F480126

General Info

Members Datasets Scaffolds Average Seq Length
772 408 772 143

Family's Representative Sequence

Representative Sequence 3300042016|Ga0439463_090554|Ga0439463_090554_93_572
Length 159
Sequence VNFVRSSILRNLVTENIKARSLAPNLEETEMSIKKKASAHWEGDLKTGLGSISTETGVLKNSPYGFKARFEGGPGTNPEELIGAAHAGCFSMAFSMILEVTLDQVDGGFAITAVHLTLKAKIPGATQQQFEELSTKAKEGCPVSKVLNAKITLDGTLVN

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
128 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
194 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
204 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
205 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
206 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
215 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
216 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
218 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
234 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
235 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
236 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
237 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
238 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
239 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
240 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
241 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
242 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
243 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
244 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
245 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
246 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
247 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
248 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
249 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
250 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
251 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
252 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
253 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
254 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
255 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
256 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
257 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
258 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
259 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
260 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
261 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
262 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
263 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
264 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
265 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
276 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
277 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
281 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
282 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
285 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
286 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
287 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
288 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
289 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
290 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
295 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
296 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
297 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
298 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
299 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
300 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
308 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
309 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
310 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
311 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
312 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
313 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
314 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
315 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
316 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
317 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
318 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
319 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
320 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
321 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
322 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
325 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
326 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
327 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
328 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
329 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
330 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
331 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
332 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
333 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
334 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
335 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
336 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
354 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
357 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
358 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
359 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
360 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
361 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
362 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
363 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
364 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
370 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
374 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
375 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
376 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
378 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
379 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
380 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
381 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
382 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
383 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
384 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
385 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
386 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
387 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
388 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
389 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
390 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
391 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
392 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
393 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
394 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
395 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
396 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
397 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
398 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
399 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
400 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
401 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
402 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
403 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
404 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
405 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.16
Nodule 0.13
Rhizoplane 5.96
Rhizosphere 80.96
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1025345 3300001976 Bacteria 778
2 JGI24739J22299_10044412 3300001989 Bacteria 1463
3 JGI24737J22298_10061775 3300001990 Bacteria 1126
4 JGI24750J21931_1015625 3300002070 Bacteria 1027
5 JGI24745J21846_1029239 3300002073 Bacteria 662
6 JGI24738J21930_10012000 3300002075 Bacteria 1897
7 JGI24744J21845_10030291 3300002077 Bacteria 1037
8 JGI24034J26672_10088205 3300002239 Bacteria 573
9 JGI24751J29686_10007457 3300002459 Bacteria 2233
10 JGI25162J39368_1000219 3300002737 Bacteria 59530
11 JGI25163J39215_1000823 3300002771 Bacteria 7445
12 JGI25163J39215_1000834 3300002771 Bacteria 7381
13 JGI25164J39214_1000175 3300002772 Bacteria 59290
14 JGI25164J39214_1000357 3300002772 Bacteria 28322
15 JGI25165J46597_1000175 3300003214 Bacteria 100117
16 JGI25165J46597_1000193 3300003214 Bacteria 91069
17 Ga0055530_10000159 3300003791 Bacteria 61131
18 Ga0055540_1000725 3300003792 Bacteria 22486
19 Ga0058692_1001767 3300003856 Bacteria 7656
20 Ga0058862_12223391 3300004803 Bacteria 606
21 Ga0065714_10067824 3300005288 Bacteria 5173
22 Ga0065714_10143055 3300005288 Bacteria 1157
23 Ga0065704_10273505 3300005289 Bacteria 932
24 Ga0065712_10088919 3300005290 Bacteria 2495
25 Ga0070676_11122110 3300005328 Bacteria 595
26 Ga0070683_100000263 3300005329 Bacteria 36252
27 Ga0070690_100239646 3300005330 Bacteria 1278
28 Ga0070670_100232450 3300005331 Bacteria 1604
29 Ga0070670_100437988 3300005331 Bacteria 1157
30 Ga0070666_10085241 3300005335 Bacteria 2163
31 Ga0070666_10969083 3300005335 Bacteria 630
32 Ga0070680_100013453 3300005336 Bacteria 6374
33 Ga0070680_100124899 3300005336 Bacteria 2150
34 Ga0070680_100133269 3300005336 Bacteria 2080
35 Ga0070680_100877116 3300005336 Bacteria 774
36 Ga0070682_100046230 3300005337 Bacteria 2700
37 Ga0068868_100019489 3300005338 Bacteria 5083
38 Ga0070660_100762924 3300005339 Bacteria 812
39 Ga0070660_101243358 3300005339 Bacteria 632
40 Ga0070689_100199650 3300005340 Bacteria 1632
41 Ga0070689_100541207 3300005340 Bacteria 1002
42 Ga0070687_100279908 3300005343 Bacteria 1049
43 Ga0070692_10140811 3300005345 Bacteria 1365
44 Ga0070668_100388968 3300005347 Bacteria 1188
45 Ga0070668_101855242 3300005347 Bacteria 555
46 Ga0070675_100112311 3300005354 Bacteria 2307
47 Ga0070674_100543955 3300005356 Bacteria 973
48 Ga0070688_100019851 3300005365 Bacteria 3898
49 Ga0070659_100361501 3300005366 Bacteria 1219
50 Ga0070667_102066040 3300005367 Bacteria 537
51 Ga0070709_11574271 3300005434 Bacteria 535
52 Ga0070714_100298184 3300005435 Bacteria 1502
53 Ga0070713_100034303 3300005436 Bacteria 4075
54 Ga0070713_101510749 3300005436 Bacteria 652
55 Ga0070710_11173123 3300005437 Bacteria 567
56 Ga0070701_10253487 3300005438 Bacteria 1064
57 Ga0070705_100125536 3300005440 Bacteria 1665
58 Ga0070700_100010193 3300005441 Bacteria 5182
59 Ga0070694_100131149 3300005444 Bacteria 1810
60 Ga0070663_100194130 3300005455 Bacteria 1581
61 Ga0070663_100407557 3300005455 Bacteria 1113
62 Ga0070678_100414740 3300005456 Bacteria 1172
63 Ga0070662_100419730 3300005457 Bacteria 1106
64 Ga0070681_10199302 3300005458 Bacteria 1920
65 Ga0070681_10578418 3300005458 Bacteria 1037
66 Ga0068867_100031608 3300005459 Bacteria 3823
67 Ga0070685_10017568 3300005466 Bacteria 3830
68 Ga0070706_100903005 3300005467 Bacteria 816
69 Ga0070706_101656337 3300005467 Bacteria 583
70 Ga0070679_100011942 3300005530 Bacteria 8292
71 Ga0070679_100017438 3300005530 Bacteria 6949
72 Ga0070679_100303496 3300005530 Bacteria 1547
73 Ga0070679_100374494 3300005530 Bacteria 1371
74 Ga0070679_100556141 3300005530 Bacteria 1091
75 Ga0070679_101713278 3300005530 Bacteria 576
76 Ga0070684_100004996 3300005535 Bacteria 10131
77 Ga0070684_100023697 3300005535 Bacteria 5138
78 Ga0070684_100421689 3300005535 Bacteria 1232
79 Ga0068853_100108458 3300005539 Bacteria 2463
80 Ga0068853_100177218 3300005539 Bacteria 1932
81 Ga0070672_100595364 3300005543 Bacteria 963
82 Ga0070693_100509832 3300005547 Bacteria 855
83 Ga0070665_100001096 3300005548 Bacteria 33479
84 Ga0070665_100021887 3300005548 Bacteria 6430
85 Ga0070665_101167384 3300005548 Bacteria 781
86 Ga0070704_100212767 3300005549 Bacteria 1567
87 Ga0068855_100000864 3300005563 Bacteria 37644
88 Ga0068855_100046181 3300005563 Bacteria 5149
89 Ga0068855_100304213 3300005563 Bacteria 1765
90 Ga0068855_101594534 3300005563 Bacteria 668
91 Ga0070664_100178286 3300005564 Bacteria 1888
92 Ga0068856_100342271 3300005614 Bacteria 1514
93 Ga0068856_101997965 3300005614 Unclassified 590
94 Ga0070702_100023459 3300005615 Bacteria 3278
95 Ga0068859_100071130 3300005617 Bacteria 3514
96 Ga0068866_10048567 3300005718 Bacteria 2146
97 Ga0068861_100024510 3300005719 Bacteria 4364
98 Ga0068870_10021857 3300005840 Bacteria 3136
99 Ga0068863_100169063 3300005841 Bacteria 2096
100 Ga0068858_100202545 3300005842 Bacteria 1877
101 Ga0068860_100219620 3300005843 Bacteria 1845
102 Ga0068860_100625520 3300005843 Bacteria 1083
103 Ga0068862_100319867 3300005844 Bacteria 1432
104 Ga0081540_1160365 3300005983 Bacteria 873
105 Ga0070717_10026052 3300006028 Bacteria 4660
106 Ga0075365_10012970 3300006038 Bacteria 4970
107 Ga0075365_10045859 3300006038 Bacteria 2869
108 Ga0075365_10050058 3300006038 Bacteria 2755
109 Ga0075365_10055835 3300006038 Bacteria 2623
110 Ga0075365_10075051 3300006038 Bacteria 2281
111 Ga0075365_10519755 3300006038 Bacteria 842
112 Ga0075363_100374683 3300006048 Bacteria 834
113 Ga0075363_100843408 3300006048 Bacteria 559
114 Ga0075364_10307385 3300006051 Bacteria 1080
115 Ga0075432_10002880 3300006058 Bacteria 5782
116 Ga0070715_10087767 3300006163 Bacteria 1425
117 Ga0070715_10087878 3300006163 Bacteria 1424
118 Ga0070712_100019927 3300006175 Bacteria 4385
119 Ga0075369_10224211 3300006186 Bacteria 870
120 Ga0097621_100098648 3300006237 Bacteria 2454
121 Ga0097621_100727441 3300006237 Bacteria 915
122 Ga0068871_100043906 3300006358 Bacteria 3592
123 Ga0068871_100420306 3300006358 Bacteria 1194
124 Ga0068871_100670937 3300006358 Bacteria 948
125 Ga0075428_100017465 3300006844 Bacteria 7929
126 Ga0075428_102406712 3300006844 Bacteria 541
127 Ga0075431_100226723 3300006847 Bacteria 1905
128 Ga0075431_100659891 3300006847 Bacteria 1026
129 Ga0075434_100537446 3300006871 Bacteria 1189
130 Ga0068865_100047115 3300006881 Bacteria 2960
131 Ga0068865_100066208 3300006881 Bacteria 2548
132 Ga0075436_100023659 3300006914 Bacteria 4219
133 Ga0097620_100071126 3300006931 Bacteria 3514
134 Ga0099794_10068552 3300007265 Bacteria 1735
135 Ga0105251_10000068 3300009011 Bacteria 98955
136 Ga0105251_10001441 3300009011 Bacteria 20465
137 Ga0105251_10026993 3300009011 Bacteria 2917
138 Ga0105244_10106077 3300009036 Bacteria 1371
139 Ga0105250_10040925 3300009092 Bacteria 1858
140 Ga0105240_10002346 3300009093 Bacteria 30550
141 Ga0105240_10044867 3300009093 Bacteria 5612
142 Ga0105240_10079592 3300009093 Bacteria 4032
143 Ga0105240_10382137 3300009093 Bacteria 1590
144 Ga0105240_10436904 3300009093 Bacteria 1467
145 Ga0105240_11177781 3300009093 Bacteria 812
146 Ga0111539_10762432 3300009094 Bacteria 1126
147 Ga0105245_12567754 3300009098 Bacteria 563
148 Ga0105247_10011015 3300009101 Bacteria 5457
149 Ga0114129_10341077 3300009147 Bacteria 1987
150 Ga0114129_10990197 3300009147 Bacteria 1059
151 Ga0114129_11238620 3300009147 Bacteria 928
152 Ga0105243_10000075 3300009148 Bacteria 112098
153 Ga0105243_10008056 3300009148 Bacteria 8089
154 Ga0105243_10128441 3300009148 Bacteria 2147
155 Ga0105241_10373160 3300009174 Bacteria 1244
156 Ga0105241_10758247 3300009174 Bacteria 890
157 Ga0105241_10920068 3300009174 Bacteria 813
158 Ga0105241_11257498 3300009174 Bacteria 703
159 Ga0105242_10102407 3300009176 Bacteria 2428
160 Ga0105237_10042538 3300009545 Bacteria 4580
161 Ga0105237_10044603 3300009545 Bacteria 4465
162 Ga0105237_10167677 3300009545 Bacteria 2195
163 Ga0105237_10275599 3300009545 Bacteria 1685
164 Ga0105237_10793015 3300009545 Bacteria 954
165 Ga0105238_10051481 3300009551 Bacteria 4142
166 Ga0105238_10096225 3300009551 Bacteria 2947
167 Ga0105238_10240552 3300009551 Bacteria 1787
168 Ga0105238_10454153 3300009551 Bacteria 1278
169 Ga0105238_11507084 3300009551 Bacteria 701
170 Ga0105249_10021961 3300009553 Bacteria 5716
171 Ga0105249_10408900 3300009553 Bacteria 1389
172 Ga0105239_10039857 3300010375 Bacteria 5146
173 Ga0105239_10140201 3300010375 Bacteria 2694
174 Ga0105239_10417763 3300010375 Bacteria 1519
175 Ga0105239_10549968 3300010375 Bacteria 1315
176 Ga0105239_10764342 3300010375 Bacteria 1106
177 Ga0105246_10199646 3300011119 Bacteria 1554
178 Ga0157373_10047780 3300013100 Bacteria 3052
179 Ga0157373_10525281 3300013100 Bacteria 857
180 Ga0157373_11366187 3300013100 Bacteria 538
181 Ga0157371_10001263 3300013102 Bacteria 26673
182 Ga0157371_10091888 3300013102 Bacteria 2150
183 Ga0157370_10155314 3300013104 Bacteria 2129
184 Ga0157369_10110463 3300013105 Bacteria 2923
185 Ga0157369_10341863 3300013105 Bacteria 1554
186 Ga0157369_10406448 3300013105 Bacteria 1412
187 Ga0157369_10605458 3300013105 Bacteria 1131
188 Ga0157369_10650949 3300013105 Bacteria 1086
189 Ga0157374_10099656 3300013296 Bacteria 2784
190 Ga0157374_10135288 3300013296 Bacteria 2389
191 Ga0157378_10534885 3300013297 Bacteria 1175
192 Ga0163162_10140237 3300013306 Bacteria 2530
193 Ga0157372_11360476 3300013307 Bacteria 819
194 Ga0157372_11493887 3300013307 Bacteria 778
195 Ga0163163_10785643 3300014325 Bacteria 1015
196 Ga0163163_10854098 3300014325 Bacteria 974
197 Ga0163163_13098522 3300014325 Bacteria 518
198 Ga0157380_11520624 3300014326 Bacteria 723
199 Ga0182008_10000367 3300014497 Bacteria 35146
200 Ga0182008_10084657 3300014497 Bacteria 1561
201 Ga0157377_10047696 3300014745 Bacteria 2400
202 Ga0157379_10079167 3300014968 Bacteria 2943
203 Ga0157379_11183755 3300014968 Bacteria 735
204 Ga0157376_10196836 3300014969 Bacteria 1852
205 Ga0157376_10308476 3300014969 Bacteria 1501
206 Ga0182006_1017252 3300015261 Bacteria 3069
207 Ga0163161_10048658 3300017792 Bacteria 3062
208 Ga0206356_11524923 3300020070 Bacteria 1067
209 Ga0206352_10477851 3300020078 Bacteria 530
210 Ga0206350_10752306 3300020080 Bacteria 543
211 Ga0206353_10249946 3300020082 Bacteria 676
212 Ga0213873_10004171 3300021358 Bacteria 2673
213 Ga0209760_100020 3300025207 Bacteria 169879
214 Ga0209760_100082 3300025207 Bacteria 76168
215 Ga0207427_100005 3300025231 Bacteria 797999
216 Ga0207427_100006 3300025231 Bacteria 785415
217 Ga0209437_100013 3300025233 Bacteria 785457
218 Ga0209437_100018 3300025233 Bacteria 694400
219 Ga0209759_1001572 3300025256 Bacteria 12431
220 Ga0209759_1020334 3300025256 Bacteria 1543
221 Ga0209233_1000021 3300025261 Bacteria 798078
222 Ga0209233_1000022 3300025261 Bacteria 785415
223 Ga0209130_1056706 3300025284 Bacteria 693
224 Ga0209676_1000222 3300025292 Bacteria 124695
225 Ga0209050_1000296 3300025298 Bacteria 104732
226 Ga0209051_1000295 3300025303 Bacteria 79621
227 Ga0209051_1008357 3300025303 Bacteria 5489
228 Ga0207655_1000135 3300025728 Bacteria 143597
229 Ga0207655_1002411 3300025728 Bacteria 15220
230 Ga0207713_1000103 3300025735 Bacteria 138415
231 Ga0207713_1002728 3300025735 Bacteria 12593
232 Ga0207692_10088135 3300025898 Bacteria 1677
233 Ga0207642_10004044 3300025899 Bacteria 4693
234 Ga0207710_10009561 3300025900 Bacteria 4077
235 Ga0207688_10028197 3300025901 Bacteria 3090
236 Ga0207688_10481329 3300025901 Bacteria 776
237 Ga0207680_10074756 3300025903 Bacteria 2111
238 Ga0207647_10034457 3300025904 Bacteria 3231
239 Ga0207685_10084454 3300025905 Bacteria 1322
240 Ga0207699_10699185 3300025906 Bacteria 742
241 Ga0207645_10014566 3300025907 Bacteria 5260
242 Ga0207643_10030491 3300025908 Bacteria 3002
243 Ga0207705_10941986 3300025909 Bacteria 668
244 Ga0207684_10914017 3300025910 Bacteria 737
245 Ga0207684_11561944 3300025910 Bacteria 535
246 Ga0207707_10256395 3300025912 Bacteria 1518
247 Ga0207695_10005133 3300025913 Bacteria 17531
248 Ga0207695_10013476 3300025913 Bacteria 9748
249 Ga0207695_10014260 3300025913 Bacteria 9427
250 Ga0207695_10021679 3300025913 Bacteria 7323
251 Ga0207695_10094384 3300025913 Bacteria 2999
252 Ga0207695_10621431 3300025913 Bacteria 961
253 Ga0207671_10049367 3300025914 Bacteria 3115
254 Ga0207671_10148853 3300025914 Bacteria 1808
255 Ga0207671_10166274 3300025914 Bacteria 1710
256 Ga0207671_10469368 3300025914 Bacteria 1003
257 Ga0207671_10495829 3300025914 Bacteria 974
258 Ga0207693_10004673 3300025915 Bacteria 11541
259 Ga0207693_10460319 3300025915 Bacteria 994
260 Ga0207663_10069742 3300025916 Bacteria 2262
261 Ga0207663_11333207 3300025916 Bacteria 578
262 Ga0207660_10011193 3300025917 Bacteria 5831
263 Ga0207660_10155592 3300025917 Bacteria 1759
264 Ga0207662_10185203 3300025918 Bacteria 1341
265 Ga0207657_10007091 3300025919 Bacteria 11517
266 Ga0207657_10094810 3300025919 Bacteria 2484
267 Ga0207649_10216147 3300025920 Bacteria 1363
268 Ga0207652_10054008 3300025921 Bacteria 3452
269 Ga0207652_10266973 3300025921 Bacteria 1544
270 Ga0207652_10316721 3300025921 Bacteria 1408
271 Ga0207652_11147904 3300025921 Bacteria 678
272 Ga0207652_11164911 3300025921 Bacteria 672
273 Ga0207694_10087928 3300025924 Bacteria 2449
274 Ga0207694_10098667 3300025924 Bacteria 2313
275 Ga0207694_10387483 3300025924 Bacteria 1161
276 Ga0207650_10005007 3300025925 Bacteria 9049
277 Ga0207659_10530156 3300025926 Bacteria 999
278 Ga0207659_11578413 3300025926 Bacteria 560
279 Ga0207687_10023734 3300025927 Bacteria 4091
280 Ga0207700_10014790 3300025928 Bacteria 5124
281 Ga0207700_10032139 3300025928 Bacteria 3739
282 Ga0207706_10085584 3300025933 Bacteria 2772
283 Ga0207686_10046064 3300025934 Bacteria 2687
284 Ga0207709_10000269 3300025935 Bacteria 61223
285 Ga0207709_10004904 3300025935 Bacteria 7658
286 Ga0207709_10027842 3300025935 Bacteria 3261
287 Ga0207709_10070325 3300025935 Bacteria 2219
288 Ga0207670_10145300 3300025936 Bacteria 1753
289 Ga0207670_11111440 3300025936 Bacteria 667
290 Ga0207704_10574844 3300025938 Bacteria 919
291 Ga0207665_10103495 3300025939 Bacteria 1991
292 Ga0207691_10012861 3300025940 Bacteria 8012
293 Ga0207711_10084825 3300025941 Bacteria 2773
294 Ga0207661_10001051 3300025944 Bacteria 18329
295 Ga0207679_10109463 3300025945 Bacteria 2177
296 Ga0207667_10008319 3300025949 Bacteria 12339
297 Ga0207667_10103750 3300025949 Bacteria 2932
298 Ga0207667_10234293 3300025949 Bacteria 1879
299 Ga0207667_11443062 3300025949 Bacteria 661
300 Ga0207651_11000103 3300025960 Bacteria 747
301 Ga0207712_10031539 3300025961 Bacteria 3570
302 Ga0207712_10062056 3300025961 Bacteria 2655
303 Ga0207668_10227836 3300025972 Bacteria 1500
304 Ga0207640_10073028 3300025981 Bacteria 2316
305 Ga0207658_10124884 3300025986 Bacteria 2058
306 Ga0207658_10417866 3300025986 Bacteria 1182
307 Ga0207658_11535943 3300025986 Bacteria 609
308 Ga0207677_10057915 3300026023 Bacteria 2664
309 Ga0207703_10234808 3300026035 Bacteria 1646
310 Ga0207639_10268333 3300026041 Bacteria 1496
311 Ga0207639_10455088 3300026041 Bacteria 1162
312 Ga0207639_10809664 3300026041 Bacteria 873
313 Ga0207678_10054141 3300026067 Bacteria 3456
314 Ga0207708_10015207 3300026075 Bacteria 5769
315 Ga0207648_10001979 3300026089 Bacteria 22372
316 Ga0207676_10159670 3300026095 Bacteria 1951
317 Ga0207674_10191341 3300026116 Unclassified 1996
318 Ga0207674_10400244 3300026116 Bacteria 1327
319 Ga0207675_100025355 3300026118 Bacteria 5518
320 Ga0207683_10038505 3300026121 Bacteria 4168
321 Ga0207698_10167884 3300026142 Bacteria 1928
322 Ga0207698_10835255 3300026142 Bacteria 925
323 Ga0207698_11646952 3300026142 Bacteria 657
324 Ga0209281_1000091 3300027111 Bacteria 242588
325 Ga0209371_1000032 3300027312 Bacteria 392355
326 Ga0209813_10052421 3300027866 Bacteria 1279
327 Ga0209813_10067027 3300027866 Bacteria 1159
328 Ga0207428_10371206 3300027907 Bacteria 1051
329 Ga0268266_10000159 3300028379 Bacteria 126969
330 Ga0268266_10022361 3300028379 Bacteria 5390
331 Ga0268266_10086781 3300028379 Bacteria 2736
332 Ga0268266_10116245 3300028379 Bacteria 2375
333 Ga0268266_10197540 3300028379 Bacteria 1839
334 Ga0268265_10138337 3300028380 Bacteria 2035
335 Ga0268264_10586842 3300028381 Bacteria 1097
336 Ga0268264_11651104 3300028381 Bacteria 651
337 Ga0307517_10411909 3300028786 Bacteria 712
338 Ga0307515_10671684 3300028794 Bacteria 650
339 Ga0265338_10049552 3300028800 Bacteria 3806
340 Ga0265338_10205713 3300028800 Bacteria 1481
341 Ga0268256_1000050 3300030500 Bacteria 300675
342 Ga0307511_10000028 3300030521 Bacteria 109328
343 Ga0307511_10067948 3300030521 Bacteria 2638
344 Ga0307511_10103544 3300030521 Bacteria 1853
345 Ga0265330_10133376 3300031235 Bacteria 1057
346 Ga0265325_10001594 3300031241 Bacteria 15822
347 Ga0265331_10016868 3300031250 Bacteria 3822
348 Ga0265331_10033379 3300031250 Bacteria 2545
349 Ga0265331_10540687 3300031250 Unclassified 525
350 Ga0265316_10068870 3300031344 Bacteria 2732
351 Ga0307509_10556846 3300031507 Bacteria 824
352 Ga0307408_100000028 3300031548 Bacteria 233440
353 Ga0265313_10011247 3300031595 Bacteria 5577
354 Ga0307508_10774739 3300031616 Bacteria 574
355 Ga0265314_10009427 3300031711 Bacteria 8232
356 Ga0265314_10208585 3300031711 Bacteria 1149
357 Ga0307414_10023320 3300032004 Bacteria 3923
358 Ga0307510_10229940 3300033180 Bacteria 1358
359 Ga0373923_0131074 3300035111 Bacteria 1127
360 Ga0373932_0218218 3300035112 Bacteria 684
361 Ga0373936_0306270 3300035113 Bacteria 718
362 Ga0373953_0034897 3300035117 Bacteria 1974
363 Ga0373957_0050160 3300035120 Bacteria 1594
364 Ga0373957_0416837 3300035120 Bacteria 579
365 Ga0373955_0051409 3300035172 Bacteria 2244
366 Ga0373924_0580013 3300035410 Bacteria 506
367 Ga0373935_0070547 3300035692 Bacteria 2252
368 Ga0373933_0009993 3300035724 Bacteria 5196
369 Ga0373937_0022169 3300036401 Bacteria 5706
370 Ga0373925_0029840 3300037068 Bacteria 4000
371 Ga0395898_0097924 3300037466 Bacteria 2816
372 Ga0395905_0244439 3300037471 Bacteria 1677
373 Ga0395901_0172942 3300038443 Bacteria 2266
374 Ga0436360_0592298 3300039438 Bacteria 6810
375 Ga0436361_0051944 3300039447 Bacteria 2094
376 Ga0436362_0951072 3300039453 Bacteria 2922
377 Ga0439447_051133 3300041407 Bacteria 986
378 Ga0439461_0040096 3300041410 Bacteria 1009
379 Ga0439466_0000697 3300041411 Bacteria 12686
380 Ga0451795_1176480 3300041456 Bacteria 1512
381 Ga0451807_0352186 3300041486 Unclassified 570
382 Ga0451807_2174716 3300041486 Bacteria 889
383 Ga0439437_007132 3300042000 Bacteria 1246
384 Ga0439432_003995 3300042006 Bacteria 5420
385 Ga0439432_006470 3300042006 Bacteria 4182
386 Ga0439451_045285 3300042009 Bacteria 881
387 Ga0439452_003511 3300042010 Bacteria 5478
388 Ga0439452_021061 3300042010 Bacteria 1703
389 Ga0439455_0031217 3300042012 Bacteria 1325
390 Ga0439456_001509 3300042013 Bacteria 4688
391 Ga0439456_009962 3300042013 Bacteria 1962
392 Ga0439456_018372 3300042013 Bacteria 1468
393 Ga0439463_000065 3300042016 Bacteria 23115
394 Ga0439463_000640 3300042016 Bacteria 9679
395 Ga0439463_090554 3300042016 Bacteria 787
396 Ga0450911_000055 3300042115 Bacteria 47324
397 Ga0450911_033868 3300042115 Bacteria 663
398 Ga0450917_001876 3300042120 Bacteria 1493
399 Ga0450904_000368 3300042139 Bacteria 9498
400 Ga0450905_021833 3300042142 Bacteria 949
401 Ga0450906_053331 3300042145 Bacteria 715
402 Ga0439446_0001744 3300042156 Bacteria 5059
403 Ga0439459_0062860 3300042438 Bacteria 842
404 Ga0439464_0003176 3300042439 Bacteria 4121
405 Ga0439464_0008637 3300042439 Bacteria 2669
406 Ga0439464_0048587 3300042439 Bacteria 1223
407 Ga0450916_007552 3300042530 Bacteria 1308
408 Ga0450893_0000923 3300042532 Bacteria 4402
409 Ga0439440_0000879 3300042993 Bacteria 5249
410 Ga0466969_0003690 3300044656 Bacteria 8151
411 Ga0466972_0132793 3300044658 Bacteria 1172
412 Ga0466966_0056001 3300044684 Bacteria 2495
413 Ga0466963_0822848 3300044694 Bacteria 655
414 Ga0466959_0023434 3300045049 Bacteria 4568
415 Ga0495617_000380 3300046452 Bacteria 24621
416 Ga0495617_014471 3300046452 Bacteria 2681
417 Ga0495617_018659 3300046452 Bacteria 2346
418 Ga0495627_000296 3300046453 Bacteria 49348
419 Ga0495627_007017 3300046453 Bacteria 4367
420 Ga0495627_121323 3300046453 Bacteria 738
421 Ga0495590_0012679 3300046457 Bacteria 3122
422 Ga0495591_000164 3300046458 Bacteria 70760
423 Ga0495591_000344 3300046458 Bacteria 41220
424 Ga0495591_004911 3300046458 Bacteria 6352
425 Ga0495591_005358 3300046458 Bacteria 5960
426 Ga0495591_009013 3300046458 Bacteria 4014
427 Ga0495591_018968 3300046458 Bacteria 2316
428 Ga0495638_0045171 3300046460 Bacteria 2772
429 Ga0495638_0053112 3300046460 Bacteria 2522
430 Ga0495638_0136375 3300046460 Bacteria 1436
431 Ga0495638_0165539 3300046460 Bacteria 1272
432 Ga0495653_0091857 3300046463 Bacteria 2218
433 Ga0495650_0000402 3300046471 Bacteria 72128
434 Ga0495650_0006144 3300046471 Bacteria 7554
435 Ga0495650_0007734 3300046471 Bacteria 6400
436 Ga0495582_0017955 3300046473 Bacteria 3867
437 Ga0495605_0000302 3300046474 Bacteria 53003
438 Ga0495605_0000316 3300046474 Bacteria 50684
439 Ga0495605_0000813 3300046474 Bacteria 22279
440 Ga0495605_0001296 3300046474 Bacteria 16598
441 Ga0495605_0007839 3300046474 Bacteria 6049
442 Ga0495605_0010401 3300046474 Bacteria 5207
443 Ga0495605_0010763 3300046474 Bacteria 5111
444 Ga0495605_0230157 3300046474 Bacteria 798
445 Ga0495605_0260902 3300046474 Bacteria 739
446 Ga0495605_0272638 3300046474 Bacteria 720
447 Ga0495639_0087624 3300046475 Bacteria 1457
448 Ga0495639_0541688 3300046475 Bacteria 596
449 Ga0495662_0265452 3300046476 Bacteria 845
450 Ga0495584_0013224 3300046491 Bacteria 4212
451 Ga0495584_0015365 3300046491 Bacteria 3900
452 Ga0495584_0146184 3300046491 Bacteria 1201
453 Ga0495584_0304970 3300046491 Bacteria 809
454 Ga0495584_0321154 3300046491 Bacteria 786
455 Ga0495585_0021381 3300046492 Bacteria 3715
456 Ga0495585_0038473 3300046492 Bacteria 2692
457 Ga0495585_0116338 3300046492 Bacteria 1418
458 Ga0495585_0300004 3300046492 Bacteria 790
459 Ga0495594_0017748 3300046499 Bacteria 3763
460 Ga0495596_0060506 3300046500 Bacteria 1475
461 Ga0495607_0000268 3300046501 Bacteria 55932
462 Ga0495607_0000365 3300046501 Bacteria 46525
463 Ga0495607_0000762 3300046501 Bacteria 30848
464 Ga0495607_0002401 3300046501 Bacteria 15280
465 Ga0495607_0015307 3300046501 Bacteria 4973
466 Ga0495607_0036943 3300046501 Bacteria 2938
467 Ga0495607_0052223 3300046501 Bacteria 2368
468 Ga0495607_0137583 3300046501 Bacteria 1263
469 Ga0495607_0161577 3300046501 Bacteria 1138
470 Ga0495607_0252004 3300046501 Bacteria 849
471 Ga0495607_0377139 3300046501 Bacteria 649
472 Ga0495583_0000409 3300046506 Bacteria 65136
473 Ga0495583_0004250 3300046506 Bacteria 10386
474 Ga0495583_0004296 3300046506 Bacteria 10311
475 Ga0495583_0004393 3300046506 Bacteria 10118
476 Ga0495583_0006517 3300046506 Bacteria 7616
477 Ga0495583_0011885 3300046506 Bacteria 4968
478 Ga0495606_0000084 3300046507 Bacteria 158428
479 Ga0495606_0000115 3300046507 Bacteria 135589
480 Ga0495606_0000285 3300046507 Bacteria 87775
481 Ga0495606_0004641 3300046507 Bacteria 13591
482 Ga0495608_0157050 3300046511 Bacteria 1447
483 Ga0495610_0010122 3300046512 Bacteria 5887
484 Ga0495610_0027408 3300046512 Bacteria 3028
485 Ga0495616_0001775 3300046513 Bacteria 14672
486 Ga0495616_0007207 3300046513 Bacteria 6665
487 Ga0495620_0000376 3300046515 Bacteria 30597
488 Ga0495620_0069093 3300046515 Bacteria 1449
489 Ga0495630_0120098 3300046517 Bacteria 1994
490 Ga0495630_0129671 3300046517 Bacteria 1915
491 Ga0495631_0002659 3300046518 Bacteria 9963
492 Ga0495631_0009813 3300046518 Bacteria 4766
493 Ga0495631_0314937 3300046518 Bacteria 666
494 Ga0495632_0000952 3300046519 Bacteria 25300
495 Ga0495632_0004049 3300046519 Bacteria 10117
496 Ga0495632_0011397 3300046519 Bacteria 5188
497 Ga0495632_0014524 3300046519 Bacteria 4450
498 Ga0495632_0111591 3300046519 Bacteria 1283
499 Ga0495632_0206563 3300046519 Bacteria 892
500 Ga0495637_0000054 3300046520 Bacteria 99531
501 Ga0495637_0001318 3300046520 Bacteria 14888
502 Ga0495637_0004745 3300046520 Bacteria 7013
503 Ga0495637_0005807 3300046520 Bacteria 6250
504 Ga0495637_0025174 3300046520 Bacteria 2683
505 Ga0495637_0161772 3300046520 Bacteria 839
506 Ga0495637_0369267 3300046520 Bacteria 501
507 Ga0495643_0010329 3300046522 Bacteria 5748
508 Ga0495643_0060533 3300046522 Bacteria 2009
509 Ga0495643_0069977 3300046522 Bacteria 1843
510 Ga0495644_0000830 3300046523 Bacteria 12764
511 Ga0495644_0002746 3300046523 Bacteria 6987
512 Ga0495648_0002978 3300046524 Bacteria 15198
513 Ga0495648_0010691 3300046524 Bacteria 6971
514 Ga0495648_0061037 3300046524 Bacteria 2240
515 Ga0495663_0026053 3300046525 Bacteria 1710
516 Ga0495666_0218711 3300046526 Bacteria 873
517 Ga0495642_0000824 3300046528 Bacteria 14888
518 Ga0495652_0822788 3300046529 Bacteria 617
519 Ga0495654_0003754 3300046530 Bacteria 9195
520 Ga0495654_0013167 3300046530 Bacteria 4430
521 Ga0495654_0019147 3300046530 Bacteria 3580
522 Ga0495654_0032890 3300046530 Bacteria 2627
523 Ga0495654_0036512 3300046530 Bacteria 2468
524 Ga0495654_0042046 3300046530 Bacteria 2270
525 Ga0495587_0021388 3300046536 Bacteria 3989
526 Ga0495598_0090404 3300046537 Bacteria 997
527 Ga0495609_0000061 3300046538 Bacteria 139848
528 Ga0495609_0000100 3300046538 Bacteria 100831
529 Ga0495609_0000756 3300046538 Bacteria 24390
530 Ga0495609_0056203 3300046538 Bacteria 1744
531 Ga0495609_0065176 3300046538 Bacteria 1606
532 Ga0495621_0135109 3300046539 Bacteria 962
533 Ga0495597_0000121 3300046542 Bacteria 70801
534 Ga0495597_0004514 3300046542 Bacteria 7619
535 Ga0495597_0016759 3300046542 Bacteria 3458
536 Ga0495597_0119652 3300046542 Bacteria 1098
537 Ga0495622_0023789 3300046557 Bacteria 2858
538 Ga0495622_0097739 3300046557 Bacteria 1347
539 Ga0495622_0197102 3300046557 Bacteria 898
540 Ga0495667_0040905 3300046559 Bacteria 3075
541 Ga0495667_0227325 3300046559 Unclassified 1190
542 Ga0495656_0017067 3300046615 Bacteria 2764
543 Ga0495656_0035535 3300046615 Bacteria 2048
544 Ga0495656_0802309 3300046615 Bacteria 509
545 Ga0495668_0025762 3300046616 Bacteria 3340
546 Ga0495668_0045844 3300046616 Bacteria 2430
547 Ga0495668_0047143 3300046616 Bacteria 2392
548 Ga0495634_0464057 3300046642 Bacteria 746
549 Ga0495611_0001663 3300046648 Bacteria 10773
550 Ga0495611_0002835 3300046648 Bacteria 7745
551 Ga0495611_0010434 3300046648 Bacteria 3931
552 Ga0495611_0310019 3300046648 Bacteria 727
553 Ga0495625_0000147 3300046660 Bacteria 107983
554 Ga0495625_0002431 3300046660 Bacteria 20158
555 Ga0495625_0028100 3300046660 Bacteria 4221
556 Ga0495635_0117825 3300046663 Bacteria 1812
557 Ga0495635_0427352 3300046663 Bacteria 878
558 Ga0495659_0155962 3300046664 Bacteria 919
559 Ga0495661_0000153 3300046665 Bacteria 81096
560 Ga0495661_0000315 3300046665 Bacteria 54229
561 Ga0495661_0011035 3300046665 Bacteria 6138
562 Ga0495661_0017783 3300046665 Bacteria 4686
563 Ga0495657_0031141 3300046675 Bacteria 3732
564 Ga0495623_0052450 3300046679 Bacteria 2577
565 Ga0495647_0013135 3300046681 Bacteria 2864
566 Ga0495669_0017432 3300046684 Bacteria 3083
567 Ga0495670_0008294 3300046691 Bacteria 5108
568 Ga0495670_0054910 3300046691 Bacteria 1997
569 Ga0495670_0129738 3300046691 Bacteria 1313
570 Ga0495670_0176228 3300046691 Bacteria 1127
571 Ga0495671_0006513 3300046692 Bacteria 6741
572 Ga0495671_0008015 3300046692 Bacteria 5968
573 Ga0495671_0257764 3300046692 Bacteria 841
574 Ga0495671_0305644 3300046692 Bacteria 765
575 Ga0495649_0000686 3300046694 Bacteria 27567
576 Ga0495649_0002690 3300046694 Bacteria 12380
577 Ga0495649_0107230 3300046694 Bacteria 1482
578 Ga0495649_0162840 3300046694 Bacteria 1169
579 Ga0495649_0283466 3300046694 Bacteria 846
580 Ga0495589_0011002 3300046794 Bacteria 4697
581 Ga0495589_0018291 3300046794 Bacteria 3595
582 Ga0495589_0088343 3300046794 Bacteria 1505
583 Ga0495600_0020460 3300046809 Bacteria 4232
584 Ga0495660_0000813 3300046810 Bacteria 23314
585 Ga0495660_0001072 3300046810 Bacteria 19628
586 Ga0495660_0002689 3300046810 Bacteria 11234
587 Ga0495660_0017784 3300046810 Bacteria 4089
588 Ga0495660_0036756 3300046810 Bacteria 2730
589 Ga0495660_0133744 3300046810 Bacteria 1241
590 Ga0495660_0170790 3300046810 Bacteria 1059
591 Ga0495660_0467728 3300046810 Bacteria 543
592 Ga0495581_0180106 3300047315 Bacteria 1236
593 Ga0495604_0209638 3300047317 Bacteria 1347
594 Ga0495636_0000767 3300047318 Bacteria 11818
595 Ga0495674_0038624 3300047319 Bacteria 4284
596 Ga0495672_0001274 3300047320 Bacteria 25229
597 Ga0495672_0003072 3300047320 Bacteria 14614
598 Ga0495672_0003235 3300047320 Bacteria 14138
599 Ga0495672_0006475 3300047320 Bacteria 9056
600 Ga0495672_0010264 3300047320 Bacteria 6689
601 Ga0495672_0018222 3300047320 Bacteria 4671
602 Ga0495672_0025075 3300047320 Bacteria 3825
603 Ga0495672_0064038 3300047320 Bacteria 2107
604 Ga0495676_0000027 3300047321 Bacteria 141955
605 Ga0495676_0024454 3300047321 Bacteria 5229
606 Ga0495683_0014876 3300047323 Bacteria 4051
607 Ga0495683_0027940 3300047323 Bacteria 2885
608 Ga0495687_001396 3300047443 Bacteria 22282
609 Ga0495675_0271091 3300047444 Bacteria 1014
610 Ga0495679_000096 3300047446 Bacteria 80131
611 Ga0495679_080819 3300047446 Bacteria 923
612 Ga0495685_271216 3300047447 Bacteria 536
613 Ga0495673_0002023 3300047469 Bacteria 14906
614 Ga0495673_0002635 3300047469 Bacteria 12426
615 Ga0495673_0003580 3300047469 Bacteria 10192
616 Ga0495673_0010013 3300047469 Bacteria 5193
617 Ga0495673_0012324 3300047469 Bacteria 4544
618 Ga0495673_0012824 3300047469 Bacteria 4424
619 Ga0495673_0024649 3300047469 Bacteria 2901
620 Ga0495681_0000737 3300047470 Bacteria 25128
621 Ga0495681_0001170 3300047470 Bacteria 19933
622 Ga0495681_0015002 3300047470 Bacteria 4406
623 Ga0495686_0434768 3300047472 Bacteria 699
624 Ga0495593_0360933 3300047673 Bacteria 726
625 Ga0495602_0424678 3300048088 Bacteria 943
626 Ga0495626_0000067 3300048091 Bacteria 139969
627 Ga0495626_0006295 3300048091 Bacteria 6773
628 Ga0495626_0165075 3300048091 Bacteria 926
629 Ga0496100_0219526 3300048903 Bacteria 1394
630 Ga0496100_0292904 3300048903 Bacteria 1216
631 Ga0496100_0342503 3300048903 Bacteria 1127
632 Ga0496101_0296607 3300048904 Bacteria 1265
633 Ga0496102_0049571 3300048905 Bacteria 3820
634 Ga0496102_0065808 3300048905 Bacteria 3322
635 Ga0496102_0172014 3300048905 Bacteria 2039
636 Ga0496102_0320457 3300048905 Bacteria 1460
637 Ga0496102_0641304 3300048905 Bacteria 985
638 Ga0496103_0109288 3300048906 Bacteria 1755
639 Ga0496103_0347895 3300048906 Bacteria 953
640 Ga0496103_0610647 3300048906 Bacteria 694
641 Ga0496104_0057291 3300048907 Bacteria 3686
642 Ga0496105_0010046 3300048908 Bacteria 7428
643 Ga0496105_0323943 3300048908 Bacteria 1234
644 Ga0496106_0048331 3300048909 Bacteria 3204
645 Ga0496106_0420939 3300048909 Bacteria 1073
646 Ga0496107_0079288 3300048910 Bacteria 2393
647 Ga0496107_0089233 3300048910 Bacteria 2251
648 Ga0496107_0941911 3300048910 Bacteria 628
649 Ga0496108_0018674 3300048911 Bacteria 5681
650 Ga0496108_0080402 3300048911 Bacteria 2760
651 Ga0496108_0896472 3300048911 Bacteria 761
652 Ga0496109_0001072 3300048912 Bacteria 22689
653 Ga0496109_0014915 3300048912 Bacteria 6763
654 Ga0496110_0078265 3300048913 Bacteria 2944
655 Ga0496110_0110524 3300048913 Bacteria 2469
656 Ga0496110_0322353 3300048913 Bacteria 1407
657 Ga0496110_0597113 3300048913 Bacteria 1002
658 Ga0496111_0040397 3300048914 Bacteria 3346
659 Ga0496111_0124538 3300048914 Bacteria 1905
660 Ga0496111_0318577 3300048914 Bacteria 1152
661 Ga0496112_0040329 3300048915 Bacteria 4565
662 Ga0496112_0098618 3300048915 Bacteria 2891
663 Ga0496112_0152673 3300048915 Bacteria 2277
664 Ga0496112_0456399 3300048915 Bacteria 1215
665 Ga0496113_0004347 3300048916 Bacteria 8683
666 Ga0496113_0505259 3300048916 Bacteria 971
667 Ga0496114_0101103 3300048917 Bacteria 2461
668 Ga0496114_0101243 3300048917 Bacteria 2459
669 Ga0496114_0210682 3300048917 Bacteria 1704
670 Ga0496115_0008641 3300048918 Bacteria 7542
671 Ga0496115_0105748 3300048918 Bacteria 2310
672 Ga0496116_0000242 3300048919 Bacteria 99455
673 Ga0496116_0007472 3300048919 Bacteria 9684
674 Ga0496117_0000270 3300048920 Bacteria 97077
675 Ga0496117_0093775 3300048920 Bacteria 1924
676 Ga0496118_0043014 3300048921 Bacteria 3556
677 Ga0496118_0101036 3300048921 Bacteria 1949
678 Ga0496118_0108973 3300048921 Bacteria 1844
679 Ga0496118_0617721 3300048921 Bacteria 515
680 Ga0496121_0000318 3300048924 Bacteria 100833
681 Ga0496121_0001431 3300048924 Bacteria 40302
682 Ga0496121_0003842 3300048924 Bacteria 20894
683 Ga0496121_0598581 3300048924 Bacteria 681
684 Ga0496122_0000517 3300048925 Bacteria 79890
685 Ga0496122_0018570 3300048925 Bacteria 6413
686 Ga0496122_0239956 3300048925 Bacteria 1023
687 Ga0496123_0000243 3300048926 Bacteria 109767
688 Ga0496123_0005798 3300048926 Bacteria 12263
689 Ga0496123_0014129 3300048926 Bacteria 6640
690 Ga0496123_0248984 3300048926 Bacteria 878
691 Ga0496124_0000751 3300048927 Bacteria 53223
692 Ga0496124_0009781 3300048927 Bacteria 9811
693 Ga0496124_0042538 3300048927 Bacteria 3911
694 Ga0496124_0562764 3300048927 Bacteria 750
695 Ga0496125_0338035 3300048928 Bacteria 905
696 Ga0496126_0089688 3300048929 Bacteria 2706
697 Ga0496126_0109567 3300048929 Bacteria 2407
698 Ga0496126_0430335 3300048929 Bacteria 1065
699 Ga0495678_000510 3300049459 Bacteria 37954
700 Ga0495678_002035 3300049459 Bacteria 14480
701 Ga0495678_007465 3300049459 Bacteria 5661
702 Ga0495678_026173 3300049459 Bacteria 2494
703 Ga0495682_0000413 3300049460 Bacteria 30397
704 Ga0495682_0090326 3300049460 Bacteria 1100
705 Ga0501033_0015112 3300049570 Bacteria 5858
706 Ga0501033_0038285 3300049570 Bacteria 3587
707 Ga0501034_0282628 3300049571 Bacteria 1599
708 Ga0501034_1344320 3300049571 Bacteria 590
709 Ga0501038_0030302 3300049574 Bacteria 4789
710 Ga0501038_0946911 3300049574 Bacteria 634
711 Ga0501043_0731533 3300049579 Bacteria 721
712 Ga0501047_0219102 3300049581 Bacteria 1760
713 Ga0501047_0283863 3300049581 Bacteria 1500
714 Ga0501047_0816699 3300049581 Bacteria 747
715 Ga0501076_0328968 3300049592 Bacteria 1254
716 Ga0501227_044144 3300049665 Bacteria 1109
717 Ga0501035_0008321 3300049822 Bacteria 9658
718 Ga0501035_0183376 3300049822 Bacteria 1802
719 Ga0501044_0011238 3300049823 Bacteria 9706
720 Ga0501044_0449883 3300049823 Bacteria 1195
721 Ga0501044_0519598 3300049823 Bacteria 1090
722 Ga0501044_1619598 3300049823 Bacteria 512
723 Ga0501226_000008 3300049853 Bacteria 199119
724 nmdc:mga03n38_304178_c1 3300050490 Bacteria 857
725 nmdc:mga00v17_53855_c1 3300050491 Bacteria 2453
726 nmdc:mga0yw44_14347_c1 3300050492 Bacteria 4206
727 nmdc:mga0yw44_149299_c1 3300050492 Bacteria 1524
728 nmdc:mga0yw44_20308_c1 3300050492 Bacteria 3684
729 nmdc:mga0yw44_20423_c1 3300050492 Bacteria 3675
730 nmdc:mga0yw44_231739_c1 3300050492 Bacteria 1226
731 nmdc:mga0yw44_373041_c1 3300050492 Bacteria 963
732 nmdc:mga06z11_475551_c1 3300050494 Bacteria 756
733 nmdc:mga06z11_828402_c1 3300050494 Bacteria 564
734 nmdc:mga04h51_55881_c1 3300050495 Bacteria 1338
735 nmdc:mga04h51_79937_c1 3300050495 Bacteria 1158
736 nmdc:mga07m45_366288_c1 3300050496 Bacteria 837
737 nmdc:mga05p37_8309_c1 3300050507 Bacteria 12274
738 nmdc:mga09592_1276293_c1 3300050508 Bacteria 604
739 nmdc:mga06r32_191090_c1 3300050510 Bacteria 2035
740 nmdc:mga08y16_75071_c1 3300050511 Bacteria 3524
741 nmdc:mga08y16_86982_c1 3300050511 Bacteria 3256
742 nmdc:mga0n895_1238613_c1 3300050512 Bacteria 719
743 nmdc:mga0n895_124780_c1 3300050512 Bacteria 2598
744 nmdc:mga08x19_61579_c1 3300050514 Bacteria 2432
745 nmdc:mga08x19_650715_c1 3300050514 Bacteria 747
746 Ga0495601_0016682 3300053077 Bacteria 4452
747 Ga0495601_0043456 3300053077 Bacteria 2822
748 Ga0495612_0022629 3300053078 Bacteria 2518
749 Ga0500635_0030792 3300053080 Bacteria 1732
750 Ga0495655_0009483 3300053083 Bacteria 1889
751 Ga0495595_0001461 3300053084 Bacteria 9232
752 Ga0495619_0060061 3300053085 Bacteria 2526
753 Ga0495619_0209617 3300053085 Bacteria 1349
754 Ga0500651_0154621 3300053093 Bacteria 1375
755 Ga0500650_0133192 3300053098 Bacteria 1155
756 Ga0500593_023431 3300053117 Bacteria 2733
757 Ga0500595_187160 3300053119 Bacteria 573
758 Ga0500608_085477 3300053122 Bacteria 1482
759 Ga0500559_0000012 3300053136 Bacteria 164222
760 Ga0500568_0000002 3300053139 Bacteria 880601
761 Ga0500573_0071125 3300053140 Bacteria 1984
762 Ga0500586_150085 3300053145 Bacteria 796
763 Ga0500636_0250802 3300053177 Bacteria 902
764 Ga0500637_0009309 3300053178 Bacteria 4995
765 Ga0500637_0376567 3300053178 Bacteria 746
766 Ga0500645_000469 3300053730 Bacteria 27530
767 Ga0500661_001487 3300055283 Bacteria 4400
768 Ga0500661_015672 3300055283 Bacteria 1358
769 Ga0587073_0146454 3300059492 Bacteria 664
770 Ga0587083_0160926 3300059505 Bacteria 614
771 Ga0587079_060033 3300059647 Bacteria 822
772 Ga0587071_188178 3300060344 Bacteria 534

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042016 Ga0439463_090554 Ga0439463_090554_93_572 128
2 3300005328 Ga0070676_11122110 Ga0070676_111221101 140
3 3300005336 Ga0070680_100124899 Ga0070680_1001248991 140
4 3300005339 Ga0070660_100762924 Ga0070660_1007629241 140
5 3300005356 Ga0070674_100543955 Ga0070674_1005439552 140
6 3300005367 Ga0070667_102066040 Ga0070667_1020660401 140
7 3300005458 Ga0070681_10578418 Ga0070681_105784182 140
8 3300005530 Ga0070679_100017438 Ga0070679_1000174383 140
9 3300005539 Ga0068853_100177218 Ga0068853_1001772182 140
10 3300005548 Ga0070665_101167384 Ga0070665_1011673841 140
11 3300005563 Ga0068855_100046181 Ga0068855_1000461812 140
12 3300006358 Ga0068871_100670937 Ga0068871_1006709372 140
13 3300006881 Ga0068865_100047115 Ga0068865_1000471154 140
14 3300009093 Ga0105240_10079592 Ga0105240_100795923 140
15 3300009093 Ga0105240_10436904 Ga0105240_104369044 140
16 3300009093 Ga0105240_11177781 Ga0105240_111777812 140
17 3300009174 Ga0105241_10373160 Ga0105241_103731601 140
18 3300009174 Ga0105241_10758247 Ga0105241_107582471 140
19 3300009545 Ga0105237_10044603 Ga0105237_100446031 140
20 3300009551 Ga0105238_10051481 Ga0105238_100514814 140
21 3300010375 Ga0105239_10140201 Ga0105239_101402012 140
22 3300013105 Ga0157369_10650949 Ga0157369_106509492 140
23 3300013307 Ga0157372_11360476 Ga0157372_113604761 140
24 3300014325 Ga0163163_10854098 Ga0163163_108540982 140
25 3300014969 Ga0157376_10308476 Ga0157376_103084764 140
26 3300025912 Ga0207707_10256395 Ga0207707_102563952 140
27 3300025913 Ga0207695_10005133 Ga0207695_100051335 140
28 3300025913 Ga0207695_10094384 Ga0207695_100943842 140
29 3300025913 Ga0207695_10621431 Ga0207695_106214312 140
30 3300025914 Ga0207671_10148853 Ga0207671_101488532 140
31 3300025921 Ga0207652_11164911 Ga0207652_111649111 140
32 3300025924 Ga0207694_10098667 Ga0207694_100986672 140
33 3300025924 Ga0207694_10387483 Ga0207694_103874831 140
34 3300025938 Ga0207704_10574844 Ga0207704_105748442 140
35 3300025949 Ga0207667_10103750 Ga0207667_101037503 140
36 3300025986 Ga0207658_11535943 Ga0207658_115359431 140
37 3300026041 Ga0207639_10268333 Ga0207639_102683331 140
38 3300028379 Ga0268266_10197540 Ga0268266_101975404 140
39 3300028800 Ga0265338_10205713 Ga0265338_102057133 140
40 3300031235 Ga0265330_10133376 Ga0265330_101333762 140
41 3300031241 Ga0265325_10001594 Ga0265325_100015945 140
42 3300031250 Ga0265331_10033379 Ga0265331_100333794 140
43 3300031344 Ga0265316_10068870 Ga0265316_100688702 140
44 3300031595 Ga0265313_10011247 Ga0265313_100112479 140
45 3300031711 Ga0265314_10208585 Ga0265314_102085852 140
46 3300037466 Ga0395898_0097924 Ga0395898_0097924_68_490 140
47 3300037471 Ga0395905_0244439 Ga0395905_0244439_581_1003 140
48 3300038443 Ga0395901_0172942 Ga0395901_0172942_1425_1847 140
49 3300046794 Ga0495589_0018291 Ga0495589_0018291_1160_1582 140
50 3300048088 Ga0495602_0424678 Ga0495602_0424678_52_474 140
51 3300048921 Ga0496118_0617721 Ga0496118_0617721_44_466 140
52 3300049570 Ga0501033_0015112 Ga0501033_0015112_5413_5835 140
53 3300049570 Ga0501033_0038285 Ga0501033_0038285_1629_2051 140
54 3300049571 Ga0501034_1344320 Ga0501034_1344320_95_520 140
55 3300049574 Ga0501038_0030302 Ga0501038_0030302_2234_2656 140
56 3300049574 Ga0501038_0946911 Ga0501038_0946911_20_442 140
57 3300049581 Ga0501047_0219102 Ga0501047_0219102_149_571 140
58 3300049581 Ga0501047_0283863 Ga0501047_0283863_360_782 140
59 3300049822 Ga0501035_0008321 Ga0501035_0008321_2011_2433 140
60 3300049822 Ga0501035_0183376 Ga0501035_0183376_1284_1706 140
61 3300049823 Ga0501044_0011238 Ga0501044_0011238_8096_8518 140
62 3300049823 Ga0501044_0519598 Ga0501044_0519598_252_674 140
63 3300003856 Ga0058692_1001767 Ga0058692_10017676 141
64 3300005290 Ga0065712_10088919 Ga0065712_100889193 141
65 3300005329 Ga0070683_100000263 Ga0070683_10000026322 141
66 3300005336 Ga0070680_100133269 Ga0070680_1001332692 141
67 3300005340 Ga0070689_100541207 Ga0070689_1005412071 141
68 3300005435 Ga0070714_100298184 Ga0070714_1002981841 141
69 3300005436 Ga0070713_100034303 Ga0070713_1000343035 141
70 3300005436 Ga0070713_101510749 Ga0070713_1015107491 141
71 3300005467 Ga0070706_100903005 Ga0070706_1009030052 141
72 3300005467 Ga0070706_101656337 Ga0070706_1016563372 141
73 3300005530 Ga0070679_100374494 Ga0070679_1003744942 141
74 3300005530 Ga0070679_100556141 Ga0070679_1005561412 141
75 3300005535 Ga0070684_100004996 Ga0070684_10000499610 141
76 3300005539 Ga0068853_100108458 Ga0068853_1001084583 141
77 3300005563 Ga0068855_100304213 Ga0068855_1003042133 141
78 3300005614 Ga0068856_101997965 Ga0068856_1019979651 141
79 3300005843 Ga0068860_100625520 Ga0068860_1006255201 141
80 3300005983 Ga0081540_1160365 Ga0081540_11603653 141
81 3300006028 Ga0070717_10026052 Ga0070717_100260525 141
82 3300006038 Ga0075365_10045859 Ga0075365_100458591 141
83 3300006038 Ga0075365_10055835 Ga0075365_100558354 141
84 3300006038 Ga0075365_10519755 Ga0075365_105197552 141
85 3300006051 Ga0075364_10307385 Ga0075364_103073852 141
86 3300006163 Ga0070715_10087767 Ga0070715_100877671 141
87 3300006175 Ga0070712_100019927 Ga0070712_1000199272 141
88 3300006847 Ga0075431_100659891 Ga0075431_1006598911 141
89 3300006871 Ga0075434_100537446 Ga0075434_1005374463 141
90 3300007265 Ga0099794_10068552 Ga0099794_100685523 141
91 3300009147 Ga0114129_10341077 Ga0114129_103410772 141
92 3300009147 Ga0114129_10990197 Ga0114129_109901971 141
93 3300009147 Ga0114129_11238620 Ga0114129_112386201 141
94 3300009174 Ga0105241_10920068 Ga0105241_109200682 141
95 3300009551 Ga0105238_10454153 Ga0105238_104541532 141
96 3300009551 Ga0105238_11507084 Ga0105238_115070842 141
97 3300010375 Ga0105239_10764342 Ga0105239_107643422 141
98 3300013100 Ga0157373_10047780 Ga0157373_100477804 141
99 3300013100 Ga0157373_10525281 Ga0157373_105252812 141
100 3300013102 Ga0157371_10091888 Ga0157371_100918882 141
101 3300013105 Ga0157369_10110463 Ga0157369_101104632 141
102 3300013105 Ga0157369_10341863 Ga0157369_103418632 141
103 3300013105 Ga0157369_10605458 Ga0157369_106054582 141
104 3300015261 Ga0182006_1017252 Ga0182006_10172523 141
105 3300021358 Ga0213873_10004171 Ga0213873_100041713 141
106 3300025303 Ga0209051_1008357 Ga0209051_10083574 141
107 3300025898 Ga0207692_10088135 Ga0207692_100881352 141
108 3300025905 Ga0207685_10084454 Ga0207685_100844542 141
109 3300025906 Ga0207699_10699185 Ga0207699_106991851 141
110 3300025909 Ga0207705_10941986 Ga0207705_109419861 141
111 3300025910 Ga0207684_10914017 Ga0207684_109140171 141
112 3300025910 Ga0207684_11561944 Ga0207684_115619441 141
113 3300025915 Ga0207693_10004673 Ga0207693_100046735 141
114 3300025915 Ga0207693_10460319 Ga0207693_104603191 141
115 3300025916 Ga0207663_11333207 Ga0207663_113332071 141
116 3300025917 Ga0207660_10155592 Ga0207660_101555921 141
117 3300025919 Ga0207657_10007091 Ga0207657_100070918 141
118 3300025921 Ga0207652_10316721 Ga0207652_103167212 141
119 3300025928 Ga0207700_10032139 Ga0207700_100321392 141
120 3300025936 Ga0207670_11111440 Ga0207670_111114402 141
121 3300025939 Ga0207665_10103495 Ga0207665_101034953 141
122 3300025944 Ga0207661_10001051 Ga0207661_100010515 141
123 3300025949 Ga0207667_10234293 Ga0207667_102342932 141
124 3300025949 Ga0207667_11443062 Ga0207667_114430621 141
125 3300026041 Ga0207639_10809664 Ga0207639_108096641 141
126 3300026116 Ga0207674_10400244 Ga0207674_104002442 141
127 3300027312 Ga0209371_1000032 Ga0209371_1000032327 141
128 3300028379 Ga0268266_10086781 Ga0268266_100867812 141
129 3300028381 Ga0268264_10586842 Ga0268264_105868421 141
130 3300028381 Ga0268264_11651104 Ga0268264_116511041 141
131 3300028800 Ga0265338_10049552 Ga0265338_100495521 141
132 3300030500 Ga0268256_1000050 Ga0268256_1000050250 141
133 3300031548 Ga0307408_100000028 Ga0307408_100000028183 141
134 3300031711 Ga0265314_10009427 Ga0265314_100094274 141
135 3300032004 Ga0307414_10023320 Ga0307414_100233207 141
136 3300035117 Ga0373953_0034897 Ga0373953_0034897_846_1271 141
137 3300035120 Ga0373957_0050160 Ga0373957_0050160_952_1377 141
138 3300035172 Ga0373955_0051409 Ga0373955_0051409_427_852 141
139 3300035410 Ga0373924_0580013 Ga0373924_0580013_64_489 141
140 3300035724 Ga0373933_0009993 Ga0373933_0009993_2011_2436 141
141 3300036401 Ga0373937_0022169 Ga0373937_0022169_3792_4217 141
142 3300039438 Ga0436360_0592298 Ga0436360_0592298_1653_2078 141
143 3300039447 Ga0436361_0051944 Ga0436361_0051944_926_1351 141
144 3300039453 Ga0436362_0951072 Ga0436362_0951072_1274_1699 141
145 3300041486 Ga0451807_0352186 Ga0451807_0352186_113_538 141
146 3300042006 Ga0439432_006470 Ga0439432_006470_3409_3834 141
147 3300042439 Ga0439464_0003176 Ga0439464_0003176_1299_1724 141
148 3300042439 Ga0439464_0008637 Ga0439464_0008637_783_1208 141
149 3300042439 Ga0439464_0048587 Ga0439464_0048587_421_846 141
150 3300044694 Ga0466963_0822848 Ga0466963_0822848_15_440 141
151 3300046463 Ga0495653_0091857 Ga0495653_0091857_1218_1643 141
152 3300046475 Ga0495639_0541688 Ga0495639_0541688_53_478 141
153 3300046491 Ga0495584_0304970 Ga0495584_0304970_86_511 141
154 3300046507 Ga0495606_0000084 Ga0495606_0000084_84976_85401 141
155 3300046511 Ga0495608_0157050 Ga0495608_0157050_968_1393 141
156 3300046525 Ga0495663_0026053 Ga0495663_0026053_1195_1620 141
157 3300046529 Ga0495652_0822788 Ga0495652_0822788_14_439 141
158 3300046536 Ga0495587_0021388 Ga0495587_0021388_1436_1861 141
159 3300046559 Ga0495667_0040905 Ga0495667_0040905_2029_2454 141
160 3300046615 Ga0495656_0035535 Ga0495656_0035535_1464_1889 141
161 3300046663 Ga0495635_0117825 Ga0495635_0117825_348_773 141
162 3300046675 Ga0495657_0031141 Ga0495657_0031141_1177_1602 141
163 3300046679 Ga0495623_0052450 Ga0495623_0052450_288_713 141
164 3300046691 Ga0495670_0054910 Ga0495670_0054910_129_554 141
165 3300046809 Ga0495600_0020460 Ga0495600_0020460_444_869 141
166 3300047317 Ga0495604_0209638 Ga0495604_0209638_433_858 141
167 3300047444 Ga0495675_0271091 Ga0495675_0271091_416_841 141
168 3300048913 Ga0496110_0597113 Ga0496110_0597113_387_812 141
169 3300048916 Ga0496113_0505259 Ga0496113_0505259_511_936 141
170 3300048924 Ga0496121_0598581 Ga0496121_0598581_142_567 141
171 3300048925 Ga0496122_0239956 Ga0496122_0239956_526_951 141
172 3300048926 Ga0496123_0248984 Ga0496123_0248984_195_620 141
173 3300048929 Ga0496126_0109567 Ga0496126_0109567_779_1204 141
174 3300048929 Ga0496126_0430335 Ga0496126_0430335_155_580 141
175 3300049571 Ga0501034_0282628 Ga0501034_0282628_691_1116 141
176 3300049579 Ga0501043_0731533 Ga0501043_0731533_66_491 141
177 3300049581 Ga0501047_0816699 Ga0501047_0816699_258_683 141
178 3300049592 Ga0501076_0328968 Ga0501076_0328968_35_460 141
179 3300049823 Ga0501044_0449883 Ga0501044_0449883_709_1134 141
180 3300049823 Ga0501044_1619598 Ga0501044_1619598_59_484 141
181 3300050491 nmdc:mga00v17_53855_c1 nmdc:mga00v17_53855_c1_1818_2243 141
182 3300050492 nmdc:mga0yw44_20423_c1 nmdc:mga0yw44_20423_c1_2795_3220 141
183 3300050492 nmdc:mga0yw44_231739_c1 nmdc:mga0yw44_231739_c1_355_780 141
184 3300050492 nmdc:mga0yw44_373041_c1 nmdc:mga0yw44_373041_c1_341_766 141
185 3300050508 nmdc:mga09592_1276293_c1 nmdc:mga09592_1276293_c1_134_559 141
186 3300050512 nmdc:mga0n895_1238613_c1 nmdc:mga0n895_1238613_c1_66_491 141
187 3300053077 Ga0495601_0016682 Ga0495601_0016682_276_701 141
188 3300053078 Ga0495612_0022629 Ga0495612_0022629_1814_2239 141
189 3300053084 Ga0495595_0001461 Ga0495595_0001461_490_915 141
190 3300053085 Ga0495619_0209617 Ga0495619_0209617_434_859 141
191 3300053730 Ga0500645_000469 Ga0500645_000469_16870_17298 141
192 3300001976 JGI24752J21851_1025345 JGI24752J21851_10253452 142
193 3300001989 JGI24739J22299_10044412 JGI24739J22299_100444122 142
194 3300001990 JGI24737J22298_10061775 JGI24737J22298_100617752 142
195 3300002070 JGI24750J21931_1015625 JGI24750J21931_10156251 142
196 3300002073 JGI24745J21846_1029239 JGI24745J21846_10292391 142
197 3300002075 JGI24738J21930_10012000 JGI24738J21930_100120001 142
198 3300002077 JGI24744J21845_10030291 JGI24744J21845_100302912 142
199 3300002239 JGI24034J26672_10088205 JGI24034J26672_100882051 142
200 3300002459 JGI24751J29686_10007457 JGI24751J29686_100074571 142
201 3300002737 JGI25162J39368_1000219 JGI25162J39368_100021940 142
202 3300002771 JGI25163J39215_1000823 JGI25163J39215_10008236 142
203 3300002771 JGI25163J39215_1000834 JGI25163J39215_10008347 142
204 3300002772 JGI25164J39214_1000175 JGI25164J39214_100017539 142
205 3300002772 JGI25164J39214_1000357 JGI25164J39214_10003575 142
206 3300003214 JGI25165J46597_1000175 JGI25165J46597_100017574 142
207 3300003214 JGI25165J46597_1000193 JGI25165J46597_100019369 142
208 3300003791 Ga0055530_10000159 Ga0055530_1000015938 142
209 3300003792 Ga0055540_1000725 Ga0055540_10007252 142
210 3300004803 Ga0058862_12223391 Ga0058862_122233911 142
211 3300005288 Ga0065714_10067824 Ga0065714_100678245 142
212 3300005288 Ga0065714_10143055 Ga0065714_101430552 142
213 3300005289 Ga0065704_10273505 Ga0065704_102735052 142
214 3300005330 Ga0070690_100239646 Ga0070690_1002396462 142
215 3300005331 Ga0070670_100232450 Ga0070670_1002324502 142
216 3300005331 Ga0070670_100437988 Ga0070670_1004379881 142
217 3300005335 Ga0070666_10085241 Ga0070666_100852412 142
218 3300005335 Ga0070666_10969083 Ga0070666_109690831 142
219 3300005336 Ga0070680_100013453 Ga0070680_1000134538 142
220 3300005336 Ga0070680_100877116 Ga0070680_1008771162 142
221 3300005337 Ga0070682_100046230 Ga0070682_1000462304 142
222 3300005338 Ga0068868_100019489 Ga0068868_1000194895 142
223 3300005339 Ga0070660_101243358 Ga0070660_1012433581 142
224 3300005340 Ga0070689_100199650 Ga0070689_1001996501 142
225 3300005343 Ga0070687_100279908 Ga0070687_1002799082 142
226 3300005345 Ga0070692_10140811 Ga0070692_101408112 142
227 3300005347 Ga0070668_100388968 Ga0070668_1003889682 142
228 3300005347 Ga0070668_101855242 Ga0070668_1018552421 142
229 3300005354 Ga0070675_100112311 Ga0070675_1001123114 142
230 3300005365 Ga0070688_100019851 Ga0070688_1000198514 142
231 3300005366 Ga0070659_100361501 Ga0070659_1003615012 142
232 3300005434 Ga0070709_11574271 Ga0070709_115742711 142
233 3300005437 Ga0070710_11173123 Ga0070710_111731231 142
234 3300005438 Ga0070701_10253487 Ga0070701_102534872 142
235 3300005440 Ga0070705_100125536 Ga0070705_1001255362 142
236 3300005441 Ga0070700_100010193 Ga0070700_1000101935 142
237 3300005444 Ga0070694_100131149 Ga0070694_1001311492 142
238 3300005455 Ga0070663_100194130 Ga0070663_1001941301 142
239 3300005455 Ga0070663_100407557 Ga0070663_1004075572 142
240 3300005456 Ga0070678_100414740 Ga0070678_1004147402 142
241 3300005457 Ga0070662_100419730 Ga0070662_1004197301 142
242 3300005458 Ga0070681_10199302 Ga0070681_101993023 142
243 3300005459 Ga0068867_100031608 Ga0068867_1000316084 142
244 3300005466 Ga0070685_10017568 Ga0070685_100175684 142
245 3300005530 Ga0070679_100011942 Ga0070679_1000119423 142
246 3300005530 Ga0070679_100303496 Ga0070679_1003034961 142
247 3300005530 Ga0070679_101713278 Ga0070679_1017132781 142
248 3300005535 Ga0070684_100023697 Ga0070684_1000236975 142
249 3300005535 Ga0070684_100421689 Ga0070684_1004216891 142
250 3300005543 Ga0070672_100595364 Ga0070672_1005953642 142
251 3300005547 Ga0070693_100509832 Ga0070693_1005098321 142
252 3300005548 Ga0070665_100001096 Ga0070665_10000109617 142
253 3300005548 Ga0070665_100021887 Ga0070665_1000218875 142
254 3300005549 Ga0070704_100212767 Ga0070704_1002127672 142
255 3300005563 Ga0068855_100000864 Ga0068855_10000086414 142
256 3300005563 Ga0068855_101594534 Ga0068855_1015945341 142
257 3300005564 Ga0070664_100178286 Ga0070664_1001782861 142
258 3300005614 Ga0068856_100342271 Ga0068856_1003422712 142
259 3300005615 Ga0070702_100023459 Ga0070702_1000234594 142
260 3300005617 Ga0068859_100071130 Ga0068859_1000711302 142
261 3300005718 Ga0068866_10048567 Ga0068866_100485672 142
262 3300005719 Ga0068861_100024510 Ga0068861_1000245104 142
263 3300005840 Ga0068870_10021857 Ga0068870_100218573 142
264 3300005841 Ga0068863_100169063 Ga0068863_1001690632 142
265 3300005842 Ga0068858_100202545 Ga0068858_1002025452 142
266 3300005843 Ga0068860_100219620 Ga0068860_1002196202 142
267 3300005844 Ga0068862_100319867 Ga0068862_1003198672 142
268 3300006038 Ga0075365_10012970 Ga0075365_100129702 142
269 3300006038 Ga0075365_10050058 Ga0075365_100500582 142
270 3300006038 Ga0075365_10075051 Ga0075365_100750512 142
271 3300006048 Ga0075363_100374683 Ga0075363_1003746832 142
272 3300006048 Ga0075363_100843408 Ga0075363_1008434082 142
273 3300006058 Ga0075432_10002880 Ga0075432_100028802 142
274 3300006163 Ga0070715_10087878 Ga0070715_100878782 142
275 3300006186 Ga0075369_10224211 Ga0075369_102242111 142
276 3300006237 Ga0097621_100098648 Ga0097621_1000986482 142
277 3300006237 Ga0097621_100727441 Ga0097621_1007274411 142
278 3300006358 Ga0068871_100043906 Ga0068871_1000439064 142
279 3300006358 Ga0068871_100420306 Ga0068871_1004203062 142
280 3300006844 Ga0075428_100017465 Ga0075428_1000174655 142
281 3300006844 Ga0075428_102406712 Ga0075428_1024067121 142
282 3300006847 Ga0075431_100226723 Ga0075431_1002267233 142
283 3300006881 Ga0068865_100066208 Ga0068865_1000662082 142
284 3300006914 Ga0075436_100023659 Ga0075436_1000236594 142
285 3300006931 Ga0097620_100071126 Ga0097620_1000711262 142
286 3300009011 Ga0105251_10000068 Ga0105251_1000006827 142
287 3300009011 Ga0105251_10001441 Ga0105251_100014417 142
288 3300009011 Ga0105251_10026993 Ga0105251_100269934 142
289 3300009036 Ga0105244_10106077 Ga0105244_101060772 142
290 3300009092 Ga0105250_10040925 Ga0105250_100409252 142
291 3300009093 Ga0105240_10002346 Ga0105240_1000234613 142
292 3300009093 Ga0105240_10044867 Ga0105240_100448676 142
293 3300009093 Ga0105240_10382137 Ga0105240_103821371 142
294 3300009094 Ga0111539_10762432 Ga0111539_107624322 142
295 3300009098 Ga0105245_12567754 Ga0105245_125677541 142
296 3300009101 Ga0105247_10011015 Ga0105247_100110152 142
297 3300009148 Ga0105243_10000075 Ga0105243_1000007542 142
298 3300009148 Ga0105243_10008056 Ga0105243_100080562 142
299 3300009148 Ga0105243_10128441 Ga0105243_101284412 142
300 3300009174 Ga0105241_11257498 Ga0105241_112574981 142
301 3300009176 Ga0105242_10102407 Ga0105242_101024074 142
302 3300009545 Ga0105237_10042538 Ga0105237_100425382 142
303 3300009545 Ga0105237_10167677 Ga0105237_101676771 142
304 3300009545 Ga0105237_10275599 Ga0105237_102755992 142
305 3300009545 Ga0105237_10793015 Ga0105237_107930151 142
306 3300009551 Ga0105238_10096225 Ga0105238_100962253 142
307 3300009551 Ga0105238_10240552 Ga0105238_102405523 142
308 3300009553 Ga0105249_10021961 Ga0105249_100219618 142
309 3300009553 Ga0105249_10408900 Ga0105249_104089002 142
310 3300010375 Ga0105239_10039857 Ga0105239_100398574 142
311 3300010375 Ga0105239_10417763 Ga0105239_104177632 142
312 3300010375 Ga0105239_10549968 Ga0105239_105499682 142
313 3300011119 Ga0105246_10199646 Ga0105246_101996462 142
314 3300013100 Ga0157373_11366187 Ga0157373_113661871 142
315 3300013102 Ga0157371_10001263 Ga0157371_100012637 142
316 3300013104 Ga0157370_10155314 Ga0157370_101553143 142
317 3300013105 Ga0157369_10406448 Ga0157369_104064482 142
318 3300013296 Ga0157374_10099656 Ga0157374_100996562 142
319 3300013296 Ga0157374_10135288 Ga0157374_101352882 142
320 3300013297 Ga0157378_10534885 Ga0157378_105348852 142
321 3300013306 Ga0163162_10140237 Ga0163162_101402372 142
322 3300013307 Ga0157372_11493887 Ga0157372_114938872 142
323 3300014325 Ga0163163_10785643 Ga0163163_107856431 142
324 3300014325 Ga0163163_13098522 Ga0163163_130985221 142
325 3300014326 Ga0157380_11520624 Ga0157380_115206242 142
326 3300014497 Ga0182008_10000367 Ga0182008_100003677 142
327 3300014497 Ga0182008_10084657 Ga0182008_100846572 142
328 3300014745 Ga0157377_10047696 Ga0157377_100476963 142
329 3300014968 Ga0157379_10079167 Ga0157379_100791672 142
330 3300014968 Ga0157379_11183755 Ga0157379_111837552 142
331 3300014969 Ga0157376_10196836 Ga0157376_101968362 142
332 3300017792 Ga0163161_10048658 Ga0163161_100486584 142
333 3300020070 Ga0206356_11524923 Ga0206356_115249231 142
334 3300020078 Ga0206352_10477851 Ga0206352_104778511 142
335 3300020080 Ga0206350_10752306 Ga0206350_107523061 142
336 3300020082 Ga0206353_10249946 Ga0206353_102499461 142
337 3300025207 Ga0209760_100020 Ga0209760_10002025 142
338 3300025207 Ga0209760_100082 Ga0209760_1000829 142
339 3300025231 Ga0207427_100005 Ga0207427_100005674 142
340 3300025231 Ga0207427_100006 Ga0207427_10000673 142
341 3300025233 Ga0209437_100013 Ga0209437_10001373 142
342 3300025233 Ga0209437_100018 Ga0209437_100018584 142
343 3300025256 Ga0209759_1001572 Ga0209759_10015725 142
344 3300025256 Ga0209759_1020334 Ga0209759_10203342 142
345 3300025261 Ga0209233_1000021 Ga0209233_1000021674 142
346 3300025261 Ga0209233_1000022 Ga0209233_100002273 142
347 3300025284 Ga0209130_1056706 Ga0209130_10567061 142
348 3300025292 Ga0209676_1000222 Ga0209676_100022278 142
349 3300025298 Ga0209050_1000296 Ga0209050_100029678 142
350 3300025303 Ga0209051_1000295 Ga0209051_10002952 142
351 3300025728 Ga0207655_1000135 Ga0207655_100013564 142
352 3300025728 Ga0207655_1002411 Ga0207655_100241112 142
353 3300025735 Ga0207713_1000103 Ga0207713_100010359 142
354 3300025735 Ga0207713_1002728 Ga0207713_10027287 142
355 3300025899 Ga0207642_10004044 Ga0207642_100040444 142
356 3300025900 Ga0207710_10009561 Ga0207710_100095614 142
357 3300025901 Ga0207688_10028197 Ga0207688_100281972 142
358 3300025901 Ga0207688_10481329 Ga0207688_104813292 142
359 3300025903 Ga0207680_10074756 Ga0207680_100747562 142
360 3300025904 Ga0207647_10034457 Ga0207647_100344571 142
361 3300025907 Ga0207645_10014566 Ga0207645_100145665 142
362 3300025908 Ga0207643_10030491 Ga0207643_100304914 142
363 3300025913 Ga0207695_10013476 Ga0207695_100134769 142
364 3300025913 Ga0207695_10014260 Ga0207695_100142606 142
365 3300025913 Ga0207695_10021679 Ga0207695_100216796 142
366 3300025914 Ga0207671_10049367 Ga0207671_100493672 142
367 3300025914 Ga0207671_10166274 Ga0207671_101662742 142
368 3300025914 Ga0207671_10469368 Ga0207671_104693682 142
369 3300025914 Ga0207671_10495829 Ga0207671_104958292 142
370 3300025916 Ga0207663_10069742 Ga0207663_100697421 142
371 3300025917 Ga0207660_10011193 Ga0207660_100111935 142
372 3300025918 Ga0207662_10185203 Ga0207662_101852032 142
373 3300025919 Ga0207657_10094810 Ga0207657_100948104 142
374 3300025920 Ga0207649_10216147 Ga0207649_102161472 142
375 3300025921 Ga0207652_10054008 Ga0207652_100540082 142
376 3300025921 Ga0207652_10266973 Ga0207652_102669731 142
377 3300025921 Ga0207652_11147904 Ga0207652_111479042 142
378 3300025924 Ga0207694_10087928 Ga0207694_100879282 142
379 3300025925 Ga0207650_10005007 Ga0207650_100050074 142
380 3300025926 Ga0207659_10530156 Ga0207659_105301561 142
381 3300025926 Ga0207659_11578413 Ga0207659_115784131 142
382 3300025927 Ga0207687_10023734 Ga0207687_100237342 142
383 3300025928 Ga0207700_10014790 Ga0207700_100147902 142
384 3300025933 Ga0207706_10085584 Ga0207706_100855842 142
385 3300025934 Ga0207686_10046064 Ga0207686_100460642 142
386 3300025935 Ga0207709_10000269 Ga0207709_1000026945 142
387 3300025935 Ga0207709_10004904 Ga0207709_100049042 142
388 3300025935 Ga0207709_10027842 Ga0207709_100278422 142
389 3300025935 Ga0207709_10070325 Ga0207709_100703253 142
390 3300025936 Ga0207670_10145300 Ga0207670_101453003 142
391 3300025940 Ga0207691_10012861 Ga0207691_100128615 142
392 3300025941 Ga0207711_10084825 Ga0207711_100848254 142
393 3300025945 Ga0207679_10109463 Ga0207679_101094631 142
394 3300025949 Ga0207667_10008319 Ga0207667_100083199 142
395 3300025960 Ga0207651_11000103 Ga0207651_110001032 142
396 3300025961 Ga0207712_10031539 Ga0207712_100315396 142
397 3300025961 Ga0207712_10062056 Ga0207712_100620562 142
398 3300025972 Ga0207668_10227836 Ga0207668_102278362 142
399 3300025981 Ga0207640_10073028 Ga0207640_100730283 142
400 3300025986 Ga0207658_10124884 Ga0207658_101248842 142
401 3300025986 Ga0207658_10417866 Ga0207658_104178661 142
402 3300026023 Ga0207677_10057915 Ga0207677_100579152 142
403 3300026035 Ga0207703_10234808 Ga0207703_102348082 142
404 3300026041 Ga0207639_10455088 Ga0207639_104550882 142
405 3300026067 Ga0207678_10054141 Ga0207678_100541412 142
406 3300026075 Ga0207708_10015207 Ga0207708_100152072 142
407 3300026089 Ga0207648_10001979 Ga0207648_100019795 142
408 3300026095 Ga0207676_10159670 Ga0207676_101596702 142
409 3300026116 Ga0207674_10191341 Ga0207674_101913412 142
410 3300026118 Ga0207675_100025355 Ga0207675_1000253554 142
411 3300026121 Ga0207683_10038505 Ga0207683_100385052 142
412 3300026142 Ga0207698_10167884 Ga0207698_101678842 142
413 3300026142 Ga0207698_10835255 Ga0207698_108352552 142
414 3300026142 Ga0207698_11646952 Ga0207698_116469521 142
415 3300027111 Ga0209281_1000091 Ga0209281_1000091195 142
416 3300027866 Ga0209813_10052421 Ga0209813_100524212 142
417 3300027866 Ga0209813_10067027 Ga0209813_100670271 142
418 3300027907 Ga0207428_10371206 Ga0207428_103712061 142
419 3300028379 Ga0268266_10000159 Ga0268266_1000015933 142
420 3300028379 Ga0268266_10022361 Ga0268266_100223613 142
421 3300028379 Ga0268266_10116245 Ga0268266_101162452 142
422 3300028380 Ga0268265_10138337 Ga0268265_101383372 142
423 3300028786 Ga0307517_10411909 Ga0307517_104119091 142
424 3300028794 Ga0307515_10671684 Ga0307515_106716841 142
425 3300030521 Ga0307511_10000028 Ga0307511_1000002815 142
426 3300030521 Ga0307511_10067948 Ga0307511_100679481 142
427 3300030521 Ga0307511_10103544 Ga0307511_101035442 142
428 3300031250 Ga0265331_10016868 Ga0265331_100168682 142
429 3300031250 Ga0265331_10540687 Ga0265331_105406871 142
430 3300031507 Ga0307509_10556846 Ga0307509_105568461 142
431 3300031616 Ga0307508_10774739 Ga0307508_107747391 142
432 3300033180 Ga0307510_10229940 Ga0307510_102299402 142
433 3300035111 Ga0373923_0131074 Ga0373923_0131074_402_830 142
434 3300035112 Ga0373932_0218218 Ga0373932_0218218_123_554 142
435 3300035113 Ga0373936_0306270 Ga0373936_0306270_218_646 142
436 3300035120 Ga0373957_0416837 Ga0373957_0416837_129_557 142
437 3300035692 Ga0373935_0070547 Ga0373935_0070547_1597_2025 142
438 3300037068 Ga0373925_0029840 Ga0373925_0029840_1418_1846 142
439 3300041407 Ga0439447_051133 Ga0439447_051133_311_742 142
440 3300041410 Ga0439461_0040096 Ga0439461_0040096_464_895 142
441 3300041411 Ga0439466_0000697 Ga0439466_0000697_3866_4297 142
442 3300041456 Ga0451795_1176480 Ga0451795_1176480_828_1340 142
443 3300041486 Ga0451807_2174716 Ga0451807_2174716_404_832 142
444 3300042000 Ga0439437_007132 Ga0439437_007132_786_1217 142
445 3300042006 Ga0439432_003995 Ga0439432_003995_521_952 142
446 3300042009 Ga0439451_045285 Ga0439451_045285_109_540 142
447 3300042010 Ga0439452_003511 Ga0439452_003511_4703_5134 142
448 3300042010 Ga0439452_021061 Ga0439452_021061_233_664 142
449 3300042012 Ga0439455_0031217 Ga0439455_0031217_707_1138 142
450 3300042013 Ga0439456_001509 Ga0439456_001509_537_1058 142
451 3300042013 Ga0439456_009962 Ga0439456_009962_457_888 142
452 3300042013 Ga0439456_018372 Ga0439456_018372_240_671 142
453 3300042016 Ga0439463_000065 Ga0439463_000065_10640_11071 142
454 3300042016 Ga0439463_000640 Ga0439463_000640_5444_5875 142
455 3300042115 Ga0450911_000055 Ga0450911_000055_5394_5825 142
456 3300042115 Ga0450911_033868 Ga0450911_033868_52_483 142
457 3300042120 Ga0450917_001876 Ga0450917_001876_1019_1450 142
458 3300042139 Ga0450904_000368 Ga0450904_000368_3535_3966 142
459 3300042142 Ga0450905_021833 Ga0450905_021833_305_736 142
460 3300042145 Ga0450906_053331 Ga0450906_053331_90_521 142
461 3300042156 Ga0439446_0001744 Ga0439446_0001744_2937_3368 142
462 3300042438 Ga0439459_0062860 Ga0439459_0062860_362_793 142
463 3300042530 Ga0450916_007552 Ga0450916_007552_754_1185 142
464 3300042532 Ga0450893_0000923 Ga0450893_0000923_2820_3251 142
465 3300042993 Ga0439440_0000879 Ga0439440_0000879_2333_2764 142
466 3300044656 Ga0466969_0003690 Ga0466969_0003690_1776_2207 142
467 3300044658 Ga0466972_0132793 Ga0466972_0132793_539_970 142
468 3300044684 Ga0466966_0056001 Ga0466966_0056001_1164_1595 142
469 3300045049 Ga0466959_0023434 Ga0466959_0023434_2431_2862 142
470 3300046452 Ga0495617_000380 Ga0495617_000380_11483_11914 142
471 3300046452 Ga0495617_014471 Ga0495617_014471_2163_2594 142
472 3300046452 Ga0495617_018659 Ga0495617_018659_586_1017 142
473 3300046453 Ga0495627_000296 Ga0495627_000296_31260_31691 142
474 3300046453 Ga0495627_007017 Ga0495627_007017_1351_1782 142
475 3300046453 Ga0495627_121323 Ga0495627_121323_202_633 142
476 3300046457 Ga0495590_0012679 Ga0495590_0012679_2011_2442 142
477 3300046458 Ga0495591_000164 Ga0495591_000164_53960_54391 142
478 3300046458 Ga0495591_000344 Ga0495591_000344_34398_34829 142
479 3300046458 Ga0495591_004911 Ga0495591_004911_1352_1783 142
480 3300046458 Ga0495591_005358 Ga0495591_005358_2385_2816 142
481 3300046458 Ga0495591_009013 Ga0495591_009013_3510_3941 142
482 3300046458 Ga0495591_018968 Ga0495591_018968_775_1206 142
483 3300046460 Ga0495638_0045171 Ga0495638_0045171_1349_1780 142
484 3300046460 Ga0495638_0053112 Ga0495638_0053112_1703_2134 142
485 3300046460 Ga0495638_0136375 Ga0495638_0136375_822_1253 142
486 3300046460 Ga0495638_0165539 Ga0495638_0165539_808_1239 142
487 3300046471 Ga0495650_0000402 Ga0495650_0000402_34190_34621 142
488 3300046471 Ga0495650_0006144 Ga0495650_0006144_2995_3426 142
489 3300046471 Ga0495650_0007734 Ga0495650_0007734_4633_5064 142
490 3300046473 Ga0495582_0017955 Ga0495582_0017955_2979_3407 142
491 3300046474 Ga0495605_0000302 Ga0495605_0000302_50359_50790 142
492 3300046474 Ga0495605_0000316 Ga0495605_0000316_13939_14370 142
493 3300046474 Ga0495605_0000813 Ga0495605_0000813_17215_17646 142
494 3300046474 Ga0495605_0001296 Ga0495605_0001296_1517_1948 142
495 3300046474 Ga0495605_0007839 Ga0495605_0007839_3492_3923 142
496 3300046474 Ga0495605_0010401 Ga0495605_0010401_1026_1457 142
497 3300046474 Ga0495605_0010763 Ga0495605_0010763_3314_3745 142
498 3300046474 Ga0495605_0230157 Ga0495605_0230157_258_689 142
499 3300046474 Ga0495605_0260902 Ga0495605_0260902_180_611 142
500 3300046474 Ga0495605_0272638 Ga0495605_0272638_239_670 142
501 3300046475 Ga0495639_0087624 Ga0495639_0087624_396_824 142
502 3300046476 Ga0495662_0265452 Ga0495662_0265452_232_660 142
503 3300046491 Ga0495584_0013224 Ga0495584_0013224_2759_3190 142
504 3300046491 Ga0495584_0015365 Ga0495584_0015365_1887_2318 142
505 3300046491 Ga0495584_0146184 Ga0495584_0146184_376_804 142
506 3300046491 Ga0495584_0321154 Ga0495584_0321154_46_477 142
507 3300046492 Ga0495585_0021381 Ga0495585_0021381_2722_3153 142
508 3300046492 Ga0495585_0038473 Ga0495585_0038473_1006_1470 142
509 3300046492 Ga0495585_0116338 Ga0495585_0116338_979_1407 142
510 3300046492 Ga0495585_0300004 Ga0495585_0300004_109_540 142
511 3300046499 Ga0495594_0017748 Ga0495594_0017748_1209_1637 142
512 3300046500 Ga0495596_0060506 Ga0495596_0060506_972_1403 142
513 3300046501 Ga0495607_0000268 Ga0495607_0000268_39374_39805 142
514 3300046501 Ga0495607_0000365 Ga0495607_0000365_21777_22208 142
515 3300046501 Ga0495607_0000762 Ga0495607_0000762_11561_11992 142
516 3300046501 Ga0495607_0002401 Ga0495607_0002401_2272_2703 142
517 3300046501 Ga0495607_0015307 Ga0495607_0015307_1968_2399 142
518 3300046501 Ga0495607_0036943 Ga0495607_0036943_1460_1891 142
519 3300046501 Ga0495607_0052223 Ga0495607_0052223_1042_1473 142
520 3300046501 Ga0495607_0137583 Ga0495607_0137583_755_1186 142
521 3300046501 Ga0495607_0161577 Ga0495607_0161577_672_1100 142
522 3300046501 Ga0495607_0252004 Ga0495607_0252004_306_737 142
523 3300046501 Ga0495607_0377139 Ga0495607_0377139_141_572 142
524 3300046506 Ga0495583_0000409 Ga0495583_0000409_23046_23477 142
525 3300046506 Ga0495583_0004250 Ga0495583_0004250_5134_5565 142
526 3300046506 Ga0495583_0004296 Ga0495583_0004296_2078_2509 142
527 3300046506 Ga0495583_0004393 Ga0495583_0004393_5352_5783 142
528 3300046506 Ga0495583_0006517 Ga0495583_0006517_2553_2984 142
529 3300046506 Ga0495583_0011885 Ga0495583_0011885_498_929 142
530 3300046507 Ga0495606_0000115 Ga0495606_0000115_72649_73080 142
531 3300046507 Ga0495606_0000285 Ga0495606_0000285_62599_63030 142
532 3300046507 Ga0495606_0004641 Ga0495606_0004641_10706_11137 142
533 3300046512 Ga0495610_0010122 Ga0495610_0010122_1766_2197 142
534 3300046512 Ga0495610_0027408 Ga0495610_0027408_589_1020 142
535 3300046513 Ga0495616_0001775 Ga0495616_0001775_12638_13069 142
536 3300046513 Ga0495616_0007207 Ga0495616_0007207_770_1201 142
537 3300046515 Ga0495620_0000376 Ga0495620_0000376_19889_20320 142
538 3300046515 Ga0495620_0069093 Ga0495620_0069093_518_949 142
539 3300046517 Ga0495630_0120098 Ga0495630_0120098_611_1039 142
540 3300046517 Ga0495630_0129671 Ga0495630_0129671_831_1259 142
541 3300046518 Ga0495631_0002659 Ga0495631_0002659_4652_5083 142
542 3300046518 Ga0495631_0009813 Ga0495631_0009813_3958_4389 142
543 3300046518 Ga0495631_0314937 Ga0495631_0314937_91_519 142
544 3300046519 Ga0495632_0000952 Ga0495632_0000952_11512_11943 142
545 3300046519 Ga0495632_0004049 Ga0495632_0004049_3037_3468 142
546 3300046519 Ga0495632_0011397 Ga0495632_0011397_4473_4904 142
547 3300046519 Ga0495632_0014524 Ga0495632_0014524_2400_2831 142
548 3300046519 Ga0495632_0111591 Ga0495632_0111591_41_472 142
549 3300046519 Ga0495632_0206563 Ga0495632_0206563_122_553 142
550 3300046520 Ga0495637_0000054 Ga0495637_0000054_24119_24550 142
551 3300046520 Ga0495637_0001318 Ga0495637_0001318_4424_4855 142
552 3300046520 Ga0495637_0004745 Ga0495637_0004745_5531_5962 142
553 3300046520 Ga0495637_0005807 Ga0495637_0005807_2522_2953 142
554 3300046520 Ga0495637_0025174 Ga0495637_0025174_1894_2325 142
555 3300046520 Ga0495637_0161772 Ga0495637_0161772_237_668 142
556 3300046520 Ga0495637_0369267 Ga0495637_0369267_28_456 142
557 3300046522 Ga0495643_0010329 Ga0495643_0010329_2291_2722 142
558 3300046522 Ga0495643_0060533 Ga0495643_0060533_258_689 142
559 3300046522 Ga0495643_0069977 Ga0495643_0069977_835_1266 142
560 3300046523 Ga0495644_0000830 Ga0495644_0000830_11170_11601 142
561 3300046523 Ga0495644_0002746 Ga0495644_0002746_2177_2608 142
562 3300046524 Ga0495648_0002978 Ga0495648_0002978_10648_11079 142
563 3300046524 Ga0495648_0010691 Ga0495648_0010691_2574_3005 142
564 3300046524 Ga0495648_0061037 Ga0495648_0061037_1779_2210 142
565 3300046526 Ga0495666_0218711 Ga0495666_0218711_99_527 142
566 3300046528 Ga0495642_0000824 Ga0495642_0000824_11508_11939 142
567 3300046530 Ga0495654_0003754 Ga0495654_0003754_5101_5532 142
568 3300046530 Ga0495654_0013167 Ga0495654_0013167_3609_4040 142
569 3300046530 Ga0495654_0019147 Ga0495654_0019147_1542_2006 142
570 3300046530 Ga0495654_0032890 Ga0495654_0032890_1659_2090 142
571 3300046530 Ga0495654_0036512 Ga0495654_0036512_1687_2118 142
572 3300046530 Ga0495654_0042046 Ga0495654_0042046_1656_2087 142
573 3300046537 Ga0495598_0090404 Ga0495598_0090404_401_829 142
574 3300046538 Ga0495609_0000061 Ga0495609_0000061_75028_75459 142
575 3300046538 Ga0495609_0000100 Ga0495609_0000100_50441_50872 142
576 3300046538 Ga0495609_0000756 Ga0495609_0000756_11768_12199 142
577 3300046538 Ga0495609_0056203 Ga0495609_0056203_971_1402 142
578 3300046538 Ga0495609_0065176 Ga0495609_0065176_836_1267 142
579 3300046539 Ga0495621_0135109 Ga0495621_0135109_277_705 142
580 3300046542 Ga0495597_0000121 Ga0495597_0000121_53979_54410 142
581 3300046542 Ga0495597_0004514 Ga0495597_0004514_5328_5759 142
582 3300046542 Ga0495597_0016759 Ga0495597_0016759_546_977 142
583 3300046542 Ga0495597_0119652 Ga0495597_0119652_180_611 142
584 3300046557 Ga0495622_0023789 Ga0495622_0023789_1746_2174 142
585 3300046557 Ga0495622_0097739 Ga0495622_0097739_96_569 142
586 3300046557 Ga0495622_0197102 Ga0495622_0197102_436_867 142
587 3300046559 Ga0495667_0227325 Ga0495667_0227325_562_993 142
588 3300046615 Ga0495656_0017067 Ga0495656_0017067_1677_2108 142
589 3300046615 Ga0495656_0802309 Ga0495656_0802309_44_472 142
590 3300046616 Ga0495668_0025762 Ga0495668_0025762_219_650 142
591 3300046616 Ga0495668_0045844 Ga0495668_0045844_879_1310 142
592 3300046616 Ga0495668_0047143 Ga0495668_0047143_213_644 142
593 3300046642 Ga0495634_0464057 Ga0495634_0464057_200_628 142
594 3300046648 Ga0495611_0001663 Ga0495611_0001663_4440_4871 142
595 3300046648 Ga0495611_0002835 Ga0495611_0002835_4132_4563 142
596 3300046648 Ga0495611_0010434 Ga0495611_0010434_83_514 142
597 3300046648 Ga0495611_0310019 Ga0495611_0310019_92_523 142
598 3300046660 Ga0495625_0000147 Ga0495625_0000147_75168_75599 142
599 3300046660 Ga0495625_0002431 Ga0495625_0002431_736_1167 142
600 3300046660 Ga0495625_0028100 Ga0495625_0028100_3644_4075 142
601 3300046663 Ga0495635_0427352 Ga0495635_0427352_311_811 142
602 3300046664 Ga0495659_0155962 Ga0495659_0155962_42_470 142
603 3300046665 Ga0495661_0000153 Ga0495661_0000153_75201_75632 142
604 3300046665 Ga0495661_0000315 Ga0495661_0000315_49080_49511 142
605 3300046665 Ga0495661_0011035 Ga0495661_0011035_2358_2789 142
606 3300046665 Ga0495661_0017783 Ga0495661_0017783_2095_2526 142
607 3300046681 Ga0495647_0013135 Ga0495647_0013135_82_510 142
608 3300046684 Ga0495669_0017432 Ga0495669_0017432_2305_2736 142
609 3300046691 Ga0495670_0008294 Ga0495670_0008294_956_1387 142
610 3300046691 Ga0495670_0129738 Ga0495670_0129738_781_1212 142
611 3300046691 Ga0495670_0176228 Ga0495670_0176228_680_1108 142
612 3300046692 Ga0495671_0006513 Ga0495671_0006513_3686_4117 142
613 3300046692 Ga0495671_0008015 Ga0495671_0008015_2338_2769 142
614 3300046692 Ga0495671_0257764 Ga0495671_0257764_113_544 142
615 3300046692 Ga0495671_0305644 Ga0495671_0305644_284_712 142
616 3300046694 Ga0495649_0000686 Ga0495649_0000686_5260_5691 142
617 3300046694 Ga0495649_0002690 Ga0495649_0002690_182_613 142
618 3300046694 Ga0495649_0107230 Ga0495649_0107230_656_1087 142
619 3300046694 Ga0495649_0162840 Ga0495649_0162840_288_719 142
620 3300046694 Ga0495649_0283466 Ga0495649_0283466_306_737 142
621 3300046794 Ga0495589_0011002 Ga0495589_0011002_2733_3164 142
622 3300046794 Ga0495589_0088343 Ga0495589_0088343_996_1427 142
623 3300046810 Ga0495660_0000813 Ga0495660_0000813_6281_6712 142
624 3300046810 Ga0495660_0001072 Ga0495660_0001072_12896_13327 142
625 3300046810 Ga0495660_0002689 Ga0495660_0002689_1557_1988 142
626 3300046810 Ga0495660_0017784 Ga0495660_0017784_1764_2195 142
627 3300046810 Ga0495660_0036756 Ga0495660_0036756_1256_1687 142
628 3300046810 Ga0495660_0133744 Ga0495660_0133744_283_714 142
629 3300046810 Ga0495660_0170790 Ga0495660_0170790_119_550 142
630 3300046810 Ga0495660_0467728 Ga0495660_0467728_73_501 142
631 3300047315 Ga0495581_0180106 Ga0495581_0180106_717_1145 142
632 3300047318 Ga0495636_0000767 Ga0495636_0000767_10943_11374 142
633 3300047319 Ga0495674_0038624 Ga0495674_0038624_3179_3607 142
634 3300047320 Ga0495672_0001274 Ga0495672_0001274_12102_12533 142
635 3300047320 Ga0495672_0003072 Ga0495672_0003072_11503_11934 142
636 3300047320 Ga0495672_0003235 Ga0495672_0003235_10829_11260 142
637 3300047320 Ga0495672_0006475 Ga0495672_0006475_2747_3178 142
638 3300047320 Ga0495672_0010264 Ga0495672_0010264_2828_3259 142
639 3300047320 Ga0495672_0018222 Ga0495672_0018222_4155_4586 142
640 3300047320 Ga0495672_0025075 Ga0495672_0025075_1323_1754 142
641 3300047320 Ga0495672_0064038 Ga0495672_0064038_361_792 142
642 3300047321 Ga0495676_0000027 Ga0495676_0000027_66207_66638 142
643 3300047321 Ga0495676_0024454 Ga0495676_0024454_1735_2163 142
644 3300047323 Ga0495683_0014876 Ga0495683_0014876_2050_2481 142
645 3300047323 Ga0495683_0027940 Ga0495683_0027940_152_616 142
646 3300047443 Ga0495687_001396 Ga0495687_001396_10181_10612 142
647 3300047446 Ga0495679_000096 Ga0495679_000096_49605_50036 142
648 3300047446 Ga0495679_080819 Ga0495679_080819_68_496 142
649 3300047447 Ga0495685_271216 Ga0495685_271216_49_480 142
650 3300047469 Ga0495673_0002023 Ga0495673_0002023_609_1040 142
651 3300047469 Ga0495673_0002635 Ga0495673_0002635_11315_11746 142
652 3300047469 Ga0495673_0003580 Ga0495673_0003580_4916_5347 142
653 3300047469 Ga0495673_0010013 Ga0495673_0010013_2673_3104 142
654 3300047469 Ga0495673_0012324 Ga0495673_0012324_1664_2095 142
655 3300047469 Ga0495673_0012824 Ga0495673_0012824_2098_2529 142
656 3300047469 Ga0495673_0024649 Ga0495673_0024649_400_831 142
657 3300047470 Ga0495681_0000737 Ga0495681_0000737_11259_11690 142
658 3300047470 Ga0495681_0001170 Ga0495681_0001170_15000_15431 142
659 3300047470 Ga0495681_0015002 Ga0495681_0015002_3146_3577 142
660 3300047472 Ga0495686_0434768 Ga0495686_0434768_217_648 142
661 3300047673 Ga0495593_0360933 Ga0495593_0360933_36_464 142
662 3300048091 Ga0495626_0000067 Ga0495626_0000067_64563_64994 142
663 3300048091 Ga0495626_0006295 Ga0495626_0006295_3584_4015 142
664 3300048091 Ga0495626_0165075 Ga0495626_0165075_220_651 142
665 3300048903 Ga0496100_0219526 Ga0496100_0219526_549_977 142
666 3300048903 Ga0496100_0292904 Ga0496100_0292904_512_940 142
667 3300048903 Ga0496100_0342503 Ga0496100_0342503_459_887 142
668 3300048904 Ga0496101_0296607 Ga0496101_0296607_214_642 142
669 3300048905 Ga0496102_0049571 Ga0496102_0049571_2839_3267 142
670 3300048905 Ga0496102_0065808 Ga0496102_0065808_663_1091 142
671 3300048905 Ga0496102_0172014 Ga0496102_0172014_1468_1899 142
672 3300048905 Ga0496102_0320457 Ga0496102_0320457_535_963 142
673 3300048905 Ga0496102_0641304 Ga0496102_0641304_27_458 142
674 3300048906 Ga0496103_0109288 Ga0496103_0109288_347_775 142
675 3300048906 Ga0496103_0347895 Ga0496103_0347895_282_713 142
676 3300048906 Ga0496103_0610647 Ga0496103_0610647_79_507 142
677 3300048907 Ga0496104_0057291 Ga0496104_0057291_2279_2707 142
678 3300048908 Ga0496105_0010046 Ga0496105_0010046_659_1087 142
679 3300048908 Ga0496105_0323943 Ga0496105_0323943_555_983 142
680 3300048909 Ga0496106_0048331 Ga0496106_0048331_2014_2442 142
681 3300048909 Ga0496106_0420939 Ga0496106_0420939_158_586 142
682 3300048910 Ga0496107_0079288 Ga0496107_0079288_1611_2039 142
683 3300048910 Ga0496107_0089233 Ga0496107_0089233_551_979 142
684 3300048910 Ga0496107_0941911 Ga0496107_0941911_122_550 142
685 3300048911 Ga0496108_0018674 Ga0496108_0018674_4722_5150 142
686 3300048911 Ga0496108_0080402 Ga0496108_0080402_1686_2114 142
687 3300048911 Ga0496108_0896472 Ga0496108_0896472_71_499 142
688 3300048912 Ga0496109_0001072 Ga0496109_0001072_2389_2817 142
689 3300048912 Ga0496109_0014915 Ga0496109_0014915_5129_5557 142
690 3300048913 Ga0496110_0078265 Ga0496110_0078265_797_1228 142
691 3300048913 Ga0496110_0110524 Ga0496110_0110524_1723_2151 142
692 3300048913 Ga0496110_0322353 Ga0496110_0322353_356_784 142
693 3300048914 Ga0496111_0040397 Ga0496111_0040397_1196_1624 142
694 3300048914 Ga0496111_0124538 Ga0496111_0124538_259_690 142
695 3300048914 Ga0496111_0318577 Ga0496111_0318577_469_900 142
696 3300048915 Ga0496112_0040329 Ga0496112_0040329_691_1212 142
697 3300048915 Ga0496112_0098618 Ga0496112_0098618_1947_2375 142
698 3300048915 Ga0496112_0152673 Ga0496112_0152673_760_1191 142
699 3300048915 Ga0496112_0456399 Ga0496112_0456399_444_872 142
700 3300048916 Ga0496113_0004347 Ga0496113_0004347_7464_7892 142
701 3300048917 Ga0496114_0101103 Ga0496114_0101103_1039_1467 142
702 3300048917 Ga0496114_0101243 Ga0496114_0101243_1893_2321 142
703 3300048917 Ga0496114_0210682 Ga0496114_0210682_306_734 142
704 3300048918 Ga0496115_0008641 Ga0496115_0008641_6491_6919 142
705 3300048918 Ga0496115_0105748 Ga0496115_0105748_1410_1838 142
706 3300048919 Ga0496116_0000242 Ga0496116_0000242_73748_74179 142
707 3300048919 Ga0496116_0007472 Ga0496116_0007472_4717_5148 142
708 3300048920 Ga0496117_0000270 Ga0496117_0000270_73737_74168 142
709 3300048920 Ga0496117_0093775 Ga0496117_0093775_404_835 142
710 3300048921 Ga0496118_0043014 Ga0496118_0043014_566_997 142
711 3300048921 Ga0496118_0101036 Ga0496118_0101036_824_1255 142
712 3300048921 Ga0496118_0108973 Ga0496118_0108973_1358_1789 142
713 3300048924 Ga0496121_0000318 Ga0496121_0000318_26664_27095 142
714 3300048924 Ga0496121_0001431 Ga0496121_0001431_3555_3986 142
715 3300048924 Ga0496121_0003842 Ga0496121_0003842_4328_4759 142
716 3300048925 Ga0496122_0000517 Ga0496122_0000517_3979_4410 142
717 3300048925 Ga0496122_0018570 Ga0496122_0018570_707_1138 142
718 3300048926 Ga0496123_0000243 Ga0496123_0000243_75481_75912 142
719 3300048926 Ga0496123_0005798 Ga0496123_0005798_3714_4145 142
720 3300048926 Ga0496123_0014129 Ga0496123_0014129_2893_3324 142
721 3300048927 Ga0496124_0000751 Ga0496124_0000751_5001_5432 142
722 3300048927 Ga0496124_0009781 Ga0496124_0009781_3684_4115 142
723 3300048927 Ga0496124_0042538 Ga0496124_0042538_1610_2041 142
724 3300048927 Ga0496124_0562764 Ga0496124_0562764_99_530 142
725 3300048928 Ga0496125_0338035 Ga0496125_0338035_76_507 142
726 3300048929 Ga0496126_0089688 Ga0496126_0089688_1513_1944 142
727 3300049459 Ga0495678_000510 Ga0495678_000510_30926_31357 142
728 3300049459 Ga0495678_002035 Ga0495678_002035_11525_11956 142
729 3300049459 Ga0495678_007465 Ga0495678_007465_1638_2069 142
730 3300049459 Ga0495678_026173 Ga0495678_026173_116_547 142
731 3300049460 Ga0495682_0000413 Ga0495682_0000413_24569_25000 142
732 3300049460 Ga0495682_0090326 Ga0495682_0090326_23_451 142
733 3300049665 Ga0501227_044144 Ga0501227_044144_596_1027 142
734 3300049853 Ga0501226_000008 Ga0501226_000008_5609_6040 142
735 3300050490 nmdc:mga03n38_304178_c1 nmdc:mga03n38_304178_c1_326_757 142
736 3300050492 nmdc:mga0yw44_14347_c1 nmdc:mga0yw44_14347_c1_2214_2642 142
737 3300050492 nmdc:mga0yw44_149299_c1 nmdc:mga0yw44_149299_c1_249_677 142
738 3300050492 nmdc:mga0yw44_20308_c1 nmdc:mga0yw44_20308_c1_1644_2072 142
739 3300050494 nmdc:mga06z11_475551_c1 nmdc:mga06z11_475551_c1_234_662 142
740 3300050494 nmdc:mga06z11_828402_c1 nmdc:mga06z11_828402_c1_49_477 142
741 3300050495 nmdc:mga04h51_55881_c1 nmdc:mga04h51_55881_c1_877_1305 142
742 3300050495 nmdc:mga04h51_79937_c1 nmdc:mga04h51_79937_c1_30_458 142
743 3300050496 nmdc:mga07m45_366288_c1 nmdc:mga07m45_366288_c1_57_485 142
744 3300050507 nmdc:mga05p37_8309_c1 nmdc:mga05p37_8309_c1_8768_9196 142
745 3300050510 nmdc:mga06r32_191090_c1 nmdc:mga06r32_191090_c1_931_1359 142
746 3300050511 nmdc:mga08y16_75071_c1 nmdc:mga08y16_75071_c1_996_1424 142
747 3300050511 nmdc:mga08y16_86982_c1 nmdc:mga08y16_86982_c1_457_885 142
748 3300050512 nmdc:mga0n895_124780_c1 nmdc:mga0n895_124780_c1_926_1354 142
749 3300050514 nmdc:mga08x19_61579_c1 nmdc:mga08x19_61579_c1_1646_2077 142
750 3300050514 nmdc:mga08x19_650715_c1 nmdc:mga08x19_650715_c1_86_514 142
751 3300053077 Ga0495601_0043456 Ga0495601_0043456_2103_2531 142
752 3300053080 Ga0500635_0030792 Ga0500635_0030792_123_554 142
753 3300053083 Ga0495655_0009483 Ga0495655_0009483_109_537 142
754 3300053085 Ga0495619_0060061 Ga0495619_0060061_1020_1520 142
755 3300053093 Ga0500651_0154621 Ga0500651_0154621_412_843 142
756 3300053098 Ga0500650_0133192 Ga0500650_0133192_432_863 142
757 3300053117 Ga0500593_023431 Ga0500593_023431_10_438 142
758 3300053119 Ga0500595_187160 Ga0500595_187160_102_533 142
759 3300053122 Ga0500608_085477 Ga0500608_085477_70_501 142
760 3300053136 Ga0500559_0000012 Ga0500559_0000012_58203_58634 142
761 3300053139 Ga0500568_0000002 Ga0500568_0000002_604476_604904 142
762 3300053140 Ga0500573_0071125 Ga0500573_0071125_219_650 142
763 3300053145 Ga0500586_150085 Ga0500586_150085_353_784 142
764 3300053177 Ga0500636_0250802 Ga0500636_0250802_138_569 142
765 3300053178 Ga0500637_0009309 Ga0500637_0009309_1415_1846 142
766 3300053178 Ga0500637_0376567 Ga0500637_0376567_259_690 142
767 3300055283 Ga0500661_001487 Ga0500661_001487_3001_3432 142
768 3300055283 Ga0500661_015672 Ga0500661_015672_910_1341 142
769 3300059492 Ga0587073_0146454 Ga0587073_0146454_87_518 142
770 3300059505 Ga0587083_0160926 Ga0587083_0160926_90_521 142
771 3300059647 Ga0587079_060033 Ga0587079_060033_104_535 142
772 3300060344 Ga0587071_188178 Ga0587071_188178_69_500 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

71

155

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.934 1 142
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9282 1 142
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9278 1 142
1nye-assembly3.cif.gz_F crystal structure of osmc from e. coli 0.9269 1 142
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.9247 1 142
ID Description Score Start End Superfamily
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9319 1 142 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9257 1 142 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9041 5 141 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8954 2 141 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8894 2 141 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A7Y1YRW7-F1-model_v4 OsmC family peroxiredoxin 0.9863 63 141
AF-T0ZAQ4-F1-model_v4 Osmotically inducible protein C 0.985 76 141
AF-A0A510J5A0-F1-model_v4 deleted 0.9773 72 142
AF-A0A2W5FXT9-F1-model_v4 OsmC family peroxiredoxin 0.9732 44 142 GO:0004601
GO:0006979
AF-A0A258Y8I4-F1-model_v4 OsmC family peroxiredoxin 0.972 52 142 GO:0004601
GO:0006979

Feature Viewer

pLDDT pTM Quality
94.71 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map