F480022

General Info

Members Datasets Scaffolds Average Seq Length
770 300 1540 156

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10062848|Ga0070676_100628482
Length 189
Sequence MTTREREIVCALGFVIRASSFMRHWSLVIRHSNMAITVRRPKLNWRERMYLPAIVAGLAITIKHFKNMLFGRTKVTMQYPEQKWDDSLPDHYRGAPALVRDEDGRVRCVACQLCEFICPPRAIKIIPGEIPSVDRFAKVEKYPEEFDIDLRKDYVITGFTRADMIHHKKKLLEIGGVMHGVVLKWNEKK

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
103 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
187 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
207 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
208 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
212 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
213 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
214 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
227 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
233 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
234 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
235 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
269 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 6.36
Rhizosphere 91.95
Stem 0
Stem Tuber 0
Unclassified 14.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10062848 3300005328 Bacteria 2210
2 SwRhRL2b_contig_1910104 2162886007 Bacteria 3159
3 CNXas_1000068 3300000545 Bacteria 19320
4 JGI25406J46586_10000013 3300003203 Bacteria 101544
5 JGI25404J52841_10067304 3300003659 Unclassified 749
6 Ga0065704_10017924 3300005289 Bacteria 2184
7 Ga0065712_10003649 3300005290 Bacteria 5279
8 Ga0065712_10011882 3300005290 Bacteria 2136
9 Ga0065712_10014644 3300005290 Bacteria 2392
10 Ga0065712_10023832 3300005290 Bacteria 1726
11 Ga0065712_10083665 3300005290 Bacteria 2819
12 Ga0065712_10155846 3300005290 Bacteria 1336
13 Ga0065712_10263287 3300005290 Unclassified 932
14 Ga0065715_10001378 3300005293 Bacteria 6983
15 Ga0065715_10004488 3300005293 Bacteria 4112
16 Ga0065715_10120293 3300005293 Bacteria 2262
17 Ga0065715_10169244 3300005293 Bacteria 1549
18 Ga0065715_10175168 3300005293 Bacteria 1506
19 Ga0065707_10017302 3300005295 Bacteria 1311
20 Ga0065707_10029267 3300005295 Bacteria 1304
21 Ga0065707_10061991 3300005295 Bacteria 673
22 Ga0065707_10088040 3300005295 Bacteria 4776
23 Ga0065707_10109122 3300005295 Bacteria 2479
24 Ga0065707_10140133 3300005295 Unclassified 1778
25 Ga0070658_10285004 3300005327 Unclassified 1407
26 Ga0070658_10545610 3300005327 Bacteria 1003
27 Ga0070658_10747789 3300005327 Bacteria 849
28 Ga0070676_10003035 3300005328 Bacteria 8673
29 Ga0070676_10020916 3300005328 Bacteria 3659
30 Ga0070676_10064469 3300005328 Bacteria 2185
31 Ga0070676_10576371 3300005328 Bacteria 809
32 Ga0070683_100008804 3300005329 Bacteria 8583
33 Ga0070683_100035697 3300005329 Bacteria 4545
34 Ga0070690_100003792 3300005330 Bacteria 8324
35 Ga0070690_100117883 3300005330 Bacteria 1779
36 Ga0070690_100197384 3300005330 Bacteria 1398
37 Ga0070690_100735949 3300005330 Unclassified 760
38 Ga0070690_101032825 3300005330 Bacteria 649
39 Ga0070670_100228086 3300005331 Bacteria 1621
40 Ga0070670_100330522 3300005331 Bacteria 1337
41 Ga0070670_100521070 3300005331 Bacteria 1058
42 Ga0068869_100431254 3300005334 Unclassified 1089
43 Ga0070666_10019022 3300005335 Bacteria 4427
44 Ga0070666_10039894 3300005335 Bacteria 3131
45 Ga0070666_10074649 3300005335 Bacteria 2311
46 Ga0070680_100479046 3300005336 Bacteria 1064
47 Ga0070682_100113326 3300005337 Bacteria 1811
48 Ga0068868_100043471 3300005338 Bacteria 3509
49 Ga0068868_100085959 3300005338 Unclassified 2528
50 Ga0068868_100109937 3300005338 Bacteria 2239
51 Ga0068868_100589636 3300005338 Unclassified 983
52 Ga0068868_101030708 3300005338 Bacteria 754
53 Ga0068868_101224658 3300005338 Unclassified 695
54 Ga0070660_100276386 3300005339 Unclassified 1374
55 Ga0070660_101059156 3300005339 Unclassified 686
56 Ga0070689_100002470 3300005340 Bacteria 12072
57 Ga0070689_100122902 3300005340 Bacteria 2075
58 Ga0070689_100304313 3300005340 Bacteria 1328
59 Ga0070689_100423784 3300005340 Bacteria 1128
60 Ga0070689_100453799 3300005340 Bacteria 1091
61 Ga0070687_100001748 3300005343 Bacteria 7827
62 Ga0070687_100054247 3300005343 Unclassified 2088
63 Ga0070661_100093742 3300005344 Unclassified 2225
64 Ga0070692_10264568 3300005345 Unclassified 1035
65 Ga0070668_100002522 3300005347 Bacteria 13475
66 Ga0070668_100046772 3300005347 Bacteria 3324
67 Ga0070668_100054013 3300005347 Bacteria 3098
68 Ga0070669_100003271 3300005353 Bacteria 11648
69 Ga0070669_100006235 3300005353 Bacteria 8612
70 Ga0070669_100011971 3300005353 Bacteria 6157
71 Ga0070669_100201767 3300005353 Bacteria 1565
72 Ga0070669_100501726 3300005353 Bacteria 1007
73 Ga0070675_100000891 3300005354 Bacteria 21212
74 Ga0070675_100014880 3300005354 Bacteria 6142
75 Ga0070675_100022877 3300005354 Bacteria 4993
76 Ga0070675_100146156 3300005354 Bacteria 2024
77 Ga0070675_100212603 3300005354 Bacteria 1682
78 Ga0070675_100304627 3300005354 Bacteria 1404
79 Ga0070671_100003967 3300005355 Bacteria 11652
80 Ga0070671_100019196 3300005355 Bacteria 5561
81 Ga0070671_100021337 3300005355 Bacteria 5290
82 Ga0070671_100031498 3300005355 Bacteria 4381
83 Ga0070671_100188124 3300005355 Bacteria 1750
84 Ga0070671_100372214 3300005355 Bacteria 1220
85 Ga0070671_100759370 3300005355 Unclassified 843
86 Ga0070671_100869891 3300005355 Bacteria 787
87 Ga0070674_100002803 3300005356 Bacteria 9634
88 Ga0070674_100018230 3300005356 Bacteria 4434
89 Ga0070674_100215235 3300005356 Bacteria 1492
90 Ga0070673_100017290 3300005364 Bacteria 5122
91 Ga0070673_100035544 3300005364 Bacteria 3779
92 Ga0070673_100039111 3300005364 Bacteria 3627
93 Ga0070673_100096902 3300005364 Bacteria 2421
94 Ga0070673_100109926 3300005364 Bacteria 2284
95 Ga0070688_100070608 3300005365 Bacteria 2234
96 Ga0070659_100003834 3300005366 Bacteria 10723
97 Ga0070659_100107258 3300005366 Bacteria 2252
98 Ga0070659_100275928 3300005366 Bacteria 1398
99 Ga0070659_100772589 3300005366 Bacteria 834
100 Ga0070667_100003349 3300005367 Bacteria 13688
101 Ga0070667_100009018 3300005367 Bacteria 8255
102 Ga0070667_100096517 3300005367 Bacteria 2549
103 Ga0070667_100153953 3300005367 Bacteria 2021
104 Ga0070667_100238946 3300005367 Unclassified 1621
105 Ga0070667_100278734 3300005367 Bacteria 1501
106 Ga0070667_100626898 3300005367 Bacteria 992
107 Ga0070709_10037307 3300005434 Bacteria 2967
108 Ga0070709_10157485 3300005434 Bacteria 1576
109 Ga0070714_100024735 3300005435 Bacteria 4948
110 Ga0070710_10448004 3300005437 Bacteria 874
111 Ga0070711_100003143 3300005439 Bacteria 9578
112 Ga0070711_100022458 3300005439 Bacteria 4090
113 Ga0070711_100417110 3300005439 Bacteria 1093
114 Ga0070705_100038918 3300005440 Bacteria 2695
115 Ga0070705_100074070 3300005440 Bacteria 2069
116 Ga0070705_100085746 3300005440 Bacteria 1947
117 Ga0070700_100014925 3300005441 Bacteria 4394
118 Ga0070694_100184591 3300005444 Unclassified 1545
119 Ga0070708_100009229 3300005445 Bacteria 7953
120 Ga0070708_100049583 3300005445 Bacteria 3715
121 Ga0070708_100078300 3300005445 Bacteria 2988
122 Ga0070708_100085449 3300005445 Unclassified 2863
123 Ga0070708_100116057 3300005445 Unclassified 2465
124 Ga0070708_100119900 3300005445 Bacteria 2426
125 Ga0070708_100192354 3300005445 Bacteria 1908
126 Ga0070708_100200786 3300005445 Bacteria 1866
127 Ga0070708_100250268 3300005445 Bacteria 1665
128 Ga0070708_100323933 3300005445 Bacteria 1452
129 Ga0070708_101161622 3300005445 Bacteria 722
130 Ga0070663_100111488 3300005455 Unclassified 2056
131 Ga0070663_100399275 3300005455 Bacteria 1123
132 Ga0070678_100048156 3300005456 Bacteria 3068
133 Ga0070678_100059820 3300005456 Bacteria 2801
134 Ga0070678_100062489 3300005456 Bacteria 2750
135 Ga0070678_100245195 3300005456 Bacteria 1500
136 Ga0070678_100946833 3300005456 Bacteria 789
137 Ga0070662_100004498 3300005457 Bacteria 8833
138 Ga0070662_100086356 3300005457 Bacteria 2346
139 Ga0070662_100577337 3300005457 Bacteria 944
140 Ga0070662_100652818 3300005457 Bacteria 887
141 Ga0070662_100857398 3300005457 Bacteria 774
142 Ga0070681_10026788 3300005458 Bacteria 5795
143 Ga0068867_100081245 3300005459 Bacteria 2443
144 Ga0070685_10341372 3300005466 Unclassified 1021
145 Ga0070706_100000069 3300005467 Bacteria 119582
146 Ga0070706_100002974 3300005467 Bacteria 16804
147 Ga0070706_100027970 3300005467 Bacteria 5186
148 Ga0070706_100179533 3300005467 Bacteria 1976
149 Ga0070706_100189320 3300005467 Unclassified 1923
150 Ga0070706_100346133 3300005467 Bacteria 1386
151 Ga0070706_100347955 3300005467 Bacteria 1381
152 Ga0070707_100007646 3300005468 Bacteria 10038
153 Ga0070707_100012830 3300005468 Bacteria 7823
154 Ga0070707_100018409 3300005468 Bacteria 6570
155 Ga0070707_100028851 3300005468 Bacteria 5280
156 Ga0070707_100049897 3300005468 Bacteria 4012
157 Ga0070707_100073355 3300005468 Unclassified 3300
158 Ga0070707_100276348 3300005468 Unclassified 1633
159 Ga0070707_100379861 3300005468 Bacteria 1372
160 Ga0070707_100381138 3300005468 Bacteria 1370
161 Ga0070698_100003081 3300005471 Bacteria 18380
162 Ga0070698_100007611 3300005471 Bacteria 11720
163 Ga0070698_100105662 3300005471 Bacteria 2785
164 Ga0070698_100882620 3300005471 Bacteria 840
165 Ga0070699_100111798 3300005518 Unclassified 2399
166 Ga0070699_100148987 3300005518 Unclassified 2069
167 Ga0070699_100228255 3300005518 Bacteria 1660
168 Ga0070699_100228646 3300005518 Bacteria 1658
169 Ga0070699_100246225 3300005518 Bacteria 1597
170 Ga0070699_100272006 3300005518 Bacteria 1516
171 Ga0070679_100007246 3300005530 Bacteria 10351
172 Ga0070684_100006960 3300005535 Bacteria 8785
173 Ga0070684_100048954 3300005535 Bacteria 3667
174 Ga0070684_100210887 3300005535 Bacteria 1770
175 Ga0070697_100003834 3300005536 Bacteria 11543
176 Ga0070697_100004265 3300005536 Bacteria 10958
177 Ga0070697_100005527 3300005536 Bacteria 9747
178 Ga0070697_100010837 3300005536 Bacteria 7118
179 Ga0070697_100024293 3300005536 Bacteria 4824
180 Ga0070697_100044739 3300005536 Bacteria 3586
181 Ga0070697_100051340 3300005536 Unclassified 3350
182 Ga0070697_100079162 3300005536 Bacteria 2705
183 Ga0070697_100094082 3300005536 Bacteria 2482
184 Ga0070697_100134086 3300005536 Unclassified 2079
185 Ga0070697_100450941 3300005536 Bacteria 1120
186 Ga0070697_100542917 3300005536 Bacteria 1019
187 Ga0070697_100766934 3300005536 Unclassified 853
188 Ga0068853_100333398 3300005539 Unclassified 1408
189 Ga0070672_100005129 3300005543 Bacteria 8643
190 Ga0070672_100029502 3300005543 Bacteria 4114
191 Ga0070672_100044338 3300005543 Bacteria 3434
192 Ga0070672_100279022 3300005543 Unclassified 1412
193 Ga0070686_100057284 3300005544 Bacteria 2503
194 Ga0070695_100090587 3300005545 Bacteria 2041
195 Ga0070696_100096711 3300005546 Bacteria 2110
196 Ga0070665_100035923 3300005548 Bacteria 4985
197 Ga0070665_100067147 3300005548 Bacteria 3597
198 Ga0070665_100209370 3300005548 Bacteria 1950
199 Ga0070665_100949222 3300005548 Unclassified 872
200 Ga0070704_100106279 3300005549 Bacteria 2127
201 Ga0070704_100280614 3300005549 Bacteria 1380
202 Ga0070704_101084490 3300005549 Bacteria 727
203 Ga0068855_100715649 3300005563 Bacteria 1070
204 Ga0070664_100196567 3300005564 Unclassified 1798
205 Ga0070664_100508709 3300005564 Unclassified 1111
206 Ga0068854_100972973 3300005578 Unclassified 750
207 Ga0068856_100015700 3300005614 Bacteria 7322
208 Ga0068856_100268925 3300005614 Bacteria 1720
209 Ga0070702_100007277 3300005615 Bacteria 5293
210 Ga0068859_100016028 3300005617 Bacteria 7532
211 Ga0068864_100587614 3300005618 Unclassified 1079
212 Ga0068866_10021346 3300005718 Bacteria 2981
213 Ga0068861_100253438 3300005719 Bacteria 1503
214 Ga0068861_100498178 3300005719 Bacteria 1101
215 Ga0068861_100582601 3300005719 Bacteria 1024
216 Ga0068870_10054691 3300005840 Bacteria 2124
217 Ga0068863_100132285 3300005841 Bacteria 2382
218 Ga0068863_100309402 3300005841 Bacteria 1533
219 Ga0068858_100639271 3300005842 Unclassified 1034
220 Ga0068858_101018523 3300005842 Bacteria 812
221 Ga0068860_100005708 3300005843 Bacteria 12559
222 Ga0068860_100025690 3300005843 Bacteria 5680
223 Ga0068860_100306894 3300005843 Bacteria 1556
224 Ga0068860_100381264 3300005843 Bacteria 1392
225 Ga0068862_100006779 3300005844 Bacteria 9496
226 Ga0081455_10004180 3300005937 Bacteria 16271
227 Ga0081455_10008289 3300005937 Bacteria 10829
228 Ga0081455_10011819 3300005937 Bacteria 8742
229 Ga0081455_10046359 3300005937 Bacteria 3772
230 Ga0081455_10070554 3300005937 Unclassified 2900
231 Ga0081455_10112385 3300005937 Bacteria 2162
232 Ga0081455_10557511 3300005937 Unclassified 756
233 Ga0081540_1000016 3300005983 Bacteria 165370
234 Ga0081540_1031667 3300005983 Bacteria 2902
235 Ga0081540_1042683 3300005983 Bacteria 2337
236 Ga0081540_1109263 3300005983 Bacteria 1173
237 Ga0081539_10000098 3300005985 Bacteria 202400
238 Ga0081539_10000955 3300005985 Bacteria 54174
239 Ga0081539_10023240 3300005985 Bacteria 4068
240 Ga0081539_10070157 3300005985 Unclassified 1882
241 Ga0081539_10223261 3300005985 Bacteria 855
242 Ga0070717_10001933 3300006028 Bacteria 14469
243 Ga0070717_10015724 3300006028 Bacteria 5849
244 Ga0070717_10090475 3300006028 Bacteria 2582
245 Ga0070717_10431798 3300006028 Bacteria 1185
246 Ga0070715_10023708 3300006163 Bacteria 2407
247 Ga0070716_100014232 3300006173 Bacteria 4072
248 Ga0070716_100024002 3300006173 Bacteria 3242
249 Ga0070716_100093265 3300006173 Bacteria 1827
250 Ga0070716_100147973 3300006173 Bacteria 1507
251 Ga0070716_100165225 3300006173 Bacteria 1438
252 Ga0070716_100269323 3300006173 Bacteria 1169
253 Ga0070716_100434657 3300006173 Bacteria 953
254 Ga0070716_100489444 3300006173 Unclassified 905
255 Ga0070716_100613345 3300006173 Bacteria 820
256 Ga0070712_100002118 3300006175 Bacteria 12201
257 Ga0070712_100144080 3300006175 Bacteria 1821
258 Ga0070712_100192358 3300006175 Bacteria 1597
259 Ga0097621_100035481 3300006237 Bacteria 3986
260 Ga0097621_100222311 3300006237 Bacteria 1646
261 Ga0097621_100641305 3300006237 Unclassified 974
262 Ga0068871_100274542 3300006358 Bacteria 1473
263 Ga0068871_100529899 3300006358 Bacteria 1065
264 Ga0068871_101080006 3300006358 Unclassified 750
265 Ga0068871_101152857 3300006358 Bacteria 726
266 Ga0075428_100708824 3300006844 Bacteria 1072
267 Ga0075433_10359364 3300006852 Bacteria 1287
268 Ga0075434_100267260 3300006871 Bacteria 1729
269 Ga0075434_100342899 3300006871 Unclassified 1515
270 Ga0068865_100036203 3300006881 Bacteria 3326
271 Ga0068865_100184074 3300006881 Bacteria 1610
272 Ga0068865_100293411 3300006881 Bacteria 1299
273 Ga0068865_100321409 3300006881 Bacteria 1245
274 Ga0068865_100680435 3300006881 Bacteria 877
275 Ga0075436_100061612 3300006914 Bacteria 2592
276 Ga0075436_100094256 3300006914 Bacteria 2082
277 Ga0075436_100487012 3300006914 Bacteria 901
278 Ga0075436_100784624 3300006914 Bacteria 709
279 Ga0097620_100016028 3300006931 Bacteria 7532
280 Ga0075435_100197255 3300007076 Bacteria 1705
281 Ga0075435_100271928 3300007076 Bacteria 1445
282 Ga0099795_10052766 3300007788 Bacteria 1486
283 Ga0099795_10065263 3300007788 Bacteria 1361
284 Ga0105240_10818894 3300009093 Unclassified 1007
285 Ga0111539_10432807 3300009094 Bacteria 1532
286 Ga0111539_10522762 3300009094 Bacteria 1382
287 Ga0111539_11214147 3300009094 Unclassified 876
288 Ga0105245_10078596 3300009098 Bacteria 3010
289 Ga0105245_10128882 3300009098 Bacteria 2371
290 Ga0114129_10006389 3300009147 Bacteria 16713
291 Ga0114129_10209723 3300009147 Bacteria 2634
292 Ga0105243_10110641 3300009148 Bacteria 2298
293 Ga0105243_10224406 3300009148 Unclassified 1663
294 Ga0105241_10219647 3300009174 Bacteria 1597
295 Ga0105242_10097677 3300009176 Bacteria 2483
296 Ga0105242_11014415 3300009176 Bacteria 838
297 Ga0105248_10203938 3300009177 Bacteria 2228
298 Ga0105249_10003175 3300009553 Bacteria 14217
299 Ga0105249_10186022 3300009553 Bacteria 2024
300 Ga0105239_10142770 3300010375 Bacteria 2669
301 Ga0105239_10470658 3300010375 Bacteria 1427
302 Ga0105239_10540280 3300010375 Bacteria 1327
303 Ga0105239_11707918 3300010375 Bacteria 729
304 Ga0157323_1024160 3300012495 Bacteria 602
305 Ga0157316_1013708 3300012510 Bacteria 796
306 Ga0157373_10419080 3300013100 Bacteria 961
307 Ga0157371_10066759 3300013102 Bacteria 2547
308 Ga0157371_10534354 3300013102 Unclassified 868
309 Ga0157369_10830284 3300013105 Unclassified 949
310 Ga0157374_10067592 3300013296 Bacteria 3360
311 Ga0157374_10078973 3300013296 Bacteria 3117
312 Ga0157374_10152927 3300013296 Bacteria 2244
313 Ga0157374_10193527 3300013296 Bacteria 1989
314 Ga0157374_10198974 3300013296 Unclassified 1962
315 Ga0157374_10395696 3300013296 Bacteria 1378
316 Ga0157374_10428075 3300013296 Unclassified 1323
317 Ga0157374_10435526 3300013296 Bacteria 1311
318 Ga0157378_10004778 3300013297 Bacteria 11870
319 Ga0157378_10033903 3300013297 Bacteria 4516
320 Ga0157378_10082491 3300013297 Bacteria 2907
321 Ga0157378_10125941 3300013297 Unclassified 2366
322 Ga0157378_10137931 3300013297 Bacteria 2263
323 Ga0157378_10166297 3300013297 Bacteria 2066
324 Ga0157378_10234626 3300013297 Unclassified 1750
325 Ga0157378_10309028 3300013297 Bacteria 1533
326 Ga0157378_10311259 3300013297 Bacteria 1527
327 Ga0157378_10396472 3300013297 Bacteria 1359
328 Ga0157378_10682466 3300013297 Bacteria 1045
329 Ga0157378_10807733 3300013297 Unclassified 964
330 Ga0157378_11547688 3300013297 Bacteria 708
331 Ga0163162_10002011 3300013306 Bacteria 19136
332 Ga0163162_10004028 3300013306 Bacteria 14105
333 Ga0163162_10060910 3300013306 Bacteria 3811
334 Ga0163162_10129679 3300013306 Bacteria 2630
335 Ga0163162_10177059 3300013306 Bacteria 2258
336 Ga0163162_10285866 3300013306 Bacteria 1781
337 Ga0163162_10790071 3300013306 Bacteria 1067
338 Ga0163162_10944996 3300013306 Bacteria 973
339 Ga0163162_10960224 3300013306 Bacteria 965
340 Ga0157372_10033136 3300013307 Bacteria 5672
341 Ga0157372_10037305 3300013307 Bacteria 5360
342 Ga0157372_10183654 3300013307 Bacteria 2422
343 Ga0157372_10498989 3300013307 Bacteria 1419
344 Ga0157375_10002896 3300013308 Bacteria 14866
345 Ga0157375_10012222 3300013308 Bacteria 7612
346 Ga0157375_10019369 3300013308 Bacteria 6189
347 Ga0157375_10051925 3300013308 Bacteria 4028
348 Ga0157375_10319589 3300013308 Bacteria 1717
349 Ga0157375_10427667 3300013308 Bacteria 1490
350 Ga0163163_10046256 3300014325 Bacteria 4275
351 Ga0163163_10387645 3300014325 Bacteria 1455
352 Ga0163163_10457296 3300014325 Bacteria 1337
353 Ga0163163_11639981 3300014325 Unclassified 704
354 Ga0182008_10054458 3300014497 Bacteria 1979
355 Ga0157377_10128910 3300014745 Bacteria 1542
356 Ga0157377_10183334 3300014745 Bacteria 1318
357 Ga0157379_10007103 3300014968 Bacteria 9684
358 Ga0157379_10254903 3300014968 Bacteria 1593
359 Ga0157376_10030155 3300014969 Bacteria 4327
360 Ga0157376_10030588 3300014969 Bacteria 4301
361 Ga0157376_10084632 3300014969 Bacteria 2731
362 Ga0157376_10092717 3300014969 Bacteria 2619
363 Ga0157376_10344879 3300014969 Bacteria 1423
364 Ga0157376_10500257 3300014969 Bacteria 1194
365 Ga0163161_10002526 3300017792 Bacteria 13052
366 Ga0163161_10379947 3300017792 Bacteria 1129
367 Ga0213876_10008009 3300021384 Bacteria 5729
368 Ga0207666_1003972 3300025271 Bacteria 1837
369 Ga0207666_1008568 3300025271 Bacteria 1369
370 Ga0207666_1011759 3300025271 Bacteria 1214
371 Ga0207673_1001175 3300025290 Bacteria 2819
372 Ga0207673_1001629 3300025290 Bacteria 2478
373 Ga0207673_1028349 3300025290 Bacteria 771
374 Ga0207697_10000755 3300025315 Bacteria 18305
375 Ga0207697_10000828 3300025315 Bacteria 17552
376 Ga0207697_10001223 3300025315 Bacteria 14056
377 Ga0207697_10003956 3300025315 Bacteria 7204
378 Ga0207697_10004502 3300025315 Bacteria 6647
379 Ga0207697_10004577 3300025315 Bacteria 6578
380 Ga0207697_10053916 3300025315 Bacteria 1666
381 Ga0207697_10068623 3300025315 Bacteria 1483
382 Ga0207697_10105531 3300025315 Unclassified 1204
383 Ga0207682_10010944 3300025893 Bacteria 3551
384 Ga0207642_10050697 3300025899 Bacteria 1874
385 Ga0207710_10290884 3300025900 Bacteria 824
386 Ga0207688_10002382 3300025901 Bacteria 10118
387 Ga0207688_10015901 3300025901 Bacteria 4080
388 Ga0207688_10180203 3300025901 Bacteria 1260
389 Ga0207688_10488098 3300025901 Bacteria 770
390 Ga0207680_10022099 3300025903 Bacteria 3454
391 Ga0207680_10038185 3300025903 Bacteria 2778
392 Ga0207680_10364772 3300025903 Unclassified 1016
393 Ga0207647_10016578 3300025904 Bacteria 5024
394 Ga0207647_10180482 3300025904 Bacteria 1226
395 Ga0207685_10064708 3300025905 Bacteria 1461
396 Ga0207699_10268156 3300025906 Bacteria 1182
397 Ga0207699_10356846 3300025906 Unclassified 1033
398 Ga0207699_10481703 3300025906 Bacteria 894
399 Ga0207645_10001169 3300025907 Bacteria 21649
400 Ga0207645_10003105 3300025907 Bacteria 12725
401 Ga0207645_10022441 3300025907 Bacteria 4106
402 Ga0207645_10300997 3300025907 Bacteria 1068
403 Ga0207643_10213216 3300025908 Bacteria 1179
404 Ga0207705_10094245 3300025909 Bacteria 2195
405 Ga0207684_10000243 3300025910 Bacteria 81628
406 Ga0207684_10000678 3300025910 Bacteria 40382
407 Ga0207684_10018778 3300025910 Bacteria 5916
408 Ga0207684_10063638 3300025910 Bacteria 3131
409 Ga0207684_10076528 3300025910 Bacteria 2844
410 Ga0207684_10108783 3300025910 Bacteria 2372
411 Ga0207684_10122743 3300025910 Unclassified 2228
412 Ga0207684_10134384 3300025910 Bacteria 2123
413 Ga0207684_10230314 3300025910 Bacteria 1599
414 Ga0207684_10339994 3300025910 Unclassified 1293
415 Ga0207684_10389823 3300025910 Unclassified 1198
416 Ga0207684_10444590 3300025910 Bacteria 1113
417 Ga0207684_10668981 3300025910 Bacteria 884
418 Ga0207707_10340453 3300025912 Bacteria 1293
419 Ga0207671_10023180 3300025914 Bacteria 4683
420 Ga0207693_10001887 3300025915 Bacteria 18332
421 Ga0207693_10042963 3300025915 Unclassified 3558
422 Ga0207693_10046274 3300025915 Bacteria 3418
423 Ga0207693_10056411 3300025915 Bacteria 3080
424 Ga0207693_10104325 3300025915 Bacteria 2223
425 Ga0207693_10118255 3300025915 Bacteria 2081
426 Ga0207693_10239216 3300025915 Bacteria 1425
427 Ga0207693_10363914 3300025915 Bacteria 1132
428 Ga0207663_10035895 3300025916 Bacteria 2978
429 Ga0207663_10247121 3300025916 Bacteria 1311
430 Ga0207663_10402688 3300025916 Bacteria 1047
431 Ga0207660_10387729 3300025917 Unclassified 1124
432 Ga0207662_10001034 3300025918 Bacteria 13038
433 Ga0207662_10121121 3300025918 Bacteria 1641
434 Ga0207662_10140833 3300025918 Bacteria 1528
435 Ga0207657_10030149 3300025919 Bacteria 4928
436 Ga0207657_10102622 3300025919 Bacteria 2372
437 Ga0207649_10019327 3300025920 Bacteria 3892
438 Ga0207649_10103428 3300025920 Bacteria 1889
439 Ga0207652_10026085 3300025921 Bacteria 4864
440 Ga0207646_10008549 3300025922 Bacteria 10240
441 Ga0207646_10028835 3300025922 Bacteria 5049
442 Ga0207646_10037448 3300025922 Bacteria 4373
443 Ga0207646_10056585 3300025922 Bacteria 3505
444 Ga0207646_10075000 3300025922 Bacteria 3022
445 Ga0207646_10075391 3300025922 Bacteria 3014
446 Ga0207646_10177780 3300025922 Bacteria 1922
447 Ga0207646_10216450 3300025922 Archaea 1730
448 Ga0207646_10963138 3300025922 Unclassified 755
449 Ga0207681_10018767 3300025923 Bacteria 4362
450 Ga0207681_10198959 3300025923 Bacteria 1537
451 Ga0207681_10249048 3300025923 Bacteria 1386
452 Ga0207681_10290409 3300025923 Bacteria 1290
453 Ga0207681_10455474 3300025923 Bacteria 1041
454 Ga0207650_10094925 3300025925 Unclassified 2286
455 Ga0207650_10131641 3300025925 Bacteria 1958
456 Ga0207650_10204555 3300025925 Bacteria 1583
457 Ga0207650_10849920 3300025925 Bacteria 774
458 Ga0207659_10027113 3300025926 Bacteria 3875
459 Ga0207659_10054673 3300025926 Bacteria 2852
460 Ga0207659_10061695 3300025926 Bacteria 2703
461 Ga0207659_10063174 3300025926 Bacteria 2676
462 Ga0207659_10067388 3300025926 Bacteria 2600
463 Ga0207659_10270732 3300025926 Bacteria 1385
464 Ga0207687_10308524 3300025927 Bacteria 1277
465 Ga0207687_10556389 3300025927 Unclassified 963
466 Ga0207700_10050767 3300025928 Bacteria 3092
467 Ga0207700_10051167 3300025928 Unclassified 3081
468 Ga0207664_10023751 3300025929 Bacteria 4599
469 Ga0207664_10309072 3300025929 Bacteria 1392
470 Ga0207664_10373520 3300025929 Unclassified 1265
471 Ga0207664_11181259 3300025929 Bacteria 683
472 Ga0207664_11552107 3300025929 Unclassified 584
473 Ga0207644_10012217 3300025931 Bacteria 5699
474 Ga0207644_10038418 3300025931 Bacteria 3372
475 Ga0207644_10100758 3300025931 Bacteria 2169
476 Ga0207644_10170625 3300025931 Bacteria 1698
477 Ga0207690_10009587 3300025932 Bacteria 5750
478 Ga0207690_10204138 3300025932 Bacteria 1503
479 Ga0207690_10303183 3300025932 Bacteria 1250
480 Ga0207690_10369994 3300025932 Bacteria 1137
481 Ga0207706_10001581 3300025933 Bacteria 22594
482 Ga0207706_10013480 3300025933 Bacteria 7429
483 Ga0207706_10059230 3300025933 Bacteria 3373
484 Ga0207706_10108739 3300025933 Bacteria 2440
485 Ga0207706_10120344 3300025933 Bacteria 2308
486 Ga0207706_10410656 3300025933 Unclassified 1173
487 Ga0207706_10537481 3300025933 Bacteria 1007
488 Ga0207706_10665888 3300025933 Bacteria 891
489 Ga0207686_10138685 3300025934 Bacteria 1678
490 Ga0207686_10141938 3300025934 Bacteria 1661
491 Ga0207686_10853207 3300025934 Unclassified 733
492 Ga0207709_10031546 3300025935 Bacteria 3096
493 Ga0207670_10002791 3300025936 Bacteria 9206
494 Ga0207670_10013204 3300025936 Bacteria 4861
495 Ga0207670_10023627 3300025936 Bacteria 3830
496 Ga0207670_10262826 3300025936 Bacteria 1338
497 Ga0207670_10362301 3300025936 Bacteria 1151
498 Ga0207669_10036686 3300025937 Unclassified 2804
499 Ga0207669_10054942 3300025937 Bacteria 2408
500 Ga0207669_10099678 3300025937 Bacteria 1916
501 Ga0207704_10012932 3300025938 Bacteria 4159
502 Ga0207704_10266591 3300025938 Bacteria 1294
503 Ga0207704_10538807 3300025938 Bacteria 947
504 Ga0207665_10021810 3300025939 Bacteria 4212
505 Ga0207665_10031461 3300025939 Bacteria 3511
506 Ga0207665_10033671 3300025939 Bacteria 3398
507 Ga0207665_10046718 3300025939 Bacteria 2901
508 Ga0207665_10075789 3300025939 Bacteria 2305
509 Ga0207665_10113696 3300025939 Bacteria 1905
510 Ga0207665_10329120 3300025939 Bacteria 1148
511 Ga0207691_10000821 3300025940 Bacteria 30956
512 Ga0207691_10001137 3300025940 Bacteria 26402
513 Ga0207691_10238035 3300025940 Bacteria 1574
514 Ga0207691_10238208 3300025940 Bacteria 1574
515 Ga0207691_10456142 3300025940 Bacteria 1087
516 Ga0207689_10154583 3300025942 Bacteria 1891
517 Ga0207689_10415946 3300025942 Bacteria 1121
518 Ga0207661_10014613 3300025944 Bacteria 5758
519 Ga0207661_10278807 3300025944 Bacteria 1493
520 Ga0207679_10129073 3300025945 Bacteria 2025
521 Ga0207679_10520823 3300025945 Bacteria 1063
522 Ga0207667_11330066 3300025949 Unclassified 694
523 Ga0207667_11477015 3300025949 Bacteria 651
524 Ga0207651_10007082 3300025960 Bacteria 5952
525 Ga0207712_10016870 3300025961 Bacteria 4735
526 Ga0207668_10010719 3300025972 Bacteria 5547
527 Ga0207668_10055952 3300025972 Bacteria 2745
528 Ga0207668_10194160 3300025972 Bacteria 1611
529 Ga0207668_10239795 3300025972 Bacteria 1466
530 Ga0207668_11229516 3300025972 Unclassified 673
531 Ga0207658_10003337 3300025986 Bacteria 11394
532 Ga0207658_10199239 3300025986 Unclassified 1670
533 Ga0207658_10677855 3300025986 Unclassified 930
534 Ga0207677_10178004 3300026023 Bacteria 1670
535 Ga0207677_10267776 3300026023 Bacteria 1396
536 Ga0207677_10417786 3300026023 Bacteria 1142
537 Ga0207677_10636852 3300026023 Bacteria 939
538 Ga0207703_10056987 3300026035 Bacteria 3184
539 Ga0207703_10627487 3300026035 Bacteria 1018
540 Ga0207703_11198876 3300026035 Bacteria 730
541 Ga0207639_10977301 3300026041 Unclassified 793
542 Ga0207678_10134668 3300026067 Unclassified 2108
543 Ga0207678_10534682 3300026067 Bacteria 1024
544 Ga0207708_10082442 3300026075 Bacteria 2472
545 Ga0207708_10262807 3300026075 Bacteria 1394
546 Ga0207702_11228676 3300026078 Unclassified 743
547 Ga0207641_10017031 3300026088 Bacteria 5948
548 Ga0207641_11694182 3300026088 Bacteria 634
549 Ga0207648_10010975 3300026089 Bacteria 8557
550 Ga0207676_10014653 3300026095 Bacteria 5646
551 Ga0207676_10659786 3300026095 Bacteria 1010
552 Ga0207674_10779242 3300026116 Unclassified 923
553 Ga0207675_100124252 3300026118 Bacteria 2443
554 Ga0207675_101067230 3300026118 Unclassified 827
555 Ga0207683_10002463 3300026121 Bacteria 16141
556 Ga0207683_10069737 3300026121 Bacteria 3105
557 Ga0207683_10074640 3300026121 Bacteria 3000
558 Ga0209982_1043283 3300027552 Bacteria 720
559 Ga0209998_10016779 3300027717 Bacteria 1542
560 Ga0268266_10026334 3300028379 Bacteria 4947
561 Ga0268266_10077047 3300028379 Unclassified 2898
562 Ga0268266_11109131 3300028379 Bacteria 765
563 Ga0268264_10117435 3300028381 Bacteria 2340
564 Ga0307513_10194465 3300031456 Bacteria 1876
565 Ga0307414_10306826 3300032004 Bacteria 1345
566 Ga0307414_11118576 3300032004 Bacteria 728
567 Ga0373948_0110074 3300034817 Bacteria 657
568 Ga0373944_0042340 3300035089 Unclassified 1412
569 Ga0373939_0181163 3300035114 Bacteria 786
570 Ga0373939_0283956 3300035114 Unclassified 655
571 Ga0373956_0301239 3300035119 Bacteria 764
572 Ga0373943_0237549 3300035170 Unclassified 1020
573 Ga0373946_0141030 3300035171 Bacteria 1117
574 Ga0373946_0301715 3300035171 Bacteria 792
575 Ga0316574_0105748 3300035398 Bacteria 1803
576 Ga0373931_0076953 3300035691 Unclassified 1834
577 Ga0373931_0123215 3300035691 Bacteria 1484
578 Ga0373931_0129165 3300035691 Bacteria 1453
579 Ga0373931_0581200 3300035691 Bacteria 731
580 Ga0373935_0050686 3300035692 Bacteria 2635
581 Ga0373935_0109124 3300035692 Unclassified 1835
582 Ga0373927_0027026 3300035695 Bacteria 3750
583 Ga0373927_0085328 3300035695 Bacteria 2049
584 Ga0373927_0114338 3300035695 Bacteria 1759
585 Ga0373927_0682932 3300035695 Unclassified 678
586 Ga0373933_0070517 3300035724 Bacteria 2126
587 Ga0373933_0079171 3300035724 Bacteria 2012
588 Ga0373947_0014513 3300035725 Bacteria 4521
589 Ga0373947_0078415 3300035725 Bacteria 2039
590 Ga0373937_0698633 3300036401 Bacteria 961
591 Ga0373937_1538734 3300036401 Unclassified 612
592 Ga0373925_0031403 3300037068 Bacteria 3903
593 Ga0373925_0088629 3300037068 Bacteria 2363
594 Ga0373925_0112867 3300037068 Bacteria 2101
595 Ga0373925_0197291 3300037068 Bacteria 1599
596 Ga0373925_0390346 3300037068 Bacteria 1134
597 Ga0395900_0020916 3300037418 Bacteria 6686
598 Ga0395900_0021440 3300037418 Bacteria 6606
599 Ga0395900_0413496 3300037418 Bacteria 1311
600 Ga0395900_1246511 3300037418 Bacteria 658
601 Ga0395900_1566803 3300037418 Unclassified 570
602 Ga0395898_0056095 3300037466 Bacteria 3842
603 Ga0395898_0153865 3300037466 Bacteria 2200
604 Ga0395898_1174981 3300037466 Bacteria 699
605 Ga0395905_0098882 3300037471 Bacteria 2740
606 Ga0395905_0174087 3300037471 Bacteria 2021
607 Ga0395905_0966388 3300037471 Bacteria 755
608 Ga0395901_0016930 3300038443 Bacteria 7430
609 Ga0395901_0019052 3300038443 Bacteria 7017
610 Ga0436365_0404877 3300039437 Bacteria 1301
611 Ga0436365_0728609 3300039437 Bacteria 41731
612 Ga0436365_0729678 3300039437 Bacteria 786
613 Ga0436365_1843395 3300039437 Bacteria 8599
614 Ga0436363_0519400 3300039450 Bacteria 15266
615 Ga0436362_0117015 3300039453 Unclassified 989
616 Ga0451835_1061780 3300041492 Unclassified 778
617 Ga0451849_0382894 3300041505 Bacteria 773
618 Ga0451849_0733666 3300041505 Unclassified 867
619 Ga0451853_1600929 3300041512 Bacteria 952
620 Ga0439448_0012397 3300042005 Bacteria 2552
621 Ga0439451_015796 3300042009 Bacteria 1522
622 Ga0439451_085414 3300042009 Bacteria 635
623 Ga0439454_032782 3300042011 Bacteria 821
624 Ga0439455_0050894 3300042012 Bacteria 1082
625 Ga0439460_0147917 3300042461 Unclassified 782
626 Ga0466964_0051234 3300044706 Bacteria 1695
627 Ga0451576_0047906 3300045051 Bacteria 4492
628 Ga0451576_1031788 3300045051 Bacteria 862
629 Ga0466967_0248092 3300045976 Bacteria 1700
630 Ga0495592_0105244 3300046454 Unclassified 2004
631 Ga0495592_0794079 3300046454 Unclassified 563
632 Ga0495629_0030432 3300046459 Bacteria 3827
633 Ga0495638_0134761 3300046460 Bacteria 1448
634 Ga0495653_0554063 3300046463 Bacteria 711
635 Ga0495650_0137936 3300046471 Bacteria 885
636 Ga0495605_0090777 3300046474 Bacteria 1416
637 Ga0495584_0419282 3300046491 Bacteria 680
638 Ga0495585_0121968 3300046492 Bacteria 1378
639 Ga0495596_0122319 3300046500 Bacteria 1010
640 Ga0495607_0074000 3300046501 Bacteria 1892
641 Ga0495608_0242313 3300046511 Bacteria 1126
642 Ga0495616_0133003 3300046513 Bacteria 1138
643 Ga0495628_0208984 3300046516 Bacteria 1469
644 Ga0495628_0395394 3300046516 Bacteria 1010
645 Ga0495630_0463452 3300046517 Bacteria 971
646 Ga0495631_0224016 3300046518 Bacteria 802
647 Ga0495631_0355666 3300046518 Bacteria 623
648 Ga0495637_0091522 3300046520 Bacteria 1199
649 Ga0495637_0193164 3300046520 Bacteria 750
650 Ga0495663_0015576 3300046525 Bacteria 2142
651 Ga0495642_0153978 3300046528 Bacteria 995
652 Ga0495652_0012948 3300046529 Bacteria 7517
653 Ga0495654_0082704 3300046530 Bacteria 1502
654 Ga0495640_0090699 3300046533 Bacteria 2017
655 Ga0495640_0595796 3300046533 Unclassified 668
656 Ga0495586_0068633 3300046535 Unclassified 1934
657 Ga0495586_0336020 3300046535 Bacteria 867
658 Ga0495587_0423793 3300046536 Bacteria 738
659 Ga0495587_0643262 3300046536 Bacteria 583
660 Ga0495598_0043889 3300046537 Bacteria 1318
661 Ga0495598_0046375 3300046537 Bacteria 1292
662 Ga0495598_0202402 3300046537 Bacteria 718
663 Ga0495645_0024556 3300046543 Bacteria 4374
664 Ga0495645_0284536 3300046543 Bacteria 1086
665 Ga0495667_0082554 3300046559 Unclassified 2088
666 Ga0495667_0224979 3300046559 Bacteria 1197
667 Ga0495656_0011773 3300046615 Bacteria 3214
668 Ga0495668_0463499 3300046616 Bacteria 698
669 Ga0495634_0240567 3300046642 Bacteria 1110
670 Ga0495611_0150769 3300046648 Bacteria 1085
671 Ga0495625_0436100 3300046660 Bacteria 812
672 Ga0495659_0059104 3300046664 Bacteria 1412
673 Ga0495659_0217800 3300046664 Bacteria 787
674 Ga0495661_0205563 3300046665 Bacteria 1028
675 Ga0495657_0543828 3300046675 Archaea 675
676 Ga0495599_0006212 3300046678 Bacteria 7199
677 Ga0495623_0172290 3300046679 Unclassified 1263
678 Ga0495646_0021386 3300046680 Bacteria 4086
679 Ga0495658_0324673 3300046683 Bacteria 976
680 Ga0495658_0354796 3300046683 Unclassified 932
681 Ga0495669_0019922 3300046684 Bacteria 2897
682 Ga0495669_0066657 3300046684 Bacteria 1635
683 Ga0495669_0074562 3300046684 Bacteria 1551
684 Ga0495669_0130498 3300046684 Bacteria 1183
685 Ga0495671_0076743 3300046692 Bacteria 1638
686 Ga0495649_0332418 3300046694 Bacteria 770
687 Ga0495589_0343971 3300046794 Bacteria 687
688 Ga0495600_0224593 3300046809 Unclassified 1201
689 Ga0495660_0253499 3300046810 Bacteria 815
690 Ga0495604_0181838 3300047317 Unclassified 1470
691 Ga0495604_0602814 3300047317 Archaea 704
692 Ga0495636_0093424 3300047318 Bacteria 1308
693 Ga0495674_0086081 3300047319 Bacteria 2691
694 Ga0495674_0879587 3300047319 Bacteria 693
695 Ga0495680_0400273 3300047322 Unclassified 948
696 Ga0495683_0175503 3300047323 Bacteria 982
697 Ga0495675_0031211 3300047444 Bacteria 3401
698 Ga0495685_085218 3300047447 Bacteria 1050
699 Ga0495681_0083772 3300047470 Bacteria 1419
700 Ga0495684_0049809 3300047471 Bacteria 3200
701 Ga0495684_0838248 3300047471 Archaea 597
702 Ga0495593_0165985 3300047673 Bacteria 1114
703 Ga0495602_0013044 3300048088 Bacteria 8500
704 Ga0495615_0047592 3300048090 Bacteria 1093
705 Ga0496100_0004564 3300048903 Bacteria 7359
706 Ga0496100_0087757 3300048903 Bacteria 2116
707 Ga0496101_0003338 3300048904 Bacteria 9995
708 Ga0496102_0013039 3300048905 Bacteria 7195
709 Ga0496102_0452715 3300048905 Bacteria 1204
710 Ga0496102_0459017 3300048905 Unclassified 1195
711 Ga0496102_0831492 3300048905 Bacteria 846
712 Ga0496103_0021206 3300048906 Bacteria 3909
713 Ga0496103_0188281 3300048906 Bacteria 1327
714 Ga0496104_0100289 3300048907 Bacteria 2772
715 Ga0496104_0103827 3300048907 Bacteria 2723
716 Ga0496104_1054662 3300048907 Unclassified 716
717 Ga0496105_0076495 3300048908 Bacteria 2764
718 Ga0496105_0190877 3300048908 Bacteria 1675
719 Ga0496105_0414439 3300048908 Bacteria 1067
720 Ga0496106_0003216 3300048909 Bacteria 12236
721 Ga0496107_0004569 3300048910 Bacteria 9379
722 Ga0496108_0187093 3300048911 Bacteria 1794
723 Ga0496108_0191272 3300048911 Bacteria 1774
724 Ga0496108_0202879 3300048911 Bacteria 1721
725 Ga0496108_0208801 3300048911 Unclassified 1695
726 Ga0496108_0263214 3300048911 Bacteria 1501
727 Ga0496109_0048009 3300048912 Bacteria 3884
728 Ga0496109_0053182 3300048912 Bacteria 3692
729 Ga0496109_0194248 3300048912 Bacteria 1907
730 Ga0496109_0406674 3300048912 Bacteria 1286
731 Ga0496109_0465558 3300048912 Bacteria 1194
732 Ga0496110_0240208 3300048913 Bacteria 1648
733 Ga0496110_0671803 3300048913 Bacteria 936
734 Ga0496111_0129468 3300048914 Bacteria 1867
735 Ga0496112_0055195 3300048915 Bacteria 3905
736 Ga0496112_0068761 3300048915 Bacteria 3498
737 Ga0496112_0087873 3300048915 Bacteria 3076
738 Ga0496112_0268172 3300048915 Bacteria 1656
739 Ga0496112_0366698 3300048915 Bacteria 1382
740 Ga0496112_0750309 3300048915 Bacteria 902
741 Ga0496112_0841595 3300048915 Bacteria 841
742 Ga0496112_0926560 3300048915 Unclassified 793
743 Ga0496113_0155806 3300048916 Bacteria 1804
744 Ga0496113_0456888 3300048916 Bacteria 1026
745 Ga0496113_0630041 3300048916 Unclassified 858
746 Ga0496114_0045686 3300048917 Bacteria 3639
747 Ga0496114_0157983 3300048917 Bacteria 1970
748 Ga0496114_0308599 3300048917 Bacteria 1397
749 Ga0496115_0020298 3300048918 Bacteria 5125
750 Ga0496115_0044764 3300048918 Bacteria 3532
751 Ga0496115_0055463 3300048918 Bacteria 3183
752 Ga0496115_0113687 3300048918 Bacteria 2225
753 Ga0496115_0619401 3300048918 Unclassified 859
754 Ga0496126_0458577 3300048929 Bacteria 1025
755 nmdc:mga05p37_25646_c1 3300050507 Bacteria 7170
756 nmdc:mga05p37_308686_c1 3300050507 Bacteria 1876
757 nmdc:mga05p37_814535_c1 3300050507 Bacteria 1019
758 nmdc:mga08y16_209033_c1 3300050511 Bacteria 2021
759 nmdc:mga08y16_418582_c1 3300050511 Bacteria 1369
760 nmdc:mga08y16_641345_c1 3300050511 Bacteria 1067
761 nmdc:mga0n895_860662_c1 3300050512 Unclassified 894
762 nmdc:mga0rr50_166949_c1 3300050513 Bacteria 1790
763 nmdc:mga0rr50_663684_c1 3300050513 Unclassified 890
764 nmdc:mga08x19_278625_c1 3300050514 Bacteria 1158
765 nmdc:mga0a205_821189_c1 3300050515 Bacteria 777
766 Ga0495601_0065102 3300053077 Unclassified 2319
767 Ga0495601_0427657 3300053077 Unclassified 857
768 Ga0495655_0009929 3300053083 Bacteria 1863
769 Ga0495619_0476039 3300053085 Bacteria 860
770 Ga0500559_0038472 3300053136 Bacteria 2078
771 Ga0070676_10062848
772 SwRhRL2b_contig_1910104
773 CNXas_1000068
774 JGI25406J46586_10000013
775 JGI25404J52841_10067304
776 Ga0065704_10017924
777 Ga0065712_10003649
778 Ga0065712_10011882
779 Ga0065712_10014644
780 Ga0065712_10023832
781 Ga0065712_10083665
782 Ga0065712_10155846
783 Ga0065712_10263287
784 Ga0065715_10001378
785 Ga0065715_10004488
786 Ga0065715_10120293
787 Ga0065715_10169244
788 Ga0065715_10175168
789 Ga0065707_10017302
790 Ga0065707_10029267
791 Ga0065707_10061991
792 Ga0065707_10088040
793 Ga0065707_10109122
794 Ga0065707_10140133
795 Ga0070658_10285004
796 Ga0070658_10545610
797 Ga0070658_10747789
798 Ga0070676_10003035
799 Ga0070676_10020916
800 Ga0070676_10064469
801 Ga0070676_10576371
802 Ga0070683_100008804
803 Ga0070683_100035697
804 Ga0070690_100003792
805 Ga0070690_100117883
806 Ga0070690_100197384
807 Ga0070690_100735949
808 Ga0070690_101032825
809 Ga0070670_100228086
810 Ga0070670_100330522
811 Ga0070670_100521070
812 Ga0068869_100431254
813 Ga0070666_10019022
814 Ga0070666_10039894
815 Ga0070666_10074649
816 Ga0070680_100479046
817 Ga0070682_100113326
818 Ga0068868_100043471
819 Ga0068868_100085959
820 Ga0068868_100109937
821 Ga0068868_100589636
822 Ga0068868_101030708
823 Ga0068868_101224658
824 Ga0070660_100276386
825 Ga0070660_101059156
826 Ga0070689_100002470
827 Ga0070689_100122902
828 Ga0070689_100304313
829 Ga0070689_100423784
830 Ga0070689_100453799
831 Ga0070687_100001748
832 Ga0070687_100054247
833 Ga0070661_100093742
834 Ga0070692_10264568
835 Ga0070668_100002522
836 Ga0070668_100046772
837 Ga0070668_100054013
838 Ga0070669_100003271
839 Ga0070669_100006235
840 Ga0070669_100011971
841 Ga0070669_100201767
842 Ga0070669_100501726
843 Ga0070675_100000891
844 Ga0070675_100014880
845 Ga0070675_100022877
846 Ga0070675_100146156
847 Ga0070675_100212603
848 Ga0070675_100304627
849 Ga0070671_100003967
850 Ga0070671_100019196
851 Ga0070671_100021337
852 Ga0070671_100031498
853 Ga0070671_100188124
854 Ga0070671_100372214
855 Ga0070671_100759370
856 Ga0070671_100869891
857 Ga0070674_100002803
858 Ga0070674_100018230
859 Ga0070674_100215235
860 Ga0070673_100017290
861 Ga0070673_100035544
862 Ga0070673_100039111
863 Ga0070673_100096902
864 Ga0070673_100109926
865 Ga0070688_100070608
866 Ga0070659_100003834
867 Ga0070659_100107258
868 Ga0070659_100275928
869 Ga0070659_100772589
870 Ga0070667_100003349
871 Ga0070667_100009018
872 Ga0070667_100096517
873 Ga0070667_100153953
874 Ga0070667_100238946
875 Ga0070667_100278734
876 Ga0070667_100626898
877 Ga0070709_10037307
878 Ga0070709_10157485
879 Ga0070714_100024735
880 Ga0070710_10448004
881 Ga0070711_100003143
882 Ga0070711_100022458
883 Ga0070711_100417110
884 Ga0070705_100038918
885 Ga0070705_100074070
886 Ga0070705_100085746
887 Ga0070700_100014925
888 Ga0070694_100184591
889 Ga0070708_100009229
890 Ga0070708_100049583
891 Ga0070708_100078300
892 Ga0070708_100085449
893 Ga0070708_100116057
894 Ga0070708_100119900
895 Ga0070708_100192354
896 Ga0070708_100200786
897 Ga0070708_100250268
898 Ga0070708_100323933
899 Ga0070708_101161622
900 Ga0070663_100111488
901 Ga0070663_100399275
902 Ga0070678_100048156
903 Ga0070678_100059820
904 Ga0070678_100062489
905 Ga0070678_100245195
906 Ga0070678_100946833
907 Ga0070662_100004498
908 Ga0070662_100086356
909 Ga0070662_100577337
910 Ga0070662_100652818
911 Ga0070662_100857398
912 Ga0070681_10026788
913 Ga0068867_100081245
914 Ga0070685_10341372
915 Ga0070706_100000069
916 Ga0070706_100002974
917 Ga0070706_100027970
918 Ga0070706_100179533
919 Ga0070706_100189320
920 Ga0070706_100346133
921 Ga0070706_100347955
922 Ga0070707_100007646
923 Ga0070707_100012830
924 Ga0070707_100018409
925 Ga0070707_100028851
926 Ga0070707_100049897
927 Ga0070707_100073355
928 Ga0070707_100276348
929 Ga0070707_100379861
930 Ga0070707_100381138
931 Ga0070698_100003081
932 Ga0070698_100007611
933 Ga0070698_100105662
934 Ga0070698_100882620
935 Ga0070699_100111798
936 Ga0070699_100148987
937 Ga0070699_100228255
938 Ga0070699_100228646
939 Ga0070699_100246225
940 Ga0070699_100272006
941 Ga0070679_100007246
942 Ga0070684_100006960
943 Ga0070684_100048954
944 Ga0070684_100210887
945 Ga0070697_100003834
946 Ga0070697_100004265
947 Ga0070697_100005527
948 Ga0070697_100010837
949 Ga0070697_100024293
950 Ga0070697_100044739
951 Ga0070697_100051340
952 Ga0070697_100079162
953 Ga0070697_100094082
954 Ga0070697_100134086
955 Ga0070697_100450941
956 Ga0070697_100542917
957 Ga0070697_100766934
958 Ga0068853_100333398
959 Ga0070672_100005129
960 Ga0070672_100029502
961 Ga0070672_100044338
962 Ga0070672_100279022
963 Ga0070686_100057284
964 Ga0070695_100090587
965 Ga0070696_100096711
966 Ga0070665_100035923
967 Ga0070665_100067147
968 Ga0070665_100209370
969 Ga0070665_100949222
970 Ga0070704_100106279
971 Ga0070704_100280614
972 Ga0070704_101084490
973 Ga0068855_100715649
974 Ga0070664_100196567
975 Ga0070664_100508709
976 Ga0068854_100972973
977 Ga0068856_100015700
978 Ga0068856_100268925
979 Ga0070702_100007277
980 Ga0068859_100016028
981 Ga0068864_100587614
982 Ga0068866_10021346
983 Ga0068861_100253438
984 Ga0068861_100498178
985 Ga0068861_100582601
986 Ga0068870_10054691
987 Ga0068863_100132285
988 Ga0068863_100309402
989 Ga0068858_100639271
990 Ga0068858_101018523
991 Ga0068860_100005708
992 Ga0068860_100025690
993 Ga0068860_100306894
994 Ga0068860_100381264
995 Ga0068862_100006779
996 Ga0081455_10004180
997 Ga0081455_10008289
998 Ga0081455_10011819
999 Ga0081455_10046359
1000 Ga0081455_10070554
1001 Ga0081455_10112385
1002 Ga0081455_10557511
1003 Ga0081540_1000016
1004 Ga0081540_1031667
1005 Ga0081540_1042683
1006 Ga0081540_1109263
1007 Ga0081539_10000098
1008 Ga0081539_10000955
1009 Ga0081539_10023240
1010 Ga0081539_10070157
1011 Ga0081539_10223261
1012 Ga0070717_10001933
1013 Ga0070717_10015724
1014 Ga0070717_10090475
1015 Ga0070717_10431798
1016 Ga0070715_10023708
1017 Ga0070716_100014232
1018 Ga0070716_100024002
1019 Ga0070716_100093265
1020 Ga0070716_100147973
1021 Ga0070716_100165225
1022 Ga0070716_100269323
1023 Ga0070716_100434657
1024 Ga0070716_100489444
1025 Ga0070716_100613345
1026 Ga0070712_100002118
1027 Ga0070712_100144080
1028 Ga0070712_100192358
1029 Ga0097621_100035481
1030 Ga0097621_100222311
1031 Ga0097621_100641305
1032 Ga0068871_100274542
1033 Ga0068871_100529899
1034 Ga0068871_101080006
1035 Ga0068871_101152857
1036 Ga0075428_100708824
1037 Ga0075433_10359364
1038 Ga0075434_100267260
1039 Ga0075434_100342899
1040 Ga0068865_100036203
1041 Ga0068865_100184074
1042 Ga0068865_100293411
1043 Ga0068865_100321409
1044 Ga0068865_100680435
1045 Ga0075436_100061612
1046 Ga0075436_100094256
1047 Ga0075436_100487012
1048 Ga0075436_100784624
1049 Ga0097620_100016028
1050 Ga0075435_100197255
1051 Ga0075435_100271928
1052 Ga0099795_10052766
1053 Ga0099795_10065263
1054 Ga0105240_10818894
1055 Ga0111539_10432807
1056 Ga0111539_10522762
1057 Ga0111539_11214147
1058 Ga0105245_10078596
1059 Ga0105245_10128882
1060 Ga0114129_10006389
1061 Ga0114129_10209723
1062 Ga0105243_10110641
1063 Ga0105243_10224406
1064 Ga0105241_10219647
1065 Ga0105242_10097677
1066 Ga0105242_11014415
1067 Ga0105248_10203938
1068 Ga0105249_10003175
1069 Ga0105249_10186022
1070 Ga0105239_10142770
1071 Ga0105239_10470658
1072 Ga0105239_10540280
1073 Ga0105239_11707918
1074 Ga0157323_1024160
1075 Ga0157316_1013708
1076 Ga0157373_10419080
1077 Ga0157371_10066759
1078 Ga0157371_10534354
1079 Ga0157369_10830284
1080 Ga0157374_10067592
1081 Ga0157374_10078973
1082 Ga0157374_10152927
1083 Ga0157374_10193527
1084 Ga0157374_10198974
1085 Ga0157374_10395696
1086 Ga0157374_10428075
1087 Ga0157374_10435526
1088 Ga0157378_10004778
1089 Ga0157378_10033903
1090 Ga0157378_10082491
1091 Ga0157378_10125941
1092 Ga0157378_10137931
1093 Ga0157378_10166297
1094 Ga0157378_10234626
1095 Ga0157378_10309028
1096 Ga0157378_10311259
1097 Ga0157378_10396472
1098 Ga0157378_10682466
1099 Ga0157378_10807733
1100 Ga0157378_11547688
1101 Ga0163162_10002011
1102 Ga0163162_10004028
1103 Ga0163162_10060910
1104 Ga0163162_10129679
1105 Ga0163162_10177059
1106 Ga0163162_10285866
1107 Ga0163162_10790071
1108 Ga0163162_10944996
1109 Ga0163162_10960224
1110 Ga0157372_10033136
1111 Ga0157372_10037305
1112 Ga0157372_10183654
1113 Ga0157372_10498989
1114 Ga0157375_10002896
1115 Ga0157375_10012222
1116 Ga0157375_10019369
1117 Ga0157375_10051925
1118 Ga0157375_10319589
1119 Ga0157375_10427667
1120 Ga0163163_10046256
1121 Ga0163163_10387645
1122 Ga0163163_10457296
1123 Ga0163163_11639981
1124 Ga0182008_10054458
1125 Ga0157377_10128910
1126 Ga0157377_10183334
1127 Ga0157379_10007103
1128 Ga0157379_10254903
1129 Ga0157376_10030155
1130 Ga0157376_10030588
1131 Ga0157376_10084632
1132 Ga0157376_10092717
1133 Ga0157376_10344879
1134 Ga0157376_10500257
1135 Ga0163161_10002526
1136 Ga0163161_10379947
1137 Ga0213876_10008009
1138 Ga0207666_1003972
1139 Ga0207666_1008568
1140 Ga0207666_1011759
1141 Ga0207673_1001175
1142 Ga0207673_1001629
1143 Ga0207673_1028349
1144 Ga0207697_10000755
1145 Ga0207697_10000828
1146 Ga0207697_10001223
1147 Ga0207697_10003956
1148 Ga0207697_10004502
1149 Ga0207697_10004577
1150 Ga0207697_10053916
1151 Ga0207697_10068623
1152 Ga0207697_10105531
1153 Ga0207682_10010944
1154 Ga0207642_10050697
1155 Ga0207710_10290884
1156 Ga0207688_10002382
1157 Ga0207688_10015901
1158 Ga0207688_10180203
1159 Ga0207688_10488098
1160 Ga0207680_10022099
1161 Ga0207680_10038185
1162 Ga0207680_10364772
1163 Ga0207647_10016578
1164 Ga0207647_10180482
1165 Ga0207685_10064708
1166 Ga0207699_10268156
1167 Ga0207699_10356846
1168 Ga0207699_10481703
1169 Ga0207645_10001169
1170 Ga0207645_10003105
1171 Ga0207645_10022441
1172 Ga0207645_10300997
1173 Ga0207643_10213216
1174 Ga0207705_10094245
1175 Ga0207684_10000243
1176 Ga0207684_10000678
1177 Ga0207684_10018778
1178 Ga0207684_10063638
1179 Ga0207684_10076528
1180 Ga0207684_10108783
1181 Ga0207684_10122743
1182 Ga0207684_10134384
1183 Ga0207684_10230314
1184 Ga0207684_10339994
1185 Ga0207684_10389823
1186 Ga0207684_10444590
1187 Ga0207684_10668981
1188 Ga0207707_10340453
1189 Ga0207671_10023180
1190 Ga0207693_10001887
1191 Ga0207693_10042963
1192 Ga0207693_10046274
1193 Ga0207693_10056411
1194 Ga0207693_10104325
1195 Ga0207693_10118255
1196 Ga0207693_10239216
1197 Ga0207693_10363914
1198 Ga0207663_10035895
1199 Ga0207663_10247121
1200 Ga0207663_10402688
1201 Ga0207660_10387729
1202 Ga0207662_10001034
1203 Ga0207662_10121121
1204 Ga0207662_10140833
1205 Ga0207657_10030149
1206 Ga0207657_10102622
1207 Ga0207649_10019327
1208 Ga0207649_10103428
1209 Ga0207652_10026085
1210 Ga0207646_10008549
1211 Ga0207646_10028835
1212 Ga0207646_10037448
1213 Ga0207646_10056585
1214 Ga0207646_10075000
1215 Ga0207646_10075391
1216 Ga0207646_10177780
1217 Ga0207646_10216450
1218 Ga0207646_10963138
1219 Ga0207681_10018767
1220 Ga0207681_10198959
1221 Ga0207681_10249048
1222 Ga0207681_10290409
1223 Ga0207681_10455474
1224 Ga0207650_10094925
1225 Ga0207650_10131641
1226 Ga0207650_10204555
1227 Ga0207650_10849920
1228 Ga0207659_10027113
1229 Ga0207659_10054673
1230 Ga0207659_10061695
1231 Ga0207659_10063174
1232 Ga0207659_10067388
1233 Ga0207659_10270732
1234 Ga0207687_10308524
1235 Ga0207687_10556389
1236 Ga0207700_10050767
1237 Ga0207700_10051167
1238 Ga0207664_10023751
1239 Ga0207664_10309072
1240 Ga0207664_10373520
1241 Ga0207664_11181259
1242 Ga0207664_11552107
1243 Ga0207644_10012217
1244 Ga0207644_10038418
1245 Ga0207644_10100758
1246 Ga0207644_10170625
1247 Ga0207690_10009587
1248 Ga0207690_10204138
1249 Ga0207690_10303183
1250 Ga0207690_10369994
1251 Ga0207706_10001581
1252 Ga0207706_10013480
1253 Ga0207706_10059230
1254 Ga0207706_10108739
1255 Ga0207706_10120344
1256 Ga0207706_10410656
1257 Ga0207706_10537481
1258 Ga0207706_10665888
1259 Ga0207686_10138685
1260 Ga0207686_10141938
1261 Ga0207686_10853207
1262 Ga0207709_10031546
1263 Ga0207670_10002791
1264 Ga0207670_10013204
1265 Ga0207670_10023627
1266 Ga0207670_10262826
1267 Ga0207670_10362301
1268 Ga0207669_10036686
1269 Ga0207669_10054942
1270 Ga0207669_10099678
1271 Ga0207704_10012932
1272 Ga0207704_10266591
1273 Ga0207704_10538807
1274 Ga0207665_10021810
1275 Ga0207665_10031461
1276 Ga0207665_10033671
1277 Ga0207665_10046718
1278 Ga0207665_10075789
1279 Ga0207665_10113696
1280 Ga0207665_10329120
1281 Ga0207691_10000821
1282 Ga0207691_10001137
1283 Ga0207691_10238035
1284 Ga0207691_10238208
1285 Ga0207691_10456142
1286 Ga0207689_10154583
1287 Ga0207689_10415946
1288 Ga0207661_10014613
1289 Ga0207661_10278807
1290 Ga0207679_10129073
1291 Ga0207679_10520823
1292 Ga0207667_11330066
1293 Ga0207667_11477015
1294 Ga0207651_10007082
1295 Ga0207712_10016870
1296 Ga0207668_10010719
1297 Ga0207668_10055952
1298 Ga0207668_10194160
1299 Ga0207668_10239795
1300 Ga0207668_11229516
1301 Ga0207658_10003337
1302 Ga0207658_10199239
1303 Ga0207658_10677855
1304 Ga0207677_10178004
1305 Ga0207677_10267776
1306 Ga0207677_10417786
1307 Ga0207677_10636852
1308 Ga0207703_10056987
1309 Ga0207703_10627487
1310 Ga0207703_11198876
1311 Ga0207639_10977301
1312 Ga0207678_10134668
1313 Ga0207678_10534682
1314 Ga0207708_10082442
1315 Ga0207708_10262807
1316 Ga0207702_11228676
1317 Ga0207641_10017031
1318 Ga0207641_11694182
1319 Ga0207648_10010975
1320 Ga0207676_10014653
1321 Ga0207676_10659786
1322 Ga0207674_10779242
1323 Ga0207675_100124252
1324 Ga0207675_101067230
1325 Ga0207683_10002463
1326 Ga0207683_10069737
1327 Ga0207683_10074640
1328 Ga0209982_1043283
1329 Ga0209998_10016779
1330 Ga0268266_10026334
1331 Ga0268266_10077047
1332 Ga0268266_11109131
1333 Ga0268264_10117435
1334 Ga0307513_10194465
1335 Ga0307414_10306826
1336 Ga0307414_11118576
1337 Ga0373948_0110074
1338 Ga0373944_0042340
1339 Ga0373939_0181163
1340 Ga0373939_0283956
1341 Ga0373956_0301239
1342 Ga0373943_0237549
1343 Ga0373946_0141030
1344 Ga0373946_0301715
1345 Ga0316574_0105748
1346 Ga0373931_0076953
1347 Ga0373931_0123215
1348 Ga0373931_0129165
1349 Ga0373931_0581200
1350 Ga0373935_0050686
1351 Ga0373935_0109124
1352 Ga0373927_0027026
1353 Ga0373927_0085328
1354 Ga0373927_0114338
1355 Ga0373927_0682932
1356 Ga0373933_0070517
1357 Ga0373933_0079171
1358 Ga0373947_0014513
1359 Ga0373947_0078415
1360 Ga0373937_0698633
1361 Ga0373937_1538734
1362 Ga0373925_0031403
1363 Ga0373925_0088629
1364 Ga0373925_0112867
1365 Ga0373925_0197291
1366 Ga0373925_0390346
1367 Ga0395900_0020916
1368 Ga0395900_0021440
1369 Ga0395900_0413496
1370 Ga0395900_1246511
1371 Ga0395900_1566803
1372 Ga0395898_0056095
1373 Ga0395898_0153865
1374 Ga0395898_1174981
1375 Ga0395905_0098882
1376 Ga0395905_0174087
1377 Ga0395905_0966388
1378 Ga0395901_0016930
1379 Ga0395901_0019052
1380 Ga0436365_0404877
1381 Ga0436365_0728609
1382 Ga0436365_0729678
1383 Ga0436365_1843395
1384 Ga0436363_0519400
1385 Ga0436362_0117015
1386 Ga0451835_1061780
1387 Ga0451849_0382894
1388 Ga0451849_0733666
1389 Ga0451853_1600929
1390 Ga0439448_0012397
1391 Ga0439451_015796
1392 Ga0439451_085414
1393 Ga0439454_032782
1394 Ga0439455_0050894
1395 Ga0439460_0147917
1396 Ga0466964_0051234
1397 Ga0451576_0047906
1398 Ga0451576_1031788
1399 Ga0466967_0248092
1400 Ga0495592_0105244
1401 Ga0495592_0794079
1402 Ga0495629_0030432
1403 Ga0495638_0134761
1404 Ga0495653_0554063
1405 Ga0495650_0137936
1406 Ga0495605_0090777
1407 Ga0495584_0419282
1408 Ga0495585_0121968
1409 Ga0495596_0122319
1410 Ga0495607_0074000
1411 Ga0495608_0242313
1412 Ga0495616_0133003
1413 Ga0495628_0208984
1414 Ga0495628_0395394
1415 Ga0495630_0463452
1416 Ga0495631_0224016
1417 Ga0495631_0355666
1418 Ga0495637_0091522
1419 Ga0495637_0193164
1420 Ga0495663_0015576
1421 Ga0495642_0153978
1422 Ga0495652_0012948
1423 Ga0495654_0082704
1424 Ga0495640_0090699
1425 Ga0495640_0595796
1426 Ga0495586_0068633
1427 Ga0495586_0336020
1428 Ga0495587_0423793
1429 Ga0495587_0643262
1430 Ga0495598_0043889
1431 Ga0495598_0046375
1432 Ga0495598_0202402
1433 Ga0495645_0024556
1434 Ga0495645_0284536
1435 Ga0495667_0082554
1436 Ga0495667_0224979
1437 Ga0495656_0011773
1438 Ga0495668_0463499
1439 Ga0495634_0240567
1440 Ga0495611_0150769
1441 Ga0495625_0436100
1442 Ga0495659_0059104
1443 Ga0495659_0217800
1444 Ga0495661_0205563
1445 Ga0495657_0543828
1446 Ga0495599_0006212
1447 Ga0495623_0172290
1448 Ga0495646_0021386
1449 Ga0495658_0324673
1450 Ga0495658_0354796
1451 Ga0495669_0019922
1452 Ga0495669_0066657
1453 Ga0495669_0074562
1454 Ga0495669_0130498
1455 Ga0495671_0076743
1456 Ga0495649_0332418
1457 Ga0495589_0343971
1458 Ga0495600_0224593
1459 Ga0495660_0253499
1460 Ga0495604_0181838
1461 Ga0495604_0602814
1462 Ga0495636_0093424
1463 Ga0495674_0086081
1464 Ga0495674_0879587
1465 Ga0495680_0400273
1466 Ga0495683_0175503
1467 Ga0495675_0031211
1468 Ga0495685_085218
1469 Ga0495681_0083772
1470 Ga0495684_0049809
1471 Ga0495684_0838248
1472 Ga0495593_0165985
1473 Ga0495602_0013044
1474 Ga0495615_0047592
1475 Ga0496100_0004564
1476 Ga0496100_0087757
1477 Ga0496101_0003338
1478 Ga0496102_0013039
1479 Ga0496102_0452715
1480 Ga0496102_0459017
1481 Ga0496102_0831492
1482 Ga0496103_0021206
1483 Ga0496103_0188281
1484 Ga0496104_0100289
1485 Ga0496104_0103827
1486 Ga0496104_1054662
1487 Ga0496105_0076495
1488 Ga0496105_0190877
1489 Ga0496105_0414439
1490 Ga0496106_0003216
1491 Ga0496107_0004569
1492 Ga0496108_0187093
1493 Ga0496108_0191272
1494 Ga0496108_0202879
1495 Ga0496108_0208801
1496 Ga0496108_0263214
1497 Ga0496109_0048009
1498 Ga0496109_0053182
1499 Ga0496109_0194248
1500 Ga0496109_0406674
1501 Ga0496109_0465558
1502 Ga0496110_0240208
1503 Ga0496110_0671803
1504 Ga0496111_0129468
1505 Ga0496112_0055195
1506 Ga0496112_0068761
1507 Ga0496112_0087873
1508 Ga0496112_0268172
1509 Ga0496112_0366698
1510 Ga0496112_0750309
1511 Ga0496112_0841595
1512 Ga0496112_0926560
1513 Ga0496113_0155806
1514 Ga0496113_0456888
1515 Ga0496113_0630041
1516 Ga0496114_0045686
1517 Ga0496114_0157983
1518 Ga0496114_0308599
1519 Ga0496115_0020298
1520 Ga0496115_0044764
1521 Ga0496115_0055463
1522 Ga0496115_0113687
1523 Ga0496115_0619401
1524 Ga0496126_0458577
1525 nmdc:mga05p37_25646_c1
1526 nmdc:mga05p37_308686_c1
1527 nmdc:mga05p37_814535_c1
1528 nmdc:mga08y16_209033_c1
1529 nmdc:mga08y16_418582_c1
1530 nmdc:mga08y16_641345_c1
1531 nmdc:mga0n895_860662_c1
1532 nmdc:mga0rr50_166949_c1
1533 nmdc:mga0rr50_663684_c1
1534 nmdc:mga08x19_278625_c1
1535 nmdc:mga0a205_821189_c1
1536 Ga0495601_0065102
1537 Ga0495601_0427657
1538 Ga0495655_0009929
1539 Ga0495619_0476039
1540 Ga0500559_0038472

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map