F480054

General Info

Members Datasets Scaffolds Average Seq Length
770 416 1540 125

Family's Representative Sequence

Representative Sequence 3300053145|Ga0500586_001382|Ga0500586_001382_2795_3220
Length 141
Sequence VQTTSDVESGAMTTNTQAAAHATVAIPSIPRDADGPVFREPWEAQAFAMAVTLHERGVFSWTEWAAALASEIKRAQAAGDADTGETYYRHWLATLENLIAEKGVTTADMLHRYRDAWDHAADRTPHGQPIELTPADFTHHD

Samples

Sample ID Description Type Environment
1 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
99 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
100 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
101 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
102 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
177 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
199 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
200 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
201 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
202 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
203 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
204 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
205 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
208 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
209 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
219 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
224 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
225 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
239 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
240 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
241 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
248 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
256 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
257 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
258 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
261 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
262 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
266 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
341 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
346 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
347 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
353 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
354 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
355 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
356 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
359 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
360 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
361 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
362 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
363 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
364 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
365 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
366 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
367 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
368 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
369 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
370 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
371 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
372 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
373 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
374 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
375 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
376 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
377 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
378 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
379 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
380 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
381 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
382 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
383 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
384 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
385 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
386 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
387 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
388 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
389 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
390 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
391 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
392 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
393 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
394 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
395 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
396 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
397 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
398 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
399 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
400 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
401 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
402 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
403 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
404 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
405 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
406 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
407 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
408 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
409 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
410 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
411 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
412 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
413 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
414 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
415 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
416 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0.65
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.12
Nodule 0.26
Rhizoplane 5.97
Rhizosphere 75.06
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500586_001382 3300053145 Bacteria 5114
2 JGI25406J46586_10032134 3300003203 Bacteria 1953
3 JGI25153J46596_10000456 3300003215 Bacteria 26118
4 rootL2_10047845 3300003322 Bacteria 1023
5 Ga0065165_1023415 3300005262 Bacteria 2095
6 Ga0070676_10270759 3300005328 Bacteria 1141
7 Ga0070683_100001608 3300005329 Bacteria 17476
8 Ga0070683_100200794 3300005329 Bacteria 1893
9 Ga0070690_100534133 3300005330 Bacteria 882
10 Ga0070670_100104209 3300005331 Bacteria 2443
11 Ga0070670_101909478 3300005331 Bacteria 547
12 Ga0070666_10092819 3300005335 Bacteria 2076
13 Ga0070680_100069534 3300005336 Bacteria 2891
14 Ga0070680_100094069 3300005336 Bacteria 2483
15 Ga0070682_100061566 3300005337 Bacteria 2376
16 Ga0070682_100102011 3300005337 Bacteria 1896
17 Ga0068868_100009130 3300005338 Bacteria 7119
18 Ga0068868_100048182 3300005338 Bacteria 3342
19 Ga0068868_100234414 3300005338 Bacteria 1540
20 Ga0068868_100514026 3300005338 Bacteria 1050
21 Ga0070660_100383116 3300005339 Bacteria 1161
22 Ga0070660_100661242 3300005339 Bacteria 875
23 Ga0070689_100169769 3300005340 Bacteria 1767
24 Ga0070691_10334359 3300005341 Bacteria 837
25 Ga0070661_100581668 3300005344 Bacteria 904
26 Ga0070669_100256023 3300005353 Bacteria 1395
27 Ga0070671_100249230 3300005355 Bacteria 1508
28 Ga0070671_100564302 3300005355 Bacteria 982
29 Ga0070671_101414369 3300005355 Bacteria 615
30 Ga0070674_100083735 3300005356 Bacteria 2285
31 Ga0070674_101449436 3300005356 Bacteria 616
32 Ga0070673_100136684 3300005364 Bacteria 2063
33 Ga0070673_100152380 3300005364 Bacteria 1959
34 Ga0070688_100005519 3300005365 Bacteria 6672
35 Ga0070659_100081837 3300005366 Bacteria 2579
36 Ga0070659_100091070 3300005366 Bacteria 2444
37 Ga0070667_100253526 3300005367 Bacteria 1574
38 Ga0070709_10005633 3300005434 Bacteria 6782
39 Ga0070709_10014997 3300005434 Bacteria 4398
40 Ga0070709_10046110 3300005434 Bacteria 2709
41 Ga0070709_10468673 3300005434 Bacteria 952
42 Ga0070714_100178640 3300005435 Bacteria 1930
43 Ga0070714_100187717 3300005435 Bacteria 1884
44 Ga0070714_100580777 3300005435 Bacteria 1075
45 Ga0070714_102064125 3300005435 Bacteria 556
46 Ga0070713_100002128 3300005436 Bacteria 12817
47 Ga0070713_100090161 3300005436 Bacteria 2635
48 Ga0070710_10001349 3300005437 Bacteria 11587
49 Ga0070710_10014545 3300005437 Bacteria 3965
50 Ga0070710_10216511 3300005437 Bacteria 1216
51 Ga0070701_10588557 3300005438 Bacteria 735
52 Ga0070711_100003046 3300005439 Bacteria 9686
53 Ga0070711_100005598 3300005439 Bacteria 7519
54 Ga0070711_100011341 3300005439 Bacteria 5531
55 Ga0070711_100102286 3300005439 Bacteria 2087
56 Ga0070700_100179672 3300005441 Bacteria 1472
57 Ga0070700_101160377 3300005441 Bacteria 643
58 Ga0070708_101522270 3300005445 Bacteria 623
59 Ga0070663_100084613 3300005455 Bacteria 2338
60 Ga0070663_100481549 3300005455 Bacteria 1027
61 Ga0070663_100517764 3300005455 Bacteria 993
62 Ga0070678_100141779 3300005456 Bacteria 1924
63 Ga0070678_100207456 3300005456 Bacteria 1621
64 Ga0070678_100601651 3300005456 Bacteria 982
65 Ga0070662_100065694 3300005457 Bacteria 2660
66 Ga0070662_101323852 3300005457 Bacteria 620
67 Ga0070681_10017891 3300005458 Bacteria 7084
68 Ga0070681_10070438 3300005458 Bacteria 3462
69 Ga0070681_10225318 3300005458 Bacteria 1789
70 Ga0070685_10346364 3300005466 Bacteria 1014
71 Ga0070698_100923236 3300005471 Bacteria 819
72 Ga0070679_100023003 3300005530 Bacteria 6096
73 Ga0070679_100325198 3300005530 Bacteria 1487
74 Ga0070679_101227667 3300005530 Bacteria 695
75 Ga0070684_100012301 3300005535 Bacteria 6854
76 Ga0070684_100021420 3300005535 Bacteria 5379
77 Ga0070684_100942852 3300005535 Bacteria 809
78 Ga0070672_100088330 3300005543 Bacteria 2496
79 Ga0070672_100250700 3300005543 Bacteria 1491
80 Ga0070686_100202196 3300005544 Bacteria 1425
81 Ga0070686_100217660 3300005544 Bacteria 1378
82 Ga0070693_100337199 3300005547 Bacteria 1028
83 Ga0070665_100258534 3300005548 Bacteria 1742
84 Ga0070665_100380715 3300005548 Bacteria 1418
85 Ga0070665_100441579 3300005548 Bacteria 1310
86 Ga0070665_100451136 3300005548 Bacteria 1296
87 Ga0070665_100502990 3300005548 Bacteria 1223
88 Ga0070665_100534311 3300005548 Bacteria 1184
89 Ga0070665_100615054 3300005548 Bacteria 1099
90 Ga0070704_101971525 3300005549 Bacteria 542
91 Ga0068855_100094226 3300005563 Bacteria 3453
92 Ga0068855_100180461 3300005563 Bacteria 2387
93 Ga0068855_100646777 3300005563 Bacteria 1136
94 Ga0070664_100079933 3300005564 Bacteria 2815
95 Ga0068857_101459895 3300005577 Bacteria 666
96 Ga0068854_100856925 3300005578 Bacteria 796
97 Ga0068856_100494759 3300005614 Bacteria 1244
98 Ga0068856_100631437 3300005614 Bacteria 1092
99 Ga0068856_100808107 3300005614 Unclassified 957
100 Ga0070702_100021367 3300005615 Bacteria 3404
101 Ga0068852_100025662 3300005616 Bacteria 4778
102 Ga0068852_100633989 3300005616 Bacteria 1075
103 Ga0068859_100151514 3300005617 Bacteria 2394
104 Ga0068859_102234700 3300005617 Bacteria 603
105 Ga0068864_100034287 3300005618 Bacteria 4317
106 Ga0068864_100682359 3300005618 Bacteria 1002
107 Ga0068864_101099363 3300005618 Bacteria 791
108 Ga0068866_10182342 3300005718 Bacteria 1241
109 Ga0068866_10660677 3300005718 Bacteria 713
110 Ga0068861_100101742 3300005719 Bacteria 2286
111 Ga0068861_101696968 3300005719 Bacteria 624
112 Ga0068851_10099392 3300005834 Bacteria 1542
113 Ga0068858_100346453 3300005842 Bacteria 1422
114 Ga0068858_100669109 3300005842 Bacteria 1009
115 Ga0068860_100473476 3300005843 Bacteria 1247
116 Ga0081538_10080612 3300005981 Bacteria 1735
117 Ga0081540_1007097 3300005983 Bacteria 8048
118 Ga0081540_1026986 3300005983 Bacteria 3265
119 Ga0081540_1046912 3300005983 Bacteria 2177
120 Ga0081539_10000152 3300005985 Bacteria 160005
121 Ga0081539_10029588 3300005985 Bacteria 3418
122 Ga0081539_10030129 3300005985 Bacteria 3375
123 Ga0081539_10203484 3300005985 Bacteria 913
124 Ga0070717_10000638 3300006028 Bacteria 22538
125 Ga0070717_10070887 3300006028 Bacteria 2906
126 Ga0070717_10223548 3300006028 Bacteria 1655
127 Ga0075365_10006357 3300006038 Bacteria 6493
128 Ga0075365_10214221 3300006038 Bacteria 1351
129 Ga0075365_10320519 3300006038 Bacteria 1091
130 Ga0075365_10618503 3300006038 Bacteria 766
131 Ga0075368_10089808 3300006042 Bacteria 1256
132 Ga0075363_100019080 3300006048 Bacteria 3424
133 Ga0075363_100498505 3300006048 Bacteria 723
134 Ga0075364_10068815 3300006051 Bacteria 2328
135 Ga0070715_10001134 3300006163 Bacteria 7602
136 Ga0070715_10086803 3300006163 Bacteria 1431
137 Ga0070715_10320289 3300006163 Bacteria 837
138 Ga0070716_100010186 3300006173 Bacteria 4709
139 Ga0070716_100034275 3300006173 Bacteria 2782
140 Ga0070712_100137216 3300006175 Bacteria 1861
141 Ga0070712_100808586 3300006175 Bacteria 804
142 Ga0070712_100997480 3300006175 Bacteria 725
143 Ga0075362_10116483 3300006177 Bacteria 1262
144 Ga0075367_10146890 3300006178 Bacteria 1462
145 Ga0075369_10005179 3300006186 Bacteria 4859
146 Ga0075366_10758482 3300006195 Bacteria 603
147 Ga0097621_100088221 3300006237 Bacteria 2591
148 Ga0075370_10092990 3300006353 Bacteria 1741
149 Ga0075370_10556769 3300006353 Bacteria 694
150 Ga0075370_10792367 3300006353 Bacteria 578
151 Ga0068871_100104453 3300006358 Bacteria 2376
152 Ga0068871_101255965 3300006358 Bacteria 696
153 Ga0075434_100215416 3300006871 Bacteria 1940
154 Ga0068865_100271026 3300006881 Bacteria 1348
155 Ga0068865_101402746 3300006881 Bacteria 624
156 Ga0075436_100008721 3300006914 Bacteria 6933
157 Ga0075436_100291135 3300006914 Bacteria 1169
158 Ga0097620_100151508 3300006931 Bacteria 2394
159 Ga0097620_102234639 3300006931 Bacteria 603
160 Ga0075435_100086867 3300007076 Bacteria 2576
161 Ga0099794_10357360 3300007265 Bacteria 760
162 Ga0105251_10009966 3300009011 Bacteria 5561
163 Ga0105240_10011857 3300009093 Bacteria 12101
164 Ga0105240_10638871 3300009093 Bacteria 1168
165 Ga0111539_10101528 3300009094 Bacteria 3377
166 Ga0111539_10777699 3300009094 Bacteria 1114
167 Ga0105245_10463719 3300009098 Bacteria 1277
168 Ga0105247_10759332 3300009101 Bacteria 736
169 Ga0105247_10939138 3300009101 Bacteria 671
170 Ga0105243_10064955 3300009148 Bacteria 2930
171 Ga0105243_10672035 3300009148 Bacteria 1006
172 Ga0105241_10323717 3300009174 Bacteria 1330
173 Ga0105242_10094702 3300009176 Bacteria 2520
174 Ga0105242_10982940 3300009176 Bacteria 850
175 Ga0105248_10460775 3300009177 Bacteria 1433
176 Ga0105248_12927376 3300009177 Bacteria 544
177 Ga0105237_10159415 3300009545 Bacteria 2254
178 Ga0105237_10430709 3300009545 Bacteria 1325
179 Ga0105237_10453539 3300009545 Bacteria 1288
180 Ga0105237_10907516 3300009545 Bacteria 888
181 Ga0105238_10160641 3300009551 Bacteria 2223
182 Ga0105238_10303519 3300009551 Bacteria 1580
183 Ga0105238_10335840 3300009551 Bacteria 1499
184 Ga0105238_10684590 3300009551 Bacteria 1037
185 Ga0105249_10041405 3300009553 Bacteria 4188
186 Ga0105249_12768409 3300009553 Bacteria 562
187 Ga0105239_10136594 3300010375 Bacteria 2730
188 Ga0105239_10184259 3300010375 Bacteria 2336
189 Ga0105239_11530390 3300010375 Bacteria 771
190 Ga0105239_13601866 3300010375 Bacteria 503
191 Ga0105246_10251207 3300011119 Bacteria 1403
192 Ga0105246_10780228 3300011119 Bacteria 846
193 Ga0157344_1016235 3300012476 Bacteria 600
194 Ga0157329_1006319 3300012491 Bacteria 832
195 Ga0157335_1003520 3300012492 Bacteria 1010
196 Ga0157314_1002866 3300012500 Bacteria 1201
197 Ga0157316_1006616 3300012510 Bacteria 957
198 Ga0157370_10393280 3300013104 Bacteria 1276
199 Ga0157369_10005882 3300013105 Bacteria 14252
200 Ga0157369_10287866 3300013105 Bacteria 1710
201 Ga0157374_10203476 3300013296 Bacteria 1939
202 Ga0157374_10275303 3300013296 Bacteria 1660
203 Ga0157374_10551456 3300013296 Bacteria 1160
204 Ga0157378_10276906 3300013297 Bacteria 1616
205 Ga0163162_10175381 3300013306 Bacteria 2269
206 Ga0163162_10431251 3300013306 Bacteria 1450
207 Ga0163162_10457060 3300013306 Bacteria 1409
208 Ga0163162_11369523 3300013306 Bacteria 805
209 Ga0157372_10046129 3300013307 Bacteria 4837
210 Ga0157372_10322226 3300013307 Bacteria 1799
211 Ga0157375_10199477 3300013308 Bacteria 2156
212 Ga0157375_10292035 3300013308 Bacteria 1793
213 Ga0163163_10361597 3300014325 Bacteria 1508
214 Ga0163163_10576782 3300014325 Bacteria 1188
215 Ga0163163_10675686 3300014325 Bacteria 1096
216 Ga0157380_10770702 3300014326 Bacteria 976
217 Ga0157377_10982097 3300014745 Bacteria 638
218 Ga0157379_10248109 3300014968 Bacteria 1616
219 Ga0157379_10380622 3300014968 Bacteria 1295
220 Ga0157379_10514824 3300014968 Bacteria 1110
221 Ga0157376_10367714 3300014969 Bacteria 1381
222 Ga0157376_11378963 3300014969 Bacteria 736
223 Ga0163161_10034729 3300017792 Bacteria 3607
224 Ga0163161_10111136 3300017792 Bacteria 2049
225 Ga0163161_10871989 3300017792 Bacteria 761
226 Ga0206356_10727236 3300020070 Bacteria 1181
227 Ga0206349_1256203 3300020075 Bacteria 545
228 Ga0206350_10699455 3300020080 Bacteria 735
229 Ga0206354_11363963 3300020081 Bacteria 725
230 Ga0213876_10062569 3300021384 Bacteria 1965
231 Ga0213876_10145725 3300021384 Bacteria 1259
232 Ga0213871_10014157 3300021441 Bacteria 1887
233 Ga0209564_1001502 3300025295 Bacteria 23414
234 Ga0209758_1005378 3300025297 Bacteria 9910
235 Ga0209256_1071995 3300025299 Bacteria 775
236 Ga0207697_10121300 3300025315 Bacteria 1125
237 Ga0207692_10003105 3300025898 Bacteria 6448
238 Ga0207692_10025067 3300025898 Bacteria 2781
239 Ga0207710_10006493 3300025900 Bacteria 4988
240 Ga0207680_10010979 3300025903 Bacteria 4556
241 Ga0207685_10005948 3300025905 Bacteria 3274
242 Ga0207685_10111197 3300025905 Bacteria 1188
243 Ga0207699_10004926 3300025906 Bacteria 6392
244 Ga0207699_10013687 3300025906 Bacteria 4160
245 Ga0207699_10077580 3300025906 Bacteria 2050
246 Ga0207699_11281738 3300025906 Bacteria 542
247 Ga0207654_10143898 3300025911 Bacteria 1523
248 Ga0207654_10606833 3300025911 Bacteria 781
249 Ga0207707_10000413 3300025912 Bacteria 44774
250 Ga0207707_10043801 3300025912 Bacteria 3902
251 Ga0207707_10259359 3300025912 Bacteria 1508
252 Ga0207695_10019824 3300025913 Bacteria 7730
253 Ga0207695_10345096 3300025913 Bacteria 1376
254 Ga0207671_10263880 3300025914 Bacteria 1356
255 Ga0207671_10329634 3300025914 Bacteria 1209
256 Ga0207671_10576968 3300025914 Bacteria 897
257 Ga0207693_10003782 3300025915 Bacteria 12888
258 Ga0207693_10003927 3300025915 Bacteria 12659
259 Ga0207693_10583736 3300025915 Bacteria 870
260 Ga0207693_10865129 3300025915 Bacteria 695
261 Ga0207663_10000453 3300025916 Bacteria 17832
262 Ga0207663_10082687 3300025916 Bacteria 2107
263 Ga0207663_10288412 3300025916 Bacteria 1222
264 Ga0207663_10465197 3300025916 Bacteria 977
265 Ga0207663_10989982 3300025916 Bacteria 674
266 Ga0207660_10103886 3300025917 Bacteria 2126
267 Ga0207660_10147019 3300025917 Bacteria 1807
268 Ga0207657_10287507 3300025919 Bacteria 1304
269 Ga0207657_10577123 3300025919 Bacteria 878
270 Ga0207649_10281516 3300025920 Bacteria 1209
271 Ga0207652_10085816 3300025921 Bacteria 2759
272 Ga0207652_10214765 3300025921 Bacteria 1733
273 Ga0207652_10928534 3300025921 Bacteria 768
274 Ga0207681_10347694 3300025923 Bacteria 1186
275 Ga0207694_10246626 3300025924 Bacteria 1460
276 Ga0207694_10343681 3300025924 Bacteria 1234
277 Ga0207694_10394221 3300025924 Bacteria 1150
278 Ga0207694_10416965 3300025924 Bacteria 1118
279 Ga0207650_10162810 3300025925 Bacteria 1768
280 Ga0207687_10041650 3300025927 Bacteria 3155
281 Ga0207700_10001520 3300025928 Bacteria 13129
282 Ga0207700_10272367 3300025928 Bacteria 1453
283 Ga0207700_10511596 3300025928 Bacteria 1063
284 Ga0207700_10862523 3300025928 Bacteria 810
285 Ga0207664_10095433 3300025929 Bacteria 2446
286 Ga0207664_10357791 3300025929 Bacteria 1293
287 Ga0207664_10456837 3300025929 Bacteria 1140
288 Ga0207664_11097595 3300025929 Bacteria 711
289 Ga0207664_11402641 3300025929 Bacteria 619
290 Ga0207664_11515689 3300025929 Bacteria 592
291 Ga0207644_10056415 3300025931 Bacteria 2834
292 Ga0207690_10056157 3300025932 Bacteria 2655
293 Ga0207706_10040601 3300025933 Bacteria 4124
294 Ga0207686_10018729 3300025934 Bacteria 3923
295 Ga0207709_10139776 3300025935 Bacteria 1663
296 Ga0207670_10605452 3300025936 Bacteria 900
297 Ga0207669_10333658 3300025937 Bacteria 1165
298 Ga0207665_10000724 3300025939 Bacteria 22366
299 Ga0207665_10000860 3300025939 Bacteria 20521
300 Ga0207665_10964196 3300025939 Bacteria 678
301 Ga0207691_10086046 3300025940 Bacteria 2821
302 Ga0207711_10126919 3300025941 Bacteria 2283
303 Ga0207711_11545979 3300025941 Bacteria 607
304 Ga0207711_11609548 3300025941 Bacteria 593
305 Ga0207689_10040891 3300025942 Bacteria 3836
306 Ga0207661_10049430 3300025944 Bacteria 3347
307 Ga0207661_10235388 3300025944 Bacteria 1623
308 Ga0207679_10375830 3300025945 Bacteria 1245
309 Ga0207667_10093325 3300025949 Bacteria 3108
310 Ga0207667_10152549 3300025949 Bacteria 2378
311 Ga0207667_10186156 3300025949 Bacteria 2131
312 Ga0207667_10627338 3300025949 Bacteria 1082
313 Ga0207667_12062227 3300025949 Bacteria 529
314 Ga0207651_10062355 3300025960 Bacteria 2598
315 Ga0207712_10416045 3300025961 Bacteria 1133
316 Ga0207712_10913861 3300025961 Bacteria 776
317 Ga0207712_11359801 3300025961 Bacteria 635
318 Ga0207668_10038403 3300025972 Bacteria 3213
319 Ga0207640_11632956 3300025981 Bacteria 581
320 Ga0207658_10011111 3300025986 Bacteria 6133
321 Ga0207658_10219063 3300025986 Bacteria 1600
322 Ga0207677_10093595 3300026023 Bacteria 2192
323 Ga0207677_10159676 3300026023 Bacteria 1750
324 Ga0207677_10269631 3300026023 Bacteria 1392
325 Ga0207639_10607026 3300026041 Bacteria 1009
326 Ga0207639_11238064 3300026041 Bacteria 700
327 Ga0207639_11615358 3300026041 Bacteria 608
328 Ga0207678_10023718 3300026067 Bacteria 5366
329 Ga0207678_10075583 3300026067 Bacteria 2886
330 Ga0207678_10116498 3300026067 Bacteria 2279
331 Ga0207678_10958966 3300026067 Bacteria 757
332 Ga0207678_11129489 3300026067 Bacteria 694
333 Ga0207678_11521928 3300026067 Bacteria 590
334 Ga0207708_11972105 3300026075 Bacteria 511
335 Ga0207702_10499523 3300026078 Bacteria 1186
336 Ga0207702_11158459 3300026078 Bacteria 767
337 Ga0207648_10195578 3300026089 Bacteria 1793
338 Ga0207676_10065808 3300026095 Bacteria 2887
339 Ga0207675_100216650 3300026118 Bacteria 1843
340 Ga0207683_10010487 3300026121 Bacteria 7906
341 Ga0207683_10016803 3300026121 Bacteria 6228
342 Ga0207683_10086384 3300026121 Bacteria 2789
343 Ga0207683_11513766 3300026121 Bacteria 619
344 Ga0207698_10185973 3300026142 Bacteria 1845
345 Ga0207698_10665834 3300026142 Bacteria 1033
346 Ga0207698_11538309 3300026142 Bacteria 681
347 Ga0209813_10070212 3300027866 Bacteria 1137
348 Ga0265357_1000290 3300028023 Bacteria 2639
349 Ga0268266_10058022 3300028379 Bacteria 3332
350 Ga0268266_10068671 3300028379 Bacteria 3069
351 Ga0268266_10217717 3300028379 Bacteria 1754
352 Ga0268266_10413334 3300028379 Bacteria 1277
353 Ga0268264_10132655 3300028381 Bacteria 2210
354 Ga0268264_12707306 3300028381 Bacteria 500
355 Ga0307517_10529587 3300028786 Bacteria 593
356 Ga0307515_10055822 3300028794 Bacteria 5759
357 Ga0265770_1143202 3300030878 Bacteria 519
358 Ga0265330_10008097 3300031235 Bacteria 5077
359 Ga0265330_10016297 3300031235 Bacteria 3430
360 Ga0265330_10156719 3300031235 Bacteria 967
361 Ga0265332_10002778 3300031238 Bacteria 8704
362 Ga0265332_10029767 3300031238 Bacteria 2386
363 Ga0265328_10060703 3300031239 Bacteria 1388
364 Ga0265328_10148736 3300031239 Bacteria 881
365 Ga0265325_10011639 3300031241 Bacteria 5053
366 Ga0265340_10134064 3300031247 Bacteria 1135
367 Ga0265339_10068825 3300031249 Bacteria 1890
368 Ga0265331_10010638 3300031250 Bacteria 5079
369 Ga0265331_10027309 3300031250 Bacteria 2862
370 Ga0265316_10547871 3300031344 Bacteria 823
371 Ga0307509_10099274 3300031507 Bacteria 2954
372 Ga0265314_10001262 3300031711 Bacteria 28846
373 Ga0265314_10010054 3300031711 Bacteria 7930
374 Ga0265342_10025463 3300031712 Bacteria 3717
375 Ga0307405_10326947 3300031731 Bacteria 1174
376 Ga0307412_10684497 3300031911 Bacteria 878
377 Ga0307412_12033019 3300031911 Bacteria 532
378 Ga0307416_103633215 3300032002 Bacteria 516
379 Ga0307411_10243560 3300032005 Bacteria 1409
380 Ga0307510_10097172 3300033180 Bacteria 2757
381 Ga0307510_10545729 3300033180 Bacteria 605
382 Ga0373930_0038859 3300034816 Bacteria 1007
383 Ga0373950_0014399 3300034818 Bacteria 1330
384 Ga0373958_0027590 3300034819 Bacteria 1094
385 Ga0373959_0026530 3300034820 Bacteria 1145
386 Ga0373928_0127510 3300035084 Bacteria 687
387 Ga0373929_0016634 3300035085 Bacteria 1443
388 Ga0373934_0018161 3300035086 Bacteria 2690
389 Ga0373934_0434245 3300035086 Bacteria 550
390 Ga0373944_0006771 3300035089 Bacteria 3051
391 Ga0373949_0013789 3300035090 Bacteria 1795
392 Ga0373951_0006062 3300035091 Bacteria 2778
393 Ga0373952_0044332 3300035092 Bacteria 1039
394 Ga0373923_0006085 3300035111 Bacteria 4146
395 Ga0373923_0009457 3300035111 Bacteria 3518
396 Ga0373932_0000786 3300035112 Bacteria 9399
397 Ga0373932_0301927 3300035112 Bacteria 598
398 Ga0373936_0003582 3300035113 Bacteria 5849
399 Ga0373941_0006455 3300035115 Bacteria 2826
400 Ga0373945_0059054 3300035116 Bacteria 1427
401 Ga0373953_0014371 3300035117 Bacteria 2847
402 Ga0373954_0021341 3300035118 Bacteria 2932
403 Ga0373954_0126687 3300035118 Bacteria 1241
404 Ga0373956_0020027 3300035119 Bacteria 2841
405 Ga0373956_0320035 3300035119 Bacteria 739
406 Ga0373957_0003294 3300035120 Bacteria 4757
407 Ga0373957_0101939 3300035120 Bacteria 1150
408 Ga0373960_0000962 3300035121 Bacteria 6194
409 Ga0373960_0141379 3300035121 Bacteria 815
410 Ga0373943_0002917 3300035170 Bacteria 7759
411 Ga0373943_0026946 3300035170 Bacteria 2696
412 Ga0373946_0058203 3300035171 Bacteria 1636
413 Ga0373955_0006213 3300035172 Bacteria 5433
414 Ga0373955_0035043 3300035172 Bacteria 2655
415 Ga0373942_0001606 3300035207 Bacteria 5783
416 Ga0373961_0000013 3300035241 Bacteria 119044
417 Ga0373961_0009329 3300035241 Bacteria 2400
418 Ga0373962_0006302 3300035242 Bacteria 2871
419 Ga0373924_0040875 3300035410 Bacteria 1899
420 Ga0373924_0103648 3300035410 Bacteria 1225
421 Ga0373931_0001080 3300035691 Bacteria 11533
422 Ga0373931_0047149 3300035691 Bacteria 2280
423 Ga0373931_0153391 3300035691 Bacteria 1344
424 Ga0373935_0007065 3300035692 Bacteria 6703
425 Ga0373935_0179407 3300035692 Bacteria 1453
426 Ga0373927_0009348 3300035695 Bacteria 6576
427 Ga0373933_0008657 3300035724 Bacteria 5548
428 Ga0373933_0211917 3300035724 Bacteria 1241
429 Ga0373947_0004680 3300035725 Bacteria 8022
430 Ga0373947_0016882 3300035725 Bacteria 4194
431 Ga0373947_0309702 3300035725 Bacteria 1054
432 Ga0373937_0009754 3300036401 Bacteria 8370
433 Ga0373937_0485528 3300036401 Bacteria 1173
434 Ga0373937_0523652 3300036401 Bacteria 1126
435 Ga0373925_0089341 3300037068 Bacteria 2353
436 Ga0373925_0277823 3300037068 Bacteria 1348
437 Ga0373925_0284985 3300037068 Bacteria 1331
438 Ga0373925_0712373 3300037068 Bacteria 827
439 Ga0373925_1005810 3300037068 Bacteria 686
440 Ga0395900_0021204 3300037418 Bacteria 6643
441 Ga0395898_0041898 3300037466 Bacteria 4520
442 Ga0395898_1177191 3300037466 Bacteria 698
443 Ga0436364_0577826 3300037853 Bacteria 640
444 Ga0436364_1322544 3300037853 Bacteria 1107
445 Ga0436365_0586698 3300039437 Bacteria 1197
446 Ga0436365_1147128 3300039437 Bacteria 1505
447 Ga0436365_1416867 3300039437 Bacteria 1398
448 Ga0436360_0455191 3300039438 Bacteria 557
449 Ga0436360_0831214 3300039438 Bacteria 1283
450 Ga0439465_0032047 3300041413 Bacteria 1676
451 Ga0451807_1774293 3300041486 Bacteria 713
452 Ga0451841_0433610 3300041498 Bacteria 629
453 Ga0466963_0181062 3300044694 Bacteria 1471
454 Ga0466957_0153984 3300044842 Bacteria 1489
455 Ga0466967_0012356 3300045976 Bacteria 6527
456 Ga0466967_0126553 3300045976 Bacteria 2367
457 Ga0466967_0141679 3300045976 Bacteria 2240
458 Ga0495603_0008115 3300046455 Bacteria 6343
459 Ga0495603_0016658 3300046455 Bacteria 4447
460 Ga0495629_0000171 3300046459 Bacteria 57349
461 Ga0495629_0091841 3300046459 Bacteria 2119
462 Ga0495629_0300347 3300046459 Bacteria 1100
463 Ga0495638_0004191 3300046460 Bacteria 10990
464 Ga0495638_0066288 3300046460 Bacteria 2219
465 Ga0495638_0180402 3300046460 Bacteria 1205
466 Ga0495641_0007135 3300046461 Bacteria 7061
467 Ga0495651_0516856 3300046462 Bacteria 762
468 Ga0495653_0086572 3300046463 Bacteria 2303
469 Ga0495653_0183945 3300046463 Bacteria 1431
470 Ga0495653_0299218 3300046463 Bacteria 1050
471 Ga0495582_0012241 3300046473 Bacteria 4727
472 Ga0495582_0561862 3300046473 Bacteria 660
473 Ga0495639_0016126 3300046475 Bacteria 3241
474 Ga0495662_0351959 3300046476 Bacteria 724
475 Ga0495662_0366762 3300046476 Bacteria 708
476 Ga0495664_0058635 3300046477 Bacteria 2290
477 Ga0495664_0118061 3300046477 Bacteria 1604
478 Ga0495584_0365085 3300046491 Bacteria 733
479 Ga0495594_0032128 3300046499 Bacteria 2848
480 Ga0495594_0080242 3300046499 Bacteria 1821
481 Ga0495594_0552599 3300046499 Bacteria 653
482 Ga0495583_0105279 3300046506 Bacteria 1200
483 Ga0495606_0041712 3300046507 Bacteria 3076
484 Ga0495608_0019643 3300046511 Bacteria 4649
485 Ga0495616_0040493 3300046513 Bacteria 2380
486 Ga0495618_0071751 3300046514 Bacteria 2203
487 Ga0495618_0503400 3300046514 Bacteria 730
488 Ga0495620_0021941 3300046515 Bacteria 3088
489 Ga0495628_0107904 3300046516 Bacteria 2143
490 Ga0495630_0060518 3300046517 Bacteria 2842
491 Ga0495631_0028217 3300046518 Bacteria 2561
492 Ga0495637_0051440 3300046520 Bacteria 1724
493 Ga0495637_0069952 3300046520 Bacteria 1419
494 Ga0495648_0178609 3300046524 Bacteria 1081
495 Ga0495666_0091022 3300046526 Bacteria 1439
496 Ga0495666_0522798 3300046526 Bacteria 530
497 Ga0495654_0044230 3300046530 Bacteria 2203
498 Ga0495665_0008224 3300046531 Bacteria 5657
499 Ga0495640_0237985 3300046533 Bacteria 1143
500 Ga0495586_0324602 3300046535 Bacteria 883
501 Ga0495597_0093792 3300046542 Bacteria 1271
502 Ga0495645_0070955 3300046543 Bacteria 2513
503 Ga0495622_0150288 3300046557 Bacteria 1054
504 Ga0495667_0023030 3300046559 Bacteria 4197
505 Ga0495668_0068173 3300046616 Bacteria 1957
506 Ga0495634_0292204 3300046642 Bacteria 987
507 Ga0495625_0119205 3300046660 Bacteria 1797
508 Ga0495625_0224613 3300046660 Bacteria 1229
509 Ga0495625_0371624 3300046660 Bacteria 899
510 Ga0495635_0117225 3300046663 Bacteria 1817
511 Ga0495661_0175223 3300046665 Bacteria 1140
512 Ga0495588_0052041 3300046674 Bacteria 2110
513 Ga0495657_0499425 3300046675 Bacteria 709
514 Ga0495599_0102647 3300046678 Bacteria 1782
515 Ga0495623_0051906 3300046679 Bacteria 2593
516 Ga0495647_0016017 3300046681 Bacteria 2635
517 Ga0495647_0085831 3300046681 Bacteria 1283
518 Ga0495658_0003990 3300046683 Bacteria 7271
519 Ga0495658_0013531 3300046683 Bacteria 4154
520 Ga0495613_0005677 3300046689 Bacteria 9348
521 Ga0495613_0036502 3300046689 Bacteria 3645
522 Ga0495624_0397159 3300046690 Bacteria 828
523 Ga0495670_0000584 3300046691 Bacteria 17383
524 Ga0495670_0098542 3300046691 Bacteria 1503
525 Ga0495671_0101611 3300046692 Bacteria 1405
526 Ga0495600_0013315 3300046809 Bacteria 5166
527 Ga0495600_0402807 3300046809 Bacteria 851
528 Ga0495600_0960648 3300046809 Bacteria 502
529 Ga0495581_0053851 3300047315 Bacteria 2323
530 Ga0495581_0057561 3300047315 Bacteria 2243
531 Ga0495581_0328228 3300047315 Bacteria 894
532 Ga0495581_0396077 3300047315 Bacteria 806
533 Ga0495674_0176376 3300047319 Bacteria 1781
534 Ga0495674_0489252 3300047319 Bacteria 985
535 Ga0495676_0028960 3300047321 Bacteria 4721
536 Ga0495680_0017427 3300047322 Bacteria 6135
537 Ga0495675_0020234 3300047444 Bacteria 4231
538 Ga0495675_0021444 3300047444 Bacteria 4113
539 Ga0495684_0002390 3300047471 Bacteria 15006
540 Ga0495684_0111222 3300047471 Bacteria 2067
541 Ga0495593_0023235 3300047673 Bacteria 3448
542 Ga0495593_0031583 3300047673 Bacteria 2892
543 Ga0495602_0114589 3300048088 Bacteria 2182
544 Ga0495602_0289255 3300048088 Bacteria 1204
545 Ga0495602_0344032 3300048088 Bacteria 1078
546 Ga0495602_1132600 3300048088 Bacteria 512
547 Ga0495626_0049921 3300048091 Bacteria 1935
548 Ga0495626_0166526 3300048091 Bacteria 921
549 Ga0496100_0036593 3300048903 Bacteria 3097
550 Ga0496101_0178147 3300048904 Bacteria 1636
551 Ga0496101_1062967 3300048904 Bacteria 636
552 Ga0496102_0009634 3300048905 Bacteria 8308
553 Ga0496102_0014486 3300048905 Bacteria 6850
554 Ga0496102_0122106 3300048905 Bacteria 2433
555 Ga0496102_0610499 3300048905 Bacteria 1014
556 Ga0496102_0694887 3300048905 Bacteria 940
557 Ga0496102_1297699 3300048905 Bacteria 647
558 Ga0496103_0135280 3300048906 Bacteria 1575
559 Ga0496103_0341103 3300048906 Bacteria 963
560 Ga0496104_0017509 3300048907 Bacteria 6526
561 Ga0496104_0059005 3300048907 Bacteria 3632
562 Ga0496104_0080202 3300048907 Bacteria 3111
563 Ga0496104_0090157 3300048907 Bacteria 2929
564 Ga0496105_0002542 3300048908 Bacteria 13233
565 Ga0496106_0024641 3300048909 Bacteria 4473
566 Ga0496106_0173957 3300048909 Bacteria 1708
567 Ga0496106_0902433 3300048909 Bacteria 698
568 Ga0496107_0036022 3300048910 Bacteria 3548
569 Ga0496107_0284595 3300048910 Bacteria 1230
570 Ga0496107_0398634 3300048910 Bacteria 1023
571 Ga0496107_0787069 3300048910 Bacteria 697
572 Ga0496108_0019086 3300048911 Bacteria 5625
573 Ga0496108_0162210 3300048911 Bacteria 1932
574 Ga0496108_0282282 3300048911 Bacteria 1445
575 Ga0496109_0236620 3300048912 Bacteria 1718
576 Ga0496109_0342625 3300048912 Bacteria 1411
577 Ga0496110_0013600 3300048913 Bacteria 6736
578 Ga0496110_0047366 3300048913 Bacteria 3764
579 Ga0496110_0048493 3300048913 Bacteria 3724
580 Ga0496110_0779982 3300048913 Bacteria 860
581 Ga0496111_0010284 3300048914 Bacteria 6268
582 Ga0496111_0043951 3300048914 Bacteria 3211
583 Ga0496112_0000009 3300048915 Bacteria 299708
584 Ga0496112_0019796 3300048915 Bacteria 6364
585 Ga0496112_0082064 3300048915 Bacteria 3188
586 Ga0496112_0332761 3300048915 Bacteria 1462
587 Ga0496113_0048545 3300048916 Bacteria 3158
588 Ga0496113_0851597 3300048916 Bacteria 722
589 Ga0496113_1159400 3300048916 Bacteria 604
590 Ga0496115_0274876 3300048918 Bacteria 1383
591 Ga0496115_0439349 3300048918 Bacteria 1055
592 Ga0496115_0900681 3300048918 Bacteria 682
593 Ga0496115_1212756 3300048918 Bacteria 566
594 Ga0496116_0003128 3300048919 Bacteria 16618
595 Ga0496117_0016712 3300048920 Bacteria 6171
596 Ga0496117_0340332 3300048920 Bacteria 778
597 Ga0496118_0007236 3300048921 Bacteria 11843
598 Ga0496118_0026981 3300048921 Bacteria 4874
599 Ga0496119_0130504 3300048922 Bacteria 1370
600 Ga0496119_0233738 3300048922 Bacteria 934
601 Ga0496120_0115018 3300048923 Bacteria 1399
602 Ga0496121_0088652 3300048924 Bacteria 2425
603 Ga0496121_0152776 3300048924 Bacteria 1697
604 Ga0496121_0181225 3300048924 Bacteria 1520
605 Ga0496122_0063896 3300048925 Bacteria 2682
606 Ga0496122_0063976 3300048925 Bacteria 2679
607 Ga0496123_0006560 3300048926 Bacteria 11245
608 Ga0496124_0093776 3300048927 Bacteria 2443
609 Ga0496124_0257128 3300048927 Bacteria 1288
610 Ga0496124_0331981 3300048927 Bacteria 1084
611 Ga0496125_0001972 3300048928 Bacteria 27900
612 Ga0496125_0040068 3300048928 Bacteria 4023
613 Ga0496125_0102059 3300048928 Bacteria 2109
614 Ga0496126_0005494 3300048929 Bacteria 14446
615 Ga0496126_0075879 3300048929 Bacteria 2983
616 Ga0496126_0186389 3300048929 Bacteria 1759
617 Ga0496126_0196462 3300048929 Bacteria 1706
618 Ga0496126_0530915 3300048929 Bacteria 936
619 Ga0496126_1093946 3300048929 Bacteria 592
620 Ga0495678_133622 3300049459 Bacteria 820
621 Ga0501031_0826988 3300049568 Bacteria 594
622 Ga0501032_0816835 3300049569 Bacteria 588
623 Ga0501034_0607949 3300049571 Bacteria 998
624 Ga0501036_0696314 3300049572 Bacteria 840
625 Ga0501036_1159195 3300049572 Bacteria 630
626 Ga0501038_0439229 3300049574 Bacteria 1005
627 Ga0501038_0839773 3300049574 Bacteria 681
628 Ga0501039_0225174 3300049575 Bacteria 1474
629 Ga0501039_0263458 3300049575 Bacteria 1355
630 Ga0501041_0238835 3300049577 Bacteria 1142
631 Ga0501043_0373516 3300049579 Bacteria 1080
632 Ga0501046_0076335 3300049580 Bacteria 2596
633 Ga0501046_0093877 3300049580 Bacteria 2306
634 Ga0501047_0067326 3300049581 Bacteria 3451
635 Ga0501047_0709053 3300049581 Bacteria 823
636 Ga0501047_0909243 3300049581 Bacteria 693
637 Ga0501048_0244360 3300049582 Bacteria 1274
638 Ga0501048_1060636 3300049582 Bacteria 583
639 Ga0501067_0032395 3300049583 Bacteria 2901
640 Ga0501067_0095827 3300049583 Bacteria 1648
641 Ga0501068_0786062 3300049584 Bacteria 624
642 Ga0501069_0310622 3300049585 Bacteria 925
643 Ga0501070_0024345 3300049586 Bacteria 5078
644 Ga0501070_0306754 3300049586 Bacteria 1292
645 Ga0501072_1099289 3300049588 Bacteria 619
646 Ga0501074_0199210 3300049590 Bacteria 1427
647 Ga0501074_1252893 3300049590 Bacteria 520
648 Ga0501076_0069366 3300049592 Bacteria 2817
649 Ga0501076_1083945 3300049592 Bacteria 660
650 Ga0501079_0773648 3300049741 Bacteria 756
651 Ga0501079_0873748 3300049741 Bacteria 708
652 Ga0501080_0177834 3300049742 Bacteria 1960
653 Ga0501080_0387488 3300049742 Bacteria 1258
654 Ga0501081_1332053 3300049743 Bacteria 545
655 Ga0501035_0104562 3300049822 Bacteria 2483
656 Ga0501035_0189673 3300049822 Bacteria 1767
657 Ga0501035_0424408 3300049822 Bacteria 1103
658 Ga0501035_1295445 3300049822 Bacteria 562
659 Ga0501044_0895442 3300049823 Bacteria 762
660 Ga0501044_1018279 3300049823 Bacteria 699
661 nmdc:mga03n38_32731_c1 3300050490 Bacteria 2205
662 nmdc:mga00v17_134992_c1 3300050491 Bacteria 1579
663 nmdc:mga0yw44_111864_c1 3300050492 Bacteria 1751
664 nmdc:mga0yw44_174243_c1 3300050492 Bacteria 1414
665 nmdc:mga04h51_83681_c1 3300050495 Bacteria 1137
666 nmdc:mga07m45_157212_c1 3300050496 Bacteria 1319
667 nmdc:mga08y16_181949_c1 3300050511 Bacteria 2182
668 nmdc:mga08y16_477242_c1 3300050511 Bacteria 1269
669 nmdc:mga08y16_628899_c1 3300050511 Bacteria 1079
670 nmdc:mga0n895_1677511_c1 3300050512 Bacteria 598
671 nmdc:mga0n895_438928_c1 3300050512 Bacteria 1319
672 nmdc:mga0n895_54681_c1 3300050512 Bacteria 3927
673 nmdc:mga0n895_672739_c1 3300050512 Bacteria 1032
674 nmdc:mga0n895_87528_c1 3300050512 Bacteria 3113
675 nmdc:mga0rr50_1372212_c1 3300050513 Bacteria 599
676 nmdc:mga0rr50_92480_c1 3300050513 Bacteria 2358
677 nmdc:mga08x19_191108_c1 3300050514 Bacteria 1401
678 nmdc:mga0sz30_7344_c2 3300050516 Bacteria 3417
679 Ga0495601_0028313 3300053077 Bacteria 3470
680 Ga0495601_0093591 3300053077 Bacteria 1936
681 Ga0495601_0251320 3300053077 Bacteria 1154
682 Ga0495601_0726760 3300053077 Bacteria 633
683 Ga0495612_0004538 3300053078 Bacteria 5765
684 Ga0495612_0162884 3300053078 Bacteria 974
685 Ga0500635_0020736 3300053080 Bacteria 2016
686 Ga0500635_0204097 3300053080 Bacteria 769
687 Ga0495595_0001410 3300053084 Bacteria 9340
688 Ga0495595_0018754 3300053084 Bacteria 2993
689 Ga0495595_0083025 3300053084 Bacteria 1529
690 Ga0495619_0000379 3300053085 Bacteria 30688
691 Ga0495619_0130991 3300053085 Bacteria 1723
692 Ga0495619_0640388 3300053085 Bacteria 726
693 Ga0500578_0310778 3300053086 Bacteria 932
694 Ga0500643_004431 3300053087 Bacteria 6352
695 Ga0500643_044672 3300053087 Bacteria 1286
696 Ga0500581_050517 3300053089 Bacteria 2121
697 Ga0500647_0065593 3300053091 Bacteria 1746
698 Ga0500651_0018843 3300053093 Bacteria 4276
699 Ga0500651_0055899 3300053093 Bacteria 2471
700 Ga0500651_0073327 3300053093 Bacteria 2128
701 Ga0500651_0079696 3300053093 Bacteria 2029
702 Ga0500566_0000012 3300053094 Bacteria 117873
703 Ga0500566_0001012 3300053094 Bacteria 16196
704 Ga0500566_0003149 3300053094 Bacteria 9863
705 Ga0500566_0026320 3300053094 Bacteria 3405
706 Ga0500566_0298685 3300053094 Bacteria 759
707 Ga0500640_000041 3300053095 Bacteria 19442
708 Ga0500641_0013698 3300053096 Bacteria 2982
709 Ga0500641_0024204 3300053096 Bacteria 2340
710 Ga0500641_0281170 3300053096 Bacteria 689
711 Ga0500650_0000514 3300053098 Bacteria 9839
712 Ga0500554_003914 3300053102 Bacteria 3098
713 Ga0500556_0000091 3300053104 Bacteria 83564
714 Ga0500572_000453 3300053111 Bacteria 14248
715 Ga0500591_073055 3300053115 Bacteria 1548
716 Ga0500592_006175 3300053116 Bacteria 1906
717 Ga0500593_192222 3300053117 Bacteria 746
718 Ga0500595_000288 3300053119 Bacteria 33340
719 Ga0500595_000564 3300053119 Bacteria 22025
720 Ga0500608_010835 3300053122 Bacteria 3931
721 Ga0500608_138379 3300053122 Bacteria 1083
722 Ga0500614_001538 3300053123 Bacteria 5472
723 Ga0500642_0000208 3300053130 Bacteria 23820
724 Ga0500642_0174664 3300053130 Bacteria 1005
725 Ga0500652_001010 3300053131 Bacteria 9186
726 Ga0500655_061972 3300053133 Bacteria 755
727 Ga0500658_0126281 3300053134 Bacteria 1137
728 Ga0500559_0001038 3300053136 Bacteria 16985
729 Ga0500559_0005664 3300053136 Bacteria 5715
730 Ga0500559_0384755 3300053136 Bacteria 654
731 Ga0500568_0000167 3300053139 Bacteria 56971
732 Ga0500568_0117103 3300053139 Bacteria 994
733 Ga0500577_0072913 3300053142 Bacteria 1350
734 Ga0500588_0007479 3300053146 Bacteria 2520
735 Ga0500588_0248605 3300053146 Bacteria 667
736 Ga0500603_000170 3300053150 Bacteria 16461
737 Ga0500603_000272 3300053150 Bacteria 13760
738 Ga0500604_0000380 3300053151 Bacteria 12188
739 Ga0500604_0052563 3300053151 Bacteria 1261
740 Ga0500616_0000059 3300053153 Bacteria 259741
741 Ga0500622_0002763 3300053156 Bacteria 12347
742 Ga0500627_0134115 3300053158 Bacteria 1118
743 Ga0500630_000455 3300053159 Bacteria 17894
744 Ga0500630_243816 3300053159 Bacteria 646
745 Ga0500634_0135840 3300053161 Bacteria 1173
746 Ga0500634_0149280 3300053161 Bacteria 1095
747 Ga0500638_001439 3300053162 Bacteria 7470
748 Ga0500638_056014 3300053162 Bacteria 1899
749 Ga0500638_136572 3300053162 Bacteria 1106
750 Ga0500639_000008 3300053163 Bacteria 143238
751 Ga0500639_090428 3300053163 Bacteria 1526
752 Ga0500636_0078261 3300053177 Bacteria 1909
753 Ga0500637_0000257 3300053178 Bacteria 19771
754 Ga0500637_0000793 3300053178 Bacteria 12680
755 Ga0500637_0128910 3300053178 Bacteria 1467
756 Ga0500611_084768 3300053727 Bacteria 797
757 Ga0500645_000106 3300053730 Bacteria 67066
758 Ga0500609_029782 3300053731 Bacteria 749
759 Ga0500609_067418 3300053731 Bacteria 502
760 Ga0500596_000042 3300053735 Bacteria 16854
761 Ga0500596_074946 3300053735 Bacteria 582
762 Ga0501084_0047609 3300054114 Bacteria 3591
763 Ga0500661_000491 3300055283 Bacteria 7332
764 Ga0501082_0494626 3300060353 Bacteria 1069
765 Ga0530510_0816779 3300061734 Bacteria 712
766 2723845417 2721755755 Bacteria 8322773
767 2857525975 2857524615 Bacteria 6615449
768 2893067749 2893066018 Bacteria 6158120
769 2919074171 2919073203 Bacteria 6531949
770 2922390678 2922386360 Bacteria 7017218
771 Ga0500586_001382
772 JGI25406J46586_10032134
773 JGI25153J46596_10000456
774 rootL2_10047845
775 Ga0065165_1023415
776 Ga0070676_10270759
777 Ga0070683_100001608
778 Ga0070683_100200794
779 Ga0070690_100534133
780 Ga0070670_100104209
781 Ga0070670_101909478
782 Ga0070666_10092819
783 Ga0070680_100069534
784 Ga0070680_100094069
785 Ga0070682_100061566
786 Ga0070682_100102011
787 Ga0068868_100009130
788 Ga0068868_100048182
789 Ga0068868_100234414
790 Ga0068868_100514026
791 Ga0070660_100383116
792 Ga0070660_100661242
793 Ga0070689_100169769
794 Ga0070691_10334359
795 Ga0070661_100581668
796 Ga0070669_100256023
797 Ga0070671_100249230
798 Ga0070671_100564302
799 Ga0070671_101414369
800 Ga0070674_100083735
801 Ga0070674_101449436
802 Ga0070673_100136684
803 Ga0070673_100152380
804 Ga0070688_100005519
805 Ga0070659_100081837
806 Ga0070659_100091070
807 Ga0070667_100253526
808 Ga0070709_10005633
809 Ga0070709_10014997
810 Ga0070709_10046110
811 Ga0070709_10468673
812 Ga0070714_100178640
813 Ga0070714_100187717
814 Ga0070714_100580777
815 Ga0070714_102064125
816 Ga0070713_100002128
817 Ga0070713_100090161
818 Ga0070710_10001349
819 Ga0070710_10014545
820 Ga0070710_10216511
821 Ga0070701_10588557
822 Ga0070711_100003046
823 Ga0070711_100005598
824 Ga0070711_100011341
825 Ga0070711_100102286
826 Ga0070700_100179672
827 Ga0070700_101160377
828 Ga0070708_101522270
829 Ga0070663_100084613
830 Ga0070663_100481549
831 Ga0070663_100517764
832 Ga0070678_100141779
833 Ga0070678_100207456
834 Ga0070678_100601651
835 Ga0070662_100065694
836 Ga0070662_101323852
837 Ga0070681_10017891
838 Ga0070681_10070438
839 Ga0070681_10225318
840 Ga0070685_10346364
841 Ga0070698_100923236
842 Ga0070679_100023003
843 Ga0070679_100325198
844 Ga0070679_101227667
845 Ga0070684_100012301
846 Ga0070684_100021420
847 Ga0070684_100942852
848 Ga0070672_100088330
849 Ga0070672_100250700
850 Ga0070686_100202196
851 Ga0070686_100217660
852 Ga0070693_100337199
853 Ga0070665_100258534
854 Ga0070665_100380715
855 Ga0070665_100441579
856 Ga0070665_100451136
857 Ga0070665_100502990
858 Ga0070665_100534311
859 Ga0070665_100615054
860 Ga0070704_101971525
861 Ga0068855_100094226
862 Ga0068855_100180461
863 Ga0068855_100646777
864 Ga0070664_100079933
865 Ga0068857_101459895
866 Ga0068854_100856925
867 Ga0068856_100494759
868 Ga0068856_100631437
869 Ga0068856_100808107
870 Ga0070702_100021367
871 Ga0068852_100025662
872 Ga0068852_100633989
873 Ga0068859_100151514
874 Ga0068859_102234700
875 Ga0068864_100034287
876 Ga0068864_100682359
877 Ga0068864_101099363
878 Ga0068866_10182342
879 Ga0068866_10660677
880 Ga0068861_100101742
881 Ga0068861_101696968
882 Ga0068851_10099392
883 Ga0068858_100346453
884 Ga0068858_100669109
885 Ga0068860_100473476
886 Ga0081538_10080612
887 Ga0081540_1007097
888 Ga0081540_1026986
889 Ga0081540_1046912
890 Ga0081539_10000152
891 Ga0081539_10029588
892 Ga0081539_10030129
893 Ga0081539_10203484
894 Ga0070717_10000638
895 Ga0070717_10070887
896 Ga0070717_10223548
897 Ga0075365_10006357
898 Ga0075365_10214221
899 Ga0075365_10320519
900 Ga0075365_10618503
901 Ga0075368_10089808
902 Ga0075363_100019080
903 Ga0075363_100498505
904 Ga0075364_10068815
905 Ga0070715_10001134
906 Ga0070715_10086803
907 Ga0070715_10320289
908 Ga0070716_100010186
909 Ga0070716_100034275
910 Ga0070712_100137216
911 Ga0070712_100808586
912 Ga0070712_100997480
913 Ga0075362_10116483
914 Ga0075367_10146890
915 Ga0075369_10005179
916 Ga0075366_10758482
917 Ga0097621_100088221
918 Ga0075370_10092990
919 Ga0075370_10556769
920 Ga0075370_10792367
921 Ga0068871_100104453
922 Ga0068871_101255965
923 Ga0075434_100215416
924 Ga0068865_100271026
925 Ga0068865_101402746
926 Ga0075436_100008721
927 Ga0075436_100291135
928 Ga0097620_100151508
929 Ga0097620_102234639
930 Ga0075435_100086867
931 Ga0099794_10357360
932 Ga0105251_10009966
933 Ga0105240_10011857
934 Ga0105240_10638871
935 Ga0111539_10101528
936 Ga0111539_10777699
937 Ga0105245_10463719
938 Ga0105247_10759332
939 Ga0105247_10939138
940 Ga0105243_10064955
941 Ga0105243_10672035
942 Ga0105241_10323717
943 Ga0105242_10094702
944 Ga0105242_10982940
945 Ga0105248_10460775
946 Ga0105248_12927376
947 Ga0105237_10159415
948 Ga0105237_10430709
949 Ga0105237_10453539
950 Ga0105237_10907516
951 Ga0105238_10160641
952 Ga0105238_10303519
953 Ga0105238_10335840
954 Ga0105238_10684590
955 Ga0105249_10041405
956 Ga0105249_12768409
957 Ga0105239_10136594
958 Ga0105239_10184259
959 Ga0105239_11530390
960 Ga0105239_13601866
961 Ga0105246_10251207
962 Ga0105246_10780228
963 Ga0157344_1016235
964 Ga0157329_1006319
965 Ga0157335_1003520
966 Ga0157314_1002866
967 Ga0157316_1006616
968 Ga0157370_10393280
969 Ga0157369_10005882
970 Ga0157369_10287866
971 Ga0157374_10203476
972 Ga0157374_10275303
973 Ga0157374_10551456
974 Ga0157378_10276906
975 Ga0163162_10175381
976 Ga0163162_10431251
977 Ga0163162_10457060
978 Ga0163162_11369523
979 Ga0157372_10046129
980 Ga0157372_10322226
981 Ga0157375_10199477
982 Ga0157375_10292035
983 Ga0163163_10361597
984 Ga0163163_10576782
985 Ga0163163_10675686
986 Ga0157380_10770702
987 Ga0157377_10982097
988 Ga0157379_10248109
989 Ga0157379_10380622
990 Ga0157379_10514824
991 Ga0157376_10367714
992 Ga0157376_11378963
993 Ga0163161_10034729
994 Ga0163161_10111136
995 Ga0163161_10871989
996 Ga0206356_10727236
997 Ga0206349_1256203
998 Ga0206350_10699455
999 Ga0206354_11363963
1000 Ga0213876_10062569
1001 Ga0213876_10145725
1002 Ga0213871_10014157
1003 Ga0209564_1001502
1004 Ga0209758_1005378
1005 Ga0209256_1071995
1006 Ga0207697_10121300
1007 Ga0207692_10003105
1008 Ga0207692_10025067
1009 Ga0207710_10006493
1010 Ga0207680_10010979
1011 Ga0207685_10005948
1012 Ga0207685_10111197
1013 Ga0207699_10004926
1014 Ga0207699_10013687
1015 Ga0207699_10077580
1016 Ga0207699_11281738
1017 Ga0207654_10143898
1018 Ga0207654_10606833
1019 Ga0207707_10000413
1020 Ga0207707_10043801
1021 Ga0207707_10259359
1022 Ga0207695_10019824
1023 Ga0207695_10345096
1024 Ga0207671_10263880
1025 Ga0207671_10329634
1026 Ga0207671_10576968
1027 Ga0207693_10003782
1028 Ga0207693_10003927
1029 Ga0207693_10583736
1030 Ga0207693_10865129
1031 Ga0207663_10000453
1032 Ga0207663_10082687
1033 Ga0207663_10288412
1034 Ga0207663_10465197
1035 Ga0207663_10989982
1036 Ga0207660_10103886
1037 Ga0207660_10147019
1038 Ga0207657_10287507
1039 Ga0207657_10577123
1040 Ga0207649_10281516
1041 Ga0207652_10085816
1042 Ga0207652_10214765
1043 Ga0207652_10928534
1044 Ga0207681_10347694
1045 Ga0207694_10246626
1046 Ga0207694_10343681
1047 Ga0207694_10394221
1048 Ga0207694_10416965
1049 Ga0207650_10162810
1050 Ga0207687_10041650
1051 Ga0207700_10001520
1052 Ga0207700_10272367
1053 Ga0207700_10511596
1054 Ga0207700_10862523
1055 Ga0207664_10095433
1056 Ga0207664_10357791
1057 Ga0207664_10456837
1058 Ga0207664_11097595
1059 Ga0207664_11402641
1060 Ga0207664_11515689
1061 Ga0207644_10056415
1062 Ga0207690_10056157
1063 Ga0207706_10040601
1064 Ga0207686_10018729
1065 Ga0207709_10139776
1066 Ga0207670_10605452
1067 Ga0207669_10333658
1068 Ga0207665_10000724
1069 Ga0207665_10000860
1070 Ga0207665_10964196
1071 Ga0207691_10086046
1072 Ga0207711_10126919
1073 Ga0207711_11545979
1074 Ga0207711_11609548
1075 Ga0207689_10040891
1076 Ga0207661_10049430
1077 Ga0207661_10235388
1078 Ga0207679_10375830
1079 Ga0207667_10093325
1080 Ga0207667_10152549
1081 Ga0207667_10186156
1082 Ga0207667_10627338
1083 Ga0207667_12062227
1084 Ga0207651_10062355
1085 Ga0207712_10416045
1086 Ga0207712_10913861
1087 Ga0207712_11359801
1088 Ga0207668_10038403
1089 Ga0207640_11632956
1090 Ga0207658_10011111
1091 Ga0207658_10219063
1092 Ga0207677_10093595
1093 Ga0207677_10159676
1094 Ga0207677_10269631
1095 Ga0207639_10607026
1096 Ga0207639_11238064
1097 Ga0207639_11615358
1098 Ga0207678_10023718
1099 Ga0207678_10075583
1100 Ga0207678_10116498
1101 Ga0207678_10958966
1102 Ga0207678_11129489
1103 Ga0207678_11521928
1104 Ga0207708_11972105
1105 Ga0207702_10499523
1106 Ga0207702_11158459
1107 Ga0207648_10195578
1108 Ga0207676_10065808
1109 Ga0207675_100216650
1110 Ga0207683_10010487
1111 Ga0207683_10016803
1112 Ga0207683_10086384
1113 Ga0207683_11513766
1114 Ga0207698_10185973
1115 Ga0207698_10665834
1116 Ga0207698_11538309
1117 Ga0209813_10070212
1118 Ga0265357_1000290
1119 Ga0268266_10058022
1120 Ga0268266_10068671
1121 Ga0268266_10217717
1122 Ga0268266_10413334
1123 Ga0268264_10132655
1124 Ga0268264_12707306
1125 Ga0307517_10529587
1126 Ga0307515_10055822
1127 Ga0265770_1143202
1128 Ga0265330_10008097
1129 Ga0265330_10016297
1130 Ga0265330_10156719
1131 Ga0265332_10002778
1132 Ga0265332_10029767
1133 Ga0265328_10060703
1134 Ga0265328_10148736
1135 Ga0265325_10011639
1136 Ga0265340_10134064
1137 Ga0265339_10068825
1138 Ga0265331_10010638
1139 Ga0265331_10027309
1140 Ga0265316_10547871
1141 Ga0307509_10099274
1142 Ga0265314_10001262
1143 Ga0265314_10010054
1144 Ga0265342_10025463
1145 Ga0307405_10326947
1146 Ga0307412_10684497
1147 Ga0307412_12033019
1148 Ga0307416_103633215
1149 Ga0307411_10243560
1150 Ga0307510_10097172
1151 Ga0307510_10545729
1152 Ga0373930_0038859
1153 Ga0373950_0014399
1154 Ga0373958_0027590
1155 Ga0373959_0026530
1156 Ga0373928_0127510
1157 Ga0373929_0016634
1158 Ga0373934_0018161
1159 Ga0373934_0434245
1160 Ga0373944_0006771
1161 Ga0373949_0013789
1162 Ga0373951_0006062
1163 Ga0373952_0044332
1164 Ga0373923_0006085
1165 Ga0373923_0009457
1166 Ga0373932_0000786
1167 Ga0373932_0301927
1168 Ga0373936_0003582
1169 Ga0373941_0006455
1170 Ga0373945_0059054
1171 Ga0373953_0014371
1172 Ga0373954_0021341
1173 Ga0373954_0126687
1174 Ga0373956_0020027
1175 Ga0373956_0320035
1176 Ga0373957_0003294
1177 Ga0373957_0101939
1178 Ga0373960_0000962
1179 Ga0373960_0141379
1180 Ga0373943_0002917
1181 Ga0373943_0026946
1182 Ga0373946_0058203
1183 Ga0373955_0006213
1184 Ga0373955_0035043
1185 Ga0373942_0001606
1186 Ga0373961_0000013
1187 Ga0373961_0009329
1188 Ga0373962_0006302
1189 Ga0373924_0040875
1190 Ga0373924_0103648
1191 Ga0373931_0001080
1192 Ga0373931_0047149
1193 Ga0373931_0153391
1194 Ga0373935_0007065
1195 Ga0373935_0179407
1196 Ga0373927_0009348
1197 Ga0373933_0008657
1198 Ga0373933_0211917
1199 Ga0373947_0004680
1200 Ga0373947_0016882
1201 Ga0373947_0309702
1202 Ga0373937_0009754
1203 Ga0373937_0485528
1204 Ga0373937_0523652
1205 Ga0373925_0089341
1206 Ga0373925_0277823
1207 Ga0373925_0284985
1208 Ga0373925_0712373
1209 Ga0373925_1005810
1210 Ga0395900_0021204
1211 Ga0395898_0041898
1212 Ga0395898_1177191
1213 Ga0436364_0577826
1214 Ga0436364_1322544
1215 Ga0436365_0586698
1216 Ga0436365_1147128
1217 Ga0436365_1416867
1218 Ga0436360_0455191
1219 Ga0436360_0831214
1220 Ga0439465_0032047
1221 Ga0451807_1774293
1222 Ga0451841_0433610
1223 Ga0466963_0181062
1224 Ga0466957_0153984
1225 Ga0466967_0012356
1226 Ga0466967_0126553
1227 Ga0466967_0141679
1228 Ga0495603_0008115
1229 Ga0495603_0016658
1230 Ga0495629_0000171
1231 Ga0495629_0091841
1232 Ga0495629_0300347
1233 Ga0495638_0004191
1234 Ga0495638_0066288
1235 Ga0495638_0180402
1236 Ga0495641_0007135
1237 Ga0495651_0516856
1238 Ga0495653_0086572
1239 Ga0495653_0183945
1240 Ga0495653_0299218
1241 Ga0495582_0012241
1242 Ga0495582_0561862
1243 Ga0495639_0016126
1244 Ga0495662_0351959
1245 Ga0495662_0366762
1246 Ga0495664_0058635
1247 Ga0495664_0118061
1248 Ga0495584_0365085
1249 Ga0495594_0032128
1250 Ga0495594_0080242
1251 Ga0495594_0552599
1252 Ga0495583_0105279
1253 Ga0495606_0041712
1254 Ga0495608_0019643
1255 Ga0495616_0040493
1256 Ga0495618_0071751
1257 Ga0495618_0503400
1258 Ga0495620_0021941
1259 Ga0495628_0107904
1260 Ga0495630_0060518
1261 Ga0495631_0028217
1262 Ga0495637_0051440
1263 Ga0495637_0069952
1264 Ga0495648_0178609
1265 Ga0495666_0091022
1266 Ga0495666_0522798
1267 Ga0495654_0044230
1268 Ga0495665_0008224
1269 Ga0495640_0237985
1270 Ga0495586_0324602
1271 Ga0495597_0093792
1272 Ga0495645_0070955
1273 Ga0495622_0150288
1274 Ga0495667_0023030
1275 Ga0495668_0068173
1276 Ga0495634_0292204
1277 Ga0495625_0119205
1278 Ga0495625_0224613
1279 Ga0495625_0371624
1280 Ga0495635_0117225
1281 Ga0495661_0175223
1282 Ga0495588_0052041
1283 Ga0495657_0499425
1284 Ga0495599_0102647
1285 Ga0495623_0051906
1286 Ga0495647_0016017
1287 Ga0495647_0085831
1288 Ga0495658_0003990
1289 Ga0495658_0013531
1290 Ga0495613_0005677
1291 Ga0495613_0036502
1292 Ga0495624_0397159
1293 Ga0495670_0000584
1294 Ga0495670_0098542
1295 Ga0495671_0101611
1296 Ga0495600_0013315
1297 Ga0495600_0402807
1298 Ga0495600_0960648
1299 Ga0495581_0053851
1300 Ga0495581_0057561
1301 Ga0495581_0328228
1302 Ga0495581_0396077
1303 Ga0495674_0176376
1304 Ga0495674_0489252
1305 Ga0495676_0028960
1306 Ga0495680_0017427
1307 Ga0495675_0020234
1308 Ga0495675_0021444
1309 Ga0495684_0002390
1310 Ga0495684_0111222
1311 Ga0495593_0023235
1312 Ga0495593_0031583
1313 Ga0495602_0114589
1314 Ga0495602_0289255
1315 Ga0495602_0344032
1316 Ga0495602_1132600
1317 Ga0495626_0049921
1318 Ga0495626_0166526
1319 Ga0496100_0036593
1320 Ga0496101_0178147
1321 Ga0496101_1062967
1322 Ga0496102_0009634
1323 Ga0496102_0014486
1324 Ga0496102_0122106
1325 Ga0496102_0610499
1326 Ga0496102_0694887
1327 Ga0496102_1297699
1328 Ga0496103_0135280
1329 Ga0496103_0341103
1330 Ga0496104_0017509
1331 Ga0496104_0059005
1332 Ga0496104_0080202
1333 Ga0496104_0090157
1334 Ga0496105_0002542
1335 Ga0496106_0024641
1336 Ga0496106_0173957
1337 Ga0496106_0902433
1338 Ga0496107_0036022
1339 Ga0496107_0284595
1340 Ga0496107_0398634
1341 Ga0496107_0787069
1342 Ga0496108_0019086
1343 Ga0496108_0162210
1344 Ga0496108_0282282
1345 Ga0496109_0236620
1346 Ga0496109_0342625
1347 Ga0496110_0013600
1348 Ga0496110_0047366
1349 Ga0496110_0048493
1350 Ga0496110_0779982
1351 Ga0496111_0010284
1352 Ga0496111_0043951
1353 Ga0496112_0000009
1354 Ga0496112_0019796
1355 Ga0496112_0082064
1356 Ga0496112_0332761
1357 Ga0496113_0048545
1358 Ga0496113_0851597
1359 Ga0496113_1159400
1360 Ga0496115_0274876
1361 Ga0496115_0439349
1362 Ga0496115_0900681
1363 Ga0496115_1212756
1364 Ga0496116_0003128
1365 Ga0496117_0016712
1366 Ga0496117_0340332
1367 Ga0496118_0007236
1368 Ga0496118_0026981
1369 Ga0496119_0130504
1370 Ga0496119_0233738
1371 Ga0496120_0115018
1372 Ga0496121_0088652
1373 Ga0496121_0152776
1374 Ga0496121_0181225
1375 Ga0496122_0063896
1376 Ga0496122_0063976
1377 Ga0496123_0006560
1378 Ga0496124_0093776
1379 Ga0496124_0257128
1380 Ga0496124_0331981
1381 Ga0496125_0001972
1382 Ga0496125_0040068
1383 Ga0496125_0102059
1384 Ga0496126_0005494
1385 Ga0496126_0075879
1386 Ga0496126_0186389
1387 Ga0496126_0196462
1388 Ga0496126_0530915
1389 Ga0496126_1093946
1390 Ga0495678_133622
1391 Ga0501031_0826988
1392 Ga0501032_0816835
1393 Ga0501034_0607949
1394 Ga0501036_0696314
1395 Ga0501036_1159195
1396 Ga0501038_0439229
1397 Ga0501038_0839773
1398 Ga0501039_0225174
1399 Ga0501039_0263458
1400 Ga0501041_0238835
1401 Ga0501043_0373516
1402 Ga0501046_0076335
1403 Ga0501046_0093877
1404 Ga0501047_0067326
1405 Ga0501047_0709053
1406 Ga0501047_0909243
1407 Ga0501048_0244360
1408 Ga0501048_1060636
1409 Ga0501067_0032395
1410 Ga0501067_0095827
1411 Ga0501068_0786062
1412 Ga0501069_0310622
1413 Ga0501070_0024345
1414 Ga0501070_0306754
1415 Ga0501072_1099289
1416 Ga0501074_0199210
1417 Ga0501074_1252893
1418 Ga0501076_0069366
1419 Ga0501076_1083945
1420 Ga0501079_0773648
1421 Ga0501079_0873748
1422 Ga0501080_0177834
1423 Ga0501080_0387488
1424 Ga0501081_1332053
1425 Ga0501035_0104562
1426 Ga0501035_0189673
1427 Ga0501035_0424408
1428 Ga0501035_1295445
1429 Ga0501044_0895442
1430 Ga0501044_1018279
1431 nmdc:mga03n38_32731_c1
1432 nmdc:mga00v17_134992_c1
1433 nmdc:mga0yw44_111864_c1
1434 nmdc:mga0yw44_174243_c1
1435 nmdc:mga04h51_83681_c1
1436 nmdc:mga07m45_157212_c1
1437 nmdc:mga08y16_181949_c1
1438 nmdc:mga08y16_477242_c1
1439 nmdc:mga08y16_628899_c1
1440 nmdc:mga0n895_1677511_c1
1441 nmdc:mga0n895_438928_c1
1442 nmdc:mga0n895_54681_c1
1443 nmdc:mga0n895_672739_c1
1444 nmdc:mga0n895_87528_c1
1445 nmdc:mga0rr50_1372212_c1
1446 nmdc:mga0rr50_92480_c1
1447 nmdc:mga08x19_191108_c1
1448 nmdc:mga0sz30_7344_c2
1449 Ga0495601_0028313
1450 Ga0495601_0093591
1451 Ga0495601_0251320
1452 Ga0495601_0726760
1453 Ga0495612_0004538
1454 Ga0495612_0162884
1455 Ga0500635_0020736
1456 Ga0500635_0204097
1457 Ga0495595_0001410
1458 Ga0495595_0018754
1459 Ga0495595_0083025
1460 Ga0495619_0000379
1461 Ga0495619_0130991
1462 Ga0495619_0640388
1463 Ga0500578_0310778
1464 Ga0500643_004431
1465 Ga0500643_044672
1466 Ga0500581_050517
1467 Ga0500647_0065593
1468 Ga0500651_0018843
1469 Ga0500651_0055899
1470 Ga0500651_0073327
1471 Ga0500651_0079696
1472 Ga0500566_0000012
1473 Ga0500566_0001012
1474 Ga0500566_0003149
1475 Ga0500566_0026320
1476 Ga0500566_0298685
1477 Ga0500640_000041
1478 Ga0500641_0013698
1479 Ga0500641_0024204
1480 Ga0500641_0281170
1481 Ga0500650_0000514
1482 Ga0500554_003914
1483 Ga0500556_0000091
1484 Ga0500572_000453
1485 Ga0500591_073055
1486 Ga0500592_006175
1487 Ga0500593_192222
1488 Ga0500595_000288
1489 Ga0500595_000564
1490 Ga0500608_010835
1491 Ga0500608_138379
1492 Ga0500614_001538
1493 Ga0500642_0000208
1494 Ga0500642_0174664
1495 Ga0500652_001010
1496 Ga0500655_061972
1497 Ga0500658_0126281
1498 Ga0500559_0001038
1499 Ga0500559_0005664
1500 Ga0500559_0384755
1501 Ga0500568_0000167
1502 Ga0500568_0117103
1503 Ga0500577_0072913
1504 Ga0500588_0007479
1505 Ga0500588_0248605
1506 Ga0500603_000170
1507 Ga0500603_000272
1508 Ga0500604_0000380
1509 Ga0500604_0052563
1510 Ga0500616_0000059
1511 Ga0500622_0002763
1512 Ga0500627_0134115
1513 Ga0500630_000455
1514 Ga0500630_243816
1515 Ga0500634_0135840
1516 Ga0500634_0149280
1517 Ga0500638_001439
1518 Ga0500638_056014
1519 Ga0500638_136572
1520 Ga0500639_000008
1521 Ga0500639_090428
1522 Ga0500636_0078261
1523 Ga0500637_0000257
1524 Ga0500637_0000793
1525 Ga0500637_0128910
1526 Ga0500611_084768
1527 Ga0500645_000106
1528 Ga0500609_029782
1529 Ga0500609_067418
1530 Ga0500596_000042
1531 Ga0500596_074946
1532 Ga0501084_0047609
1533 Ga0500661_000491
1534 Ga0501082_0494626
1535 Ga0530510_0816779
1536 2723845417
1537 2857525975
1538 2893067749
1539 2919074171
1540 2922390678

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

22

135

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zgd-assembly1.cif.gz_B mutant r157a of fe-type nitrile hydratase from comamonas testosteroni ni1 0.6406 18 103
6c0w-assembly1.cif.gz_E cryo-em structure of human kinetochore protein cenp-n with the centromeric nucleosome containing cenp-a 0.622 85 126
3qyg-assembly4.cif.gz_H crystal structure of co-type nitrile hydratase beta-e56q from pseudomonas putida. 0.5687 20 120
3qxe-assembly3.cif.gz_F crystal structure of co-type nitrile hydratase from pseudomonas putida. 0.5676 20 120
3qz9-assembly4.cif.gz_H crystal structure of co-type nitrile hydratase beta-y215f from pseudomonas putida. 0.564 20 121
ID Description Score Start End Superfamily
3ddhB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.5021 29 101 1.10.150.240
1ireB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.4987 18 126 1.10.472.20
4fm4B01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.4925 9 123 1.10.472.20
2dd4H00 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.478 1 123 1.10.472.20
4fm4B01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.4748 9 123 1.10.472.20
ID Description Score Start End GO Terms
AF-A0A534BN14-F1-model_v4 Nitrile hydratase accessory protein 0.9678 16 95
AF-A0A1E4ZL45-F1-model_v4 Nitrile hydratase accessory protein 0.9568 17 91
AF-A0A6L7PJF4-F1-model_v4 deleted 0.9253 16 94
AF-A0A6L7KWT2-F1-model_v4 deleted 0.9201 16 94
AF-A0A537WK21-F1-model_v4 Nitrile hydratase accessory protein 0.9173 6 94

Map