F480012
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 769 | 298 | 769 | 175 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0149050|Ga0501033_0149050_79_726 |
| Length | 215 |
| Sequence | LNNEEHEEDAEKLFIVILRRSNLFGIPGFRQPPTRYDDRAMSTLTPPFDFKRWIDENRHLLKPPVGNKCLVDGDFIVMIVGGPNSRTDYHFDEGPEFFYQLEGEMVLKVQDDGRARDIPIRAGEVFYLPPRVPHSPQRLANSIGLVIERKRLPDEKDGLLWFCERCNHKLYEEFFTLKNIETDFPAVFERFYRSLDARTCKACGHVNPAPEKYRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 171 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 172 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 178 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 179 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 198 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 199 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 200 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 201 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 202 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 203 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 204 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 205 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 206 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 207 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 236 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 242 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 243 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 244 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 245 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 246 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 247 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 248 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 249 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 250 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 251 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 252 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 276 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 277 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 278 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 279 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 280 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 285 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 289 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 290 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 291 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 292 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 293 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 294 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 295 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 296 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 298 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.16 |
| Nodule | 0 |
| Rhizoplane | 3.25 |
| Rhizosphere | 86.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3830080 | 2162886007 | Bacteria | 1118 |
| 2 | JGI24736J21556_1013939 | 3300001904 | Bacteria | 1295 |
| 3 | JGI24740J21852_10000412 | 3300001979 | Bacteria | 18285 |
| 4 | JGI25157J39369_1002492 | 3300002741 | Bacteria | 4503 |
| 5 | JGI25164J39214_1000663 | 3300002772 | Bacteria | 14046 |
| 6 | JGI25164J39214_1000732 | 3300002772 | Bacteria | 12289 |
| 7 | JGI25165J46597_1001316 | 3300003214 | Bacteria | 14046 |
| 8 | JGI25165J46597_1002058 | 3300003214 | Bacteria | 7545 |
| 9 | rootH1_10040100 | 3300003316 | Bacteria | 1886 |
| 10 | rootH2_10227379 | 3300003320 | Bacteria | 2296 |
| 11 | rootL2_10075816 | 3300003322 | Bacteria | 1828 |
| 12 | rootH1_10150984 | 3300003323 | Bacteria | 2742 |
| 13 | Ga0065165_1000001 | 3300005262 | Bacteria | 494087 |
| 14 | Ga0065715_10190471 | 3300005293 | Bacteria | 1416 |
| 15 | Ga0070658_10013088 | 3300005327 | Bacteria | 6656 |
| 16 | Ga0070658_10027599 | 3300005327 | Bacteria | 4554 |
| 17 | Ga0070658_10033211 | 3300005327 | Bacteria | 4150 |
| 18 | Ga0070658_10318006 | 3300005327 | Bacteria | 1329 |
| 19 | Ga0070676_10029738 | 3300005328 | Bacteria | 3110 |
| 20 | Ga0070676_10256726 | 3300005328 | Bacteria | 1169 |
| 21 | Ga0070676_10936418 | 3300005328 | Bacteria | 647 |
| 22 | Ga0070683_100039765 | 3300005329 | Bacteria | 4320 |
| 23 | Ga0070683_100133545 | 3300005329 | Bacteria | 2349 |
| 24 | Ga0070683_100570161 | 3300005329 | Bacteria | 1083 |
| 25 | Ga0070690_100049423 | 3300005330 | Bacteria | 2681 |
| 26 | Ga0070690_100102383 | 3300005330 | Bacteria | 1900 |
| 27 | Ga0070670_100277141 | 3300005331 | Bacteria | 1464 |
| 28 | Ga0070670_100443477 | 3300005331 | Bacteria | 1150 |
| 29 | Ga0068869_100141183 | 3300005334 | Bacteria | 1860 |
| 30 | Ga0068869_100275713 | 3300005334 | Bacteria | 1351 |
| 31 | Ga0068869_100948339 | 3300005334 | Bacteria | 747 |
| 32 | Ga0070666_10000003 | 3300005335 | Bacteria | 463666 |
| 33 | Ga0070666_10000109 | 3300005335 | Bacteria | 56796 |
| 34 | Ga0070666_10002838 | 3300005335 | Bacteria | 10471 |
| 35 | Ga0070666_10038006 | 3300005335 | Bacteria | 3202 |
| 36 | Ga0070666_10259770 | 3300005335 | Bacteria | 1231 |
| 37 | Ga0070680_100016672 | 3300005336 | Bacteria | 5785 |
| 38 | Ga0070680_100104449 | 3300005336 | Bacteria | 2354 |
| 39 | Ga0070680_100111346 | 3300005336 | Bacteria | 2279 |
| 40 | Ga0070680_100118825 | 3300005336 | Bacteria | 2205 |
| 41 | Ga0070682_100109903 | 3300005337 | Bacteria | 1835 |
| 42 | Ga0070682_100125947 | 3300005337 | Bacteria | 1726 |
| 43 | Ga0068868_100046371 | 3300005338 | Bacteria | 3402 |
| 44 | Ga0068868_100053523 | 3300005338 | Bacteria | 3180 |
| 45 | Ga0068868_100134985 | 3300005338 | Bacteria | 2022 |
| 46 | Ga0070660_100017899 | 3300005339 | Bacteria | 5169 |
| 47 | Ga0070660_100111133 | 3300005339 | Bacteria | 2180 |
| 48 | Ga0070660_100152137 | 3300005339 | Bacteria | 1861 |
| 49 | Ga0070660_101212630 | 3300005339 | Bacteria | 640 |
| 50 | Ga0070689_100219534 | 3300005340 | Bacteria | 1559 |
| 51 | Ga0070661_100000840 | 3300005344 | Bacteria | 22051 |
| 52 | Ga0070661_100019824 | 3300005344 | Bacteria | 4793 |
| 53 | Ga0070661_100112784 | 3300005344 | Bacteria | 2031 |
| 54 | Ga0070661_100112920 | 3300005344 | Bacteria | 2030 |
| 55 | Ga0070661_100260185 | 3300005344 | Bacteria | 1341 |
| 56 | Ga0070661_100413944 | 3300005344 | Bacteria | 1067 |
| 57 | Ga0070661_101315693 | 3300005344 | Bacteria | 606 |
| 58 | Ga0070692_10034406 | 3300005345 | Bacteria | 2559 |
| 59 | Ga0070692_10106871 | 3300005345 | Bacteria | 1542 |
| 60 | Ga0070668_100614023 | 3300005347 | Bacteria | 952 |
| 61 | Ga0070668_100754550 | 3300005347 | Bacteria | 862 |
| 62 | Ga0070669_100034776 | 3300005353 | Bacteria | 3648 |
| 63 | Ga0070669_100237149 | 3300005353 | Bacteria | 1448 |
| 64 | Ga0070671_100065196 | 3300005355 | Bacteria | 3034 |
| 65 | Ga0070671_100104112 | 3300005355 | Bacteria | 2382 |
| 66 | Ga0070673_100735459 | 3300005364 | Bacteria | 908 |
| 67 | Ga0070673_100799579 | 3300005364 | Bacteria | 871 |
| 68 | Ga0070659_100081072 | 3300005366 | Bacteria | 2591 |
| 69 | Ga0070659_100325447 | 3300005366 | Bacteria | 1286 |
| 70 | Ga0070667_100000005 | 3300005367 | Bacteria | 347268 |
| 71 | Ga0070667_100015468 | 3300005367 | Bacteria | 6310 |
| 72 | Ga0070667_100038266 | 3300005367 | Bacteria | 4022 |
| 73 | Ga0070667_100050855 | 3300005367 | Bacteria | 3492 |
| 74 | Ga0070667_100073428 | 3300005367 | Bacteria | 2917 |
| 75 | Ga0070667_100183175 | 3300005367 | Bacteria | 1853 |
| 76 | Ga0070667_100192722 | 3300005367 | Bacteria | 1806 |
| 77 | Ga0070667_100255194 | 3300005367 | Bacteria | 1568 |
| 78 | Ga0070667_100503208 | 3300005367 | Bacteria | 1111 |
| 79 | Ga0070667_100560384 | 3300005367 | Bacteria | 1051 |
| 80 | Ga0070667_100667310 | 3300005367 | Bacteria | 961 |
| 81 | Ga0070714_100004101 | 3300005435 | Bacteria | 10953 |
| 82 | Ga0070714_100006554 | 3300005435 | Bacteria | 9004 |
| 83 | Ga0070714_100535247 | 3300005435 | Bacteria | 1120 |
| 84 | Ga0070713_100011777 | 3300005436 | Bacteria | 6389 |
| 85 | Ga0070663_100003718 | 3300005455 | Bacteria | 8846 |
| 86 | Ga0070663_100180611 | 3300005455 | Bacteria | 1637 |
| 87 | Ga0070663_100399346 | 3300005455 | Bacteria | 1123 |
| 88 | Ga0070678_100065671 | 3300005456 | Bacteria | 2695 |
| 89 | Ga0070678_100361648 | 3300005456 | Bacteria | 1251 |
| 90 | Ga0070678_100637529 | 3300005456 | Bacteria | 955 |
| 91 | Ga0070678_100847467 | 3300005456 | Bacteria | 833 |
| 92 | Ga0070678_100917123 | 3300005456 | Bacteria | 802 |
| 93 | Ga0070662_100215387 | 3300005457 | Bacteria | 1530 |
| 94 | Ga0070662_100220665 | 3300005457 | Bacteria | 1513 |
| 95 | Ga0070681_10000058 | 3300005458 | Bacteria | 79062 |
| 96 | Ga0070681_10002046 | 3300005458 | Bacteria | 18277 |
| 97 | Ga0070681_10015819 | 3300005458 | Bacteria | 7520 |
| 98 | Ga0070681_10021136 | 3300005458 | Bacteria | 6521 |
| 99 | Ga0070681_10248744 | 3300005458 | Bacteria | 1691 |
| 100 | Ga0070681_10268180 | 3300005458 | Bacteria | 1618 |
| 101 | Ga0068867_100170221 | 3300005459 | Bacteria | 1724 |
| 102 | Ga0068867_100943849 | 3300005459 | Bacteria | 779 |
| 103 | Ga0070699_100617411 | 3300005518 | Bacteria | 989 |
| 104 | Ga0070679_100000809 | 3300005530 | Bacteria | 27122 |
| 105 | Ga0070679_100014718 | 3300005530 | Bacteria | 7520 |
| 106 | Ga0070679_100019814 | 3300005530 | Bacteria | 6549 |
| 107 | Ga0070684_100258913 | 3300005535 | Bacteria | 1591 |
| 108 | Ga0070684_100668202 | 3300005535 | Bacteria | 968 |
| 109 | Ga0068853_100014008 | 3300005539 | Bacteria | 6561 |
| 110 | Ga0068853_100027763 | 3300005539 | Bacteria | 4757 |
| 111 | Ga0068853_100033329 | 3300005539 | Bacteria | 4369 |
| 112 | Ga0068853_100041564 | 3300005539 | Bacteria | 3928 |
| 113 | Ga0068853_100087611 | 3300005539 | Bacteria | 2732 |
| 114 | Ga0068853_100166264 | 3300005539 | Bacteria | 1993 |
| 115 | Ga0068853_100219628 | 3300005539 | Bacteria | 1735 |
| 116 | Ga0068853_100261665 | 3300005539 | Bacteria | 1591 |
| 117 | Ga0068853_100471146 | 3300005539 | Bacteria | 1183 |
| 118 | Ga0068853_101422637 | 3300005539 | Bacteria | 671 |
| 119 | Ga0068853_101513833 | 3300005539 | Bacteria | 650 |
| 120 | Ga0070672_100397071 | 3300005543 | Bacteria | 1181 |
| 121 | Ga0070672_101142998 | 3300005543 | Bacteria | 693 |
| 122 | Ga0070696_100009303 | 3300005546 | Bacteria | 6577 |
| 123 | Ga0070696_100172223 | 3300005546 | Bacteria | 1601 |
| 124 | Ga0070693_100044184 | 3300005547 | Bacteria | 2520 |
| 125 | Ga0070693_100051377 | 3300005547 | Bacteria | 2360 |
| 126 | Ga0070665_100000057 | 3300005548 | Bacteria | 237271 |
| 127 | Ga0070665_100000838 | 3300005548 | Bacteria | 40099 |
| 128 | Ga0070665_100088395 | 3300005548 | Bacteria | 3104 |
| 129 | Ga0070665_100117114 | 3300005548 | Bacteria | 2666 |
| 130 | Ga0070665_100122005 | 3300005548 | Bacteria | 2608 |
| 131 | Ga0070665_100235001 | 3300005548 | Bacteria | 1833 |
| 132 | Ga0070665_100642002 | 3300005548 | Bacteria | 1074 |
| 133 | Ga0070665_100781849 | 3300005548 | Bacteria | 968 |
| 134 | Ga0070665_101480519 | 3300005548 | Bacteria | 687 |
| 135 | Ga0068855_100003960 | 3300005563 | Bacteria | 18083 |
| 136 | Ga0068855_100022714 | 3300005563 | Bacteria | 7517 |
| 137 | Ga0068855_100067485 | 3300005563 | Bacteria | 4166 |
| 138 | Ga0068855_100584817 | 3300005563 | Bacteria | 1205 |
| 139 | Ga0068855_101070045 | 3300005563 | Bacteria | 844 |
| 140 | Ga0070664_100019492 | 3300005564 | Bacteria | 5582 |
| 141 | Ga0070664_100079048 | 3300005564 | Bacteria | 2830 |
| 142 | Ga0070664_100089947 | 3300005564 | Bacteria | 2656 |
| 143 | Ga0068857_100039190 | 3300005577 | Bacteria | 4196 |
| 144 | Ga0068857_100126595 | 3300005577 | Bacteria | 2302 |
| 145 | Ga0068857_100134512 | 3300005577 | Bacteria | 2232 |
| 146 | Ga0068854_100056373 | 3300005578 | Bacteria | 2832 |
| 147 | Ga0068854_100088088 | 3300005578 | Bacteria | 2304 |
| 148 | Ga0068854_100101051 | 3300005578 | Bacteria | 2162 |
| 149 | Ga0068854_100125577 | 3300005578 | Bacteria | 1953 |
| 150 | Ga0068854_100635046 | 3300005578 | Bacteria | 915 |
| 151 | Ga0068856_100008809 | 3300005614 | Bacteria | 9819 |
| 152 | Ga0068856_100011032 | 3300005614 | Bacteria | 8776 |
| 153 | Ga0068856_100021219 | 3300005614 | Bacteria | 6309 |
| 154 | Ga0068856_100021290 | 3300005614 | Bacteria | 6300 |
| 155 | Ga0068856_100081913 | 3300005614 | Bacteria | 3202 |
| 156 | Ga0068856_100103208 | 3300005614 | Bacteria | 2845 |
| 157 | Ga0068856_100171100 | 3300005614 | Bacteria | 2184 |
| 158 | Ga0068856_100188138 | 3300005614 | Bacteria | 2078 |
| 159 | Ga0068852_100021868 | 3300005616 | Bacteria | 5117 |
| 160 | Ga0068852_100040124 | 3300005616 | Bacteria | 3947 |
| 161 | Ga0068852_100170279 | 3300005616 | Bacteria | 2041 |
| 162 | Ga0068852_100322078 | 3300005616 | Bacteria | 1502 |
| 163 | Ga0068852_101437205 | 3300005616 | Bacteria | 712 |
| 164 | Ga0068859_100015799 | 3300005617 | Bacteria | 7585 |
| 165 | Ga0068859_100344287 | 3300005617 | Bacteria | 1585 |
| 166 | Ga0068859_101026992 | 3300005617 | Bacteria | 906 |
| 167 | Ga0068864_100002860 | 3300005618 | Bacteria | 14264 |
| 168 | Ga0068864_101409508 | 3300005618 | Bacteria | 699 |
| 169 | Ga0068866_10763603 | 3300005718 | Bacteria | 669 |
| 170 | Ga0068851_10002611 | 3300005834 | Bacteria | 7942 |
| 171 | Ga0068851_10470272 | 3300005834 | Bacteria | 750 |
| 172 | Ga0068851_10581375 | 3300005834 | Bacteria | 680 |
| 173 | Ga0068851_10678200 | 3300005834 | Bacteria | 633 |
| 174 | Ga0068863_100005670 | 3300005841 | Bacteria | 12263 |
| 175 | Ga0068863_100059126 | 3300005841 | Bacteria | 3627 |
| 176 | Ga0068863_100190876 | 3300005841 | Bacteria | 1969 |
| 177 | Ga0068863_100269277 | 3300005841 | Bacteria | 1648 |
| 178 | Ga0068858_100008089 | 3300005842 | Bacteria | 10123 |
| 179 | Ga0068860_100067923 | 3300005843 | Bacteria | 3386 |
| 180 | Ga0068860_100103296 | 3300005843 | Bacteria | 2720 |
| 181 | Ga0068860_100107406 | 3300005843 | Bacteria | 2667 |
| 182 | Ga0068860_100254503 | 3300005843 | Bacteria | 1711 |
| 183 | Ga0068860_100636891 | 3300005843 | Bacteria | 1073 |
| 184 | Ga0068860_101764052 | 3300005843 | Bacteria | 641 |
| 185 | Ga0068862_100000354 | 3300005844 | Bacteria | 49717 |
| 186 | Ga0068862_100407715 | 3300005844 | Bacteria | 1273 |
| 187 | Ga0081540_1002130 | 3300005983 | Bacteria | 16480 |
| 188 | Ga0081539_10082143 | 3300005985 | Bacteria | 1690 |
| 189 | Ga0070712_100305876 | 3300006175 | Bacteria | 1288 |
| 190 | Ga0075362_10097059 | 3300006177 | Bacteria | 1374 |
| 191 | Ga0097621_100021693 | 3300006237 | Bacteria | 4974 |
| 192 | Ga0097621_100023998 | 3300006237 | Bacteria | 4756 |
| 193 | Ga0097621_100053409 | 3300006237 | Bacteria | 3294 |
| 194 | Ga0097621_100058214 | 3300006237 | Bacteria | 3162 |
| 195 | Ga0097621_100240442 | 3300006237 | Bacteria | 1582 |
| 196 | Ga0097621_100242028 | 3300006237 | Bacteria | 1577 |
| 197 | Ga0097621_100652511 | 3300006237 | Bacteria | 966 |
| 198 | Ga0068871_100045937 | 3300006358 | Bacteria | 3517 |
| 199 | Ga0068871_100063532 | 3300006358 | Bacteria | 3020 |
| 200 | Ga0068871_100093093 | 3300006358 | Bacteria | 2514 |
| 201 | Ga0068871_100877089 | 3300006358 | Bacteria | 831 |
| 202 | Ga0068871_100894292 | 3300006358 | Bacteria | 823 |
| 203 | Ga0068865_100002265 | 3300006881 | Bacteria | 11321 |
| 204 | Ga0068865_100025332 | 3300006881 | Bacteria | 3901 |
| 205 | Ga0068865_100025358 | 3300006881 | Bacteria | 3900 |
| 206 | Ga0068865_100318826 | 3300006881 | Bacteria | 1249 |
| 207 | Ga0097620_100015798 | 3300006931 | Bacteria | 7585 |
| 208 | Ga0097620_100344331 | 3300006931 | Bacteria | 1585 |
| 209 | Ga0097620_101027042 | 3300006931 | Bacteria | 906 |
| 210 | Ga0105240_10015501 | 3300009093 | Bacteria | 10361 |
| 211 | Ga0105240_10074524 | 3300009093 | Bacteria | 4189 |
| 212 | Ga0105240_10088669 | 3300009093 | Bacteria | 3785 |
| 213 | Ga0105240_10095619 | 3300009093 | Bacteria | 3622 |
| 214 | Ga0105240_10487860 | 3300009093 | Bacteria | 1372 |
| 215 | Ga0105240_10884580 | 3300009093 | Bacteria | 962 |
| 216 | Ga0111539_10886538 | 3300009094 | Bacteria | 1038 |
| 217 | Ga0105247_10165443 | 3300009101 | Bacteria | 1467 |
| 218 | Ga0105247_10243910 | 3300009101 | Bacteria | 1225 |
| 219 | Ga0105241_10009386 | 3300009174 | Bacteria | 7188 |
| 220 | Ga0105241_10091566 | 3300009174 | Bacteria | 2399 |
| 221 | Ga0105241_10245181 | 3300009174 | Bacteria | 1516 |
| 222 | Ga0105241_10394162 | 3300009174 | Bacteria | 1213 |
| 223 | Ga0105241_10656940 | 3300009174 | Bacteria | 953 |
| 224 | Ga0105241_10729508 | 3300009174 | Bacteria | 907 |
| 225 | Ga0105241_10952460 | 3300009174 | Bacteria | 800 |
| 226 | Ga0105242_10047025 | 3300009176 | Bacteria | 3503 |
| 227 | Ga0105242_11013304 | 3300009176 | Bacteria | 839 |
| 228 | Ga0105248_10001462 | 3300009177 | Bacteria | 26311 |
| 229 | Ga0105248_10038118 | 3300009177 | Bacteria | 5378 |
| 230 | Ga0105248_10359810 | 3300009177 | Bacteria | 1638 |
| 231 | Ga0105248_10401968 | 3300009177 | Bacteria | 1542 |
| 232 | Ga0105248_10531864 | 3300009177 | Bacteria | 1326 |
| 233 | Ga0105248_10533444 | 3300009177 | Bacteria | 1324 |
| 234 | Ga0105248_10790463 | 3300009177 | Bacteria | 1071 |
| 235 | Ga0105237_10000202 | 3300009545 | Bacteria | 84889 |
| 236 | Ga0105237_10008758 | 3300009545 | Bacteria | 10917 |
| 237 | Ga0105237_10018893 | 3300009545 | Bacteria | 7126 |
| 238 | Ga0105237_10020473 | 3300009545 | Bacteria | 6816 |
| 239 | Ga0105237_10055037 | 3300009545 | Bacteria | 3985 |
| 240 | Ga0105237_10161918 | 3300009545 | Bacteria | 2236 |
| 241 | Ga0105237_10166841 | 3300009545 | Bacteria | 2201 |
| 242 | Ga0105237_10311236 | 3300009545 | Bacteria | 1578 |
| 243 | Ga0105237_10516804 | 3300009545 | Bacteria | 1201 |
| 244 | Ga0105237_10582001 | 3300009545 | Bacteria | 1126 |
| 245 | Ga0105238_10001867 | 3300009551 | Bacteria | 21119 |
| 246 | Ga0105238_10017719 | 3300009551 | Bacteria | 7241 |
| 247 | Ga0105238_10032357 | 3300009551 | Bacteria | 5321 |
| 248 | Ga0105238_10063962 | 3300009551 | Bacteria | 3680 |
| 249 | Ga0105238_10099145 | 3300009551 | Bacteria | 2897 |
| 250 | Ga0105238_10134714 | 3300009551 | Bacteria | 2448 |
| 251 | Ga0105238_10269754 | 3300009551 | Bacteria | 1682 |
| 252 | Ga0105238_11083509 | 3300009551 | Bacteria | 823 |
| 253 | Ga0105249_10002363 | 3300009553 | Bacteria | 16380 |
| 254 | Ga0105249_10008901 | 3300009553 | Bacteria | 8769 |
| 255 | Ga0105239_10019312 | 3300010375 | Bacteria | 7527 |
| 256 | Ga0105239_10023410 | 3300010375 | Bacteria | 6802 |
| 257 | Ga0105239_10161115 | 3300010375 | Bacteria | 2506 |
| 258 | Ga0105239_10203852 | 3300010375 | Bacteria | 2216 |
| 259 | Ga0105239_10205582 | 3300010375 | Bacteria | 2206 |
| 260 | Ga0105239_10216696 | 3300010375 | Bacteria | 2146 |
| 261 | Ga0105239_10392182 | 3300010375 | Bacteria | 1571 |
| 262 | Ga0105239_10410468 | 3300010375 | Bacteria | 1533 |
| 263 | Ga0105239_10873933 | 3300010375 | Bacteria | 1031 |
| 264 | Ga0105246_10027734 | 3300011119 | Bacteria | 3715 |
| 265 | Ga0105246_10061223 | 3300011119 | Bacteria | 2618 |
| 266 | Ga0157326_1016886 | 3300012513 | Bacteria | 868 |
| 267 | Ga0157373_10014849 | 3300013100 | Bacteria | 5704 |
| 268 | Ga0157373_10017413 | 3300013100 | Bacteria | 5235 |
| 269 | Ga0157373_10039784 | 3300013100 | Bacteria | 3365 |
| 270 | Ga0157373_10122400 | 3300013100 | Bacteria | 1828 |
| 271 | Ga0157373_10569840 | 3300013100 | Bacteria | 822 |
| 272 | Ga0157371_10003647 | 3300013102 | Bacteria | 13861 |
| 273 | Ga0157371_10014602 | 3300013102 | Bacteria | 5920 |
| 274 | Ga0157371_10028462 | 3300013102 | Bacteria | 4046 |
| 275 | Ga0157371_10048524 | 3300013102 | Bacteria | 3018 |
| 276 | Ga0157371_10147703 | 3300013102 | Bacteria | 1676 |
| 277 | Ga0157371_10204810 | 3300013102 | Bacteria | 1415 |
| 278 | Ga0157370_10010975 | 3300013104 | Bacteria | 9504 |
| 279 | Ga0157370_10013955 | 3300013104 | Bacteria | 8250 |
| 280 | Ga0157370_10016379 | 3300013104 | Bacteria | 7503 |
| 281 | Ga0157370_10125618 | 3300013104 | Bacteria | 2394 |
| 282 | Ga0157370_10171705 | 3300013104 | Bacteria | 2015 |
| 283 | Ga0157370_10255156 | 3300013104 | Bacteria | 1622 |
| 284 | Ga0157370_10870333 | 3300013104 | Bacteria | 818 |
| 285 | Ga0157370_10997638 | 3300013104 | Bacteria | 758 |
| 286 | Ga0157369_10000195 | 3300013105 | Bacteria | 84688 |
| 287 | Ga0157369_10004547 | 3300013105 | Bacteria | 16312 |
| 288 | Ga0157369_10012799 | 3300013105 | Bacteria | 9513 |
| 289 | Ga0157369_10097251 | 3300013105 | Bacteria | 3141 |
| 290 | Ga0157369_10142387 | 3300013105 | Bacteria | 2536 |
| 291 | Ga0157369_10209993 | 3300013105 | Bacteria | 2041 |
| 292 | Ga0157369_10243903 | 3300013105 | Bacteria | 1876 |
| 293 | Ga0157369_10377727 | 3300013105 | Bacteria | 1471 |
| 294 | Ga0157374_10011793 | 3300013296 | Bacteria | 7584 |
| 295 | Ga0157374_10056986 | 3300013296 | Bacteria | 3649 |
| 296 | Ga0157374_10284900 | 3300013296 | Bacteria | 1632 |
| 297 | Ga0157378_10045866 | 3300013297 | Bacteria | 3885 |
| 298 | Ga0157378_10549281 | 3300013297 | Bacteria | 1160 |
| 299 | Ga0157378_10595795 | 3300013297 | Bacteria | 1116 |
| 300 | Ga0157378_10711924 | 3300013297 | Bacteria | 1024 |
| 301 | Ga0163162_10000003 | 3300013306 | Bacteria | 698280 |
| 302 | Ga0163162_10000236 | 3300013306 | Bacteria | 50620 |
| 303 | Ga0163162_10371860 | 3300013306 | Bacteria | 1562 |
| 304 | Ga0157372_10005441 | 3300013307 | Bacteria | 13531 |
| 305 | Ga0157372_10007019 | 3300013307 | Bacteria | 11995 |
| 306 | Ga0157372_10019326 | 3300013307 | Bacteria | 7338 |
| 307 | Ga0157372_10019352 | 3300013307 | Bacteria | 7335 |
| 308 | Ga0157372_10216413 | 3300013307 | Bacteria | 2220 |
| 309 | Ga0157372_10455968 | 3300013307 | Bacteria | 1490 |
| 310 | Ga0157372_10773055 | 3300013307 | Bacteria | 1116 |
| 311 | Ga0157372_11797896 | 3300013307 | Bacteria | 705 |
| 312 | Ga0157375_10066877 | 3300013308 | Bacteria | 3589 |
| 313 | Ga0157375_10080866 | 3300013308 | Bacteria | 3288 |
| 314 | Ga0157375_10361666 | 3300013308 | Bacteria | 1617 |
| 315 | Ga0163163_10000196 | 3300014325 | Bacteria | 62407 |
| 316 | Ga0163163_10136376 | 3300014325 | Bacteria | 2495 |
| 317 | Ga0163163_10381420 | 3300014325 | Bacteria | 1467 |
| 318 | Ga0157380_11007094 | 3300014326 | Bacteria | 867 |
| 319 | Ga0157380_11679752 | 3300014326 | Bacteria | 692 |
| 320 | Ga0182008_10017736 | 3300014497 | Bacteria | 3690 |
| 321 | Ga0182008_10054015 | 3300014497 | Bacteria | 1988 |
| 322 | Ga0157377_10791270 | 3300014745 | Bacteria | 698 |
| 323 | Ga0157379_10089866 | 3300014968 | Bacteria | 2755 |
| 324 | Ga0157379_10154459 | 3300014968 | Bacteria | 2070 |
| 325 | Ga0157379_10266710 | 3300014968 | Bacteria | 1557 |
| 326 | Ga0157379_10345633 | 3300014968 | Bacteria | 1361 |
| 327 | Ga0157376_10000734 | 3300014969 | Bacteria | 21294 |
| 328 | Ga0157376_10101988 | 3300014969 | Bacteria | 2509 |
| 329 | Ga0157376_10264663 | 3300014969 | Bacteria | 1612 |
| 330 | Ga0157376_10402560 | 3300014969 | Bacteria | 1324 |
| 331 | Ga0182006_1210691 | 3300015261 | Bacteria | 642 |
| 332 | Ga0182007_10004354 | 3300015262 | Bacteria | 6432 |
| 333 | Ga0182007_10056763 | 3300015262 | Bacteria | 1285 |
| 334 | Ga0182007_10077240 | 3300015262 | Bacteria | 1092 |
| 335 | Ga0182005_1000004 | 3300015265 | Bacteria | 609645 |
| 336 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 337 | Ga0163161_10002464 | 3300017792 | Bacteria | 13212 |
| 338 | Ga0206354_10672385 | 3300020081 | Bacteria | 1284 |
| 339 | Ga0209674_103668 | 3300025226 | Bacteria | 2742 |
| 340 | Ga0209672_100237 | 3300025228 | Bacteria | 41924 |
| 341 | Ga0207427_100040 | 3300025231 | Bacteria | 265135 |
| 342 | Ga0207427_100115 | 3300025231 | Bacteria | 104282 |
| 343 | Ga0207427_100130 | 3300025231 | Bacteria | 94510 |
| 344 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 345 | Ga0209437_100079 | 3300025233 | Bacteria | 275948 |
| 346 | Ga0209437_100172 | 3300025233 | Bacteria | 140146 |
| 347 | Ga0209258_100246 | 3300025242 | Bacteria | 99606 |
| 348 | Ga0209258_100806 | 3300025242 | Bacteria | 18294 |
| 349 | Ga0209646_1000500 | 3300025246 | Bacteria | 18240 |
| 350 | Ga0209026_1000105 | 3300025250 | Bacteria | 150738 |
| 351 | Ga0209026_1001092 | 3300025250 | Bacteria | 13010 |
| 352 | Ga0209026_1009956 | 3300025250 | Bacteria | 1813 |
| 353 | Ga0209148_1000024 | 3300025254 | Bacteria | 669890 |
| 354 | Ga0209759_1000907 | 3300025256 | Bacteria | 22090 |
| 355 | Ga0209759_1001941 | 3300025256 | Bacteria | 10054 |
| 356 | Ga0209759_1017742 | 3300025256 | Bacteria | 1742 |
| 357 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 358 | Ga0209233_1000108 | 3300025261 | Bacteria | 265137 |
| 359 | Ga0209233_1000121 | 3300025261 | Bacteria | 233309 |
| 360 | Ga0209455_1000025 | 3300025272 | Bacteria | 670673 |
| 361 | Ga0207426_1017394 | 3300025302 | Bacteria | 2558 |
| 362 | Ga0209257_1000145 | 3300025304 | Bacteria | 195152 |
| 363 | Ga0207656_10000750 | 3300025321 | Bacteria | 10626 |
| 364 | Ga0207656_10072651 | 3300025321 | Bacteria | 1532 |
| 365 | Ga0207680_10000006 | 3300025903 | Bacteria | 635950 |
| 366 | Ga0207680_10010093 | 3300025903 | Bacteria | 4712 |
| 367 | Ga0207680_10125419 | 3300025903 | Bacteria | 1685 |
| 368 | Ga0207680_10151500 | 3300025903 | Bacteria | 1546 |
| 369 | Ga0207647_10000091 | 3300025904 | Bacteria | 68421 |
| 370 | Ga0207647_10002917 | 3300025904 | Bacteria | 12877 |
| 371 | Ga0207645_10008128 | 3300025907 | Bacteria | 7353 |
| 372 | Ga0207645_10042438 | 3300025907 | Bacteria | 2910 |
| 373 | Ga0207643_10126130 | 3300025908 | Bacteria | 1520 |
| 374 | Ga0207705_10031472 | 3300025909 | Bacteria | 3788 |
| 375 | Ga0207705_10500109 | 3300025909 | Bacteria | 944 |
| 376 | Ga0207705_11080398 | 3300025909 | Bacteria | 618 |
| 377 | Ga0207654_10000065 | 3300025911 | Bacteria | 69237 |
| 378 | Ga0207654_10020184 | 3300025911 | Bacteria | 3529 |
| 379 | Ga0207654_10025227 | 3300025911 | Bacteria | 3204 |
| 380 | Ga0207654_10044869 | 3300025911 | Bacteria | 2513 |
| 381 | Ga0207654_10095886 | 3300025911 | Bacteria | 1818 |
| 382 | Ga0207654_10445749 | 3300025911 | Bacteria | 907 |
| 383 | Ga0207707_10000641 | 3300025912 | Bacteria | 34523 |
| 384 | Ga0207707_10052739 | 3300025912 | Bacteria | 3540 |
| 385 | Ga0207707_10245050 | 3300025912 | Bacteria | 1557 |
| 386 | Ga0207695_10001492 | 3300025913 | Bacteria | 39028 |
| 387 | Ga0207695_10009244 | 3300025913 | Bacteria | 12214 |
| 388 | Ga0207695_10010430 | 3300025913 | Bacteria | 11367 |
| 389 | Ga0207695_10013791 | 3300025913 | Bacteria | 9616 |
| 390 | Ga0207695_10058089 | 3300025913 | Bacteria | 4016 |
| 391 | Ga0207695_10112306 | 3300025913 | Bacteria | 2703 |
| 392 | Ga0207695_10595603 | 3300025913 | Bacteria | 986 |
| 393 | Ga0207671_10000726 | 3300025914 | Bacteria | 41902 |
| 394 | Ga0207671_10001709 | 3300025914 | Bacteria | 24785 |
| 395 | Ga0207671_10004311 | 3300025914 | Bacteria | 13675 |
| 396 | Ga0207671_10011034 | 3300025914 | Bacteria | 7397 |
| 397 | Ga0207671_10042128 | 3300025914 | Bacteria | 3380 |
| 398 | Ga0207671_10068319 | 3300025914 | Bacteria | 2648 |
| 399 | Ga0207671_10247644 | 3300025914 | Bacteria | 1401 |
| 400 | Ga0207671_10505242 | 3300025914 | Bacteria | 964 |
| 401 | Ga0207671_10776506 | 3300025914 | Bacteria | 760 |
| 402 | Ga0207660_10297938 | 3300025917 | Bacteria | 1284 |
| 403 | Ga0207657_10003100 | 3300025919 | Bacteria | 17774 |
| 404 | Ga0207649_10000447 | 3300025920 | Bacteria | 29709 |
| 405 | Ga0207649_10054552 | 3300025920 | Bacteria | 2488 |
| 406 | Ga0207649_10184952 | 3300025920 | Bacteria | 1461 |
| 407 | Ga0207652_11511933 | 3300025921 | Bacteria | 575 |
| 408 | Ga0207681_10387327 | 3300025923 | Bacteria | 1126 |
| 409 | Ga0207681_10649757 | 3300025923 | Bacteria | 874 |
| 410 | Ga0207681_11068835 | 3300025923 | Bacteria | 678 |
| 411 | Ga0207694_10000162 | 3300025924 | Bacteria | 68375 |
| 412 | Ga0207694_10005909 | 3300025924 | Bacteria | 9384 |
| 413 | Ga0207694_10010020 | 3300025924 | Bacteria | 7142 |
| 414 | Ga0207694_10031338 | 3300025924 | Bacteria | 4061 |
| 415 | Ga0207694_10046795 | 3300025924 | Bacteria | 3344 |
| 416 | Ga0207694_10135584 | 3300025924 | Bacteria | 1976 |
| 417 | Ga0207650_10012333 | 3300025925 | Bacteria | 5899 |
| 418 | Ga0207650_10249151 | 3300025925 | Bacteria | 1438 |
| 419 | Ga0207650_10625677 | 3300025925 | Bacteria | 906 |
| 420 | Ga0207659_10189913 | 3300025926 | Bacteria | 1634 |
| 421 | Ga0207687_10381976 | 3300025927 | Bacteria | 1154 |
| 422 | Ga0207700_10003472 | 3300025928 | Bacteria | 9176 |
| 423 | Ga0207664_10003176 | 3300025929 | Bacteria | 10917 |
| 424 | Ga0207664_10216281 | 3300025929 | Bacteria | 1660 |
| 425 | Ga0207644_10019889 | 3300025931 | Bacteria | 4559 |
| 426 | Ga0207644_10603820 | 3300025931 | Bacteria | 911 |
| 427 | Ga0207644_10719428 | 3300025931 | Bacteria | 833 |
| 428 | Ga0207690_10318815 | 3300025932 | Bacteria | 1221 |
| 429 | Ga0207706_10001761 | 3300025933 | Bacteria | 21250 |
| 430 | Ga0207706_10070574 | 3300025933 | Bacteria | 3073 |
| 431 | Ga0207686_10902852 | 3300025934 | Bacteria | 713 |
| 432 | Ga0207670_10137570 | 3300025936 | Bacteria | 1797 |
| 433 | Ga0207704_10004475 | 3300025938 | Bacteria | 6387 |
| 434 | Ga0207704_10101378 | 3300025938 | Bacteria | 1920 |
| 435 | Ga0207704_10259950 | 3300025938 | Bacteria | 1308 |
| 436 | Ga0207704_10628631 | 3300025938 | Bacteria | 882 |
| 437 | Ga0207691_10063560 | 3300025940 | Bacteria | 3347 |
| 438 | Ga0207691_11045615 | 3300025940 | Bacteria | 680 |
| 439 | Ga0207711_10007760 | 3300025941 | Bacteria | 8965 |
| 440 | Ga0207711_10036542 | 3300025941 | Bacteria | 4168 |
| 441 | Ga0207711_10231908 | 3300025941 | Bacteria | 1691 |
| 442 | Ga0207711_10345179 | 3300025941 | Bacteria | 1378 |
| 443 | Ga0207689_10056528 | 3300025942 | Bacteria | 3229 |
| 444 | Ga0207689_10112245 | 3300025942 | Bacteria | 2241 |
| 445 | Ga0207689_10224681 | 3300025942 | Bacteria | 1552 |
| 446 | Ga0207689_10307716 | 3300025942 | Bacteria | 1314 |
| 447 | Ga0207689_10343794 | 3300025942 | Bacteria | 1239 |
| 448 | Ga0207661_10042331 | 3300025944 | Bacteria | 3590 |
| 449 | Ga0207661_11379533 | 3300025944 | Bacteria | 647 |
| 450 | Ga0207679_10091567 | 3300025945 | Bacteria | 2353 |
| 451 | Ga0207679_10238823 | 3300025945 | Bacteria | 1538 |
| 452 | Ga0207667_10017535 | 3300025949 | Bacteria | 8053 |
| 453 | Ga0207667_10049480 | 3300025949 | Bacteria | 4438 |
| 454 | Ga0207667_10320311 | 3300025949 | Bacteria | 1583 |
| 455 | Ga0207667_10592568 | 3300025949 | Bacteria | 1118 |
| 456 | Ga0207667_10684266 | 3300025949 | Bacteria | 1029 |
| 457 | Ga0207651_10493077 | 3300025960 | Bacteria | 1058 |
| 458 | Ga0207712_10000354 | 3300025961 | Bacteria | 40709 |
| 459 | Ga0207712_10000677 | 3300025961 | Bacteria | 26367 |
| 460 | Ga0207668_10139484 | 3300025972 | Bacteria | 1862 |
| 461 | Ga0207668_10243186 | 3300025972 | Bacteria | 1457 |
| 462 | Ga0207668_10647632 | 3300025972 | Bacteria | 924 |
| 463 | Ga0207640_10017628 | 3300025981 | Bacteria | 4182 |
| 464 | Ga0207640_10143997 | 3300025981 | Bacteria | 1741 |
| 465 | Ga0207640_10200658 | 3300025981 | Bacteria | 1511 |
| 466 | Ga0207640_10244153 | 3300025981 | Bacteria | 1389 |
| 467 | Ga0207640_10559357 | 3300025981 | Bacteria | 962 |
| 468 | Ga0207640_10596196 | 3300025981 | Bacteria | 935 |
| 469 | Ga0207658_10000006 | 3300025986 | Bacteria | 392309 |
| 470 | Ga0207658_10017811 | 3300025986 | Bacteria | 4894 |
| 471 | Ga0207658_10035782 | 3300025986 | Bacteria | 3557 |
| 472 | Ga0207658_10093763 | 3300025986 | Bacteria | 2335 |
| 473 | Ga0207658_10112380 | 3300025986 | Bacteria | 2156 |
| 474 | Ga0207658_10193339 | 3300025986 | Bacteria | 1693 |
| 475 | Ga0207658_10510794 | 3300025986 | Bacteria | 1071 |
| 476 | Ga0207658_10537771 | 3300025986 | Bacteria | 1044 |
| 477 | Ga0207677_10275189 | 3300026023 | Bacteria | 1379 |
| 478 | Ga0207703_10008155 | 3300026035 | Bacteria | 8277 |
| 479 | Ga0207703_10238645 | 3300026035 | Bacteria | 1633 |
| 480 | Ga0207703_11469480 | 3300026035 | Bacteria | 656 |
| 481 | Ga0207639_10000955 | 3300026041 | Bacteria | 19606 |
| 482 | Ga0207639_10001472 | 3300026041 | Bacteria | 15846 |
| 483 | Ga0207639_10006738 | 3300026041 | Bacteria | 7818 |
| 484 | Ga0207639_10063785 | 3300026041 | Bacteria | 2854 |
| 485 | Ga0207639_10243867 | 3300026041 | Bacteria | 1564 |
| 486 | Ga0207639_10502276 | 3300026041 | Bacteria | 1108 |
| 487 | Ga0207639_10661296 | 3300026041 | Bacteria | 967 |
| 488 | Ga0207639_10916584 | 3300026041 | Bacteria | 819 |
| 489 | Ga0207639_11078295 | 3300026041 | Bacteria | 753 |
| 490 | Ga0207678_10004860 | 3300026067 | Bacteria | 12069 |
| 491 | Ga0207678_10019625 | 3300026067 | Bacteria | 5943 |
| 492 | Ga0207678_10206327 | 3300026067 | Bacteria | 1681 |
| 493 | Ga0207678_11107666 | 3300026067 | Bacteria | 701 |
| 494 | Ga0207702_10009340 | 3300026078 | Bacteria | 8239 |
| 495 | Ga0207702_10028139 | 3300026078 | Bacteria | 4670 |
| 496 | Ga0207702_10080298 | 3300026078 | Bacteria | 2829 |
| 497 | Ga0207702_10319521 | 3300026078 | Bacteria | 1478 |
| 498 | Ga0207702_11347938 | 3300026078 | Bacteria | 707 |
| 499 | Ga0207641_10185918 | 3300026088 | Bacteria | 1906 |
| 500 | Ga0207641_10283783 | 3300026088 | Bacteria | 1558 |
| 501 | Ga0207641_10480936 | 3300026088 | Bacteria | 1203 |
| 502 | Ga0207648_10082156 | 3300026089 | Bacteria | 2810 |
| 503 | Ga0207648_10801246 | 3300026089 | Bacteria | 877 |
| 504 | Ga0207676_10020708 | 3300026095 | Bacteria | 4815 |
| 505 | Ga0207676_10131613 | 3300026095 | Bacteria | 2128 |
| 506 | Ga0207676_10547304 | 3300026095 | Bacteria | 1105 |
| 507 | Ga0207674_10002998 | 3300026116 | Bacteria | 20947 |
| 508 | Ga0207674_10014829 | 3300026116 | Bacteria | 8596 |
| 509 | Ga0207674_10045181 | 3300026116 | Bacteria | 4533 |
| 510 | Ga0207675_100085274 | 3300026118 | Bacteria | 2964 |
| 511 | Ga0207675_100242712 | 3300026118 | Bacteria | 1741 |
| 512 | Ga0207683_10002105 | 3300026121 | Bacteria | 17534 |
| 513 | Ga0207683_10003087 | 3300026121 | Bacteria | 14551 |
| 514 | Ga0207683_10178672 | 3300026121 | Bacteria | 1924 |
| 515 | Ga0207683_10413038 | 3300026121 | Bacteria | 1242 |
| 516 | Ga0207698_10037983 | 3300026142 | Bacteria | 3553 |
| 517 | Ga0207698_10103822 | 3300026142 | Bacteria | 2363 |
| 518 | Ga0207698_10342443 | 3300026142 | Bacteria | 1409 |
| 519 | Ga0207698_11122631 | 3300026142 | Bacteria | 799 |
| 520 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 521 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 522 | Ga0268266_10000021 | 3300028379 | Bacteria | 522453 |
| 523 | Ga0268266_10031052 | 3300028379 | Bacteria | 4537 |
| 524 | Ga0268266_10051990 | 3300028379 | Bacteria | 3517 |
| 525 | Ga0268266_10058826 | 3300028379 | Bacteria | 3310 |
| 526 | Ga0268266_10080418 | 3300028379 | Bacteria | 2840 |
| 527 | Ga0268266_10275366 | 3300028379 | Bacteria | 1563 |
| 528 | Ga0268266_10516068 | 3300028379 | Bacteria | 1142 |
| 529 | Ga0268265_10002801 | 3300028380 | Bacteria | 12848 |
| 530 | Ga0268265_10120047 | 3300028380 | Bacteria | 2164 |
| 531 | Ga0268264_10009178 | 3300028381 | Bacteria | 8194 |
| 532 | Ga0268264_10107393 | 3300028381 | Bacteria | 2438 |
| 533 | Ga0268264_10339490 | 3300028381 | Bacteria | 1426 |
| 534 | Ga0265332_10110878 | 3300031238 | Bacteria | 1156 |
| 535 | Ga0307508_10012852 | 3300031616 | Bacteria | 7655 |
| 536 | Ga0307516_10136241 | 3300031730 | Bacteria | 2229 |
| 537 | Ga0307405_10197212 | 3300031731 | Bacteria | 1459 |
| 538 | Ga0307405_10268704 | 3300031731 | Bacteria | 1278 |
| 539 | Ga0307407_10228419 | 3300031903 | Bacteria | 1262 |
| 540 | Ga0307412_10186234 | 3300031911 | Bacteria | 1566 |
| 541 | Ga0307409_100104473 | 3300031995 | Bacteria | 2359 |
| 542 | Ga0307414_10163842 | 3300032004 | Bacteria | 1769 |
| 543 | Ga0307414_10251535 | 3300032004 | Bacteria | 1469 |
| 544 | Ga0307507_10322001 | 3300033179 | Bacteria | 930 |
| 545 | Ga0307510_10014110 | 3300033180 | Bacteria | 9461 |
| 546 | Ga0373944_0010152 | 3300035089 | Bacteria | 2562 |
| 547 | Ga0373953_0161241 | 3300035117 | Bacteria | 964 |
| 548 | Ga0373924_0264281 | 3300035410 | Bacteria | 763 |
| 549 | Ga0373933_0203783 | 3300035724 | Bacteria | 1266 |
| 550 | Ga0373937_0015568 | 3300036401 | Bacteria | 6730 |
| 551 | Ga0395900_0193227 | 3300037418 | Bacteria | 2063 |
| 552 | Ga0395905_0000577 | 3300037471 | Bacteria | 49489 |
| 553 | Ga0395901_0024530 | 3300038443 | Bacteria | 6191 |
| 554 | Ga0395901_0080831 | 3300038443 | Bacteria | 3394 |
| 555 | Ga0395901_0501959 | 3300038443 | Bacteria | 1235 |
| 556 | Ga0395901_1101987 | 3300038443 | Bacteria | 764 |
| 557 | Ga0436365_1382606 | 3300039437 | Bacteria | 3124 |
| 558 | Ga0436365_1829561 | 3300039437 | Bacteria | 736 |
| 559 | Ga0451787_313061 | 3300041441 | Bacteria | 937 |
| 560 | Ga0451789_0232468 | 3300041443 | Bacteria | 2402 |
| 561 | Ga0451791_1139757 | 3300041451 | Bacteria | 1057 |
| 562 | Ga0451793_0324997 | 3300041452 | Bacteria | 3220 |
| 563 | Ga0451798_1175536 | 3300041458 | Bacteria | 1105 |
| 564 | Ga0451802_1618475 | 3300041460 | Bacteria | 1273 |
| 565 | Ga0451806_196532 | 3300041462 | Bacteria | 765 |
| 566 | Ga0451804_0461783 | 3300041463 | Bacteria | 1142 |
| 567 | Ga0451804_0515953 | 3300041463 | Bacteria | 838 |
| 568 | Ga0451807_1293046 | 3300041486 | Bacteria | 691 |
| 569 | Ga0451807_2640286 | 3300041486 | Bacteria | 6134 |
| 570 | Ga0451837_0354769 | 3300041494 | Bacteria | 959 |
| 571 | Ga0451837_1800117 | 3300041494 | Bacteria | 1235 |
| 572 | Ga0451839_1321482 | 3300041496 | Bacteria | 1033 |
| 573 | Ga0451843_0934667 | 3300041509 | Bacteria | 1079 |
| 574 | Ga0451843_1653258 | 3300041509 | Bacteria | 3316 |
| 575 | Ga0451853_3308297 | 3300041512 | Bacteria | 1403 |
| 576 | Ga0439448_0125511 | 3300042005 | Bacteria | 882 |
| 577 | Ga0439449_0103205 | 3300042007 | Bacteria | 1054 |
| 578 | Ga0439459_0001975 | 3300042438 | Bacteria | 3114 |
| 579 | Ga0453684_0000377 | 3300044712 | Bacteria | 183445 |
| 580 | Ga0453684_0499313 | 3300044712 | Bacteria | 1347 |
| 581 | Ga0466970_0007619 | 3300044765 | Bacteria | 5427 |
| 582 | Ga0451576_0000033 | 3300045051 | Bacteria | 393131 |
| 583 | Ga0495638_0000063 | 3300046460 | Bacteria | 185733 |
| 584 | Ga0495638_0064037 | 3300046460 | Bacteria | 2265 |
| 585 | Ga0495650_0002554 | 3300046471 | Bacteria | 14454 |
| 586 | Ga0495582_0022480 | 3300046473 | Bacteria | 3451 |
| 587 | Ga0495607_0000003 | 3300046501 | Bacteria | 366900 |
| 588 | Ga0495606_0001000 | 3300046507 | Bacteria | 41217 |
| 589 | Ga0495606_0015836 | 3300046507 | Bacteria | 5787 |
| 590 | Ga0495606_0031819 | 3300046507 | Bacteria | 3662 |
| 591 | Ga0495610_0021270 | 3300046512 | Bacteria | 3572 |
| 592 | Ga0495610_0115460 | 3300046512 | Bacteria | 1184 |
| 593 | Ga0495616_0183344 | 3300046513 | Bacteria | 929 |
| 594 | Ga0495620_0008202 | 3300046515 | Bacteria | 5617 |
| 595 | Ga0495631_0003861 | 3300046518 | Bacteria | 8115 |
| 596 | Ga0495632_0000011 | 3300046519 | Bacteria | 266804 |
| 597 | Ga0495632_0019552 | 3300046519 | Bacteria | 3686 |
| 598 | Ga0495648_0025746 | 3300046524 | Bacteria | 3976 |
| 599 | Ga0495586_0135540 | 3300046535 | Bacteria | 1380 |
| 600 | Ga0495622_0062103 | 3300046557 | Bacteria | 1730 |
| 601 | Ga0495633_0189155 | 3300046558 | Bacteria | 946 |
| 602 | Ga0495611_0000068 | 3300046648 | Bacteria | 71983 |
| 603 | Ga0495625_0054963 | 3300046660 | Bacteria | 2841 |
| 604 | Ga0495625_0088678 | 3300046660 | Bacteria | 2142 |
| 605 | Ga0495588_0348843 | 3300046674 | Bacteria | 778 |
| 606 | Ga0495599_0669546 | 3300046678 | Bacteria | 600 |
| 607 | Ga0495647_0086713 | 3300046681 | Bacteria | 1277 |
| 608 | Ga0495658_0006329 | 3300046683 | Bacteria | 5816 |
| 609 | Ga0495658_0684504 | 3300046683 | Bacteria | 657 |
| 610 | Ga0495636_0000522 | 3300047318 | Bacteria | 14147 |
| 611 | Ga0495680_0215176 | 3300047322 | Bacteria | 1374 |
| 612 | Ga0495673_0000229 | 3300047469 | Bacteria | 82319 |
| 613 | Ga0495686_0000037 | 3300047472 | Bacteria | 307937 |
| 614 | Ga0495686_0037360 | 3300047472 | Bacteria | 3111 |
| 615 | Ga0496101_0007405 | 3300048904 | Bacteria | 7112 |
| 616 | Ga0496101_0207430 | 3300048904 | Bacteria | 1517 |
| 617 | Ga0496102_0359306 | 3300048905 | Bacteria | 1371 |
| 618 | Ga0496102_1544009 | 3300048905 | Bacteria | 582 |
| 619 | Ga0496103_0053287 | 3300048906 | Bacteria | 2507 |
| 620 | Ga0496104_0000011 | 3300048907 | Bacteria | 459358 |
| 621 | Ga0496105_0000071 | 3300048908 | Bacteria | 79908 |
| 622 | Ga0496105_0349928 | 3300048908 | Bacteria | 1180 |
| 623 | Ga0496108_0471812 | 3300048911 | Bacteria | 1096 |
| 624 | Ga0496109_0174386 | 3300048912 | Bacteria | 2018 |
| 625 | Ga0496112_0891872 | 3300048915 | Bacteria | 811 |
| 626 | Ga0496114_0383774 | 3300048917 | Bacteria | 1244 |
| 627 | Ga0496115_0000153 | 3300048918 | Bacteria | 64207 |
| 628 | Ga0496115_0119821 | 3300048918 | Bacteria | 2165 |
| 629 | Ga0496116_0162714 | 3300048919 | Bacteria | 1222 |
| 630 | Ga0496117_0005879 | 3300048920 | Bacteria | 12682 |
| 631 | Ga0496118_0000362 | 3300048921 | Bacteria | 76786 |
| 632 | Ga0496118_0018115 | 3300048921 | Bacteria | 6371 |
| 633 | Ga0496119_0000851 | 3300048922 | Bacteria | 40261 |
| 634 | Ga0496119_0024644 | 3300048922 | Bacteria | 4226 |
| 635 | Ga0496120_0001387 | 3300048923 | Bacteria | 29403 |
| 636 | Ga0496121_0068082 | 3300048924 | Bacteria | 2882 |
| 637 | Ga0496121_0253006 | 3300048924 | Bacteria | 1220 |
| 638 | Ga0496122_0001419 | 3300048925 | Bacteria | 38784 |
| 639 | Ga0496122_0012114 | 3300048925 | Bacteria | 8634 |
| 640 | Ga0496122_0013791 | 3300048925 | Bacteria | 7875 |
| 641 | Ga0496122_0045754 | 3300048925 | Bacteria | 3397 |
| 642 | Ga0496123_0001240 | 3300048926 | Bacteria | 37029 |
| 643 | Ga0496123_0033997 | 3300048926 | Bacteria | 3660 |
| 644 | Ga0496123_0050317 | 3300048926 | Bacteria | 2784 |
| 645 | Ga0496123_0377951 | 3300048926 | Bacteria | 651 |
| 646 | Ga0496124_0000893 | 3300048927 | Bacteria | 48172 |
| 647 | Ga0496124_0015807 | 3300048927 | Bacteria | 7211 |
| 648 | Ga0496125_0065237 | 3300048928 | Bacteria | 2886 |
| 649 | Ga0496125_0252505 | 3300048928 | Bacteria | 1111 |
| 650 | Ga0496126_0000199 | 3300048929 | Bacteria | 133742 |
| 651 | Ga0496126_0092387 | 3300048929 | Bacteria | 2659 |
| 652 | Ga0496126_0361429 | 3300048929 | Bacteria | 1185 |
| 653 | Ga0495678_164343 | 3300049459 | Bacteria | 707 |
| 654 | Ga0501031_0039849 | 3300049568 | Bacteria | 3066 |
| 655 | Ga0501031_0396754 | 3300049568 | Bacteria | 892 |
| 656 | Ga0501032_0002312 | 3300049569 | Bacteria | 14953 |
| 657 | Ga0501032_0002816 | 3300049569 | Bacteria | 13525 |
| 658 | Ga0501032_0203665 | 3300049569 | Bacteria | 1291 |
| 659 | Ga0501032_0352007 | 3300049569 | Bacteria | 949 |
| 660 | Ga0501033_0000329 | 3300049570 | Bacteria | 45324 |
| 661 | Ga0501033_0002545 | 3300049570 | Bacteria | 15427 |
| 662 | Ga0501033_0005030 | 3300049570 | Bacteria | 10525 |
| 663 | Ga0501033_0113682 | 3300049570 | Bacteria | 1968 |
| 664 | Ga0501033_0149050 | 3300049570 | Bacteria | 1688 |
| 665 | Ga0501034_0000462 | 3300049571 | Bacteria | 67291 |
| 666 | Ga0501034_0005495 | 3300049571 | Bacteria | 13833 |
| 667 | Ga0501034_0008806 | 3300049571 | Bacteria | 10620 |
| 668 | Ga0501034_0009780 | 3300049571 | Bacteria | 10028 |
| 669 | Ga0501034_0045875 | 3300049571 | Bacteria | 4415 |
| 670 | Ga0501034_0245487 | 3300049571 | Bacteria | 1735 |
| 671 | Ga0501034_1127123 | 3300049571 | Bacteria | 665 |
| 672 | Ga0501036_0008335 | 3300049572 | Bacteria | 8492 |
| 673 | Ga0501036_0033157 | 3300049572 | Bacteria | 4368 |
| 674 | Ga0501036_0038435 | 3300049572 | Bacteria | 4051 |
| 675 | Ga0501037_0000815 | 3300049573 | Bacteria | 23310 |
| 676 | Ga0501037_0001246 | 3300049573 | Bacteria | 18764 |
| 677 | Ga0501037_0164498 | 3300049573 | Bacteria | 1580 |
| 678 | Ga0501037_0169325 | 3300049573 | Bacteria | 1553 |
| 679 | Ga0501037_0169510 | 3300049573 | Bacteria | 1552 |
| 680 | Ga0501038_0001377 | 3300049574 | Bacteria | 22209 |
| 681 | Ga0501038_0003503 | 3300049574 | Bacteria | 14613 |
| 682 | Ga0501038_0069785 | 3300049574 | Bacteria | 2984 |
| 683 | Ga0501039_0006941 | 3300049575 | Bacteria | 8619 |
| 684 | Ga0501039_0143013 | 3300049575 | Bacteria | 1879 |
| 685 | Ga0501039_0567220 | 3300049575 | Bacteria | 890 |
| 686 | Ga0501039_0896089 | 3300049575 | Bacteria | 690 |
| 687 | Ga0501042_0129517 | 3300049578 | Bacteria | 1818 |
| 688 | Ga0501042_0284719 | 3300049578 | Bacteria | 1194 |
| 689 | Ga0501043_0018924 | 3300049579 | Bacteria | 5404 |
| 690 | Ga0501043_0044929 | 3300049579 | Bacteria | 3474 |
| 691 | Ga0501046_0004658 | 3300049580 | Bacteria | 12390 |
| 692 | Ga0501046_0006111 | 3300049580 | Bacteria | 10705 |
| 693 | Ga0501046_0020493 | 3300049580 | Bacteria | 5465 |
| 694 | Ga0501046_0062606 | 3300049580 | Bacteria | 2906 |
| 695 | Ga0501047_0000442 | 3300049581 | Bacteria | 45876 |
| 696 | Ga0501047_0009516 | 3300049581 | Bacteria | 9183 |
| 697 | Ga0501047_0039527 | 3300049581 | Bacteria | 4562 |
| 698 | Ga0501047_0135765 | 3300049581 | Bacteria | 2340 |
| 699 | Ga0501047_0371243 | 3300049581 | Bacteria | 1265 |
| 700 | Ga0501047_0564776 | 3300049581 | Bacteria | 961 |
| 701 | Ga0501048_0011657 | 3300049582 | Bacteria | 6556 |
| 702 | Ga0501048_0089741 | 3300049582 | Bacteria | 2168 |
| 703 | Ga0501048_0378663 | 3300049582 | Bacteria | 1010 |
| 704 | Ga0501067_0040303 | 3300049583 | Bacteria | 2594 |
| 705 | Ga0501067_0270395 | 3300049583 | Bacteria | 946 |
| 706 | Ga0501068_0061005 | 3300049584 | Bacteria | 2290 |
| 707 | Ga0501068_0101517 | 3300049584 | Bacteria | 1783 |
| 708 | Ga0501069_0123731 | 3300049585 | Bacteria | 1478 |
| 709 | Ga0501070_0003148 | 3300049586 | Bacteria | 14367 |
| 710 | Ga0501070_0007994 | 3300049586 | Bacteria | 8956 |
| 711 | Ga0501070_0012356 | 3300049586 | Bacteria | 7204 |
| 712 | Ga0501070_0019143 | 3300049586 | Bacteria | 5742 |
| 713 | Ga0501070_0379252 | 3300049586 | Bacteria | 1145 |
| 714 | Ga0501070_0513722 | 3300049586 | Bacteria | 961 |
| 715 | Ga0501071_0008690 | 3300049587 | Bacteria | 6720 |
| 716 | Ga0501071_0040952 | 3300049587 | Bacteria | 3317 |
| 717 | Ga0501072_0096613 | 3300049588 | Bacteria | 2347 |
| 718 | Ga0501073_0008238 | 3300049589 | Bacteria | 7730 |
| 719 | Ga0501073_0013158 | 3300049589 | Bacteria | 6031 |
| 720 | Ga0501073_0015900 | 3300049589 | Bacteria | 5453 |
| 721 | Ga0501073_0032725 | 3300049589 | Bacteria | 3706 |
| 722 | Ga0501073_0135137 | 3300049589 | Bacteria | 1709 |
| 723 | Ga0501074_0027269 | 3300049590 | Bacteria | 4141 |
| 724 | Ga0501074_0028263 | 3300049590 | Bacteria | 4064 |
| 725 | Ga0501074_0042555 | 3300049590 | Bacteria | 3286 |
| 726 | Ga0501076_0561196 | 3300049592 | Bacteria | 941 |
| 727 | Ga0501242_006330 | 3300049674 | Bacteria | 1349 |
| 728 | Ga0501243_012743 | 3300049675 | Bacteria | 1330 |
| 729 | Ga0501253_045559 | 3300049683 | Bacteria | 901 |
| 730 | Ga0501257_058346 | 3300049686 | Bacteria | 972 |
| 731 | Ga0501245_009677 | 3300049708 | Bacteria | 1386 |
| 732 | Ga0501079_0126479 | 3300049741 | Bacteria | 1988 |
| 733 | Ga0501079_0130892 | 3300049741 | Bacteria | 1953 |
| 734 | Ga0501079_1056387 | 3300049741 | Bacteria | 640 |
| 735 | Ga0501080_0010508 | 3300049742 | Bacteria | 8475 |
| 736 | Ga0501080_0069799 | 3300049742 | Bacteria | 3268 |
| 737 | Ga0501080_0245097 | 3300049742 | Bacteria | 1635 |
| 738 | Ga0501080_0249898 | 3300049742 | Bacteria | 1617 |
| 739 | Ga0501080_0749441 | 3300049742 | Bacteria | 859 |
| 740 | Ga0501080_0924075 | 3300049742 | Bacteria | 759 |
| 741 | Ga0501080_1048044 | 3300049742 | Bacteria | 706 |
| 742 | Ga0501081_0073885 | 3300049743 | Bacteria | 2378 |
| 743 | Ga0501083_0070334 | 3300049744 | Bacteria | 2327 |
| 744 | Ga0501266_023267 | 3300049763 | Bacteria | 855 |
| 745 | Ga0501035_0005822 | 3300049822 | Bacteria | 11622 |
| 746 | Ga0501035_0130250 | 3300049822 | Bacteria | 2193 |
| 747 | Ga0501035_0380373 | 3300049822 | Bacteria | 1177 |
| 748 | Ga0501035_0438295 | 3300049822 | Bacteria | 1082 |
| 749 | Ga0501044_0029625 | 3300049823 | Bacteria | 5770 |
| 750 | Ga0501044_0048316 | 3300049823 | Bacteria | 4395 |
| 751 | Ga0501044_0159940 | 3300049823 | Bacteria | 2230 |
| 752 | Ga0501044_0188919 | 3300049823 | Bacteria | 2023 |
| 753 | Ga0501044_0346733 | 3300049823 | Bacteria | 1405 |
| 754 | Ga0501045_0088995 | 3300049824 | Bacteria | 2280 |
| 755 | Ga0501045_0195199 | 3300049824 | Bacteria | 1509 |
| 756 | nmdc:mga00v17_26539_c1 | 3300050491 | Bacteria | 3377 |
| 757 | Ga0500610_0000123 | 3300053079 | Bacteria | 23259 |
| 758 | Ga0500643_001529 | 3300053087 | Bacteria | 13160 |
| 759 | Ga0500651_0108545 | 3300053093 | Bacteria | 1695 |
| 760 | Ga0500566_0078691 | 3300053094 | Bacteria | 1839 |
| 761 | Ga0500568_0000145 | 3300053139 | Bacteria | 62300 |
| 762 | Ga0500620_007813 | 3300053155 | Bacteria | 2665 |
| 763 | Ga0500633_0006033 | 3300053160 | Bacteria | 2938 |
| 764 | Ga0501084_0305625 | 3300054114 | Bacteria | 1343 |
| 765 | Ga0500661_003635 | 3300055283 | Bacteria | 2898 |
| 766 | Ga0501082_0000082 | 3300060353 | Bacteria | 71065 |
| 767 | Ga0501082_0132506 | 3300060353 | Bacteria | 2162 |
| 768 | Ga0501082_0254058 | 3300060353 | Bacteria | 1529 |
| 769 | Ga0501082_0538245 | 3300060353 | Bacteria | 1021 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300001979 | JGI24740J21852_10000412 | JGI24740J21852_1000041215 | 170 |
| 2 | 3300005327 | Ga0070658_10013088 | Ga0070658_100130882 | 170 |
| 3 | 3300005329 | Ga0070683_100133545 | Ga0070683_1001335451 | 170 |
| 4 | 3300005336 | Ga0070680_100016672 | Ga0070680_1000166722 | 170 |
| 5 | 3300005336 | Ga0070680_100104449 | Ga0070680_1001044491 | 170 |
| 6 | 3300005336 | Ga0070680_100118825 | Ga0070680_1001188252 | 170 |
| 7 | 3300005337 | Ga0070682_100109903 | Ga0070682_1001099033 | 170 |
| 8 | 3300005339 | Ga0070660_100017899 | Ga0070660_1000178992 | 170 |
| 9 | 3300005339 | Ga0070660_100152137 | Ga0070660_1001521372 | 170 |
| 10 | 3300005344 | Ga0070661_100112920 | Ga0070661_1001129202 | 170 |
| 11 | 3300005344 | Ga0070661_101315693 | Ga0070661_1013156931 | 170 |
| 12 | 3300005345 | Ga0070692_10034406 | Ga0070692_100344062 | 170 |
| 13 | 3300005345 | Ga0070692_10106871 | Ga0070692_101068711 | 170 |
| 14 | 3300005366 | Ga0070659_100325447 | Ga0070659_1003254472 | 170 |
| 15 | 3300005455 | Ga0070663_100180611 | Ga0070663_1001806112 | 170 |
| 16 | 3300005455 | Ga0070663_100399346 | Ga0070663_1003993462 | 170 |
| 17 | 3300005458 | Ga0070681_10002046 | Ga0070681_100020463 | 170 |
| 18 | 3300005458 | Ga0070681_10015819 | Ga0070681_100158195 | 170 |
| 19 | 3300005458 | Ga0070681_10021136 | Ga0070681_100211361 | 170 |
| 20 | 3300005518 | Ga0070699_100617411 | Ga0070699_1006174111 | 170 |
| 21 | 3300005530 | Ga0070679_100000809 | Ga0070679_1000008093 | 170 |
| 22 | 3300005530 | Ga0070679_100014718 | Ga0070679_1000147185 | 170 |
| 23 | 3300005530 | Ga0070679_100019814 | Ga0070679_1000198148 | 170 |
| 24 | 3300005539 | Ga0068853_100219628 | Ga0068853_1002196283 | 170 |
| 25 | 3300005539 | Ga0068853_100471146 | Ga0068853_1004711461 | 170 |
| 26 | 3300005546 | Ga0070696_100009303 | Ga0070696_1000093031 | 170 |
| 27 | 3300005563 | Ga0068855_100022714 | Ga0068855_1000227146 | 170 |
| 28 | 3300005564 | Ga0070664_100089947 | Ga0070664_1000899471 | 170 |
| 29 | 3300005578 | Ga0068854_100101051 | Ga0068854_1001010512 | 170 |
| 30 | 3300005614 | Ga0068856_100021290 | Ga0068856_1000212902 | 170 |
| 31 | 3300005614 | Ga0068856_100171100 | Ga0068856_1001711005 | 170 |
| 32 | 3300005616 | Ga0068852_100021868 | Ga0068852_1000218682 | 170 |
| 33 | 3300005834 | Ga0068851_10678200 | Ga0068851_106782001 | 170 |
| 34 | 3300009093 | Ga0105240_10487860 | Ga0105240_104878601 | 170 |
| 35 | 3300009551 | Ga0105238_11083509 | Ga0105238_110835091 | 170 |
| 36 | 3300013100 | Ga0157373_10017413 | Ga0157373_100174137 | 170 |
| 37 | 3300013100 | Ga0157373_10039784 | Ga0157373_100397845 | 170 |
| 38 | 3300013102 | Ga0157371_10048524 | Ga0157371_100485246 | 170 |
| 39 | 3300013102 | Ga0157371_10147703 | Ga0157371_101477033 | 170 |
| 40 | 3300013102 | Ga0157371_10204810 | Ga0157371_102048102 | 170 |
| 41 | 3300013104 | Ga0157370_10016379 | Ga0157370_100163795 | 170 |
| 42 | 3300013104 | Ga0157370_10255156 | Ga0157370_102551562 | 170 |
| 43 | 3300013105 | Ga0157369_10097251 | Ga0157369_100972516 | 170 |
| 44 | 3300013105 | Ga0157369_10142387 | Ga0157369_101423872 | 170 |
| 45 | 3300013105 | Ga0157369_10243903 | Ga0157369_102439031 | 170 |
| 46 | 3300013307 | Ga0157372_10019352 | Ga0157372_100193524 | 170 |
| 47 | 3300013307 | Ga0157372_10455968 | Ga0157372_104559682 | 170 |
| 48 | 3300013307 | Ga0157372_10773055 | Ga0157372_107730552 | 170 |
| 49 | 3300038443 | Ga0395901_0024530 | Ga0395901_0024530_1910_2458 | 170 |
| 50 | 3300044712 | Ga0453684_0000377 | Ga0453684_0000377_152947_153465 | 170 |
| 51 | 3300045051 | Ga0451576_0000033 | Ga0451576_0000033_29981_30499 | 170 |
| 52 | 3300049586 | Ga0501070_0003148 | Ga0501070_0003148_1379_1924 | 170 |
| 53 | 3300049824 | Ga0501045_0195199 | Ga0501045_0195199_714_1232 | 170 |
| 54 | 3300005834 | Ga0068851_10581375 | Ga0068851_105813752 | 171 |
| 55 | 3300026118 | Ga0207675_100242712 | Ga0207675_1002427121 | 171 |
| 56 | 3300046674 | Ga0495588_0348843 | Ga0495588_0348843_236_754 | 171 |
| 57 | 3300002741 | JGI25157J39369_1002492 | JGI25157J39369_10024923 | 172 |
| 58 | 3300002772 | JGI25164J39214_1000663 | JGI25164J39214_100066314 | 172 |
| 59 | 3300002772 | JGI25164J39214_1000732 | JGI25164J39214_10007322 | 172 |
| 60 | 3300003214 | JGI25165J46597_1001316 | JGI25165J46597_100131614 | 172 |
| 61 | 3300003214 | JGI25165J46597_1002058 | JGI25165J46597_10020587 | 172 |
| 62 | 3300003322 | rootL2_10075816 | rootL2_100758162 | 172 |
| 63 | 3300005327 | Ga0070658_10027599 | Ga0070658_100275992 | 172 |
| 64 | 3300005328 | Ga0070676_10029738 | Ga0070676_100297382 | 172 |
| 65 | 3300005328 | Ga0070676_10936418 | Ga0070676_109364181 | 172 |
| 66 | 3300005331 | Ga0070670_100443477 | Ga0070670_1004434772 | 172 |
| 67 | 3300005334 | Ga0068869_100275713 | Ga0068869_1002757132 | 172 |
| 68 | 3300005335 | Ga0070666_10000003 | Ga0070666_10000003297 | 172 |
| 69 | 3300005335 | Ga0070666_10038006 | Ga0070666_100380064 | 172 |
| 70 | 3300005337 | Ga0070682_100125947 | Ga0070682_1001259471 | 172 |
| 71 | 3300005338 | Ga0068868_100053523 | Ga0068868_1000535233 | 172 |
| 72 | 3300005340 | Ga0070689_100219534 | Ga0070689_1002195342 | 172 |
| 73 | 3300005347 | Ga0070668_100754550 | Ga0070668_1007545501 | 172 |
| 74 | 3300005353 | Ga0070669_100237149 | Ga0070669_1002371491 | 172 |
| 75 | 3300005364 | Ga0070673_100735459 | Ga0070673_1007354591 | 172 |
| 76 | 3300005366 | Ga0070659_100081072 | Ga0070659_1000810722 | 172 |
| 77 | 3300005367 | Ga0070667_100000005 | Ga0070667_1000000055 | 172 |
| 78 | 3300005367 | Ga0070667_100183175 | Ga0070667_1001831751 | 172 |
| 79 | 3300005367 | Ga0070667_100255194 | Ga0070667_1002551942 | 172 |
| 80 | 3300005435 | Ga0070714_100004101 | Ga0070714_1000041015 | 172 |
| 81 | 3300005435 | Ga0070714_100006554 | Ga0070714_10000655410 | 172 |
| 82 | 3300005436 | Ga0070713_100011777 | Ga0070713_1000117774 | 172 |
| 83 | 3300005455 | Ga0070663_100003718 | Ga0070663_1000037187 | 172 |
| 84 | 3300005456 | Ga0070678_100065671 | Ga0070678_1000656712 | 172 |
| 85 | 3300005456 | Ga0070678_100361648 | Ga0070678_1003616482 | 172 |
| 86 | 3300005456 | Ga0070678_100637529 | Ga0070678_1006375291 | 172 |
| 87 | 3300005456 | Ga0070678_100847467 | Ga0070678_1008474671 | 172 |
| 88 | 3300005456 | Ga0070678_100917123 | Ga0070678_1009171231 | 172 |
| 89 | 3300005458 | Ga0070681_10000058 | Ga0070681_1000005862 | 172 |
| 90 | 3300005535 | Ga0070684_100668202 | Ga0070684_1006682021 | 172 |
| 91 | 3300005539 | Ga0068853_100014008 | Ga0068853_1000140083 | 172 |
| 92 | 3300005539 | Ga0068853_100033329 | Ga0068853_1000333295 | 172 |
| 93 | 3300005539 | Ga0068853_100041564 | Ga0068853_1000415644 | 172 |
| 94 | 3300005539 | Ga0068853_100087611 | Ga0068853_1000876113 | 172 |
| 95 | 3300005539 | Ga0068853_100261665 | Ga0068853_1002616653 | 172 |
| 96 | 3300005539 | Ga0068853_101422637 | Ga0068853_1014226371 | 172 |
| 97 | 3300005539 | Ga0068853_101513833 | Ga0068853_1015138331 | 172 |
| 98 | 3300005543 | Ga0070672_100397071 | Ga0070672_1003970712 | 172 |
| 99 | 3300005546 | Ga0070696_100172223 | Ga0070696_1001722232 | 172 |
| 100 | 3300005547 | Ga0070693_100044184 | Ga0070693_1000441841 | 172 |
| 101 | 3300005547 | Ga0070693_100051377 | Ga0070693_1000513773 | 172 |
| 102 | 3300005548 | Ga0070665_100088395 | Ga0070665_1000883951 | 172 |
| 103 | 3300005548 | Ga0070665_100122005 | Ga0070665_1001220053 | 172 |
| 104 | 3300005548 | Ga0070665_100235001 | Ga0070665_1002350012 | 172 |
| 105 | 3300005548 | Ga0070665_100642002 | Ga0070665_1006420022 | 172 |
| 106 | 3300005563 | Ga0068855_101070045 | Ga0068855_1010700452 | 172 |
| 107 | 3300005577 | Ga0068857_100039190 | Ga0068857_1000391902 | 172 |
| 108 | 3300005578 | Ga0068854_100056373 | Ga0068854_1000563733 | 172 |
| 109 | 3300005578 | Ga0068854_100125577 | Ga0068854_1001255772 | 172 |
| 110 | 3300005578 | Ga0068854_100635046 | Ga0068854_1006350462 | 172 |
| 111 | 3300005614 | Ga0068856_100021219 | Ga0068856_1000212196 | 172 |
| 112 | 3300005614 | Ga0068856_100103208 | Ga0068856_1001032081 | 172 |
| 113 | 3300005616 | Ga0068852_100170279 | Ga0068852_1001702792 | 172 |
| 114 | 3300005616 | Ga0068852_100322078 | Ga0068852_1003220781 | 172 |
| 115 | 3300005616 | Ga0068852_101437205 | Ga0068852_1014372052 | 172 |
| 116 | 3300005617 | Ga0068859_100344287 | Ga0068859_1003442872 | 172 |
| 117 | 3300005618 | Ga0068864_100002860 | Ga0068864_10000286012 | 172 |
| 118 | 3300005718 | Ga0068866_10763603 | Ga0068866_107636031 | 172 |
| 119 | 3300005841 | Ga0068863_100005670 | Ga0068863_10000567011 | 172 |
| 120 | 3300005841 | Ga0068863_100059126 | Ga0068863_1000591262 | 172 |
| 121 | 3300005843 | Ga0068860_100067923 | Ga0068860_1000679233 | 172 |
| 122 | 3300005843 | Ga0068860_100103296 | Ga0068860_1001032962 | 172 |
| 123 | 3300005843 | Ga0068860_100107406 | Ga0068860_1001074062 | 172 |
| 124 | 3300006237 | Ga0097621_100058214 | Ga0097621_1000582142 | 172 |
| 125 | 3300006237 | Ga0097621_100242028 | Ga0097621_1002420282 | 172 |
| 126 | 3300006358 | Ga0068871_100063532 | Ga0068871_1000635324 | 172 |
| 127 | 3300006358 | Ga0068871_100894292 | Ga0068871_1008942921 | 172 |
| 128 | 3300006881 | Ga0068865_100002265 | Ga0068865_10000226510 | 172 |
| 129 | 3300006881 | Ga0068865_100025358 | Ga0068865_1000253584 | 172 |
| 130 | 3300006931 | Ga0097620_100344331 | Ga0097620_1003443312 | 172 |
| 131 | 3300009093 | Ga0105240_10088669 | Ga0105240_100886692 | 172 |
| 132 | 3300009093 | Ga0105240_10884580 | Ga0105240_108845801 | 172 |
| 133 | 3300009174 | Ga0105241_10245181 | Ga0105241_102451812 | 172 |
| 134 | 3300009174 | Ga0105241_10394162 | Ga0105241_103941621 | 172 |
| 135 | 3300009177 | Ga0105248_10001462 | Ga0105248_100014622 | 172 |
| 136 | 3300009177 | Ga0105248_10359810 | Ga0105248_103598102 | 172 |
| 137 | 3300009177 | Ga0105248_10533444 | Ga0105248_105334443 | 172 |
| 138 | 3300009545 | Ga0105237_10000202 | Ga0105237_1000020289 | 172 |
| 139 | 3300009545 | Ga0105237_10008758 | Ga0105237_100087585 | 172 |
| 140 | 3300009545 | Ga0105237_10161918 | Ga0105237_101619183 | 172 |
| 141 | 3300009551 | Ga0105238_10001867 | Ga0105238_1000186720 | 172 |
| 142 | 3300009551 | Ga0105238_10017719 | Ga0105238_100177195 | 172 |
| 143 | 3300009551 | Ga0105238_10063962 | Ga0105238_100639621 | 172 |
| 144 | 3300009553 | Ga0105249_10002363 | Ga0105249_100023636 | 172 |
| 145 | 3300010375 | Ga0105239_10023410 | Ga0105239_100234107 | 172 |
| 146 | 3300010375 | Ga0105239_10216696 | Ga0105239_102166962 | 172 |
| 147 | 3300010375 | Ga0105239_10873933 | Ga0105239_108739332 | 172 |
| 148 | 3300011119 | Ga0105246_10061223 | Ga0105246_100612232 | 172 |
| 149 | 3300013100 | Ga0157373_10122400 | Ga0157373_101224002 | 172 |
| 150 | 3300013100 | Ga0157373_10569840 | Ga0157373_105698402 | 172 |
| 151 | 3300013104 | Ga0157370_10010975 | Ga0157370_100109759 | 172 |
| 152 | 3300013104 | Ga0157370_10013955 | Ga0157370_100139552 | 172 |
| 153 | 3300013104 | Ga0157370_10870333 | Ga0157370_108703331 | 172 |
| 154 | 3300013105 | Ga0157369_10000195 | Ga0157369_1000019584 | 172 |
| 155 | 3300013105 | Ga0157369_10377727 | Ga0157369_103777271 | 172 |
| 156 | 3300013296 | Ga0157374_10056986 | Ga0157374_100569864 | 172 |
| 157 | 3300013297 | Ga0157378_10549281 | Ga0157378_105492812 | 172 |
| 158 | 3300013297 | Ga0157378_10711924 | Ga0157378_107119242 | 172 |
| 159 | 3300013306 | Ga0163162_10000003 | Ga0163162_10000003631 | 172 |
| 160 | 3300013306 | Ga0163162_10000236 | Ga0163162_1000023620 | 172 |
| 161 | 3300013306 | Ga0163162_10371860 | Ga0163162_103718602 | 172 |
| 162 | 3300013307 | Ga0157372_10216413 | Ga0157372_102164131 | 172 |
| 163 | 3300013308 | Ga0157375_10066877 | Ga0157375_100668772 | 172 |
| 164 | 3300014325 | Ga0163163_10136376 | Ga0163163_101363763 | 172 |
| 165 | 3300014326 | Ga0157380_11679752 | Ga0157380_116797521 | 172 |
| 166 | 3300014497 | Ga0182008_10017736 | Ga0182008_100177363 | 172 |
| 167 | 3300014497 | Ga0182008_10054015 | Ga0182008_100540153 | 172 |
| 168 | 3300014745 | Ga0157377_10791270 | Ga0157377_107912701 | 172 |
| 169 | 3300014968 | Ga0157379_10089866 | Ga0157379_100898663 | 172 |
| 170 | 3300014968 | Ga0157379_10154459 | Ga0157379_101544592 | 172 |
| 171 | 3300014969 | Ga0157376_10000734 | Ga0157376_1000073410 | 172 |
| 172 | 3300014969 | Ga0157376_10402560 | Ga0157376_104025602 | 172 |
| 173 | 3300015261 | Ga0182006_1210691 | Ga0182006_12106911 | 172 |
| 174 | 3300015262 | Ga0182007_10004354 | Ga0182007_100043542 | 172 |
| 175 | 3300015262 | Ga0182007_10056763 | Ga0182007_100567632 | 172 |
| 176 | 3300015262 | Ga0182007_10077240 | Ga0182007_100772402 | 172 |
| 177 | 3300015687 | Ga0183368_1004 | Ga0183368_1004255 | 172 |
| 178 | 3300020081 | Ga0206354_10672385 | Ga0206354_106723851 | 172 |
| 179 | 3300025226 | Ga0209674_103668 | Ga0209674_1036682 | 172 |
| 180 | 3300025228 | Ga0209672_100237 | Ga0209672_10023716 | 172 |
| 181 | 3300025231 | Ga0207427_100040 | Ga0207427_10004067 | 172 |
| 182 | 3300025231 | Ga0207427_100115 | Ga0207427_10011551 | 172 |
| 183 | 3300025231 | Ga0207427_100130 | Ga0207427_10013050 | 172 |
| 184 | 3300025233 | Ga0209437_100020 | Ga0209437_100020193 | 172 |
| 185 | 3300025233 | Ga0209437_100079 | Ga0209437_100079223 | 172 |
| 186 | 3300025233 | Ga0209437_100172 | Ga0209437_10017267 | 172 |
| 187 | 3300025242 | Ga0209258_100246 | Ga0209258_10024627 | 172 |
| 188 | 3300025242 | Ga0209258_100806 | Ga0209258_1008062 | 172 |
| 189 | 3300025246 | Ga0209646_1000500 | Ga0209646_10005008 | 172 |
| 190 | 3300025250 | Ga0209026_1000105 | Ga0209026_100010574 | 172 |
| 191 | 3300025250 | Ga0209026_1001092 | Ga0209026_10010923 | 172 |
| 192 | 3300025250 | Ga0209026_1009956 | Ga0209026_10099562 | 172 |
| 193 | 3300025254 | Ga0209148_1000024 | Ga0209148_1000024505 | 172 |
| 194 | 3300025256 | Ga0209759_1000907 | Ga0209759_10009074 | 172 |
| 195 | 3300025256 | Ga0209759_1001941 | Ga0209759_10019415 | 172 |
| 196 | 3300025256 | Ga0209759_1017742 | Ga0209759_10177422 | 172 |
| 197 | 3300025261 | Ga0209233_1000020 | Ga0209233_1000020432 | 172 |
| 198 | 3300025261 | Ga0209233_1000108 | Ga0209233_1000108159 | 172 |
| 199 | 3300025261 | Ga0209233_1000121 | Ga0209233_1000121180 | 172 |
| 200 | 3300025272 | Ga0209455_1000025 | Ga0209455_1000025505 | 172 |
| 201 | 3300025903 | Ga0207680_10000006 | Ga0207680_10000006444 | 172 |
| 202 | 3300025903 | Ga0207680_10125419 | Ga0207680_101254192 | 172 |
| 203 | 3300025907 | Ga0207645_10008128 | Ga0207645_100081286 | 172 |
| 204 | 3300025908 | Ga0207643_10126130 | Ga0207643_101261302 | 172 |
| 205 | 3300025909 | Ga0207705_10031472 | Ga0207705_100314722 | 172 |
| 206 | 3300025909 | Ga0207705_11080398 | Ga0207705_110803981 | 172 |
| 207 | 3300025911 | Ga0207654_10000065 | Ga0207654_1000006535 | 172 |
| 208 | 3300025911 | Ga0207654_10025227 | Ga0207654_100252274 | 172 |
| 209 | 3300025912 | Ga0207707_10000641 | Ga0207707_100006414 | 172 |
| 210 | 3300025913 | Ga0207695_10009244 | Ga0207695_100092443 | 172 |
| 211 | 3300025913 | Ga0207695_10013791 | Ga0207695_100137916 | 172 |
| 212 | 3300025913 | Ga0207695_10595603 | Ga0207695_105956032 | 172 |
| 213 | 3300025914 | Ga0207671_10000726 | Ga0207671_1000072630 | 172 |
| 214 | 3300025914 | Ga0207671_10001709 | Ga0207671_1000170920 | 172 |
| 215 | 3300025914 | Ga0207671_10004311 | Ga0207671_100043115 | 172 |
| 216 | 3300025920 | Ga0207649_10184952 | Ga0207649_101849522 | 172 |
| 217 | 3300025921 | Ga0207652_11511933 | Ga0207652_115119331 | 172 |
| 218 | 3300025924 | Ga0207694_10000162 | Ga0207694_100001622 | 172 |
| 219 | 3300025924 | Ga0207694_10005909 | Ga0207694_100059094 | 172 |
| 220 | 3300025924 | Ga0207694_10031338 | Ga0207694_100313383 | 172 |
| 221 | 3300025925 | Ga0207650_10249151 | Ga0207650_102491512 | 172 |
| 222 | 3300025926 | Ga0207659_10189913 | Ga0207659_101899131 | 172 |
| 223 | 3300025928 | Ga0207700_10003472 | Ga0207700_100034725 | 172 |
| 224 | 3300025929 | Ga0207664_10003176 | Ga0207664_100031763 | 172 |
| 225 | 3300025929 | Ga0207664_10216281 | Ga0207664_102162812 | 172 |
| 226 | 3300025932 | Ga0207690_10318815 | Ga0207690_103188152 | 172 |
| 227 | 3300025936 | Ga0207670_10137570 | Ga0207670_101375702 | 172 |
| 228 | 3300025938 | Ga0207704_10004475 | Ga0207704_100044756 | 172 |
| 229 | 3300025938 | Ga0207704_10628631 | Ga0207704_106286312 | 172 |
| 230 | 3300025940 | Ga0207691_10063560 | Ga0207691_100635604 | 172 |
| 231 | 3300025940 | Ga0207691_11045615 | Ga0207691_110456151 | 172 |
| 232 | 3300025941 | Ga0207711_10007760 | Ga0207711_100077602 | 172 |
| 233 | 3300025941 | Ga0207711_10231908 | Ga0207711_102319082 | 172 |
| 234 | 3300025941 | Ga0207711_10345179 | Ga0207711_103451793 | 172 |
| 235 | 3300025942 | Ga0207689_10307716 | Ga0207689_103077161 | 172 |
| 236 | 3300025949 | Ga0207667_10320311 | Ga0207667_103203111 | 172 |
| 237 | 3300025961 | Ga0207712_10000677 | Ga0207712_1000067720 | 172 |
| 238 | 3300025972 | Ga0207668_10243186 | Ga0207668_102431861 | 172 |
| 239 | 3300025981 | Ga0207640_10017628 | Ga0207640_100176284 | 172 |
| 240 | 3300025981 | Ga0207640_10244153 | Ga0207640_102441532 | 172 |
| 241 | 3300025981 | Ga0207640_10559357 | Ga0207640_105593572 | 172 |
| 242 | 3300025981 | Ga0207640_10596196 | Ga0207640_105961961 | 172 |
| 243 | 3300025986 | Ga0207658_10000006 | Ga0207658_10000006366 | 172 |
| 244 | 3300025986 | Ga0207658_10112380 | Ga0207658_101123803 | 172 |
| 245 | 3300026023 | Ga0207677_10275189 | Ga0207677_102751891 | 172 |
| 246 | 3300026041 | Ga0207639_10000955 | Ga0207639_100009553 | 172 |
| 247 | 3300026041 | Ga0207639_10063785 | Ga0207639_100637852 | 172 |
| 248 | 3300026041 | Ga0207639_10243867 | Ga0207639_102438673 | 172 |
| 249 | 3300026041 | Ga0207639_10502276 | Ga0207639_105022761 | 172 |
| 250 | 3300026041 | Ga0207639_10661296 | Ga0207639_106612962 | 172 |
| 251 | 3300026041 | Ga0207639_10916584 | Ga0207639_109165841 | 172 |
| 252 | 3300026041 | Ga0207639_11078295 | Ga0207639_110782951 | 172 |
| 253 | 3300026067 | Ga0207678_10004860 | Ga0207678_1000486012 | 172 |
| 254 | 3300026067 | Ga0207678_10206327 | Ga0207678_102063273 | 172 |
| 255 | 3300026078 | Ga0207702_10028139 | Ga0207702_100281393 | 172 |
| 256 | 3300026078 | Ga0207702_10319521 | Ga0207702_103195212 | 172 |
| 257 | 3300026088 | Ga0207641_10185918 | Ga0207641_101859183 | 172 |
| 258 | 3300026088 | Ga0207641_10480936 | Ga0207641_104809362 | 172 |
| 259 | 3300026095 | Ga0207676_10020708 | Ga0207676_100207084 | 172 |
| 260 | 3300026095 | Ga0207676_10131613 | Ga0207676_101316133 | 172 |
| 261 | 3300026116 | Ga0207674_10014829 | Ga0207674_100148293 | 172 |
| 262 | 3300026121 | Ga0207683_10002105 | Ga0207683_100021059 | 172 |
| 263 | 3300026121 | Ga0207683_10003087 | Ga0207683_1000308716 | 172 |
| 264 | 3300026121 | Ga0207683_10178672 | Ga0207683_101786722 | 172 |
| 265 | 3300026142 | Ga0207698_10342443 | Ga0207698_103424431 | 172 |
| 266 | 3300028379 | Ga0268266_10000021 | Ga0268266_10000021374 | 172 |
| 267 | 3300028379 | Ga0268266_10058826 | Ga0268266_100588262 | 172 |
| 268 | 3300028379 | Ga0268266_10275366 | Ga0268266_102753662 | 172 |
| 269 | 3300028379 | Ga0268266_10516068 | Ga0268266_105160682 | 172 |
| 270 | 3300028380 | Ga0268265_10120047 | Ga0268265_101200472 | 172 |
| 271 | 3300028381 | Ga0268264_10009178 | Ga0268264_100091781 | 172 |
| 272 | 3300028381 | Ga0268264_10339490 | Ga0268264_103394903 | 172 |
| 273 | 3300031238 | Ga0265332_10110878 | Ga0265332_101108782 | 172 |
| 274 | 3300031616 | Ga0307508_10012852 | Ga0307508_100128526 | 172 |
| 275 | 3300033180 | Ga0307510_10014110 | Ga0307510_100141106 | 172 |
| 276 | 3300035089 | Ga0373944_0010152 | Ga0373944_0010152_215_733 | 172 |
| 277 | 3300035117 | Ga0373953_0161241 | Ga0373953_0161241_284_802 | 172 |
| 278 | 3300035410 | Ga0373924_0264281 | Ga0373924_0264281_182_700 | 172 |
| 279 | 3300035724 | Ga0373933_0203783 | Ga0373933_0203783_110_628 | 172 |
| 280 | 3300036401 | Ga0373937_0015568 | Ga0373937_0015568_2141_2659 | 172 |
| 281 | 3300038443 | Ga0395901_1101987 | Ga0395901_1101987_131_652 | 172 |
| 282 | 3300039437 | Ga0436365_1382606 | Ga0436365_1382606_1184_1711 | 172 |
| 283 | 3300039437 | Ga0436365_1829561 | Ga0436365_1829561_178_705 | 172 |
| 284 | 3300041463 | Ga0451804_0461783 | Ga0451804_0461783_164_688 | 172 |
| 285 | 3300041486 | Ga0451807_2640286 | Ga0451807_2640286_884_1414 | 172 |
| 286 | 3300041509 | Ga0451843_1653258 | Ga0451843_1653258_640_1170 | 172 |
| 287 | 3300042005 | Ga0439448_0125511 | Ga0439448_0125511_156_677 | 172 |
| 288 | 3300044712 | Ga0453684_0499313 | Ga0453684_0499313_668_1195 | 172 |
| 289 | 3300046473 | Ga0495582_0022480 | Ga0495582_0022480_988_1506 | 172 |
| 290 | 3300046507 | Ga0495606_0001000 | Ga0495606_0001000_16830_17363 | 172 |
| 291 | 3300046535 | Ga0495586_0135540 | Ga0495586_0135540_574_1092 | 172 |
| 292 | 3300046678 | Ga0495599_0669546 | Ga0495599_0669546_18_536 | 172 |
| 293 | 3300046681 | Ga0495647_0086713 | Ga0495647_0086713_189_707 | 172 |
| 294 | 3300046683 | Ga0495658_0006329 | Ga0495658_0006329_3934_4452 | 172 |
| 295 | 3300046683 | Ga0495658_0684504 | Ga0495658_0684504_15_533 | 172 |
| 296 | 3300047322 | Ga0495680_0215176 | Ga0495680_0215176_643_1161 | 172 |
| 297 | 3300048905 | Ga0496102_0359306 | Ga0496102_0359306_389_919 | 172 |
| 298 | 3300048906 | Ga0496103_0053287 | Ga0496103_0053287_463_993 | 172 |
| 299 | 3300048907 | Ga0496104_0000011 | Ga0496104_0000011_234234_234752 | 172 |
| 300 | 3300048908 | Ga0496105_0000071 | Ga0496105_0000071_13387_13905 | 172 |
| 301 | 3300048918 | Ga0496115_0000153 | Ga0496115_0000153_22665_23192 | 172 |
| 302 | 3300048921 | Ga0496118_0018115 | Ga0496118_0018115_819_1349 | 172 |
| 303 | 3300048924 | Ga0496121_0068082 | Ga0496121_0068082_1902_2423 | 172 |
| 304 | 3300048925 | Ga0496122_0001419 | Ga0496122_0001419_18678_19199 | 172 |
| 305 | 3300048926 | Ga0496123_0001240 | Ga0496123_0001240_13048_13569 | 172 |
| 306 | 3300048929 | Ga0496126_0000199 | Ga0496126_0000199_62943_63470 | 172 |
| 307 | 3300048929 | Ga0496126_0092387 | Ga0496126_0092387_63_584 | 172 |
| 308 | 3300049459 | Ga0495678_164343 | Ga0495678_164343_46_579 | 172 |
| 309 | 3300049568 | Ga0501031_0396754 | Ga0501031_0396754_161_688 | 172 |
| 310 | 3300049569 | Ga0501032_0002312 | Ga0501032_0002312_5183_5710 | 172 |
| 311 | 3300049569 | Ga0501032_0203665 | Ga0501032_0203665_407_925 | 172 |
| 312 | 3300049570 | Ga0501033_0002545 | Ga0501033_0002545_669_1190 | 172 |
| 313 | 3300049570 | Ga0501033_0005030 | Ga0501033_0005030_5183_5710 | 172 |
| 314 | 3300049571 | Ga0501034_0000462 | Ga0501034_0000462_13834_14352 | 172 |
| 315 | 3300049571 | Ga0501034_0008806 | Ga0501034_0008806_4715_5242 | 172 |
| 316 | 3300049571 | Ga0501034_0045875 | Ga0501034_0045875_893_1411 | 172 |
| 317 | 3300049572 | Ga0501036_0033157 | Ga0501036_0033157_1210_1731 | 172 |
| 318 | 3300049572 | Ga0501036_0038435 | Ga0501036_0038435_1730_2257 | 172 |
| 319 | 3300049573 | Ga0501037_0001246 | Ga0501037_0001246_2910_3437 | 172 |
| 320 | 3300049573 | Ga0501037_0164498 | Ga0501037_0164498_671_1192 | 172 |
| 321 | 3300049573 | Ga0501037_0169325 | Ga0501037_0169325_544_1092 | 172 |
| 322 | 3300049574 | Ga0501038_0001377 | Ga0501038_0001377_5183_5710 | 172 |
| 323 | 3300049575 | Ga0501039_0143013 | Ga0501039_0143013_1058_1585 | 172 |
| 324 | 3300049575 | Ga0501039_0567220 | Ga0501039_0567220_197_718 | 172 |
| 325 | 3300049578 | Ga0501042_0284719 | Ga0501042_0284719_613_1137 | 172 |
| 326 | 3300049579 | Ga0501043_0044929 | Ga0501043_0044929_2269_2796 | 172 |
| 327 | 3300049580 | Ga0501046_0006111 | Ga0501046_0006111_10041_10568 | 172 |
| 328 | 3300049580 | Ga0501046_0020493 | Ga0501046_0020493_1202_1723 | 172 |
| 329 | 3300049581 | Ga0501047_0000442 | Ga0501047_0000442_3472_3990 | 172 |
| 330 | 3300049581 | Ga0501047_0009516 | Ga0501047_0009516_3190_3717 | 172 |
| 331 | 3300049581 | Ga0501047_0564776 | Ga0501047_0564776_324_842 | 172 |
| 332 | 3300049582 | Ga0501048_0378663 | Ga0501048_0378663_67_594 | 172 |
| 333 | 3300049586 | Ga0501070_0007994 | Ga0501070_0007994_3095_3613 | 172 |
| 334 | 3300049586 | Ga0501070_0012356 | Ga0501070_0012356_4172_4690 | 172 |
| 335 | 3300049589 | Ga0501073_0013158 | Ga0501073_0013158_4926_5453 | 172 |
| 336 | 3300049589 | Ga0501073_0015900 | Ga0501073_0015900_846_1364 | 172 |
| 337 | 3300049590 | Ga0501074_0027269 | Ga0501074_0027269_447_965 | 172 |
| 338 | 3300049590 | Ga0501074_0028263 | Ga0501074_0028263_3514_4032 | 172 |
| 339 | 3300049741 | Ga0501079_0130892 | Ga0501079_0130892_1058_1576 | 172 |
| 340 | 3300049742 | Ga0501080_0010508 | Ga0501080_0010508_2387_2905 | 172 |
| 341 | 3300049742 | Ga0501080_0069799 | Ga0501080_0069799_2614_3132 | 172 |
| 342 | 3300049742 | Ga0501080_0245097 | Ga0501080_0245097_274_795 | 172 |
| 343 | 3300049742 | Ga0501080_0249898 | Ga0501080_0249898_1075_1602 | 172 |
| 344 | 3300049742 | Ga0501080_1048044 | Ga0501080_1048044_95_616 | 172 |
| 345 | 3300049822 | Ga0501035_0005822 | Ga0501035_0005822_5913_6440 | 172 |
| 346 | 3300049822 | Ga0501035_0438295 | Ga0501035_0438295_543_1064 | 172 |
| 347 | 3300049823 | Ga0501044_0048316 | Ga0501044_0048316_3190_3717 | 172 |
| 348 | 3300053079 | Ga0500610_0000123 | Ga0500610_0000123_148_669 | 172 |
| 349 | 3300053087 | Ga0500643_001529 | Ga0500643_001529_843_1364 | 172 |
| 350 | 3300053094 | Ga0500566_0078691 | Ga0500566_0078691_1276_1794 | 172 |
| 351 | 3300055283 | Ga0500661_003635 | Ga0500661_003635_55_576 | 172 |
| 352 | 3300060353 | Ga0501082_0254058 | Ga0501082_0254058_297_815 | 172 |
| 353 | 3300060353 | Ga0501082_0538245 | Ga0501082_0538245_316_834 | 172 |
| 354 | 2162886007 | SwRhRL2b_contig_3830080 | SwRhRL2b_0142.00007830 | 173 |
| 355 | 3300001904 | JGI24736J21556_1013939 | JGI24736J21556_10139392 | 173 |
| 356 | 3300003316 | rootH1_10040100 | rootH1_100401002 | 173 |
| 357 | 3300003320 | rootH2_10227379 | rootH2_102273793 | 173 |
| 358 | 3300003323 | rootH1_10150984 | rootH1_101509841 | 173 |
| 359 | 3300005262 | Ga0065165_1000001 | Ga0065165_1000001194 | 173 |
| 360 | 3300005293 | Ga0065715_10190471 | Ga0065715_101904712 | 173 |
| 361 | 3300005327 | Ga0070658_10033211 | Ga0070658_100332114 | 173 |
| 362 | 3300005327 | Ga0070658_10318006 | Ga0070658_103180062 | 173 |
| 363 | 3300005328 | Ga0070676_10256726 | Ga0070676_102567261 | 173 |
| 364 | 3300005329 | Ga0070683_100039765 | Ga0070683_1000397655 | 173 |
| 365 | 3300005329 | Ga0070683_100570161 | Ga0070683_1005701612 | 173 |
| 366 | 3300005330 | Ga0070690_100049423 | Ga0070690_1000494233 | 173 |
| 367 | 3300005330 | Ga0070690_100102383 | Ga0070690_1001023832 | 173 |
| 368 | 3300005331 | Ga0070670_100277141 | Ga0070670_1002771412 | 173 |
| 369 | 3300005334 | Ga0068869_100141183 | Ga0068869_1001411833 | 173 |
| 370 | 3300005334 | Ga0068869_100948339 | Ga0068869_1009483391 | 173 |
| 371 | 3300005335 | Ga0070666_10000109 | Ga0070666_1000010943 | 173 |
| 372 | 3300005335 | Ga0070666_10002838 | Ga0070666_100028384 | 173 |
| 373 | 3300005335 | Ga0070666_10259770 | Ga0070666_102597703 | 173 |
| 374 | 3300005336 | Ga0070680_100111346 | Ga0070680_1001113463 | 173 |
| 375 | 3300005338 | Ga0068868_100046371 | Ga0068868_1000463712 | 173 |
| 376 | 3300005338 | Ga0068868_100134985 | Ga0068868_1001349853 | 173 |
| 377 | 3300005339 | Ga0070660_100111133 | Ga0070660_1001111333 | 173 |
| 378 | 3300005339 | Ga0070660_101212630 | Ga0070660_1012126301 | 173 |
| 379 | 3300005344 | Ga0070661_100000840 | Ga0070661_10000084020 | 173 |
| 380 | 3300005344 | Ga0070661_100019824 | Ga0070661_1000198244 | 173 |
| 381 | 3300005344 | Ga0070661_100112784 | Ga0070661_1001127842 | 173 |
| 382 | 3300005344 | Ga0070661_100260185 | Ga0070661_1002601852 | 173 |
| 383 | 3300005344 | Ga0070661_100413944 | Ga0070661_1004139441 | 173 |
| 384 | 3300005347 | Ga0070668_100614023 | Ga0070668_1006140231 | 173 |
| 385 | 3300005353 | Ga0070669_100034776 | Ga0070669_1000347762 | 173 |
| 386 | 3300005355 | Ga0070671_100065196 | Ga0070671_1000651964 | 173 |
| 387 | 3300005355 | Ga0070671_100104112 | Ga0070671_1001041122 | 173 |
| 388 | 3300005364 | Ga0070673_100799579 | Ga0070673_1007995791 | 173 |
| 389 | 3300005367 | Ga0070667_100015468 | Ga0070667_1000154684 | 173 |
| 390 | 3300005367 | Ga0070667_100038266 | Ga0070667_1000382663 | 173 |
| 391 | 3300005367 | Ga0070667_100050855 | Ga0070667_1000508552 | 173 |
| 392 | 3300005367 | Ga0070667_100073428 | Ga0070667_1000734284 | 173 |
| 393 | 3300005367 | Ga0070667_100192722 | Ga0070667_1001927223 | 173 |
| 394 | 3300005367 | Ga0070667_100503208 | Ga0070667_1005032081 | 173 |
| 395 | 3300005367 | Ga0070667_100560384 | Ga0070667_1005603842 | 173 |
| 396 | 3300005367 | Ga0070667_100667310 | Ga0070667_1006673101 | 173 |
| 397 | 3300005435 | Ga0070714_100535247 | Ga0070714_1005352472 | 173 |
| 398 | 3300005457 | Ga0070662_100215387 | Ga0070662_1002153873 | 173 |
| 399 | 3300005457 | Ga0070662_100220665 | Ga0070662_1002206651 | 173 |
| 400 | 3300005458 | Ga0070681_10248744 | Ga0070681_102487442 | 173 |
| 401 | 3300005458 | Ga0070681_10268180 | Ga0070681_102681804 | 173 |
| 402 | 3300005459 | Ga0068867_100170221 | Ga0068867_1001702213 | 173 |
| 403 | 3300005459 | Ga0068867_100943849 | Ga0068867_1009438491 | 173 |
| 404 | 3300005535 | Ga0070684_100258913 | Ga0070684_1002589133 | 173 |
| 405 | 3300005539 | Ga0068853_100027763 | Ga0068853_1000277634 | 173 |
| 406 | 3300005539 | Ga0068853_100166264 | Ga0068853_1001662641 | 173 |
| 407 | 3300005543 | Ga0070672_101142998 | Ga0070672_1011429981 | 173 |
| 408 | 3300005548 | Ga0070665_100000057 | Ga0070665_100000057203 | 173 |
| 409 | 3300005548 | Ga0070665_100000838 | Ga0070665_10000083826 | 173 |
| 410 | 3300005548 | Ga0070665_100117114 | Ga0070665_1001171144 | 173 |
| 411 | 3300005548 | Ga0070665_100781849 | Ga0070665_1007818492 | 173 |
| 412 | 3300005548 | Ga0070665_101480519 | Ga0070665_1014805191 | 173 |
| 413 | 3300005563 | Ga0068855_100003960 | Ga0068855_1000039608 | 173 |
| 414 | 3300005563 | Ga0068855_100067485 | Ga0068855_1000674854 | 173 |
| 415 | 3300005563 | Ga0068855_100584817 | Ga0068855_1005848172 | 173 |
| 416 | 3300005564 | Ga0070664_100019492 | Ga0070664_1000194926 | 173 |
| 417 | 3300005564 | Ga0070664_100079048 | Ga0070664_1000790483 | 173 |
| 418 | 3300005577 | Ga0068857_100126595 | Ga0068857_1001265953 | 173 |
| 419 | 3300005577 | Ga0068857_100134512 | Ga0068857_1001345123 | 173 |
| 420 | 3300005578 | Ga0068854_100088088 | Ga0068854_1000880883 | 173 |
| 421 | 3300005614 | Ga0068856_100008809 | Ga0068856_1000088094 | 173 |
| 422 | 3300005614 | Ga0068856_100011032 | Ga0068856_1000110326 | 173 |
| 423 | 3300005614 | Ga0068856_100081913 | Ga0068856_1000819134 | 173 |
| 424 | 3300005614 | Ga0068856_100188138 | Ga0068856_1001881383 | 173 |
| 425 | 3300005616 | Ga0068852_100040124 | Ga0068852_1000401241 | 173 |
| 426 | 3300005617 | Ga0068859_100015799 | Ga0068859_1000157994 | 173 |
| 427 | 3300005617 | Ga0068859_101026992 | Ga0068859_1010269921 | 173 |
| 428 | 3300005618 | Ga0068864_101409508 | Ga0068864_1014095082 | 173 |
| 429 | 3300005834 | Ga0068851_10002611 | Ga0068851_100026117 | 173 |
| 430 | 3300005834 | Ga0068851_10470272 | Ga0068851_104702722 | 173 |
| 431 | 3300005841 | Ga0068863_100190876 | Ga0068863_1001908762 | 173 |
| 432 | 3300005841 | Ga0068863_100269277 | Ga0068863_1002692772 | 173 |
| 433 | 3300005842 | Ga0068858_100008089 | Ga0068858_1000080897 | 173 |
| 434 | 3300005843 | Ga0068860_100254503 | Ga0068860_1002545031 | 173 |
| 435 | 3300005843 | Ga0068860_100636891 | Ga0068860_1006368912 | 173 |
| 436 | 3300005843 | Ga0068860_101764052 | Ga0068860_1017640521 | 173 |
| 437 | 3300005844 | Ga0068862_100000354 | Ga0068862_10000035435 | 173 |
| 438 | 3300005844 | Ga0068862_100407715 | Ga0068862_1004077151 | 173 |
| 439 | 3300005983 | Ga0081540_1002130 | Ga0081540_100213017 | 173 |
| 440 | 3300005985 | Ga0081539_10082143 | Ga0081539_100821432 | 173 |
| 441 | 3300006175 | Ga0070712_100305876 | Ga0070712_1003058762 | 173 |
| 442 | 3300006177 | Ga0075362_10097059 | Ga0075362_100970592 | 173 |
| 443 | 3300006237 | Ga0097621_100021693 | Ga0097621_1000216935 | 173 |
| 444 | 3300006237 | Ga0097621_100023998 | Ga0097621_1000239984 | 173 |
| 445 | 3300006237 | Ga0097621_100053409 | Ga0097621_1000534093 | 173 |
| 446 | 3300006237 | Ga0097621_100240442 | Ga0097621_1002404422 | 173 |
| 447 | 3300006237 | Ga0097621_100652511 | Ga0097621_1006525112 | 173 |
| 448 | 3300006358 | Ga0068871_100045937 | Ga0068871_1000459371 | 173 |
| 449 | 3300006358 | Ga0068871_100093093 | Ga0068871_1000930934 | 173 |
| 450 | 3300006358 | Ga0068871_100877089 | Ga0068871_1008770892 | 173 |
| 451 | 3300006881 | Ga0068865_100025332 | Ga0068865_1000253322 | 173 |
| 452 | 3300006881 | Ga0068865_100318826 | Ga0068865_1003188262 | 173 |
| 453 | 3300006931 | Ga0097620_100015798 | Ga0097620_1000157984 | 173 |
| 454 | 3300006931 | Ga0097620_101027042 | Ga0097620_1010270422 | 173 |
| 455 | 3300009093 | Ga0105240_10015501 | Ga0105240_100155017 | 173 |
| 456 | 3300009093 | Ga0105240_10074524 | Ga0105240_100745245 | 173 |
| 457 | 3300009093 | Ga0105240_10095619 | Ga0105240_100956193 | 173 |
| 458 | 3300009094 | Ga0111539_10886538 | Ga0111539_108865382 | 173 |
| 459 | 3300009101 | Ga0105247_10165443 | Ga0105247_101654432 | 173 |
| 460 | 3300009101 | Ga0105247_10243910 | Ga0105247_102439101 | 173 |
| 461 | 3300009174 | Ga0105241_10009386 | Ga0105241_100093862 | 173 |
| 462 | 3300009174 | Ga0105241_10091566 | Ga0105241_100915662 | 173 |
| 463 | 3300009174 | Ga0105241_10656940 | Ga0105241_106569401 | 173 |
| 464 | 3300009174 | Ga0105241_10729508 | Ga0105241_107295082 | 173 |
| 465 | 3300009174 | Ga0105241_10952460 | Ga0105241_109524602 | 173 |
| 466 | 3300009176 | Ga0105242_10047025 | Ga0105242_100470253 | 173 |
| 467 | 3300009176 | Ga0105242_11013304 | Ga0105242_110133042 | 173 |
| 468 | 3300009177 | Ga0105248_10038118 | Ga0105248_100381184 | 173 |
| 469 | 3300009177 | Ga0105248_10401968 | Ga0105248_104019682 | 173 |
| 470 | 3300009177 | Ga0105248_10531864 | Ga0105248_105318641 | 173 |
| 471 | 3300009177 | Ga0105248_10790463 | Ga0105248_107904632 | 173 |
| 472 | 3300009545 | Ga0105237_10018893 | Ga0105237_100188933 | 173 |
| 473 | 3300009545 | Ga0105237_10020473 | Ga0105237_100204735 | 173 |
| 474 | 3300009545 | Ga0105237_10055037 | Ga0105237_100550374 | 173 |
| 475 | 3300009545 | Ga0105237_10166841 | Ga0105237_101668412 | 173 |
| 476 | 3300009545 | Ga0105237_10311236 | Ga0105237_103112363 | 173 |
| 477 | 3300009545 | Ga0105237_10516804 | Ga0105237_105168042 | 173 |
| 478 | 3300009545 | Ga0105237_10582001 | Ga0105237_105820012 | 173 |
| 479 | 3300009551 | Ga0105238_10032357 | Ga0105238_100323572 | 173 |
| 480 | 3300009551 | Ga0105238_10099145 | Ga0105238_100991454 | 173 |
| 481 | 3300009551 | Ga0105238_10134714 | Ga0105238_101347144 | 173 |
| 482 | 3300009551 | Ga0105238_10269754 | Ga0105238_102697542 | 173 |
| 483 | 3300009553 | Ga0105249_10008901 | Ga0105249_100089012 | 173 |
| 484 | 3300010375 | Ga0105239_10019312 | Ga0105239_100193129 | 173 |
| 485 | 3300010375 | Ga0105239_10161115 | Ga0105239_101611153 | 173 |
| 486 | 3300010375 | Ga0105239_10203852 | Ga0105239_102038522 | 173 |
| 487 | 3300010375 | Ga0105239_10205582 | Ga0105239_102055822 | 173 |
| 488 | 3300010375 | Ga0105239_10392182 | Ga0105239_103921822 | 173 |
| 489 | 3300010375 | Ga0105239_10410468 | Ga0105239_104104682 | 173 |
| 490 | 3300011119 | Ga0105246_10027734 | Ga0105246_100277343 | 173 |
| 491 | 3300012513 | Ga0157326_1016886 | Ga0157326_10168862 | 173 |
| 492 | 3300013100 | Ga0157373_10014849 | Ga0157373_100148493 | 173 |
| 493 | 3300013102 | Ga0157371_10003647 | Ga0157371_100036476 | 173 |
| 494 | 3300013102 | Ga0157371_10014602 | Ga0157371_100146024 | 173 |
| 495 | 3300013102 | Ga0157371_10028462 | Ga0157371_100284624 | 173 |
| 496 | 3300013104 | Ga0157370_10125618 | Ga0157370_101256183 | 173 |
| 497 | 3300013104 | Ga0157370_10171705 | Ga0157370_101717054 | 173 |
| 498 | 3300013104 | Ga0157370_10997638 | Ga0157370_109976381 | 173 |
| 499 | 3300013105 | Ga0157369_10004547 | Ga0157369_1000454711 | 173 |
| 500 | 3300013105 | Ga0157369_10012799 | Ga0157369_100127992 | 173 |
| 501 | 3300013105 | Ga0157369_10209993 | Ga0157369_102099933 | 173 |
| 502 | 3300013296 | Ga0157374_10011793 | Ga0157374_100117933 | 173 |
| 503 | 3300013296 | Ga0157374_10284900 | Ga0157374_102849004 | 173 |
| 504 | 3300013297 | Ga0157378_10045866 | Ga0157378_100458663 | 173 |
| 505 | 3300013297 | Ga0157378_10595795 | Ga0157378_105957952 | 173 |
| 506 | 3300013307 | Ga0157372_10005441 | Ga0157372_1000544114 | 173 |
| 507 | 3300013307 | Ga0157372_10007019 | Ga0157372_100070195 | 173 |
| 508 | 3300013307 | Ga0157372_10019326 | Ga0157372_100193268 | 173 |
| 509 | 3300013307 | Ga0157372_11797896 | Ga0157372_117978961 | 173 |
| 510 | 3300013308 | Ga0157375_10080866 | Ga0157375_100808662 | 173 |
| 511 | 3300013308 | Ga0157375_10361666 | Ga0157375_103616662 | 173 |
| 512 | 3300014325 | Ga0163163_10000196 | Ga0163163_1000019620 | 173 |
| 513 | 3300014325 | Ga0163163_10381420 | Ga0163163_103814202 | 173 |
| 514 | 3300014326 | Ga0157380_11007094 | Ga0157380_110070941 | 173 |
| 515 | 3300014968 | Ga0157379_10266710 | Ga0157379_102667103 | 173 |
| 516 | 3300014968 | Ga0157379_10345633 | Ga0157379_103456332 | 173 |
| 517 | 3300014969 | Ga0157376_10101988 | Ga0157376_101019883 | 173 |
| 518 | 3300014969 | Ga0157376_10264663 | Ga0157376_102646632 | 173 |
| 519 | 3300015265 | Ga0182005_1000004 | Ga0182005_1000004329 | 173 |
| 520 | 3300017792 | Ga0163161_10002464 | Ga0163161_100024646 | 173 |
| 521 | 3300025302 | Ga0207426_1017394 | Ga0207426_10173943 | 173 |
| 522 | 3300025304 | Ga0209257_1000145 | Ga0209257_100014569 | 173 |
| 523 | 3300025321 | Ga0207656_10000750 | Ga0207656_100007509 | 173 |
| 524 | 3300025321 | Ga0207656_10072651 | Ga0207656_100726512 | 173 |
| 525 | 3300025903 | Ga0207680_10010093 | Ga0207680_100100934 | 173 |
| 526 | 3300025903 | Ga0207680_10151500 | Ga0207680_101515002 | 173 |
| 527 | 3300025904 | Ga0207647_10000091 | Ga0207647_1000009148 | 173 |
| 528 | 3300025904 | Ga0207647_10002917 | Ga0207647_100029175 | 173 |
| 529 | 3300025907 | Ga0207645_10042438 | Ga0207645_100424382 | 173 |
| 530 | 3300025909 | Ga0207705_10500109 | Ga0207705_105001093 | 173 |
| 531 | 3300025911 | Ga0207654_10020184 | Ga0207654_100201843 | 173 |
| 532 | 3300025911 | Ga0207654_10044869 | Ga0207654_100448694 | 173 |
| 533 | 3300025911 | Ga0207654_10095886 | Ga0207654_100958864 | 173 |
| 534 | 3300025911 | Ga0207654_10445749 | Ga0207654_104457492 | 173 |
| 535 | 3300025912 | Ga0207707_10052739 | Ga0207707_100527394 | 173 |
| 536 | 3300025912 | Ga0207707_10245050 | Ga0207707_102450502 | 173 |
| 537 | 3300025913 | Ga0207695_10001492 | Ga0207695_1000149234 | 173 |
| 538 | 3300025913 | Ga0207695_10010430 | Ga0207695_100104308 | 173 |
| 539 | 3300025913 | Ga0207695_10058089 | Ga0207695_100580894 | 173 |
| 540 | 3300025913 | Ga0207695_10112306 | Ga0207695_101123063 | 173 |
| 541 | 3300025914 | Ga0207671_10011034 | Ga0207671_100110344 | 173 |
| 542 | 3300025914 | Ga0207671_10042128 | Ga0207671_100421283 | 173 |
| 543 | 3300025914 | Ga0207671_10068319 | Ga0207671_100683192 | 173 |
| 544 | 3300025914 | Ga0207671_10247644 | Ga0207671_102476442 | 173 |
| 545 | 3300025914 | Ga0207671_10505242 | Ga0207671_105052422 | 173 |
| 546 | 3300025914 | Ga0207671_10776506 | Ga0207671_107765061 | 173 |
| 547 | 3300025917 | Ga0207660_10297938 | Ga0207660_102979383 | 173 |
| 548 | 3300025919 | Ga0207657_10003100 | Ga0207657_1000310014 | 173 |
| 549 | 3300025920 | Ga0207649_10000447 | Ga0207649_1000044717 | 173 |
| 550 | 3300025920 | Ga0207649_10054552 | Ga0207649_100545521 | 173 |
| 551 | 3300025923 | Ga0207681_10387327 | Ga0207681_103873271 | 173 |
| 552 | 3300025923 | Ga0207681_10649757 | Ga0207681_106497571 | 173 |
| 553 | 3300025923 | Ga0207681_11068835 | Ga0207681_110688351 | 173 |
| 554 | 3300025924 | Ga0207694_10010020 | Ga0207694_100100204 | 173 |
| 555 | 3300025924 | Ga0207694_10046795 | Ga0207694_100467953 | 173 |
| 556 | 3300025924 | Ga0207694_10135584 | Ga0207694_101355842 | 173 |
| 557 | 3300025925 | Ga0207650_10012333 | Ga0207650_100123336 | 173 |
| 558 | 3300025925 | Ga0207650_10625677 | Ga0207650_106256771 | 173 |
| 559 | 3300025927 | Ga0207687_10381976 | Ga0207687_103819763 | 173 |
| 560 | 3300025931 | Ga0207644_10019889 | Ga0207644_100198896 | 173 |
| 561 | 3300025931 | Ga0207644_10603820 | Ga0207644_106038202 | 173 |
| 562 | 3300025931 | Ga0207644_10719428 | Ga0207644_107194282 | 173 |
| 563 | 3300025933 | Ga0207706_10001761 | Ga0207706_100017617 | 173 |
| 564 | 3300025933 | Ga0207706_10070574 | Ga0207706_100705743 | 173 |
| 565 | 3300025934 | Ga0207686_10902852 | Ga0207686_109028521 | 173 |
| 566 | 3300025938 | Ga0207704_10101378 | Ga0207704_101013782 | 173 |
| 567 | 3300025938 | Ga0207704_10259950 | Ga0207704_102599502 | 173 |
| 568 | 3300025941 | Ga0207711_10036542 | Ga0207711_100365422 | 173 |
| 569 | 3300025942 | Ga0207689_10056528 | Ga0207689_100565283 | 173 |
| 570 | 3300025942 | Ga0207689_10112245 | Ga0207689_101122452 | 173 |
| 571 | 3300025942 | Ga0207689_10224681 | Ga0207689_102246812 | 173 |
| 572 | 3300025942 | Ga0207689_10343794 | Ga0207689_103437943 | 173 |
| 573 | 3300025944 | Ga0207661_10042331 | Ga0207661_100423314 | 173 |
| 574 | 3300025944 | Ga0207661_11379533 | Ga0207661_113795331 | 173 |
| 575 | 3300025945 | Ga0207679_10091567 | Ga0207679_100915673 | 173 |
| 576 | 3300025945 | Ga0207679_10238823 | Ga0207679_102388231 | 173 |
| 577 | 3300025949 | Ga0207667_10017535 | Ga0207667_100175358 | 173 |
| 578 | 3300025949 | Ga0207667_10049480 | Ga0207667_100494804 | 173 |
| 579 | 3300025949 | Ga0207667_10592568 | Ga0207667_105925682 | 173 |
| 580 | 3300025949 | Ga0207667_10684266 | Ga0207667_106842662 | 173 |
| 581 | 3300025960 | Ga0207651_10493077 | Ga0207651_104930771 | 173 |
| 582 | 3300025961 | Ga0207712_10000354 | Ga0207712_1000035427 | 173 |
| 583 | 3300025972 | Ga0207668_10139484 | Ga0207668_101394841 | 173 |
| 584 | 3300025972 | Ga0207668_10647632 | Ga0207668_106476322 | 173 |
| 585 | 3300025981 | Ga0207640_10143997 | Ga0207640_101439973 | 173 |
| 586 | 3300025981 | Ga0207640_10200658 | Ga0207640_102006583 | 173 |
| 587 | 3300025986 | Ga0207658_10017811 | Ga0207658_100178113 | 173 |
| 588 | 3300025986 | Ga0207658_10035782 | Ga0207658_100357823 | 173 |
| 589 | 3300025986 | Ga0207658_10093763 | Ga0207658_100937632 | 173 |
| 590 | 3300025986 | Ga0207658_10193339 | Ga0207658_101933393 | 173 |
| 591 | 3300025986 | Ga0207658_10510794 | Ga0207658_105107941 | 173 |
| 592 | 3300025986 | Ga0207658_10537771 | Ga0207658_105377712 | 173 |
| 593 | 3300026035 | Ga0207703_10008155 | Ga0207703_100081556 | 173 |
| 594 | 3300026035 | Ga0207703_10238645 | Ga0207703_102386453 | 173 |
| 595 | 3300026035 | Ga0207703_11469480 | Ga0207703_114694801 | 173 |
| 596 | 3300026041 | Ga0207639_10001472 | Ga0207639_1000147210 | 173 |
| 597 | 3300026041 | Ga0207639_10006738 | Ga0207639_100067385 | 173 |
| 598 | 3300026067 | Ga0207678_10019625 | Ga0207678_100196254 | 173 |
| 599 | 3300026067 | Ga0207678_11107666 | Ga0207678_111076662 | 173 |
| 600 | 3300026078 | Ga0207702_10009340 | Ga0207702_100093404 | 173 |
| 601 | 3300026078 | Ga0207702_10080298 | Ga0207702_100802983 | 173 |
| 602 | 3300026078 | Ga0207702_11347938 | Ga0207702_113479381 | 173 |
| 603 | 3300026088 | Ga0207641_10283783 | Ga0207641_102837833 | 173 |
| 604 | 3300026089 | Ga0207648_10082156 | Ga0207648_100821562 | 173 |
| 605 | 3300026089 | Ga0207648_10801246 | Ga0207648_108012461 | 173 |
| 606 | 3300026095 | Ga0207676_10547304 | Ga0207676_105473042 | 173 |
| 607 | 3300026116 | Ga0207674_10002998 | Ga0207674_100029988 | 173 |
| 608 | 3300026116 | Ga0207674_10045181 | Ga0207674_100451813 | 173 |
| 609 | 3300026118 | Ga0207675_100085274 | Ga0207675_1000852742 | 173 |
| 610 | 3300026121 | Ga0207683_10413038 | Ga0207683_104130382 | 173 |
| 611 | 3300026142 | Ga0207698_10037983 | Ga0207698_100379833 | 173 |
| 612 | 3300026142 | Ga0207698_10103822 | Ga0207698_101038223 | 173 |
| 613 | 3300026142 | Ga0207698_11122631 | Ga0207698_111226311 | 173 |
| 614 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000012834 | 173 |
| 615 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006316 | 173 |
| 616 | 3300028379 | Ga0268266_10031052 | Ga0268266_100310525 | 173 |
| 617 | 3300028379 | Ga0268266_10051990 | Ga0268266_100519902 | 173 |
| 618 | 3300028379 | Ga0268266_10080418 | Ga0268266_100804183 | 173 |
| 619 | 3300028380 | Ga0268265_10002801 | Ga0268265_1000280112 | 173 |
| 620 | 3300028381 | Ga0268264_10107393 | Ga0268264_101073932 | 173 |
| 621 | 3300031730 | Ga0307516_10136241 | Ga0307516_101362413 | 173 |
| 622 | 3300031731 | Ga0307405_10197212 | Ga0307405_101972122 | 173 |
| 623 | 3300031731 | Ga0307405_10268704 | Ga0307405_102687042 | 173 |
| 624 | 3300031903 | Ga0307407_10228419 | Ga0307407_102284192 | 173 |
| 625 | 3300031911 | Ga0307412_10186234 | Ga0307412_101862342 | 173 |
| 626 | 3300031995 | Ga0307409_100104473 | Ga0307409_1001044732 | 173 |
| 627 | 3300032004 | Ga0307414_10163842 | Ga0307414_101638421 | 173 |
| 628 | 3300032004 | Ga0307414_10251535 | Ga0307414_102515352 | 173 |
| 629 | 3300033179 | Ga0307507_10322001 | Ga0307507_103220011 | 173 |
| 630 | 3300037418 | Ga0395900_0193227 | Ga0395900_0193227_1310_1858 | 173 |
| 631 | 3300037471 | Ga0395905_0000577 | Ga0395905_0000577_3479_4027 | 173 |
| 632 | 3300038443 | Ga0395901_0080831 | Ga0395901_0080831_1987_2535 | 173 |
| 633 | 3300038443 | Ga0395901_0501959 | Ga0395901_0501959_517_1065 | 173 |
| 634 | 3300041441 | Ga0451787_313061 | Ga0451787_313061_84_878 | 173 |
| 635 | 3300041443 | Ga0451789_0232468 | Ga0451789_0232468_397_921 | 173 |
| 636 | 3300041451 | Ga0451791_1139757 | Ga0451791_1139757_439_963 | 173 |
| 637 | 3300041452 | Ga0451793_0324997 | Ga0451793_0324997_864_1388 | 173 |
| 638 | 3300041458 | Ga0451798_1175536 | Ga0451798_1175536_56_580 | 173 |
| 639 | 3300041460 | Ga0451802_1618475 | Ga0451802_1618475_467_1168 | 173 |
| 640 | 3300041462 | Ga0451806_196532 | Ga0451806_196532_151_675 | 173 |
| 641 | 3300041463 | Ga0451804_0515953 | Ga0451804_0515953_235_759 | 173 |
| 642 | 3300041486 | Ga0451807_1293046 | Ga0451807_1293046_151_681 | 173 |
| 643 | 3300041494 | Ga0451837_0354769 | Ga0451837_0354769_70_597 | 173 |
| 644 | 3300041494 | Ga0451837_1800117 | Ga0451837_1800117_24_572 | 173 |
| 645 | 3300041496 | Ga0451839_1321482 | Ga0451839_1321482_358_882 | 173 |
| 646 | 3300041509 | Ga0451843_0934667 | Ga0451843_0934667_463_1011 | 173 |
| 647 | 3300041512 | Ga0451853_3308297 | Ga0451853_3308297_227_751 | 173 |
| 648 | 3300042007 | Ga0439449_0103205 | Ga0439449_0103205_291_821 | 173 |
| 649 | 3300042438 | Ga0439459_0001975 | Ga0439459_0001975_1114_1638 | 173 |
| 650 | 3300044765 | Ga0466970_0007619 | Ga0466970_0007619_3865_4389 | 173 |
| 651 | 3300046460 | Ga0495638_0000063 | Ga0495638_0000063_102654_103178 | 173 |
| 652 | 3300046460 | Ga0495638_0064037 | Ga0495638_0064037_414_938 | 173 |
| 653 | 3300046471 | Ga0495650_0002554 | Ga0495650_0002554_3057_3581 | 173 |
| 654 | 3300046501 | Ga0495607_0000003 | Ga0495607_0000003_77555_78079 | 173 |
| 655 | 3300046507 | Ga0495606_0015836 | Ga0495606_0015836_749_1273 | 173 |
| 656 | 3300046507 | Ga0495606_0031819 | Ga0495606_0031819_1613_2137 | 173 |
| 657 | 3300046512 | Ga0495610_0021270 | Ga0495610_0021270_2639_3163 | 173 |
| 658 | 3300046512 | Ga0495610_0115460 | Ga0495610_0115460_72_596 | 173 |
| 659 | 3300046513 | Ga0495616_0183344 | Ga0495616_0183344_70_600 | 173 |
| 660 | 3300046515 | Ga0495620_0008202 | Ga0495620_0008202_4601_5125 | 173 |
| 661 | 3300046518 | Ga0495631_0003861 | Ga0495631_0003861_3275_3799 | 173 |
| 662 | 3300046519 | Ga0495632_0000011 | Ga0495632_0000011_150451_150999 | 173 |
| 663 | 3300046519 | Ga0495632_0019552 | Ga0495632_0019552_1912_2436 | 173 |
| 664 | 3300046524 | Ga0495648_0025746 | Ga0495648_0025746_3096_3620 | 173 |
| 665 | 3300046557 | Ga0495622_0062103 | Ga0495622_0062103_248_772 | 173 |
| 666 | 3300046558 | Ga0495633_0189155 | Ga0495633_0189155_63_599 | 173 |
| 667 | 3300046648 | Ga0495611_0000068 | Ga0495611_0000068_36040_36564 | 173 |
| 668 | 3300046660 | Ga0495625_0054963 | Ga0495625_0054963_1921_2445 | 173 |
| 669 | 3300046660 | Ga0495625_0088678 | Ga0495625_0088678_1041_1565 | 173 |
| 670 | 3300047318 | Ga0495636_0000522 | Ga0495636_0000522_6223_6753 | 173 |
| 671 | 3300047469 | Ga0495673_0000229 | Ga0495673_0000229_905_1429 | 173 |
| 672 | 3300047472 | Ga0495686_0000037 | Ga0495686_0000037_295426_295950 | 173 |
| 673 | 3300047472 | Ga0495686_0037360 | Ga0495686_0037360_1962_2486 | 173 |
| 674 | 3300048904 | Ga0496101_0007405 | Ga0496101_0007405_4286_4810 | 173 |
| 675 | 3300048904 | Ga0496101_0207430 | Ga0496101_0207430_482_1030 | 173 |
| 676 | 3300048905 | Ga0496102_1544009 | Ga0496102_1544009_28_552 | 173 |
| 677 | 3300048908 | Ga0496105_0349928 | Ga0496105_0349928_425_952 | 173 |
| 678 | 3300048911 | Ga0496108_0471812 | Ga0496108_0471812_31_579 | 173 |
| 679 | 3300048912 | Ga0496109_0174386 | Ga0496109_0174386_899_1447 | 173 |
| 680 | 3300048915 | Ga0496112_0891872 | Ga0496112_0891872_10_558 | 173 |
| 681 | 3300048917 | Ga0496114_0383774 | Ga0496114_0383774_99_623 | 173 |
| 682 | 3300048918 | Ga0496115_0119821 | Ga0496115_0119821_1214_1738 | 173 |
| 683 | 3300048919 | Ga0496116_0162714 | Ga0496116_0162714_276_800 | 173 |
| 684 | 3300048920 | Ga0496117_0005879 | Ga0496117_0005879_2751_3278 | 173 |
| 685 | 3300048921 | Ga0496118_0000362 | Ga0496118_0000362_9316_9843 | 173 |
| 686 | 3300048922 | Ga0496119_0000851 | Ga0496119_0000851_28846_29367 | 173 |
| 687 | 3300048922 | Ga0496119_0024644 | Ga0496119_0024644_3636_4160 | 173 |
| 688 | 3300048923 | Ga0496120_0001387 | Ga0496120_0001387_17979_18500 | 173 |
| 689 | 3300048924 | Ga0496121_0253006 | Ga0496121_0253006_494_1015 | 173 |
| 690 | 3300048925 | Ga0496122_0012114 | Ga0496122_0012114_395_922 | 173 |
| 691 | 3300048925 | Ga0496122_0013791 | Ga0496122_0013791_1715_2245 | 173 |
| 692 | 3300048925 | Ga0496122_0045754 | Ga0496122_0045754_1872_2396 | 173 |
| 693 | 3300048926 | Ga0496123_0033997 | Ga0496123_0033997_537_1061 | 173 |
| 694 | 3300048926 | Ga0496123_0050317 | Ga0496123_0050317_394_921 | 173 |
| 695 | 3300048926 | Ga0496123_0377951 | Ga0496123_0377951_50_577 | 173 |
| 696 | 3300048927 | Ga0496124_0000893 | Ga0496124_0000893_27428_27952 | 173 |
| 697 | 3300048927 | Ga0496124_0015807 | Ga0496124_0015807_2060_2587 | 173 |
| 698 | 3300048928 | Ga0496125_0065237 | Ga0496125_0065237_1444_1971 | 173 |
| 699 | 3300048928 | Ga0496125_0252505 | Ga0496125_0252505_460_981 | 173 |
| 700 | 3300048929 | Ga0496126_0361429 | Ga0496126_0361429_403_924 | 173 |
| 701 | 3300049568 | Ga0501031_0039849 | Ga0501031_0039849_2069_2596 | 173 |
| 702 | 3300049569 | Ga0501032_0002816 | Ga0501032_0002816_10991_11518 | 173 |
| 703 | 3300049569 | Ga0501032_0352007 | Ga0501032_0352007_39_566 | 173 |
| 704 | 3300049570 | Ga0501033_0000329 | Ga0501033_0000329_28785_29312 | 173 |
| 705 | 3300049570 | Ga0501033_0113682 | Ga0501033_0113682_295_819 | 173 |
| 706 | 3300049570 | Ga0501033_0149050 | Ga0501033_0149050_79_726 | 173 |
| 707 | 3300049571 | Ga0501034_0005495 | Ga0501034_0005495_43_591 | 173 |
| 708 | 3300049571 | Ga0501034_0009780 | Ga0501034_0009780_1703_2230 | 173 |
| 709 | 3300049571 | Ga0501034_0245487 | Ga0501034_0245487_693_1220 | 173 |
| 710 | 3300049571 | Ga0501034_1127123 | Ga0501034_1127123_62_586 | 173 |
| 711 | 3300049572 | Ga0501036_0008335 | Ga0501036_0008335_4746_5273 | 173 |
| 712 | 3300049573 | Ga0501037_0000815 | Ga0501037_0000815_6771_7298 | 173 |
| 713 | 3300049573 | Ga0501037_0169510 | Ga0501037_0169510_897_1424 | 173 |
| 714 | 3300049574 | Ga0501038_0003503 | Ga0501038_0003503_1370_1897 | 173 |
| 715 | 3300049574 | Ga0501038_0069785 | Ga0501038_0069785_1833_2360 | 173 |
| 716 | 3300049575 | Ga0501039_0006941 | Ga0501039_0006941_4198_4725 | 173 |
| 717 | 3300049575 | Ga0501039_0896089 | Ga0501039_0896089_121_648 | 173 |
| 718 | 3300049578 | Ga0501042_0129517 | Ga0501042_0129517_989_1516 | 173 |
| 719 | 3300049579 | Ga0501043_0018924 | Ga0501043_0018924_1158_1685 | 173 |
| 720 | 3300049580 | Ga0501046_0004658 | Ga0501046_0004658_7108_7635 | 173 |
| 721 | 3300049580 | Ga0501046_0062606 | Ga0501046_0062606_1679_2206 | 173 |
| 722 | 3300049581 | Ga0501047_0039527 | Ga0501047_0039527_316_843 | 173 |
| 723 | 3300049581 | Ga0501047_0135765 | Ga0501047_0135765_1311_1838 | 173 |
| 724 | 3300049581 | Ga0501047_0371243 | Ga0501047_0371243_181_705 | 173 |
| 725 | 3300049582 | Ga0501048_0011657 | Ga0501048_0011657_6013_6537 | 173 |
| 726 | 3300049582 | Ga0501048_0089741 | Ga0501048_0089741_1515_2042 | 173 |
| 727 | 3300049583 | Ga0501067_0040303 | Ga0501067_0040303_61_588 | 173 |
| 728 | 3300049583 | Ga0501067_0270395 | Ga0501067_0270395_179_706 | 173 |
| 729 | 3300049584 | Ga0501068_0061005 | Ga0501068_0061005_62_589 | 173 |
| 730 | 3300049584 | Ga0501068_0101517 | Ga0501068_0101517_718_1245 | 173 |
| 731 | 3300049585 | Ga0501069_0123731 | Ga0501069_0123731_661_1188 | 173 |
| 732 | 3300049586 | Ga0501070_0019143 | Ga0501070_0019143_4652_5179 | 173 |
| 733 | 3300049586 | Ga0501070_0379252 | Ga0501070_0379252_154_798 | 173 |
| 734 | 3300049586 | Ga0501070_0513722 | Ga0501070_0513722_401_928 | 173 |
| 735 | 3300049587 | Ga0501071_0008690 | Ga0501071_0008690_782_1309 | 173 |
| 736 | 3300049587 | Ga0501071_0040952 | Ga0501071_0040952_2285_2812 | 173 |
| 737 | 3300049588 | Ga0501072_0096613 | Ga0501072_0096613_1106_1753 | 173 |
| 738 | 3300049589 | Ga0501073_0008238 | Ga0501073_0008238_4141_4668 | 173 |
| 739 | 3300049589 | Ga0501073_0032725 | Ga0501073_0032725_1627_2154 | 173 |
| 740 | 3300049589 | Ga0501073_0135137 | Ga0501073_0135137_523_1050 | 173 |
| 741 | 3300049590 | Ga0501074_0042555 | Ga0501074_0042555_1840_2367 | 173 |
| 742 | 3300049592 | Ga0501076_0561196 | Ga0501076_0561196_63_590 | 173 |
| 743 | 3300049674 | Ga0501242_006330 | Ga0501242_006330_783_1331 | 173 |
| 744 | 3300049675 | Ga0501243_012743 | Ga0501243_012743_152_700 | 173 |
| 745 | 3300049683 | Ga0501253_045559 | Ga0501253_045559_73_621 | 173 |
| 746 | 3300049686 | Ga0501257_058346 | Ga0501257_058346_17_565 | 173 |
| 747 | 3300049708 | Ga0501245_009677 | Ga0501245_009677_134_682 | 173 |
| 748 | 3300049741 | Ga0501079_0126479 | Ga0501079_0126479_50_577 | 173 |
| 749 | 3300049741 | Ga0501079_1056387 | Ga0501079_1056387_65_592 | 173 |
| 750 | 3300049742 | Ga0501080_0749441 | Ga0501080_0749441_22_549 | 173 |
| 751 | 3300049742 | Ga0501080_0924075 | Ga0501080_0924075_50_577 | 173 |
| 752 | 3300049743 | Ga0501081_0073885 | Ga0501081_0073885_72_599 | 173 |
| 753 | 3300049744 | Ga0501083_0070334 | Ga0501083_0070334_1580_2107 | 173 |
| 754 | 3300049763 | Ga0501266_023267 | Ga0501266_023267_115_663 | 173 |
| 755 | 3300049822 | Ga0501035_0130250 | Ga0501035_0130250_1037_1564 | 173 |
| 756 | 3300049822 | Ga0501035_0380373 | Ga0501035_0380373_359_883 | 173 |
| 757 | 3300049823 | Ga0501044_0029625 | Ga0501044_0029625_1524_2051 | 173 |
| 758 | 3300049823 | Ga0501044_0159940 | Ga0501044_0159940_1657_2184 | 173 |
| 759 | 3300049823 | Ga0501044_0188919 | Ga0501044_0188919_561_1085 | 173 |
| 760 | 3300049823 | Ga0501044_0346733 | Ga0501044_0346733_34_654 | 173 |
| 761 | 3300049824 | Ga0501045_0088995 | Ga0501045_0088995_78_605 | 173 |
| 762 | 3300050491 | nmdc:mga00v17_26539_c1 | nmdc:mga00v17_26539_c1_449_997 | 173 |
| 763 | 3300053093 | Ga0500651_0108545 | Ga0500651_0108545_1037_1561 | 173 |
| 764 | 3300053139 | Ga0500568_0000145 | Ga0500568_0000145_32510_33034 | 173 |
| 765 | 3300053155 | Ga0500620_007813 | Ga0500620_007813_834_1358 | 173 |
| 766 | 3300053160 | Ga0500633_0006033 | Ga0500633_0006033_2219_2743 | 173 |
| 767 | 3300054114 | Ga0501084_0305625 | Ga0501084_0305625_279_806 | 173 |
| 768 | 3300060353 | Ga0501082_0000082 | Ga0501082_0000082_29208_29729 | 173 |
| 769 | 3300060353 | Ga0501082_0132506 | Ga0501082_0132506_1043_1687 | 173 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5v26-assembly1.cif.gz_A | 1.78 angstrom crystal structure of p97h 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans | 0.9466 | 1 | 166 |
| 4hvq-assembly1.cif.gz_A | x-ray crystal structure of fecu reconstituted 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans | 0.9437 | 1 | 149 |
| 6bvp-assembly1.cif.gz_A | crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase n27a from cupriavidus metallidurans | 0.9423 | 3 | 166 |
| 5v28-assembly1.cif.gz_A | 2.72 angstrom crystal structure of p97a 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans | 0.9368 | 1 | 166 |
| 5v27-assembly1.cif.gz_A | 2.35 angstrom crystal structure of p97v 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans | 0.9364 | 1 | 166 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q59K86_4_170_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9642 | 3 | 165 | 2.60.120.10 |
| af_Q54S02_3_181_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9543 | 4 | 169 | 2.60.120.10 |
| 4hvqA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9437 | 1 | 149 | 2.60.120.10 |
| 1yfuA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.942 | 7 | 166 | 2.60.120.10 |
| af_Q59K86_4_170_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9362 | 3 | 165 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P7X5F2-F1-model_v4 | 3-hydroxyanthranilate 3,4-dioxygenase-like | 0.9997 | 36 | 117 |
GO:0000334
GO:0005506 GO:0005737 GO:0034354 GO:0046874 |
| AF-A0A7F8RKZ4-F1-model_v4 | 3-hydroxyanthranilate 3,4-dioxygenase | 0.9922 | 2 | 117 |
GO:0000334
GO:0005506 GO:0005737 GO:0034354 GO:0046874 |
| AF-A0A7W1FBJ5-F1-model_v4 | 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) | 0.985 | 26 | 149 |
GO:0000334
GO:0005506 GO:0019363 |
| AF-A0A142EKN5-F1-model_v4 | 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) (3-hydroxyanthranilate oxygenase) (3-HAO) (3-hydroxyanthranilic acid dioxygenase) (HAD) | 0.9833 | 1 | 167 |
GO:0000334
GO:0005737 GO:0006569 GO:0008198 GO:0019805 GO:0034354 GO:0043420 |
| AF-A0A2T0WT71-F1-model_v4 | 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) (3-hydroxyanthranilate oxygenase) (3-HAO) (3-hydroxyanthranilic acid dioxygenase) (HAD) | 0.9814 | 1 | 168 |
GO:0000334
GO:0006569 GO:0008198 GO:0016020 GO:0019805 GO:0034354 GO:0043420 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar