0495605_0000302_50359_50790 | 142 |
| 492 | 3300046474 | Ga0495605_0000316 | Ga0495605_0000316_13939_14370 | 142 |
| 493 | 3300046474 | Ga0495605_0000813 | Ga0495605_0000813_17215_17646 | 142 |
| 494 | 3300046474 | Ga0495605_0001296 | Ga0495605_0001296_1517_1948 | 142 |
| 495 | 3300046474 | Ga0495605_0007839 | Ga0495605_0007839_3492_3923 | 142 |
| 496 | 3300046474 | Ga0495605_0010401 | Ga0495605_0010401_1026_1457 | 142 |
| 497 | 3300046474 | Ga0495605_0010763 | Ga0495605_0010763_3314_3745 | 142 |
| 498 | 3300046474 | Ga0495605_0230157 | Ga0495605_0230157_258_689 | 142 |
| 499 | 3300046474 | Ga0495605_0260902 | Ga0495605_0260902_180_611 | 142 |
| 500 | 3300046474 | Ga0495605_0272638 | Ga0495605_0272638_239_670 | 142 |
| 501 | 3300046475 | Ga0495639_0087624 | Ga0495639_0087624_396_824 | 142 |
| 502 | 3300046476 | Ga0495662_0265452 | Ga0495662_0265452_232_660 | 142 |
| 503 | 3300046491 | Ga0495584_0013224 | Ga0495584_0013224_2759_3190 | 142 |
| 504 | 3300046491 | Ga0495584_0015365 | Ga0495584_0015365_1887_2318 | 142 |
| 505 | 3300046491 | Ga0495584_0146184 | Ga0495584_0146184_376_804 | 142 |
| 506 | 3300046491 | Ga0495584_0321154 | Ga0495584_0321154_46_477 | 142 |
| 507 | 3300046492 | Ga0495585_0021381 | Ga0495585_0021381_2722_3153 | 142 |
| 508 | 3300046492 | Ga0495585_0038473 | Ga0495585_0038473_1006_1470 | 142 |
| 509 | 3300046492 | Ga0495585_0116338 | Ga0495585_0116338_979_1407 | 142 |
| 510 | 3300046492 | Ga0495585_0300004 | Ga0495585_0300004_109_540 | 142 |
| 511 | 3300046499 | Ga0495594_0017748 | Ga0495594_0017748_1209_1637 | 142 |
| 512 | 3300046500 | Ga0495596_0060506 | Ga0495596_0060506_972_1403 | 142 |
| 513 | 3300046501 | Ga0495607_0000268 | Ga0495607_0000268_39374_39805 | 142 |
| 514 | 3300046501 | Ga0495607_0000365 | Ga0495607_0000365_21777_22208 | 142 |
| 515 | 3300046501 | Ga0495607_0000762 | Ga0495607_0000762_11561_11992 | 142 |
| 516 | 3300046501 | Ga0495607_0002401 | Ga0495607_0002401_2272_2703 | 142 |
| 517 | 3300046501 | Ga0495607_0015307 | Ga0495607_0015307_1968_2399 | 142 |
| 518 | 3300046501 | Ga0495607_0036943 | Ga0495607_0036943_1460_1891 | 142 |
| 519 | 3300046501 | Ga0495607_0052223 | Ga0495607_0052223_1042_1473 | 142 |
| 520 | 3300046501 | Ga0495607_0137583 | Ga0495607_0137583_755_1186 | 142 |
| 521 | 3300046501 | Ga0495607_0161577 | Ga0495607_0161577_672_1100 | 142 |
| 522 | 3300046501 | Ga0495607_0252004 | Ga0495607_0252004_306_737 | 142 |
| 523 | 3300046501 | Ga0495607_0377139 | Ga0495607_0377139_141_572 | 142 |
| 524 | 3300046506 | Ga0495583_0000409 | Ga0495583_0000409_23046_23477 | 142 |
| 525 | 3300046506 | Ga0495583_0004250 | Ga0495583_0004250_5134_5565 | 142 |
| 526 | 3300046506 | Ga0495583_0004296 | Ga0495583_0004296_2078_2509 | 142 |
| 527 | 3300046506 | Ga0495583_0004393 | Ga0495583_0004393_5352_5783 | 142 |
| 528 | 3300046506 | Ga0495583_0006517 | Ga0495583_0006517_2553_2984 | 142 |
| 529 | 3300046506 | Ga0495583_0011885 | Ga0495583_0011885_498_929 | 142 |
| 530 | 3300046507 | Ga0495606_0000115 | Ga0495606_0000115_72649_73080 | 142 |
| 531 | 3300046507 | Ga0495606_0000285 | Ga0495606_0000285_62599_63030 | 142 |
| 532 | 3300046507 | Ga0495606_0004641 | Ga0495606_0004641_10706_11137 | 142 |
| 533 | 3300046512 | Ga0495610_0010122 | Ga0495610_0010122_1766_2197 | 142 |
| 534 | 3300046512 | Ga0495610_0027408 | Ga0495610_0027408_589_1020 | 142 |
| 535 | 3300046513 | Ga0495616_0001775 | Ga0495616_0001775_12638_13069 | 142 |
| 536 | 3300046513 | Ga0495616_0007207 | Ga0495616_0007207_770_1201 | 142 |
| 537 | 3300046515 | Ga0495620_0000376 | Ga0495620_0000376_19889_20320 | 142 |
| 538 | 3300046515 | Ga0495620_0069093 | Ga0495620_0069093_518_949 | 142 |
| 539 | 3300046517 | Ga0495630_0120098 | Ga0495630_0120098_611_1039 | 142 |
| 540 | 3300046517 | Ga0495630_0129671 | Ga0495630_0129671_831_1259 | 142 |
| 541 | 3300046518 | Ga0495631_0002659 | Ga0495631_0002659_4652_5083 | 142 |
| 542 | 3300046518 | Ga0495631_0009813 | Ga0495631_0009813_3958_4389 | 142 |
| 543 | 3300046518 | Ga0495631_0314937 | Ga0495631_0314937_91_519 | 142 |
| 544 | 3300046519 | Ga0495632_0000952 | Ga0495632_0000952_11512_11943 | 142 |
| 545 | 3300046519 | Ga0495632_0004049 | Ga0495632_0004049_3037_3468 | 142 |
| 546 | 3300046519 | Ga0495632_0011397 | Ga0495632_0011397_4473_4904 | 142 |
| 547 | 3300046519 | Ga0495632_0014524 | Ga0495632_0014524_2400_2831 | 142 |
| 548 | 3300046519 | Ga0495632_0111591 | Ga0495632_0111591_41_472 | 142 |
| 549 | 3300046519 | Ga0495632_0206563 | Ga0495632_0206563_122_553 | 142 |
| 550 | 3300046520 | Ga0495637_0000054 | Ga0495637_0000054_24119_24550 | 142 |
| 551 | 3300046520 | Ga0495637_0001318 | Ga0495637_0001318_4424_4855 | 142 |
| 552 | 3300046520 | Ga0495637_0004745 | Ga0495637_0004745_5531_5962 | 142 |
| 553 | 3300046520 | Ga0495637_0005807 | Ga0495637_0005807_2522_2953 | 142 |
| 554 | 3300046520 | Ga0495637_0025174 | Ga0495637_0025174_1894_2325 | 142 |
| 555 | 3300046520 | Ga0495637_0161772 | Ga0495637_0161772_237_668 | 142 |
| 556 | 3300046520 | Ga0495637_0369267 | Ga0495637_0369267_28_456 | 142 |
| 557 | 3300046522 | Ga0495643_0010329 | Ga0495643_0010329_2291_2722 | 142 |
| 558 | 3300046522 | Ga0495643_0060533 | Ga0495643_0060533_258_689 | 142 |
| 559 | 3300046522 | Ga0495643_0069977 | Ga0495643_0069977_835_1266 | 142 |
| 560 | 3300046523 | Ga0495644_0000830 | Ga0495644_0000830_11170_11601 | 142 |
| 561 | 3300046523 | Ga0495644_0002746 | Ga0495644_0002746_2177_2608 | 142 |
| 562 | 3300046524 | Ga0495648_0002978 | Ga0495648_0002978_10648_11079 | 142 |
| 563 | 3300046524 | Ga0495648_0010691 | Ga0495648_0010691_2574_3005 | 142 |
| 564 | 3300046524 | Ga0495648_0061037 | Ga0495648_0061037_1779_2210 | 142 |
| 565 | 3300046526 | Ga0495666_0218711 | Ga0495666_0218711_99_527 | 142 |
| 566 | 3300046528 | Ga0495642_0000824 | Ga0495642_0000824_11508_11939 | 142 |
| 567 | 3300046530 | Ga0495654_0003754 | Ga0495654_0003754_5101_5532 | 142 |
| 568 | 3300046530 | Ga0495654_0013167 | Ga0495654_0013167_3609_4040 | 142 |
| 569 | 3300046530 | Ga0495654_0019147 | Ga0495654_0019147_1542_2006 | 142 |
| 570 | 3300046530 | Ga0495654_0032890 | Ga0495654_0032890_1659_2090 | 142 |
| 571 | 3300046530 | Ga0495654_0036512 | Ga0495654_0036512_1687_2118 | 142 |
| 572 | 3300046530 | Ga0495654_0042046 | Ga0495654_0042046_1656_2087 | 142 |
| 573 | 3300046537 | Ga0495598_0090404 | Ga0495598_0090404_401_829 | 142 |
| 574 | 3300046538 | Ga0495609_0000061 | Ga0495609_0000061_75028_75459 | 142 |
| 575 | 3300046538 | Ga0495609_0000100 | Ga0495609_0000100_50441_50872 | 142 |
| 576 | 3300046538 | Ga0495609_0000756 | Ga0495609_0000756_11768_12199 | 142 |
| 577 | 3300046538 | Ga0495609_0056203 | Ga0495609_0056203_971_1402 | 142 |
| 578 | 3300046538 | Ga0495609_0065176 | Ga0495609_0065176_836_1267 | 142 |
| 579 | 3300046539 | Ga0495621_0135109 | Ga0495621_0135109_277_705 | 142 |
| 580 | 3300046542 | Ga0495597_0000121 | Ga0495597_0000121_53979_54410 | 142 |
| 581 | 3300046542 | Ga0495597_0004514 | Ga0495597_0004514_5328_5759 | 142 |
| 582 | 3300046542 | Ga0495597_0016759 | Ga0495597_0016759_546_977 | 142 |
| 583 | 3300046542 | Ga0495597_0119652 | Ga0495597_0119652_180_611 | 142 |
| 584 | 3300046557 | Ga0495622_0023789 | Ga0495622_0023789_1746_2174 | 142 |
| 585 | 3300046557 | Ga0495622_0097739 | Ga0495622_0097739_96_569 | 142 |
| 586 | 3300046557 | Ga0495622_0197102 | Ga0495622_0197102_436_867 | 142 |
| 587 | 3300046559 | Ga0495667_0227325 | Ga0495667_0227325_562_993 | 142 |
| 588 | 3300046615 | Ga0495656_0017067 | Ga0495656_0017067_1677_2108 | 142 |
| 589 | 3300046615 | Ga0495656_0802309 | Ga0495656_0802309_44_472 | 142 |
| 590 | 3300046616 | Ga0495668_0025762 | Ga0495668_0025762_219_650 | 142 |
| 591 | 3300046616 | Ga0495668_0045844 | Ga0495668_0045844_879_1310 | 142 |
| 592 | 3300046616 | Ga0495668_0047143 | Ga0495668_0047143_213_644 | 142 |
| 593 | 3300046642 | Ga0495634_0464057 | Ga0495634_0464057_200_628 | 142 |
| 594 | 3300046648 | Ga0495611_0001663 | Ga0495611_0001663_4440_4871 | 142 |
| 595 | 3300046648 | Ga0495611_0002835 | Ga0495611_0002835_4132_4563 | 142 |
| 596 | 3300046648 | Ga0495611_0010434 | Ga0495611_0010434_83_514 | 142 |
| 597 | 3300046648 | Ga0495611_0310019 | Ga0495611_0310019_92_523 | 142 |
| 598 | 3300046660 | Ga0495625_0000147 | Ga0495625_0000147_75168_75599 | 142 |
| 599 | 3300046660 | Ga0495625_0002431 | Ga0495625_0002431_736_1167 | 142 |
| 600 | 3300046660 | Ga0495625_0028100 | Ga0495625_0028100_3644_4075 | 142 |
| 601 | 3300046663 | Ga0495635_0427352 | Ga0495635_0427352_311_811 | 142 |
| 602 | 3300046664 | Ga0495659_0155962 | Ga0495659_0155962_42_470 | 142 |
| 603 | 3300046665 | Ga0495661_0000153 | Ga0495661_0000153_75201_75632 | 142 |
| 604 | 3300046665 | Ga0495661_0000315 | Ga0495661_0000315_49080_49511 | 142 |
| 605 | 3300046665 | Ga0495661_0011035 | Ga0495661_0011035_2358_2789 | 142 |
| 606 | 3300046665 | Ga0495661_0017783 | Ga0495661_0017783_2095_2526 | 142 |
| 607 | 3300046681 | Ga0495647_0013135 | Ga0495647_0013135_82_510 | 142 |
| 608 | 3300046684 | Ga0495669_0017432 | Ga0495669_0017432_2305_2736 | 142 |
| 609 | 3300046691 | Ga0495670_0008294 | Ga0495670_0008294_956_1387 | 142 |
| 610 | 3300046691 | Ga0495670_0129738 | Ga0495670_0129738_781_1212 | 142 |
| 611 | 3300046691 | Ga0495670_0176228 | Ga0495670_0176228_680_1108 | 142 |
| 612 | 3300046692 | Ga0495671_0006513 | Ga0495671_0006513_3686_4117 | 142 |
| 613 | 3300046692 | Ga0495671_0008015 | Ga0495671_0008015_2338_2769 | 142 |
| 614 | 3300046692 | Ga0495671_0257764 | Ga0495671_0257764_113_544 | 142 |
| 615 | 3300046692 | Ga0495671_0305644 | Ga0495671_0305644_284_712 | 142 |
| 616 | 3300046694 | Ga0495649_0000686 | Ga0495649_0000686_5260_5691 | 142 |
| 617 | 3300046694 | Ga0495649_0002690 | Ga0495649_0002690_182_613 | 142 |
| 618 | 3300046694 | Ga0495649_0107230 | Ga0495649_0107230_656_1087 | 142 |
| 619 | 3300046694 | Ga0495649_0162840 | Ga0495649_0162840_288_719 | 142 |
| 620 | 3300046694 | Ga0495649_0283466 | Ga0495649_0283466_306_737 | 142 |
| 621 | 3300046794 | Ga0495589_0011002 | Ga0495589_0011002_2733_3164 | 142 |
| 622 | 3300046794 | Ga0495589_0088343 | Ga0495589_0088343_996_1427 | 142 |
| 623 | 3300046810 | Ga0495660_0000813 | Ga0495660_0000813_6281_6712 | 142 |
| 624 | 3300046810 | Ga0495660_0001072 | Ga0495660_0001072_12896_13327 | 142 |
| 625 | 3300046810 | Ga0495660_0002689 | Ga0495660_0002689_1557_1988 | 142 |
| 626 | 3300046810 | Ga0495660_0017784 | Ga0495660_0017784_1764_2195 | 142 |
| 627 | 3300046810 | Ga0495660_0036756 | Ga0495660_0036756_1256_1687 | 142 |
| 628 | 3300046810 | Ga0495660_0133744 | Ga0495660_0133744_283_714 | 142 |
| 629 | 3300046810 | Ga0495660_0170790 | Ga0495660_0170790_119_550 | 142 |
| 630 | 3300046810 | Ga0495660_0467728 | Ga0495660_0467728_73_501 | 142 |
| 631 | 3300047315 | Ga0495581_0180106 | Ga0495581_0180106_717_1145 | 142 |
| 632 | 3300047318 | Ga0495636_0000767 | Ga0495636_0000767_10943_11374 | 142 |
| 633 | 3300047319 | Ga0495674_0038624 | Ga0495674_0038624_3179_3607 | 142 |
| 634 | 3300047320 | Ga0495672_0001274 | Ga0495672_0001274_12102_12533 | 142 |
| 635 | 3300047320 | Ga0495672_0003072 | Ga0495672_0003072_11503_11934 | 142 |
| 636 | 3300047320 | Ga0495672_0003235 | Ga0495672_0003235_10829_11260 | 142 |
| 637 | 3300047320 | Ga0495672_0006475 | Ga0495672_0006475_2747_3178 | 142 |
| 638 | 3300047320 | Ga0495672_0010264 | Ga0495672_0010264_2828_3259 | 142 |
| 639 | 3300047320 | Ga0495672_0018222 | Ga0495672_0018222_4155_4586 | 142 |
| 640 | 3300047320 | Ga0495672_0025075 | Ga0495672_0025075_1323_1754 | 142 |
| 641 | 3300047320 | Ga0495672_0064038 | Ga0495672_0064038_361_792 | 142 |
| 642 | 3300047321 | Ga0495676_0000027 | Ga0495676_0000027_66207_66638 | 142 |
| 643 | 3300047321 | Ga0495676_0024454 | Ga0495676_0024454_1735_2163 | 142 |
| 644 | 3300047323 | Ga0495683_0014876 | Ga0495683_0014876_2050_2481 | 142 |
| 645 | 3300047323 | Ga0495683_0027940 | Ga0495683_0027940_152_616 | 142 |
| 646 | 3300047443 | Ga0495687_001396 | Ga0495687_001396_10181_10612 | 142 |
| 647 | 3300047446 | Ga0495679_000096 | Ga0495679_000096_49605_50036 | 142 |
| 648 | 3300047446 | Ga0495679_080819 | Ga0495679_080819_68_496 | 142 |
| 649 | 3300047447 | Ga0495685_271216 | Ga0495685_271216_49_480 | 142 |
| 650 | 3300047469 | Ga0495673_0002023 | Ga0495673_0002023_609_1040 | 142 |
| 651 | 3300047469 | Ga0495673_0002635 | Ga0495673_0002635_11315_11746 | 142 |
| 652 | 3300047469 | Ga0495673_0003580 | Ga0495673_0003580_4916_5347 | 142 |
| 653 | 3300047469 | Ga0495673_0010013 | Ga0495673_0010013_2673_3104 | 142 |
| 654 | 3300047469 | Ga0495673_0012324 | Ga0495673_0012324_1664_2095 | 142 |
| 655 | 3300047469 | Ga0495673_0012824 | Ga0495673_0012824_2098_2529 | 142 |
| 656 | 3300047469 | Ga0495673_0024649 | Ga0495673_0024649_400_831 | 142 |
| 657 | 3300047470 | Ga0495681_0000737 | Ga0495681_0000737_11259_11690 | 142 |
| 658 | 3300047470 | Ga0495681_0001170 | Ga0495681_0001170_15000_15431 | 142 |
| 659 | 3300047470 | Ga0495681_0015002 | Ga0495681_0015002_3146_3577 | 142 |
| 660 | 3300047472 | Ga0495686_0434768 | Ga0495686_0434768_217_648 | 142 |
| 661 | 3300047673 | Ga0495593_0360933 | Ga0495593_0360933_36_464 | 142 |
| 662 | 3300048091 | Ga0495626_0000067 | Ga0495626_0000067_64563_64994 | 142 |
| 663 | 3300048091 | Ga0495626_0006295 | Ga0495626_0006295_3584_4015 | 142 |
| 664 | 3300048091 | Ga0495626_0165075 | Ga0495626_0165075_220_651 | 142 |
| 665 | 3300048903 | Ga0496100_0219526 | Ga0496100_0219526_549_977 | 142 |
| 666 | 3300048903 | Ga0496100_0292904 | Ga0496100_0292904_512_940 | 142 |
| 667 | 3300048903 | Ga0496100_0342503 | Ga0496100_0342503_459_887 | 142 |
| 668 | 3300048904 | Ga0496101_0296607 | Ga0496101_0296607_214_642 | 142 |
| 669 | 3300048905 | Ga0496102_0049571 | Ga0496102_0049571_2839_3267 | 142 |
| 670 | 3300048905 | Ga0496102_0065808 | Ga0496102_0065808_663_1091 | 142 |
| 671 | 3300048905 | Ga0496102_0172014 | Ga0496102_0172014_1468_1899 | 142 |
| 672 | 3300048905 | Ga0496102_0320457 | Ga0496102_0320457_535_963 | 142 |
| 673 | 3300048905 | Ga0496102_0641304 | Ga0496102_0641304_27_458 | 142 |
| 674 | 3300048906 | Ga0496103_0109288 | Ga0496103_0109288_347_775 | 142 |
| 675 | 3300048906 | Ga0496103_0347895 | Ga0496103_0347895_282_713 | 142 |
| 676 | 3300048906 | Ga0496103_0610647 | Ga0496103_0610647_79_507 | 142 |
| 677 | 3300048907 | Ga0496104_0057291 | Ga0496104_0057291_2279_2707 | 142 |
| 678 | 3300048908 | Ga0496105_0010046 | Ga0496105_0010046_659_1087 | 142 |
| 679 | 3300048908 | Ga0496105_0323943 | Ga0496105_0323943_555_983 | 142 |
| 680 | 3300048909 | Ga0496106_0048331 | Ga0496106_0048331_2014_2442 | 142 |
| 681 | 3300048909 | Ga0496106_0420939 | Ga0496106_0420939_158_586 | 142 |
| 682 | 3300048910 | Ga0496107_0079288 | Ga0496107_0079288_1611_2039 | 142 |
| 683 | 3300048910 | Ga0496107_0089233 | Ga0496107_0089233_551_979 | 142 |
| 684 | 3300048910 | Ga0496107_0941911 | Ga0496107_0941911_122_550 | 142 |
| 685 | 3300048911 | Ga0496108_0018674 | Ga0496108_0018674_4722_5150 | 142 |
| 686 | 3300048911 | Ga0496108_0080402 | Ga0496108_0080402_1686_2114 | 142 |
| 687 | 3300048911 | Ga0496108_0896472 | Ga0496108_0896472_71_499 | 142 |
| 688 | 3300048912 | Ga0496109_0001072 | Ga0496109_0001072_2389_2817 | 142 |
| 689 | 3300048912 | Ga0496109_0014915 | Ga0496109_0014915_5129_5557 | 142 |
| 690 | 3300048913 | Ga0496110_0078265 | Ga0496110_0078265_797_1228 | 142 |
| 691 | 3300048913 | Ga0496110_0110524 | Ga0496110_0110524_1723_2151 | 142 |
| 692 | 3300048913 | Ga0496110_0322353 | Ga0496110_0322353_356_784 | 142 |
| 693 | 3300048914 | Ga0496111_0040397 | Ga0496111_0040397_1196_1624 | 142 |
| 694 | 3300048914 | Ga0496111_0124538 | Ga0496111_0124538_259_690 | 142 |
| 695 | 3300048914 | Ga0496111_0318577 | Ga0496111_0318577_469_900 | 142 |
| 696 | 3300048915 | Ga0496112_0040329 | Ga0496112_0040329_691_1212 | 142 |
| 697 | 3300048915 | Ga0496112_0098618 | Ga0496112_0098618_1947_2375 | 142 |
| 698 | 3300048915 | Ga0496112_0152673 | Ga0496112_0152673_760_1191 | 142 |
| 699 | 3300048915 | Ga0496112_0456399 | Ga0496112_0456399_444_872 | 142 |
| 700 | 3300048916 | Ga0496113_0004347 | Ga0496113_0004347_7464_7892 | 142 |
| 701 | 3300048917 | Ga0496114_0101103 | Ga0496114_0101103_1039_1467 | 142 |
| 702 | 3300048917 | Ga0496114_0101243 | Ga0496114_0101243_1893_2321 | 142 |
| 703 | 3300048917 | Ga0496114_0210682 | Ga0496114_0210682_306_734 | 142 |
| 704 | 3300048918 | Ga0496115_0008641 | Ga0496115_0008641_6491_6919 | 142 |
| 705 | 3300048918 | Ga0496115_0105748 | Ga0496115_0105748_1410_1838 | 142 |
| 706 | 3300048919 | Ga0496116_0000242 | Ga0496116_0000242_73748_74179 | 142 |
| 707 | 3300048919 | Ga0496116_0007472 | Ga0496116_0007472_4717_5148 | 142 |
| 708 | 3300048920 | Ga0496117_0000270 | Ga0496117_0000270_73737_74168 | 142 |
| 709 | 3300048920 | Ga0496117_0093775 | Ga0496117_0093775_404_835 | 142 |
| 710 | 3300048921 | Ga0496118_0043014 | Ga0496118_0043014_566_997 | 142 |
| 711 | 3300048921 | Ga0496118_0101036 | Ga0496118_0101036_824_1255 | 142 |
| 712 | 3300048921 | Ga0496118_0108973 | Ga0496118_0108973_1358_1789 | 142 |
| 713 | 3300048924 | Ga0496121_0000318 | Ga0496121_0000318_26664_27095 | 142 |
| 714 | 3300048924 | Ga0496121_0001431 | Ga0496121_0001431_3555_3986 | 142 |
| 715 | 3300048924 | Ga0496121_0003842 | Ga0496121_0003842_4328_4759 | 142 |
| 716 | 3300048925 | Ga0496122_0000517 | Ga0496122_0000517_3979_4410 | 142 |
| 717 | 3300048925 | Ga0496122_0018570 | Ga0496122_0018570_707_1138 | 142 |
| 718 | 3300048926 | Ga0496123_0000243 | Ga0496123_0000243_75481_75912 | 142 |
| 719 | 3300048926 | Ga0496123_0005798 | Ga0496123_0005798_3714_4145 | 142 |
| 720 | 3300048926 | Ga0496123_0014129 | Ga0496123_0014129_2893_3324 | 142 |
| 721 | 3300048927 | Ga0496124_0000751 | Ga0496124_0000751_5001_5432 | 142 |
| 722 | 3300048927 | Ga0496124_0009781 | Ga0496124_0009781_3684_4115 | 142 |
| 723 | 3300048927 | Ga0496124_0042538 | Ga0496124_0042538_1610_2041 | 142 |
| 724 | 3300048927 | Ga0496124_0562764 | Ga0496124_0562764_99_530 | 142 |
| 725 | 3300048928 | Ga0496125_0338035 | Ga0496125_0338035_76_507 | 142 |
| 726 | 3300048929 | Ga0496126_0089688 | Ga0496126_0089688_1513_1944 | 142 |
| 727 | 3300049459 | Ga0495678_000510 | Ga0495678_000510_30926_31357 | 142 |
| 728 | 3300049459 | Ga0495678_002035 | Ga0495678_002035_11525_11956 | 142 |
| 729 | 3300049459 | Ga0495678_007465 | Ga0495678_007465_1638_2069 | 142 |
| 730 | 3300049459 | Ga0495678_026173 | Ga0495678_026173_116_547 | 142 |
| 731 | 3300049460 | Ga0495682_0000413 | Ga0495682_0000413_24569_25000 | 142 |
| 732 | 3300049460 | Ga0495682_0090326 | Ga0495682_0090326_23_451 | 142 |
| 733 | 3300049665 | Ga0501227_044144 | Ga0501227_044144_596_1027 | 142 |
| 734 | 3300049853 | Ga0501226_000008 | Ga0501226_000008_5609_6040 | 142 |
| 735 | 3300050490 | nmdc:mga03n38_304178_c1 | nmdc:mga03n38_304178_c1_326_757 | 142 |
| 736 | 3300050492 | nmdc:mga0yw44_14347_c1 | nmdc:mga0yw44_14347_c1_2214_2642 | 142 |
| 737 | 3300050492 | nmdc:mga0yw44_149299_c1 | nmdc:mga0yw44_149299_c1_249_677 | 142 |
| 738 | 3300050492 | nmdc:mga0yw44_20308_c1 | nmdc:mga0yw44_20308_c1_1644_2072 | 142 |
| 739 | 3300050494 | nmdc:mga06z11_475551_c1 | nmdc:mga06z11_475551_c1_234_662 | 142 |
| 740 | 3300050494 | nmdc:mga06z11_828402_c1 | nmdc:mga06z11_828402_c1_49_477 | 142 |
| 741 | 3300050495 | nmdc:mga04h51_55881_c1 | nmdc:mga04h51_55881_c1_877_1305 | 142 |
| 742 | 3300050495 | nmdc:mga04h51_79937_c1 | nmdc:mga04h51_79937_c1_30_458 | 142 |
| 743 | 3300050496 | nmdc:mga07m45_366288_c1 | nmdc:mga07m45_366288_c1_57_485 | 142 |
| 744 | 3300050507 | nmdc:mga05p37_8309_c1 | nmdc:mga05p37_8309_c1_8768_9196 | 142 |
| 745 | 3300050510 | nmdc:mga06r32_191090_c1 | nmdc:mga06r32_191090_c1_931_1359 | 142 |
| 746 | 3300050511 | nmdc:mga08y16_75071_c1 | nmdc:mga08y16_75071_c1_996_1424 | 142 |
| 747 | 3300050511 | nmdc:mga08y16_86982_c1 | nmdc:mga08y16_86982_c1_457_885 | 142 |
| 748 | 3300050512 | nmdc:mga0n895_124780_c1 | nmdc:mga0n895_124780_c1_926_1354 | 142 |
| 749 | 3300050514 | nmdc:mga08x19_61579_c1 | nmdc:mga08x19_61579_c1_1646_2077 | 142 |
| 750 | 3300050514 | nmdc:mga08x19_650715_c1 | nmdc:mga08x19_650715_c1_86_514 | 142 |
| 751 | 3300053077 | Ga0495601_0043456 | Ga0495601_0043456_2103_2531 | 142 |
| 752 | 3300053080 | Ga0500635_0030792 | Ga0500635_0030792_123_554 | 142 |
| 753 | 3300053083 | Ga0495655_0009483 | Ga0495655_0009483_109_537 | 142 |
| 754 | 3300053085 | Ga0495619_0060061 | Ga0495619_0060061_1020_1520 | 142 |
| 755 | 3300053093 | Ga0500651_0154621 | Ga0500651_0154621_412_843 | 142 |
| 756 | 3300053098 | Ga0500650_0133192 | Ga0500650_0133192_432_863 | 142 |
| 757 | 3300053117 | Ga0500593_023431 | Ga0500593_023431_10_438 | 142 |
| 758 | 3300053119 | Ga0500595_187160 | Ga0500595_187160_102_533 | 142 |
| 759 | 3300053122 | Ga0500608_085477 | Ga0500608_085477_70_501 | 142 |
| 760 | 3300053136 | Ga0500559_0000012 | Ga0500559_0000012_58203_58634 | 142 |
| 761 | 3300053139 | Ga0500568_0000002 | Ga0500568_0000002_604476_604904 | 142 |
| 762 | 3300053140 | Ga0500573_0071125 | Ga0500573_0071125_219_650 | 142 |
| 763 | 3300053145 | Ga0500586_150085 | Ga0500586_150085_353_784 | 142 |
| 764 | 3300053177 | Ga0500636_0250802 | Ga0500636_0250802_138_569 | 142 |
| 765 | 3300053178 | Ga0500637_0009309 | Ga0500637_0009309_1415_1846 | 142 |
| 766 | 3300053178 | Ga0500637_0376567 | Ga0500637_0376567_259_690 | 142 |
| 767 | 3300055283 | Ga0500661_001487 | Ga0500661_001487_3001_3432 | 142 |
| 768 | 3300055283 | Ga0500661_015672 | Ga0500661_015672_910_1341 | 142 |
| 769 | 3300059492 | Ga0587073_0146454 | Ga0587073_0146454_87_518 | 142 |
| 770 | 3300059505 | Ga0587083_0160926 | Ga0587083_0160926_90_521 | 142 |
| 771 | 3300059647 | Ga0587079_060033 | Ga0587079_060033_104_535 | 142 |
| 772 | 3300060344 | Ga0587071_188178 | Ga0587071_188178_69_500 | 142 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.934 | 1 | 142 |
| 1nye-assembly2.cif.gz_C | crystal structure of osmc from e. coli | 0.9282 | 1 | 142 |
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.9278 | 1 | 142 |
| 1nye-assembly3.cif.gz_F | crystal structure of osmc from e. coli | 0.9269 | 1 | 142 |
| 1qwi-assembly1.cif.gz_B | crystal structure of e. coli osmc | 0.9247 | 1 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9319 | 1 | 142 | 3.30.300.20 |
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9257 | 1 | 142 | 3.30.300.20 |
| af_Q55EI4_11_156_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9041 | 5 | 141 | 3.30.300.20 |
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8954 | 2 | 141 | 3.30.300.20 |
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8894 | 2 | 141 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y1YRW7-F1-model_v4 | OsmC family peroxiredoxin | 0.9863 | 63 | 141 |
|
| AF-T0ZAQ4-F1-model_v4 | Osmotically inducible protein C | 0.985 | 76 | 141 |
|
| AF-A0A510J5A0-F1-model_v4 | deleted | 0.9773 | 72 | 142 |
|
| AF-A0A2W5FXT9-F1-model_v4 | OsmC family peroxiredoxin | 0.9732 | 44 | 142 |
GO:0004601
GO:0006979 |
| AF-A0A258Y8I4-F1-model_v4 | OsmC family peroxiredoxin | 0.972 | 52 | 142 |
GO:0004601
GO:0006979 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar