F480012

General Info

Members Datasets Scaffolds Average Seq Length
769 298 769 175

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0149050|Ga0501033_0149050_79_726
Length 215
Sequence LNNEEHEEDAEKLFIVILRRSNLFGIPGFRQPPTRYDDRAMSTLTPPFDFKRWIDENRHLLKPPVGNKCLVDGDFIVMIVGGPNSRTDYHFDEGPEFFYQLEGEMVLKVQDDGRARDIPIRAGEVFYLPPRVPHSPQRLANSIGLVIERKRLPDEKDGLLWFCERCNHKLYEEFFTLKNIETDFPAVFERFYRSLDARTCKACGHVNPAPEKYRS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
100 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
110 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
189 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
190 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
191 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
192 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
193 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
194 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
195 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
198 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
199 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
203 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
213 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
214 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
215 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
253 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
276 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
277 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
278 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
279 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
290 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
291 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
292 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
293 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
294 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
295 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.16
Nodule 0
Rhizoplane 3.25
Rhizosphere 86.35
Stem 0
Stem Tuber 0
Unclassified 6.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3830080 2162886007 Bacteria 1118
2 JGI24736J21556_1013939 3300001904 Bacteria 1295
3 JGI24740J21852_10000412 3300001979 Bacteria 18285
4 JGI25157J39369_1002492 3300002741 Bacteria 4503
5 JGI25164J39214_1000663 3300002772 Bacteria 14046
6 JGI25164J39214_1000732 3300002772 Bacteria 12289
7 JGI25165J46597_1001316 3300003214 Bacteria 14046
8 JGI25165J46597_1002058 3300003214 Bacteria 7545
9 rootH1_10040100 3300003316 Bacteria 1886
10 rootH2_10227379 3300003320 Bacteria 2296
11 rootL2_10075816 3300003322 Bacteria 1828
12 rootH1_10150984 3300003323 Bacteria 2742
13 Ga0065165_1000001 3300005262 Bacteria 494087
14 Ga0065715_10190471 3300005293 Bacteria 1416
15 Ga0070658_10013088 3300005327 Bacteria 6656
16 Ga0070658_10027599 3300005327 Bacteria 4554
17 Ga0070658_10033211 3300005327 Bacteria 4150
18 Ga0070658_10318006 3300005327 Bacteria 1329
19 Ga0070676_10029738 3300005328 Bacteria 3110
20 Ga0070676_10256726 3300005328 Bacteria 1169
21 Ga0070676_10936418 3300005328 Bacteria 647
22 Ga0070683_100039765 3300005329 Bacteria 4320
23 Ga0070683_100133545 3300005329 Bacteria 2349
24 Ga0070683_100570161 3300005329 Bacteria 1083
25 Ga0070690_100049423 3300005330 Bacteria 2681
26 Ga0070690_100102383 3300005330 Bacteria 1900
27 Ga0070670_100277141 3300005331 Bacteria 1464
28 Ga0070670_100443477 3300005331 Bacteria 1150
29 Ga0068869_100141183 3300005334 Bacteria 1860
30 Ga0068869_100275713 3300005334 Bacteria 1351
31 Ga0068869_100948339 3300005334 Bacteria 747
32 Ga0070666_10000003 3300005335 Bacteria 463666
33 Ga0070666_10000109 3300005335 Bacteria 56796
34 Ga0070666_10002838 3300005335 Bacteria 10471
35 Ga0070666_10038006 3300005335 Bacteria 3202
36 Ga0070666_10259770 3300005335 Bacteria 1231
37 Ga0070680_100016672 3300005336 Bacteria 5785
38 Ga0070680_100104449 3300005336 Bacteria 2354
39 Ga0070680_100111346 3300005336 Bacteria 2279
40 Ga0070680_100118825 3300005336 Bacteria 2205
41 Ga0070682_100109903 3300005337 Bacteria 1835
42 Ga0070682_100125947 3300005337 Bacteria 1726
43 Ga0068868_100046371 3300005338 Bacteria 3402
44 Ga0068868_100053523 3300005338 Bacteria 3180
45 Ga0068868_100134985 3300005338 Bacteria 2022
46 Ga0070660_100017899 3300005339 Bacteria 5169
47 Ga0070660_100111133 3300005339 Bacteria 2180
48 Ga0070660_100152137 3300005339 Bacteria 1861
49 Ga0070660_101212630 3300005339 Bacteria 640
50 Ga0070689_100219534 3300005340 Bacteria 1559
51 Ga0070661_100000840 3300005344 Bacteria 22051
52 Ga0070661_100019824 3300005344 Bacteria 4793
53 Ga0070661_100112784 3300005344 Bacteria 2031
54 Ga0070661_100112920 3300005344 Bacteria 2030
55 Ga0070661_100260185 3300005344 Bacteria 1341
56 Ga0070661_100413944 3300005344 Bacteria 1067
57 Ga0070661_101315693 3300005344 Bacteria 606
58 Ga0070692_10034406 3300005345 Bacteria 2559
59 Ga0070692_10106871 3300005345 Bacteria 1542
60 Ga0070668_100614023 3300005347 Bacteria 952
61 Ga0070668_100754550 3300005347 Bacteria 862
62 Ga0070669_100034776 3300005353 Bacteria 3648
63 Ga0070669_100237149 3300005353 Bacteria 1448
64 Ga0070671_100065196 3300005355 Bacteria 3034
65 Ga0070671_100104112 3300005355 Bacteria 2382
66 Ga0070673_100735459 3300005364 Bacteria 908
67 Ga0070673_100799579 3300005364 Bacteria 871
68 Ga0070659_100081072 3300005366 Bacteria 2591
69 Ga0070659_100325447 3300005366 Bacteria 1286
70 Ga0070667_100000005 3300005367 Bacteria 347268
71 Ga0070667_100015468 3300005367 Bacteria 6310
72 Ga0070667_100038266 3300005367 Bacteria 4022
73 Ga0070667_100050855 3300005367 Bacteria 3492
74 Ga0070667_100073428 3300005367 Bacteria 2917
75 Ga0070667_100183175 3300005367 Bacteria 1853
76 Ga0070667_100192722 3300005367 Bacteria 1806
77 Ga0070667_100255194 3300005367 Bacteria 1568
78 Ga0070667_100503208 3300005367 Bacteria 1111
79 Ga0070667_100560384 3300005367 Bacteria 1051
80 Ga0070667_100667310 3300005367 Bacteria 961
81 Ga0070714_100004101 3300005435 Bacteria 10953
82 Ga0070714_100006554 3300005435 Bacteria 9004
83 Ga0070714_100535247 3300005435 Bacteria 1120
84 Ga0070713_100011777 3300005436 Bacteria 6389
85 Ga0070663_100003718 3300005455 Bacteria 8846
86 Ga0070663_100180611 3300005455 Bacteria 1637
87 Ga0070663_100399346 3300005455 Bacteria 1123
88 Ga0070678_100065671 3300005456 Bacteria 2695
89 Ga0070678_100361648 3300005456 Bacteria 1251
90 Ga0070678_100637529 3300005456 Bacteria 955
91 Ga0070678_100847467 3300005456 Bacteria 833
92 Ga0070678_100917123 3300005456 Bacteria 802
93 Ga0070662_100215387 3300005457 Bacteria 1530
94 Ga0070662_100220665 3300005457 Bacteria 1513
95 Ga0070681_10000058 3300005458 Bacteria 79062
96 Ga0070681_10002046 3300005458 Bacteria 18277
97 Ga0070681_10015819 3300005458 Bacteria 7520
98 Ga0070681_10021136 3300005458 Bacteria 6521
99 Ga0070681_10248744 3300005458 Bacteria 1691
100 Ga0070681_10268180 3300005458 Bacteria 1618
101 Ga0068867_100170221 3300005459 Bacteria 1724
102 Ga0068867_100943849 3300005459 Bacteria 779
103 Ga0070699_100617411 3300005518 Bacteria 989
104 Ga0070679_100000809 3300005530 Bacteria 27122
105 Ga0070679_100014718 3300005530 Bacteria 7520
106 Ga0070679_100019814 3300005530 Bacteria 6549
107 Ga0070684_100258913 3300005535 Bacteria 1591
108 Ga0070684_100668202 3300005535 Bacteria 968
109 Ga0068853_100014008 3300005539 Bacteria 6561
110 Ga0068853_100027763 3300005539 Bacteria 4757
111 Ga0068853_100033329 3300005539 Bacteria 4369
112 Ga0068853_100041564 3300005539 Bacteria 3928
113 Ga0068853_100087611 3300005539 Bacteria 2732
114 Ga0068853_100166264 3300005539 Bacteria 1993
115 Ga0068853_100219628 3300005539 Bacteria 1735
116 Ga0068853_100261665 3300005539 Bacteria 1591
117 Ga0068853_100471146 3300005539 Bacteria 1183
118 Ga0068853_101422637 3300005539 Bacteria 671
119 Ga0068853_101513833 3300005539 Bacteria 650
120 Ga0070672_100397071 3300005543 Bacteria 1181
121 Ga0070672_101142998 3300005543 Bacteria 693
122 Ga0070696_100009303 3300005546 Bacteria 6577
123 Ga0070696_100172223 3300005546 Bacteria 1601
124 Ga0070693_100044184 3300005547 Bacteria 2520
125 Ga0070693_100051377 3300005547 Bacteria 2360
126 Ga0070665_100000057 3300005548 Bacteria 237271
127 Ga0070665_100000838 3300005548 Bacteria 40099
128 Ga0070665_100088395 3300005548 Bacteria 3104
129 Ga0070665_100117114 3300005548 Bacteria 2666
130 Ga0070665_100122005 3300005548 Bacteria 2608
131 Ga0070665_100235001 3300005548 Bacteria 1833
132 Ga0070665_100642002 3300005548 Bacteria 1074
133 Ga0070665_100781849 3300005548 Bacteria 968
134 Ga0070665_101480519 3300005548 Bacteria 687
135 Ga0068855_100003960 3300005563 Bacteria 18083
136 Ga0068855_100022714 3300005563 Bacteria 7517
137 Ga0068855_100067485 3300005563 Bacteria 4166
138 Ga0068855_100584817 3300005563 Bacteria 1205
139 Ga0068855_101070045 3300005563 Bacteria 844
140 Ga0070664_100019492 3300005564 Bacteria 5582
141 Ga0070664_100079048 3300005564 Bacteria 2830
142 Ga0070664_100089947 3300005564 Bacteria 2656
143 Ga0068857_100039190 3300005577 Bacteria 4196
144 Ga0068857_100126595 3300005577 Bacteria 2302
145 Ga0068857_100134512 3300005577 Bacteria 2232
146 Ga0068854_100056373 3300005578 Bacteria 2832
147 Ga0068854_100088088 3300005578 Bacteria 2304
148 Ga0068854_100101051 3300005578 Bacteria 2162
149 Ga0068854_100125577 3300005578 Bacteria 1953
150 Ga0068854_100635046 3300005578 Bacteria 915
151 Ga0068856_100008809 3300005614 Bacteria 9819
152 Ga0068856_100011032 3300005614 Bacteria 8776
153 Ga0068856_100021219 3300005614 Bacteria 6309
154 Ga0068856_100021290 3300005614 Bacteria 6300
155 Ga0068856_100081913 3300005614 Bacteria 3202
156 Ga0068856_100103208 3300005614 Bacteria 2845
157 Ga0068856_100171100 3300005614 Bacteria 2184
158 Ga0068856_100188138 3300005614 Bacteria 2078
159 Ga0068852_100021868 3300005616 Bacteria 5117
160 Ga0068852_100040124 3300005616 Bacteria 3947
161 Ga0068852_100170279 3300005616 Bacteria 2041
162 Ga0068852_100322078 3300005616 Bacteria 1502
163 Ga0068852_101437205 3300005616 Bacteria 712
164 Ga0068859_100015799 3300005617 Bacteria 7585
165 Ga0068859_100344287 3300005617 Bacteria 1585
166 Ga0068859_101026992 3300005617 Bacteria 906
167 Ga0068864_100002860 3300005618 Bacteria 14264
168 Ga0068864_101409508 3300005618 Bacteria 699
169 Ga0068866_10763603 3300005718 Bacteria 669
170 Ga0068851_10002611 3300005834 Bacteria 7942
171 Ga0068851_10470272 3300005834 Bacteria 750
172 Ga0068851_10581375 3300005834 Bacteria 680
173 Ga0068851_10678200 3300005834 Bacteria 633
174 Ga0068863_100005670 3300005841 Bacteria 12263
175 Ga0068863_100059126 3300005841 Bacteria 3627
176 Ga0068863_100190876 3300005841 Bacteria 1969
177 Ga0068863_100269277 3300005841 Bacteria 1648
178 Ga0068858_100008089 3300005842 Bacteria 10123
179 Ga0068860_100067923 3300005843 Bacteria 3386
180 Ga0068860_100103296 3300005843 Bacteria 2720
181 Ga0068860_100107406 3300005843 Bacteria 2667
182 Ga0068860_100254503 3300005843 Bacteria 1711
183 Ga0068860_100636891 3300005843 Bacteria 1073
184 Ga0068860_101764052 3300005843 Bacteria 641
185 Ga0068862_100000354 3300005844 Bacteria 49717
186 Ga0068862_100407715 3300005844 Bacteria 1273
187 Ga0081540_1002130 3300005983 Bacteria 16480
188 Ga0081539_10082143 3300005985 Bacteria 1690
189 Ga0070712_100305876 3300006175 Bacteria 1288
190 Ga0075362_10097059 3300006177 Bacteria 1374
191 Ga0097621_100021693 3300006237 Bacteria 4974
192 Ga0097621_100023998 3300006237 Bacteria 4756
193 Ga0097621_100053409 3300006237 Bacteria 3294
194 Ga0097621_100058214 3300006237 Bacteria 3162
195 Ga0097621_100240442 3300006237 Bacteria 1582
196 Ga0097621_100242028 3300006237 Bacteria 1577
197 Ga0097621_100652511 3300006237 Bacteria 966
198 Ga0068871_100045937 3300006358 Bacteria 3517
199 Ga0068871_100063532 3300006358 Bacteria 3020
200 Ga0068871_100093093 3300006358 Bacteria 2514
201 Ga0068871_100877089 3300006358 Bacteria 831
202 Ga0068871_100894292 3300006358 Bacteria 823
203 Ga0068865_100002265 3300006881 Bacteria 11321
204 Ga0068865_100025332 3300006881 Bacteria 3901
205 Ga0068865_100025358 3300006881 Bacteria 3900
206 Ga0068865_100318826 3300006881 Bacteria 1249
207 Ga0097620_100015798 3300006931 Bacteria 7585
208 Ga0097620_100344331 3300006931 Bacteria 1585
209 Ga0097620_101027042 3300006931 Bacteria 906
210 Ga0105240_10015501 3300009093 Bacteria 10361
211 Ga0105240_10074524 3300009093 Bacteria 4189
212 Ga0105240_10088669 3300009093 Bacteria 3785
213 Ga0105240_10095619 3300009093 Bacteria 3622
214 Ga0105240_10487860 3300009093 Bacteria 1372
215 Ga0105240_10884580 3300009093 Bacteria 962
216 Ga0111539_10886538 3300009094 Bacteria 1038
217 Ga0105247_10165443 3300009101 Bacteria 1467
218 Ga0105247_10243910 3300009101 Bacteria 1225
219 Ga0105241_10009386 3300009174 Bacteria 7188
220 Ga0105241_10091566 3300009174 Bacteria 2399
221 Ga0105241_10245181 3300009174 Bacteria 1516
222 Ga0105241_10394162 3300009174 Bacteria 1213
223 Ga0105241_10656940 3300009174 Bacteria 953
224 Ga0105241_10729508 3300009174 Bacteria 907
225 Ga0105241_10952460 3300009174 Bacteria 800
226 Ga0105242_10047025 3300009176 Bacteria 3503
227 Ga0105242_11013304 3300009176 Bacteria 839
228 Ga0105248_10001462 3300009177 Bacteria 26311
229 Ga0105248_10038118 3300009177 Bacteria 5378
230 Ga0105248_10359810 3300009177 Bacteria 1638
231 Ga0105248_10401968 3300009177 Bacteria 1542
232 Ga0105248_10531864 3300009177 Bacteria 1326
233 Ga0105248_10533444 3300009177 Bacteria 1324
234 Ga0105248_10790463 3300009177 Bacteria 1071
235 Ga0105237_10000202 3300009545 Bacteria 84889
236 Ga0105237_10008758 3300009545 Bacteria 10917
237 Ga0105237_10018893 3300009545 Bacteria 7126
238 Ga0105237_10020473 3300009545 Bacteria 6816
239 Ga0105237_10055037 3300009545 Bacteria 3985
240 Ga0105237_10161918 3300009545 Bacteria 2236
241 Ga0105237_10166841 3300009545 Bacteria 2201
242 Ga0105237_10311236 3300009545 Bacteria 1578
243 Ga0105237_10516804 3300009545 Bacteria 1201
244 Ga0105237_10582001 3300009545 Bacteria 1126
245 Ga0105238_10001867 3300009551 Bacteria 21119
246 Ga0105238_10017719 3300009551 Bacteria 7241
247 Ga0105238_10032357 3300009551 Bacteria 5321
248 Ga0105238_10063962 3300009551 Bacteria 3680
249 Ga0105238_10099145 3300009551 Bacteria 2897
250 Ga0105238_10134714 3300009551 Bacteria 2448
251 Ga0105238_10269754 3300009551 Bacteria 1682
252 Ga0105238_11083509 3300009551 Bacteria 823
253 Ga0105249_10002363 3300009553 Bacteria 16380
254 Ga0105249_10008901 3300009553 Bacteria 8769
255 Ga0105239_10019312 3300010375 Bacteria 7527
256 Ga0105239_10023410 3300010375 Bacteria 6802
257 Ga0105239_10161115 3300010375 Bacteria 2506
258 Ga0105239_10203852 3300010375 Bacteria 2216
259 Ga0105239_10205582 3300010375 Bacteria 2206
260 Ga0105239_10216696 3300010375 Bacteria 2146
261 Ga0105239_10392182 3300010375 Bacteria 1571
262 Ga0105239_10410468 3300010375 Bacteria 1533
263 Ga0105239_10873933 3300010375 Bacteria 1031
264 Ga0105246_10027734 3300011119 Bacteria 3715
265 Ga0105246_10061223 3300011119 Bacteria 2618
266 Ga0157326_1016886 3300012513 Bacteria 868
267 Ga0157373_10014849 3300013100 Bacteria 5704
268 Ga0157373_10017413 3300013100 Bacteria 5235
269 Ga0157373_10039784 3300013100 Bacteria 3365
270 Ga0157373_10122400 3300013100 Bacteria 1828
271 Ga0157373_10569840 3300013100 Bacteria 822
272 Ga0157371_10003647 3300013102 Bacteria 13861
273 Ga0157371_10014602 3300013102 Bacteria 5920
274 Ga0157371_10028462 3300013102 Bacteria 4046
275 Ga0157371_10048524 3300013102 Bacteria 3018
276 Ga0157371_10147703 3300013102 Bacteria 1676
277 Ga0157371_10204810 3300013102 Bacteria 1415
278 Ga0157370_10010975 3300013104 Bacteria 9504
279 Ga0157370_10013955 3300013104 Bacteria 8250
280 Ga0157370_10016379 3300013104 Bacteria 7503
281 Ga0157370_10125618 3300013104 Bacteria 2394
282 Ga0157370_10171705 3300013104 Bacteria 2015
283 Ga0157370_10255156 3300013104 Bacteria 1622
284 Ga0157370_10870333 3300013104 Bacteria 818
285 Ga0157370_10997638 3300013104 Bacteria 758
286 Ga0157369_10000195 3300013105 Bacteria 84688
287 Ga0157369_10004547 3300013105 Bacteria 16312
288 Ga0157369_10012799 3300013105 Bacteria 9513
289 Ga0157369_10097251 3300013105 Bacteria 3141
290 Ga0157369_10142387 3300013105 Bacteria 2536
291 Ga0157369_10209993 3300013105 Bacteria 2041
292 Ga0157369_10243903 3300013105 Bacteria 1876
293 Ga0157369_10377727 3300013105 Bacteria 1471
294 Ga0157374_10011793 3300013296 Bacteria 7584
295 Ga0157374_10056986 3300013296 Bacteria 3649
296 Ga0157374_10284900 3300013296 Bacteria 1632
297 Ga0157378_10045866 3300013297 Bacteria 3885
298 Ga0157378_10549281 3300013297 Bacteria 1160
299 Ga0157378_10595795 3300013297 Bacteria 1116
300 Ga0157378_10711924 3300013297 Bacteria 1024
301 Ga0163162_10000003 3300013306 Bacteria 698280
302 Ga0163162_10000236 3300013306 Bacteria 50620
303 Ga0163162_10371860 3300013306 Bacteria 1562
304 Ga0157372_10005441 3300013307 Bacteria 13531
305 Ga0157372_10007019 3300013307 Bacteria 11995
306 Ga0157372_10019326 3300013307 Bacteria 7338
307 Ga0157372_10019352 3300013307 Bacteria 7335
308 Ga0157372_10216413 3300013307 Bacteria 2220
309 Ga0157372_10455968 3300013307 Bacteria 1490
310 Ga0157372_10773055 3300013307 Bacteria 1116
311 Ga0157372_11797896 3300013307 Bacteria 705
312 Ga0157375_10066877 3300013308 Bacteria 3589
313 Ga0157375_10080866 3300013308 Bacteria 3288
314 Ga0157375_10361666 3300013308 Bacteria 1617
315 Ga0163163_10000196 3300014325 Bacteria 62407
316 Ga0163163_10136376 3300014325 Bacteria 2495
317 Ga0163163_10381420 3300014325 Bacteria 1467
318 Ga0157380_11007094 3300014326 Bacteria 867
319 Ga0157380_11679752 3300014326 Bacteria 692
320 Ga0182008_10017736 3300014497 Bacteria 3690
321 Ga0182008_10054015 3300014497 Bacteria 1988
322 Ga0157377_10791270 3300014745 Bacteria 698
323 Ga0157379_10089866 3300014968 Bacteria 2755
324 Ga0157379_10154459 3300014968 Bacteria 2070
325 Ga0157379_10266710 3300014968 Bacteria 1557
326 Ga0157379_10345633 3300014968 Bacteria 1361
327 Ga0157376_10000734 3300014969 Bacteria 21294
328 Ga0157376_10101988 3300014969 Bacteria 2509
329 Ga0157376_10264663 3300014969 Bacteria 1612
330 Ga0157376_10402560 3300014969 Bacteria 1324
331 Ga0182006_1210691 3300015261 Bacteria 642
332 Ga0182007_10004354 3300015262 Bacteria 6432
333 Ga0182007_10056763 3300015262 Bacteria 1285
334 Ga0182007_10077240 3300015262 Bacteria 1092
335 Ga0182005_1000004 3300015265 Bacteria 609645
336 Ga0183368_1004 3300015687 Bacteria 1211761
337 Ga0163161_10002464 3300017792 Bacteria 13212
338 Ga0206354_10672385 3300020081 Bacteria 1284
339 Ga0209674_103668 3300025226 Bacteria 2742
340 Ga0209672_100237 3300025228 Bacteria 41924
341 Ga0207427_100040 3300025231 Bacteria 265135
342 Ga0207427_100115 3300025231 Bacteria 104282
343 Ga0207427_100130 3300025231 Bacteria 94510
344 Ga0209437_100020 3300025233 Bacteria 656374
345 Ga0209437_100079 3300025233 Bacteria 275948
346 Ga0209437_100172 3300025233 Bacteria 140146
347 Ga0209258_100246 3300025242 Bacteria 99606
348 Ga0209258_100806 3300025242 Bacteria 18294
349 Ga0209646_1000500 3300025246 Bacteria 18240
350 Ga0209026_1000105 3300025250 Bacteria 150738
351 Ga0209026_1001092 3300025250 Bacteria 13010
352 Ga0209026_1009956 3300025250 Bacteria 1813
353 Ga0209148_1000024 3300025254 Bacteria 669890
354 Ga0209759_1000907 3300025256 Bacteria 22090
355 Ga0209759_1001941 3300025256 Bacteria 10054
356 Ga0209759_1017742 3300025256 Bacteria 1742
357 Ga0209233_1000020 3300025261 Bacteria 798224
358 Ga0209233_1000108 3300025261 Bacteria 265137
359 Ga0209233_1000121 3300025261 Bacteria 233309
360 Ga0209455_1000025 3300025272 Bacteria 670673
361 Ga0207426_1017394 3300025302 Bacteria 2558
362 Ga0209257_1000145 3300025304 Bacteria 195152
363 Ga0207656_10000750 3300025321 Bacteria 10626
364 Ga0207656_10072651 3300025321 Bacteria 1532
365 Ga0207680_10000006 3300025903 Bacteria 635950
366 Ga0207680_10010093 3300025903 Bacteria 4712
367 Ga0207680_10125419 3300025903 Bacteria 1685
368 Ga0207680_10151500 3300025903 Bacteria 1546
369 Ga0207647_10000091 3300025904 Bacteria 68421
370 Ga0207647_10002917 3300025904 Bacteria 12877
371 Ga0207645_10008128 3300025907 Bacteria 7353
372 Ga0207645_10042438 3300025907 Bacteria 2910
373 Ga0207643_10126130 3300025908 Bacteria 1520
374 Ga0207705_10031472 3300025909 Bacteria 3788
375 Ga0207705_10500109 3300025909 Bacteria 944
376 Ga0207705_11080398 3300025909 Bacteria 618
377 Ga0207654_10000065 3300025911 Bacteria 69237
378 Ga0207654_10020184 3300025911 Bacteria 3529
379 Ga0207654_10025227 3300025911 Bacteria 3204
380 Ga0207654_10044869 3300025911 Bacteria 2513
381 Ga0207654_10095886 3300025911 Bacteria 1818
382 Ga0207654_10445749 3300025911 Bacteria 907
383 Ga0207707_10000641 3300025912 Bacteria 34523
384 Ga0207707_10052739 3300025912 Bacteria 3540
385 Ga0207707_10245050 3300025912 Bacteria 1557
386 Ga0207695_10001492 3300025913 Bacteria 39028
387 Ga0207695_10009244 3300025913 Bacteria 12214
388 Ga0207695_10010430 3300025913 Bacteria 11367
389 Ga0207695_10013791 3300025913 Bacteria 9616
390 Ga0207695_10058089 3300025913 Bacteria 4016
391 Ga0207695_10112306 3300025913 Bacteria 2703
392 Ga0207695_10595603 3300025913 Bacteria 986
393 Ga0207671_10000726 3300025914 Bacteria 41902
394 Ga0207671_10001709 3300025914 Bacteria 24785
395 Ga0207671_10004311 3300025914 Bacteria 13675
396 Ga0207671_10011034 3300025914 Bacteria 7397
397 Ga0207671_10042128 3300025914 Bacteria 3380
398 Ga0207671_10068319 3300025914 Bacteria 2648
399 Ga0207671_10247644 3300025914 Bacteria 1401
400 Ga0207671_10505242 3300025914 Bacteria 964
401 Ga0207671_10776506 3300025914 Bacteria 760
402 Ga0207660_10297938 3300025917 Bacteria 1284
403 Ga0207657_10003100 3300025919 Bacteria 17774
404 Ga0207649_10000447 3300025920 Bacteria 29709
405 Ga0207649_10054552 3300025920 Bacteria 2488
406 Ga0207649_10184952 3300025920 Bacteria 1461
407 Ga0207652_11511933 3300025921 Bacteria 575
408 Ga0207681_10387327 3300025923 Bacteria 1126
409 Ga0207681_10649757 3300025923 Bacteria 874
410 Ga0207681_11068835 3300025923 Bacteria 678
411 Ga0207694_10000162 3300025924 Bacteria 68375
412 Ga0207694_10005909 3300025924 Bacteria 9384
413 Ga0207694_10010020 3300025924 Bacteria 7142
414 Ga0207694_10031338 3300025924 Bacteria 4061
415 Ga0207694_10046795 3300025924 Bacteria 3344
416 Ga0207694_10135584 3300025924 Bacteria 1976
417 Ga0207650_10012333 3300025925 Bacteria 5899
418 Ga0207650_10249151 3300025925 Bacteria 1438
419 Ga0207650_10625677 3300025925 Bacteria 906
420 Ga0207659_10189913 3300025926 Bacteria 1634
421 Ga0207687_10381976 3300025927 Bacteria 1154
422 Ga0207700_10003472 3300025928 Bacteria 9176
423 Ga0207664_10003176 3300025929 Bacteria 10917
424 Ga0207664_10216281 3300025929 Bacteria 1660
425 Ga0207644_10019889 3300025931 Bacteria 4559
426 Ga0207644_10603820 3300025931 Bacteria 911
427 Ga0207644_10719428 3300025931 Bacteria 833
428 Ga0207690_10318815 3300025932 Bacteria 1221
429 Ga0207706_10001761 3300025933 Bacteria 21250
430 Ga0207706_10070574 3300025933 Bacteria 3073
431 Ga0207686_10902852 3300025934 Bacteria 713
432 Ga0207670_10137570 3300025936 Bacteria 1797
433 Ga0207704_10004475 3300025938 Bacteria 6387
434 Ga0207704_10101378 3300025938 Bacteria 1920
435 Ga0207704_10259950 3300025938 Bacteria 1308
436 Ga0207704_10628631 3300025938 Bacteria 882
437 Ga0207691_10063560 3300025940 Bacteria 3347
438 Ga0207691_11045615 3300025940 Bacteria 680
439 Ga0207711_10007760 3300025941 Bacteria 8965
440 Ga0207711_10036542 3300025941 Bacteria 4168
441 Ga0207711_10231908 3300025941 Bacteria 1691
442 Ga0207711_10345179 3300025941 Bacteria 1378
443 Ga0207689_10056528 3300025942 Bacteria 3229
444 Ga0207689_10112245 3300025942 Bacteria 2241
445 Ga0207689_10224681 3300025942 Bacteria 1552
446 Ga0207689_10307716 3300025942 Bacteria 1314
447 Ga0207689_10343794 3300025942 Bacteria 1239
448 Ga0207661_10042331 3300025944 Bacteria 3590
449 Ga0207661_11379533 3300025944 Bacteria 647
450 Ga0207679_10091567 3300025945 Bacteria 2353
451 Ga0207679_10238823 3300025945 Bacteria 1538
452 Ga0207667_10017535 3300025949 Bacteria 8053
453 Ga0207667_10049480 3300025949 Bacteria 4438
454 Ga0207667_10320311 3300025949 Bacteria 1583
455 Ga0207667_10592568 3300025949 Bacteria 1118
456 Ga0207667_10684266 3300025949 Bacteria 1029
457 Ga0207651_10493077 3300025960 Bacteria 1058
458 Ga0207712_10000354 3300025961 Bacteria 40709
459 Ga0207712_10000677 3300025961 Bacteria 26367
460 Ga0207668_10139484 3300025972 Bacteria 1862
461 Ga0207668_10243186 3300025972 Bacteria 1457
462 Ga0207668_10647632 3300025972 Bacteria 924
463 Ga0207640_10017628 3300025981 Bacteria 4182
464 Ga0207640_10143997 3300025981 Bacteria 1741
465 Ga0207640_10200658 3300025981 Bacteria 1511
466 Ga0207640_10244153 3300025981 Bacteria 1389
467 Ga0207640_10559357 3300025981 Bacteria 962
468 Ga0207640_10596196 3300025981 Bacteria 935
469 Ga0207658_10000006 3300025986 Bacteria 392309
470 Ga0207658_10017811 3300025986 Bacteria 4894
471 Ga0207658_10035782 3300025986 Bacteria 3557
472 Ga0207658_10093763 3300025986 Bacteria 2335
473 Ga0207658_10112380 3300025986 Bacteria 2156
474 Ga0207658_10193339 3300025986 Bacteria 1693
475 Ga0207658_10510794 3300025986 Bacteria 1071
476 Ga0207658_10537771 3300025986 Bacteria 1044
477 Ga0207677_10275189 3300026023 Bacteria 1379
478 Ga0207703_10008155 3300026035 Bacteria 8277
479 Ga0207703_10238645 3300026035 Bacteria 1633
480 Ga0207703_11469480 3300026035 Bacteria 656
481 Ga0207639_10000955 3300026041 Bacteria 19606
482 Ga0207639_10001472 3300026041 Bacteria 15846
483 Ga0207639_10006738 3300026041 Bacteria 7818
484 Ga0207639_10063785 3300026041 Bacteria 2854
485 Ga0207639_10243867 3300026041 Bacteria 1564
486 Ga0207639_10502276 3300026041 Bacteria 1108
487 Ga0207639_10661296 3300026041 Bacteria 967
488 Ga0207639_10916584 3300026041 Bacteria 819
489 Ga0207639_11078295 3300026041 Bacteria 753
490 Ga0207678_10004860 3300026067 Bacteria 12069
491 Ga0207678_10019625 3300026067 Bacteria 5943
492 Ga0207678_10206327 3300026067 Bacteria 1681
493 Ga0207678_11107666 3300026067 Bacteria 701
494 Ga0207702_10009340 3300026078 Bacteria 8239
495 Ga0207702_10028139 3300026078 Bacteria 4670
496 Ga0207702_10080298 3300026078 Bacteria 2829
497 Ga0207702_10319521 3300026078 Bacteria 1478
498 Ga0207702_11347938 3300026078 Bacteria 707
499 Ga0207641_10185918 3300026088 Bacteria 1906
500 Ga0207641_10283783 3300026088 Bacteria 1558
501 Ga0207641_10480936 3300026088 Bacteria 1203
502 Ga0207648_10082156 3300026089 Bacteria 2810
503 Ga0207648_10801246 3300026089 Bacteria 877
504 Ga0207676_10020708 3300026095 Bacteria 4815
505 Ga0207676_10131613 3300026095 Bacteria 2128
506 Ga0207676_10547304 3300026095 Bacteria 1105
507 Ga0207674_10002998 3300026116 Bacteria 20947
508 Ga0207674_10014829 3300026116 Bacteria 8596
509 Ga0207674_10045181 3300026116 Bacteria 4533
510 Ga0207675_100085274 3300026118 Bacteria 2964
511 Ga0207675_100242712 3300026118 Bacteria 1741
512 Ga0207683_10002105 3300026121 Bacteria 17534
513 Ga0207683_10003087 3300026121 Bacteria 14551
514 Ga0207683_10178672 3300026121 Bacteria 1924
515 Ga0207683_10413038 3300026121 Bacteria 1242
516 Ga0207698_10037983 3300026142 Bacteria 3553
517 Ga0207698_10103822 3300026142 Bacteria 2363
518 Ga0207698_10342443 3300026142 Bacteria 1409
519 Ga0207698_11122631 3300026142 Bacteria 799
520 Ga0268266_10000001 3300028379 Bacteria 4040580
521 Ga0268266_10000006 3300028379 Bacteria 1410021
522 Ga0268266_10000021 3300028379 Bacteria 522453
523 Ga0268266_10031052 3300028379 Bacteria 4537
524 Ga0268266_10051990 3300028379 Bacteria 3517
525 Ga0268266_10058826 3300028379 Bacteria 3310
526 Ga0268266_10080418 3300028379 Bacteria 2840
527 Ga0268266_10275366 3300028379 Bacteria 1563
528 Ga0268266_10516068 3300028379 Bacteria 1142
529 Ga0268265_10002801 3300028380 Bacteria 12848
530 Ga0268265_10120047 3300028380 Bacteria 2164
531 Ga0268264_10009178 3300028381 Bacteria 8194
532 Ga0268264_10107393 3300028381 Bacteria 2438
533 Ga0268264_10339490 3300028381 Bacteria 1426
534 Ga0265332_10110878 3300031238 Bacteria 1156
535 Ga0307508_10012852 3300031616 Bacteria 7655
536 Ga0307516_10136241 3300031730 Bacteria 2229
537 Ga0307405_10197212 3300031731 Bacteria 1459
538 Ga0307405_10268704 3300031731 Bacteria 1278
539 Ga0307407_10228419 3300031903 Bacteria 1262
540 Ga0307412_10186234 3300031911 Bacteria 1566
541 Ga0307409_100104473 3300031995 Bacteria 2359
542 Ga0307414_10163842 3300032004 Bacteria 1769
543 Ga0307414_10251535 3300032004 Bacteria 1469
544 Ga0307507_10322001 3300033179 Bacteria 930
545 Ga0307510_10014110 3300033180 Bacteria 9461
546 Ga0373944_0010152 3300035089 Bacteria 2562
547 Ga0373953_0161241 3300035117 Bacteria 964
548 Ga0373924_0264281 3300035410 Bacteria 763
549 Ga0373933_0203783 3300035724 Bacteria 1266
550 Ga0373937_0015568 3300036401 Bacteria 6730
551 Ga0395900_0193227 3300037418 Bacteria 2063
552 Ga0395905_0000577 3300037471 Bacteria 49489
553 Ga0395901_0024530 3300038443 Bacteria 6191
554 Ga0395901_0080831 3300038443 Bacteria 3394
555 Ga0395901_0501959 3300038443 Bacteria 1235
556 Ga0395901_1101987 3300038443 Bacteria 764
557 Ga0436365_1382606 3300039437 Bacteria 3124
558 Ga0436365_1829561 3300039437 Bacteria 736
559 Ga0451787_313061 3300041441 Bacteria 937
560 Ga0451789_0232468 3300041443 Bacteria 2402
561 Ga0451791_1139757 3300041451 Bacteria 1057
562 Ga0451793_0324997 3300041452 Bacteria 3220
563 Ga0451798_1175536 3300041458 Bacteria 1105
564 Ga0451802_1618475 3300041460 Bacteria 1273
565 Ga0451806_196532 3300041462 Bacteria 765
566 Ga0451804_0461783 3300041463 Bacteria 1142
567 Ga0451804_0515953 3300041463 Bacteria 838
568 Ga0451807_1293046 3300041486 Bacteria 691
569 Ga0451807_2640286 3300041486 Bacteria 6134
570 Ga0451837_0354769 3300041494 Bacteria 959
571 Ga0451837_1800117 3300041494 Bacteria 1235
572 Ga0451839_1321482 3300041496 Bacteria 1033
573 Ga0451843_0934667 3300041509 Bacteria 1079
574 Ga0451843_1653258 3300041509 Bacteria 3316
575 Ga0451853_3308297 3300041512 Bacteria 1403
576 Ga0439448_0125511 3300042005 Bacteria 882
577 Ga0439449_0103205 3300042007 Bacteria 1054
578 Ga0439459_0001975 3300042438 Bacteria 3114
579 Ga0453684_0000377 3300044712 Bacteria 183445
580 Ga0453684_0499313 3300044712 Bacteria 1347
581 Ga0466970_0007619 3300044765 Bacteria 5427
582 Ga0451576_0000033 3300045051 Bacteria 393131
583 Ga0495638_0000063 3300046460 Bacteria 185733
584 Ga0495638_0064037 3300046460 Bacteria 2265
585 Ga0495650_0002554 3300046471 Bacteria 14454
586 Ga0495582_0022480 3300046473 Bacteria 3451
587 Ga0495607_0000003 3300046501 Bacteria 366900
588 Ga0495606_0001000 3300046507 Bacteria 41217
589 Ga0495606_0015836 3300046507 Bacteria 5787
590 Ga0495606_0031819 3300046507 Bacteria 3662
591 Ga0495610_0021270 3300046512 Bacteria 3572
592 Ga0495610_0115460 3300046512 Bacteria 1184
593 Ga0495616_0183344 3300046513 Bacteria 929
594 Ga0495620_0008202 3300046515 Bacteria 5617
595 Ga0495631_0003861 3300046518 Bacteria 8115
596 Ga0495632_0000011 3300046519 Bacteria 266804
597 Ga0495632_0019552 3300046519 Bacteria 3686
598 Ga0495648_0025746 3300046524 Bacteria 3976
599 Ga0495586_0135540 3300046535 Bacteria 1380
600 Ga0495622_0062103 3300046557 Bacteria 1730
601 Ga0495633_0189155 3300046558 Bacteria 946
602 Ga0495611_0000068 3300046648 Bacteria 71983
603 Ga0495625_0054963 3300046660 Bacteria 2841
604 Ga0495625_0088678 3300046660 Bacteria 2142
605 Ga0495588_0348843 3300046674 Bacteria 778
606 Ga0495599_0669546 3300046678 Bacteria 600
607 Ga0495647_0086713 3300046681 Bacteria 1277
608 Ga0495658_0006329 3300046683 Bacteria 5816
609 Ga0495658_0684504 3300046683 Bacteria 657
610 Ga0495636_0000522 3300047318 Bacteria 14147
611 Ga0495680_0215176 3300047322 Bacteria 1374
612 Ga0495673_0000229 3300047469 Bacteria 82319
613 Ga0495686_0000037 3300047472 Bacteria 307937
614 Ga0495686_0037360 3300047472 Bacteria 3111
615 Ga0496101_0007405 3300048904 Bacteria 7112
616 Ga0496101_0207430 3300048904 Bacteria 1517
617 Ga0496102_0359306 3300048905 Bacteria 1371
618 Ga0496102_1544009 3300048905 Bacteria 582
619 Ga0496103_0053287 3300048906 Bacteria 2507
620 Ga0496104_0000011 3300048907 Bacteria 459358
621 Ga0496105_0000071 3300048908 Bacteria 79908
622 Ga0496105_0349928 3300048908 Bacteria 1180
623 Ga0496108_0471812 3300048911 Bacteria 1096
624 Ga0496109_0174386 3300048912 Bacteria 2018
625 Ga0496112_0891872 3300048915 Bacteria 811
626 Ga0496114_0383774 3300048917 Bacteria 1244
627 Ga0496115_0000153 3300048918 Bacteria 64207
628 Ga0496115_0119821 3300048918 Bacteria 2165
629 Ga0496116_0162714 3300048919 Bacteria 1222
630 Ga0496117_0005879 3300048920 Bacteria 12682
631 Ga0496118_0000362 3300048921 Bacteria 76786
632 Ga0496118_0018115 3300048921 Bacteria 6371
633 Ga0496119_0000851 3300048922 Bacteria 40261
634 Ga0496119_0024644 3300048922 Bacteria 4226
635 Ga0496120_0001387 3300048923 Bacteria 29403
636 Ga0496121_0068082 3300048924 Bacteria 2882
637 Ga0496121_0253006 3300048924 Bacteria 1220
638 Ga0496122_0001419 3300048925 Bacteria 38784
639 Ga0496122_0012114 3300048925 Bacteria 8634
640 Ga0496122_0013791 3300048925 Bacteria 7875
641 Ga0496122_0045754 3300048925 Bacteria 3397
642 Ga0496123_0001240 3300048926 Bacteria 37029
643 Ga0496123_0033997 3300048926 Bacteria 3660
644 Ga0496123_0050317 3300048926 Bacteria 2784
645 Ga0496123_0377951 3300048926 Bacteria 651
646 Ga0496124_0000893 3300048927 Bacteria 48172
647 Ga0496124_0015807 3300048927 Bacteria 7211
648 Ga0496125_0065237 3300048928 Bacteria 2886
649 Ga0496125_0252505 3300048928 Bacteria 1111
650 Ga0496126_0000199 3300048929 Bacteria 133742
651 Ga0496126_0092387 3300048929 Bacteria 2659
652 Ga0496126_0361429 3300048929 Bacteria 1185
653 Ga0495678_164343 3300049459 Bacteria 707
654 Ga0501031_0039849 3300049568 Bacteria 3066
655 Ga0501031_0396754 3300049568 Bacteria 892
656 Ga0501032_0002312 3300049569 Bacteria 14953
657 Ga0501032_0002816 3300049569 Bacteria 13525
658 Ga0501032_0203665 3300049569 Bacteria 1291
659 Ga0501032_0352007 3300049569 Bacteria 949
660 Ga0501033_0000329 3300049570 Bacteria 45324
661 Ga0501033_0002545 3300049570 Bacteria 15427
662 Ga0501033_0005030 3300049570 Bacteria 10525
663 Ga0501033_0113682 3300049570 Bacteria 1968
664 Ga0501033_0149050 3300049570 Bacteria 1688
665 Ga0501034_0000462 3300049571 Bacteria 67291
666 Ga0501034_0005495 3300049571 Bacteria 13833
667 Ga0501034_0008806 3300049571 Bacteria 10620
668 Ga0501034_0009780 3300049571 Bacteria 10028
669 Ga0501034_0045875 3300049571 Bacteria 4415
670 Ga0501034_0245487 3300049571 Bacteria 1735
671 Ga0501034_1127123 3300049571 Bacteria 665
672 Ga0501036_0008335 3300049572 Bacteria 8492
673 Ga0501036_0033157 3300049572 Bacteria 4368
674 Ga0501036_0038435 3300049572 Bacteria 4051
675 Ga0501037_0000815 3300049573 Bacteria 23310
676 Ga0501037_0001246 3300049573 Bacteria 18764
677 Ga0501037_0164498 3300049573 Bacteria 1580
678 Ga0501037_0169325 3300049573 Bacteria 1553
679 Ga0501037_0169510 3300049573 Bacteria 1552
680 Ga0501038_0001377 3300049574 Bacteria 22209
681 Ga0501038_0003503 3300049574 Bacteria 14613
682 Ga0501038_0069785 3300049574 Bacteria 2984
683 Ga0501039_0006941 3300049575 Bacteria 8619
684 Ga0501039_0143013 3300049575 Bacteria 1879
685 Ga0501039_0567220 3300049575 Bacteria 890
686 Ga0501039_0896089 3300049575 Bacteria 690
687 Ga0501042_0129517 3300049578 Bacteria 1818
688 Ga0501042_0284719 3300049578 Bacteria 1194
689 Ga0501043_0018924 3300049579 Bacteria 5404
690 Ga0501043_0044929 3300049579 Bacteria 3474
691 Ga0501046_0004658 3300049580 Bacteria 12390
692 Ga0501046_0006111 3300049580 Bacteria 10705
693 Ga0501046_0020493 3300049580 Bacteria 5465
694 Ga0501046_0062606 3300049580 Bacteria 2906
695 Ga0501047_0000442 3300049581 Bacteria 45876
696 Ga0501047_0009516 3300049581 Bacteria 9183
697 Ga0501047_0039527 3300049581 Bacteria 4562
698 Ga0501047_0135765 3300049581 Bacteria 2340
699 Ga0501047_0371243 3300049581 Bacteria 1265
700 Ga0501047_0564776 3300049581 Bacteria 961
701 Ga0501048_0011657 3300049582 Bacteria 6556
702 Ga0501048_0089741 3300049582 Bacteria 2168
703 Ga0501048_0378663 3300049582 Bacteria 1010
704 Ga0501067_0040303 3300049583 Bacteria 2594
705 Ga0501067_0270395 3300049583 Bacteria 946
706 Ga0501068_0061005 3300049584 Bacteria 2290
707 Ga0501068_0101517 3300049584 Bacteria 1783
708 Ga0501069_0123731 3300049585 Bacteria 1478
709 Ga0501070_0003148 3300049586 Bacteria 14367
710 Ga0501070_0007994 3300049586 Bacteria 8956
711 Ga0501070_0012356 3300049586 Bacteria 7204
712 Ga0501070_0019143 3300049586 Bacteria 5742
713 Ga0501070_0379252 3300049586 Bacteria 1145
714 Ga0501070_0513722 3300049586 Bacteria 961
715 Ga0501071_0008690 3300049587 Bacteria 6720
716 Ga0501071_0040952 3300049587 Bacteria 3317
717 Ga0501072_0096613 3300049588 Bacteria 2347
718 Ga0501073_0008238 3300049589 Bacteria 7730
719 Ga0501073_0013158 3300049589 Bacteria 6031
720 Ga0501073_0015900 3300049589 Bacteria 5453
721 Ga0501073_0032725 3300049589 Bacteria 3706
722 Ga0501073_0135137 3300049589 Bacteria 1709
723 Ga0501074_0027269 3300049590 Bacteria 4141
724 Ga0501074_0028263 3300049590 Bacteria 4064
725 Ga0501074_0042555 3300049590 Bacteria 3286
726 Ga0501076_0561196 3300049592 Bacteria 941
727 Ga0501242_006330 3300049674 Bacteria 1349
728 Ga0501243_012743 3300049675 Bacteria 1330
729 Ga0501253_045559 3300049683 Bacteria 901
730 Ga0501257_058346 3300049686 Bacteria 972
731 Ga0501245_009677 3300049708 Bacteria 1386
732 Ga0501079_0126479 3300049741 Bacteria 1988
733 Ga0501079_0130892 3300049741 Bacteria 1953
734 Ga0501079_1056387 3300049741 Bacteria 640
735 Ga0501080_0010508 3300049742 Bacteria 8475
736 Ga0501080_0069799 3300049742 Bacteria 3268
737 Ga0501080_0245097 3300049742 Bacteria 1635
738 Ga0501080_0249898 3300049742 Bacteria 1617
739 Ga0501080_0749441 3300049742 Bacteria 859
740 Ga0501080_0924075 3300049742 Bacteria 759
741 Ga0501080_1048044 3300049742 Bacteria 706
742 Ga0501081_0073885 3300049743 Bacteria 2378
743 Ga0501083_0070334 3300049744 Bacteria 2327
744 Ga0501266_023267 3300049763 Bacteria 855
745 Ga0501035_0005822 3300049822 Bacteria 11622
746 Ga0501035_0130250 3300049822 Bacteria 2193
747 Ga0501035_0380373 3300049822 Bacteria 1177
748 Ga0501035_0438295 3300049822 Bacteria 1082
749 Ga0501044_0029625 3300049823 Bacteria 5770
750 Ga0501044_0048316 3300049823 Bacteria 4395
751 Ga0501044_0159940 3300049823 Bacteria 2230
752 Ga0501044_0188919 3300049823 Bacteria 2023
753 Ga0501044_0346733 3300049823 Bacteria 1405
754 Ga0501045_0088995 3300049824 Bacteria 2280
755 Ga0501045_0195199 3300049824 Bacteria 1509
756 nmdc:mga00v17_26539_c1 3300050491 Bacteria 3377
757 Ga0500610_0000123 3300053079 Bacteria 23259
758 Ga0500643_001529 3300053087 Bacteria 13160
759 Ga0500651_0108545 3300053093 Bacteria 1695
760 Ga0500566_0078691 3300053094 Bacteria 1839
761 Ga0500568_0000145 3300053139 Bacteria 62300
762 Ga0500620_007813 3300053155 Bacteria 2665
763 Ga0500633_0006033 3300053160 Bacteria 2938
764 Ga0501084_0305625 3300054114 Bacteria 1343
765 Ga0500661_003635 3300055283 Bacteria 2898
766 Ga0501082_0000082 3300060353 Bacteria 71065
767 Ga0501082_0132506 3300060353 Bacteria 2162
768 Ga0501082_0254058 3300060353 Bacteria 1529
769 Ga0501082_0538245 3300060353 Bacteria 1021

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001979 JGI24740J21852_10000412 JGI24740J21852_1000041215 170
2 3300005327 Ga0070658_10013088 Ga0070658_100130882 170
3 3300005329 Ga0070683_100133545 Ga0070683_1001335451 170
4 3300005336 Ga0070680_100016672 Ga0070680_1000166722 170
5 3300005336 Ga0070680_100104449 Ga0070680_1001044491 170
6 3300005336 Ga0070680_100118825 Ga0070680_1001188252 170
7 3300005337 Ga0070682_100109903 Ga0070682_1001099033 170
8 3300005339 Ga0070660_100017899 Ga0070660_1000178992 170
9 3300005339 Ga0070660_100152137 Ga0070660_1001521372 170
10 3300005344 Ga0070661_100112920 Ga0070661_1001129202 170
11 3300005344 Ga0070661_101315693 Ga0070661_1013156931 170
12 3300005345 Ga0070692_10034406 Ga0070692_100344062 170
13 3300005345 Ga0070692_10106871 Ga0070692_101068711 170
14 3300005366 Ga0070659_100325447 Ga0070659_1003254472 170
15 3300005455 Ga0070663_100180611 Ga0070663_1001806112 170
16 3300005455 Ga0070663_100399346 Ga0070663_1003993462 170
17 3300005458 Ga0070681_10002046 Ga0070681_100020463 170
18 3300005458 Ga0070681_10015819 Ga0070681_100158195 170
19 3300005458 Ga0070681_10021136 Ga0070681_100211361 170
20 3300005518 Ga0070699_100617411 Ga0070699_1006174111 170
21 3300005530 Ga0070679_100000809 Ga0070679_1000008093 170
22 3300005530 Ga0070679_100014718 Ga0070679_1000147185 170
23 3300005530 Ga0070679_100019814 Ga0070679_1000198148 170
24 3300005539 Ga0068853_100219628 Ga0068853_1002196283 170
25 3300005539 Ga0068853_100471146 Ga0068853_1004711461 170
26 3300005546 Ga0070696_100009303 Ga0070696_1000093031 170
27 3300005563 Ga0068855_100022714 Ga0068855_1000227146 170
28 3300005564 Ga0070664_100089947 Ga0070664_1000899471 170
29 3300005578 Ga0068854_100101051 Ga0068854_1001010512 170
30 3300005614 Ga0068856_100021290 Ga0068856_1000212902 170
31 3300005614 Ga0068856_100171100 Ga0068856_1001711005 170
32 3300005616 Ga0068852_100021868 Ga0068852_1000218682 170
33 3300005834 Ga0068851_10678200 Ga0068851_106782001 170
34 3300009093 Ga0105240_10487860 Ga0105240_104878601 170
35 3300009551 Ga0105238_11083509 Ga0105238_110835091 170
36 3300013100 Ga0157373_10017413 Ga0157373_100174137 170
37 3300013100 Ga0157373_10039784 Ga0157373_100397845 170
38 3300013102 Ga0157371_10048524 Ga0157371_100485246 170
39 3300013102 Ga0157371_10147703 Ga0157371_101477033 170
40 3300013102 Ga0157371_10204810 Ga0157371_102048102 170
41 3300013104 Ga0157370_10016379 Ga0157370_100163795 170
42 3300013104 Ga0157370_10255156 Ga0157370_102551562 170
43 3300013105 Ga0157369_10097251 Ga0157369_100972516 170
44 3300013105 Ga0157369_10142387 Ga0157369_101423872 170
45 3300013105 Ga0157369_10243903 Ga0157369_102439031 170
46 3300013307 Ga0157372_10019352 Ga0157372_100193524 170
47 3300013307 Ga0157372_10455968 Ga0157372_104559682 170
48 3300013307 Ga0157372_10773055 Ga0157372_107730552 170
49 3300038443 Ga0395901_0024530 Ga0395901_0024530_1910_2458 170
50 3300044712 Ga0453684_0000377 Ga0453684_0000377_152947_153465 170
51 3300045051 Ga0451576_0000033 Ga0451576_0000033_29981_30499 170
52 3300049586 Ga0501070_0003148 Ga0501070_0003148_1379_1924 170
53 3300049824 Ga0501045_0195199 Ga0501045_0195199_714_1232 170
54 3300005834 Ga0068851_10581375 Ga0068851_105813752 171
55 3300026118 Ga0207675_100242712 Ga0207675_1002427121 171
56 3300046674 Ga0495588_0348843 Ga0495588_0348843_236_754 171
57 3300002741 JGI25157J39369_1002492 JGI25157J39369_10024923 172
58 3300002772 JGI25164J39214_1000663 JGI25164J39214_100066314 172
59 3300002772 JGI25164J39214_1000732 JGI25164J39214_10007322 172
60 3300003214 JGI25165J46597_1001316 JGI25165J46597_100131614 172
61 3300003214 JGI25165J46597_1002058 JGI25165J46597_10020587 172
62 3300003322 rootL2_10075816 rootL2_100758162 172
63 3300005327 Ga0070658_10027599 Ga0070658_100275992 172
64 3300005328 Ga0070676_10029738 Ga0070676_100297382 172
65 3300005328 Ga0070676_10936418 Ga0070676_109364181 172
66 3300005331 Ga0070670_100443477 Ga0070670_1004434772 172
67 3300005334 Ga0068869_100275713 Ga0068869_1002757132 172
68 3300005335 Ga0070666_10000003 Ga0070666_10000003297 172
69 3300005335 Ga0070666_10038006 Ga0070666_100380064 172
70 3300005337 Ga0070682_100125947 Ga0070682_1001259471 172
71 3300005338 Ga0068868_100053523 Ga0068868_1000535233 172
72 3300005340 Ga0070689_100219534 Ga0070689_1002195342 172
73 3300005347 Ga0070668_100754550 Ga0070668_1007545501 172
74 3300005353 Ga0070669_100237149 Ga0070669_1002371491 172
75 3300005364 Ga0070673_100735459 Ga0070673_1007354591 172
76 3300005366 Ga0070659_100081072 Ga0070659_1000810722 172
77 3300005367 Ga0070667_100000005 Ga0070667_1000000055 172
78 3300005367 Ga0070667_100183175 Ga0070667_1001831751 172
79 3300005367 Ga0070667_100255194 Ga0070667_1002551942 172
80 3300005435 Ga0070714_100004101 Ga0070714_1000041015 172
81 3300005435 Ga0070714_100006554 Ga0070714_10000655410 172
82 3300005436 Ga0070713_100011777 Ga0070713_1000117774 172
83 3300005455 Ga0070663_100003718 Ga0070663_1000037187 172
84 3300005456 Ga0070678_100065671 Ga0070678_1000656712 172
85 3300005456 Ga0070678_100361648 Ga0070678_1003616482 172
86 3300005456 Ga0070678_100637529 Ga0070678_1006375291 172
87 3300005456 Ga0070678_100847467 Ga0070678_1008474671 172
88 3300005456 Ga0070678_100917123 Ga0070678_1009171231 172
89 3300005458 Ga0070681_10000058 Ga0070681_1000005862 172
90 3300005535 Ga0070684_100668202 Ga0070684_1006682021 172
91 3300005539 Ga0068853_100014008 Ga0068853_1000140083 172
92 3300005539 Ga0068853_100033329 Ga0068853_1000333295 172
93 3300005539 Ga0068853_100041564 Ga0068853_1000415644 172
94 3300005539 Ga0068853_100087611 Ga0068853_1000876113 172
95 3300005539 Ga0068853_100261665 Ga0068853_1002616653 172
96 3300005539 Ga0068853_101422637 Ga0068853_1014226371 172
97 3300005539 Ga0068853_101513833 Ga0068853_1015138331 172
98 3300005543 Ga0070672_100397071 Ga0070672_1003970712 172
99 3300005546 Ga0070696_100172223 Ga0070696_1001722232 172
100 3300005547 Ga0070693_100044184 Ga0070693_1000441841 172
101 3300005547 Ga0070693_100051377 Ga0070693_1000513773 172
102 3300005548 Ga0070665_100088395 Ga0070665_1000883951 172
103 3300005548 Ga0070665_100122005 Ga0070665_1001220053 172
104 3300005548 Ga0070665_100235001 Ga0070665_1002350012 172
105 3300005548 Ga0070665_100642002 Ga0070665_1006420022 172
106 3300005563 Ga0068855_101070045 Ga0068855_1010700452 172
107 3300005577 Ga0068857_100039190 Ga0068857_1000391902 172
108 3300005578 Ga0068854_100056373 Ga0068854_1000563733 172
109 3300005578 Ga0068854_100125577 Ga0068854_1001255772 172
110 3300005578 Ga0068854_100635046 Ga0068854_1006350462 172
111 3300005614 Ga0068856_100021219 Ga0068856_1000212196 172
112 3300005614 Ga0068856_100103208 Ga0068856_1001032081 172
113 3300005616 Ga0068852_100170279 Ga0068852_1001702792 172
114 3300005616 Ga0068852_100322078 Ga0068852_1003220781 172
115 3300005616 Ga0068852_101437205 Ga0068852_1014372052 172
116 3300005617 Ga0068859_100344287 Ga0068859_1003442872 172
117 3300005618 Ga0068864_100002860 Ga0068864_10000286012 172
118 3300005718 Ga0068866_10763603 Ga0068866_107636031 172
119 3300005841 Ga0068863_100005670 Ga0068863_10000567011 172
120 3300005841 Ga0068863_100059126 Ga0068863_1000591262 172
121 3300005843 Ga0068860_100067923 Ga0068860_1000679233 172
122 3300005843 Ga0068860_100103296 Ga0068860_1001032962 172
123 3300005843 Ga0068860_100107406 Ga0068860_1001074062 172
124 3300006237 Ga0097621_100058214 Ga0097621_1000582142 172
125 3300006237 Ga0097621_100242028 Ga0097621_1002420282 172
126 3300006358 Ga0068871_100063532 Ga0068871_1000635324 172
127 3300006358 Ga0068871_100894292 Ga0068871_1008942921 172
128 3300006881 Ga0068865_100002265 Ga0068865_10000226510 172
129 3300006881 Ga0068865_100025358 Ga0068865_1000253584 172
130 3300006931 Ga0097620_100344331 Ga0097620_1003443312 172
131 3300009093 Ga0105240_10088669 Ga0105240_100886692 172
132 3300009093 Ga0105240_10884580 Ga0105240_108845801 172
133 3300009174 Ga0105241_10245181 Ga0105241_102451812 172
134 3300009174 Ga0105241_10394162 Ga0105241_103941621 172
135 3300009177 Ga0105248_10001462 Ga0105248_100014622 172
136 3300009177 Ga0105248_10359810 Ga0105248_103598102 172
137 3300009177 Ga0105248_10533444 Ga0105248_105334443 172
138 3300009545 Ga0105237_10000202 Ga0105237_1000020289 172
139 3300009545 Ga0105237_10008758 Ga0105237_100087585 172
140 3300009545 Ga0105237_10161918 Ga0105237_101619183 172
141 3300009551 Ga0105238_10001867 Ga0105238_1000186720 172
142 3300009551 Ga0105238_10017719 Ga0105238_100177195 172
143 3300009551 Ga0105238_10063962 Ga0105238_100639621 172
144 3300009553 Ga0105249_10002363 Ga0105249_100023636 172
145 3300010375 Ga0105239_10023410 Ga0105239_100234107 172
146 3300010375 Ga0105239_10216696 Ga0105239_102166962 172
147 3300010375 Ga0105239_10873933 Ga0105239_108739332 172
148 3300011119 Ga0105246_10061223 Ga0105246_100612232 172
149 3300013100 Ga0157373_10122400 Ga0157373_101224002 172
150 3300013100 Ga0157373_10569840 Ga0157373_105698402 172
151 3300013104 Ga0157370_10010975 Ga0157370_100109759 172
152 3300013104 Ga0157370_10013955 Ga0157370_100139552 172
153 3300013104 Ga0157370_10870333 Ga0157370_108703331 172
154 3300013105 Ga0157369_10000195 Ga0157369_1000019584 172
155 3300013105 Ga0157369_10377727 Ga0157369_103777271 172
156 3300013296 Ga0157374_10056986 Ga0157374_100569864 172
157 3300013297 Ga0157378_10549281 Ga0157378_105492812 172
158 3300013297 Ga0157378_10711924 Ga0157378_107119242 172
159 3300013306 Ga0163162_10000003 Ga0163162_10000003631 172
160 3300013306 Ga0163162_10000236 Ga0163162_1000023620 172
161 3300013306 Ga0163162_10371860 Ga0163162_103718602 172
162 3300013307 Ga0157372_10216413 Ga0157372_102164131 172
163 3300013308 Ga0157375_10066877 Ga0157375_100668772 172
164 3300014325 Ga0163163_10136376 Ga0163163_101363763 172
165 3300014326 Ga0157380_11679752 Ga0157380_116797521 172
166 3300014497 Ga0182008_10017736 Ga0182008_100177363 172
167 3300014497 Ga0182008_10054015 Ga0182008_100540153 172
168 3300014745 Ga0157377_10791270 Ga0157377_107912701 172
169 3300014968 Ga0157379_10089866 Ga0157379_100898663 172
170 3300014968 Ga0157379_10154459 Ga0157379_101544592 172
171 3300014969 Ga0157376_10000734 Ga0157376_1000073410 172
172 3300014969 Ga0157376_10402560 Ga0157376_104025602 172
173 3300015261 Ga0182006_1210691 Ga0182006_12106911 172
174 3300015262 Ga0182007_10004354 Ga0182007_100043542 172
175 3300015262 Ga0182007_10056763 Ga0182007_100567632 172
176 3300015262 Ga0182007_10077240 Ga0182007_100772402 172
177 3300015687 Ga0183368_1004 Ga0183368_1004255 172
178 3300020081 Ga0206354_10672385 Ga0206354_106723851 172
179 3300025226 Ga0209674_103668 Ga0209674_1036682 172
180 3300025228 Ga0209672_100237 Ga0209672_10023716 172
181 3300025231 Ga0207427_100040 Ga0207427_10004067 172
182 3300025231 Ga0207427_100115 Ga0207427_10011551 172
183 3300025231 Ga0207427_100130 Ga0207427_10013050 172
184 3300025233 Ga0209437_100020 Ga0209437_100020193 172
185 3300025233 Ga0209437_100079 Ga0209437_100079223 172
186 3300025233 Ga0209437_100172 Ga0209437_10017267 172
187 3300025242 Ga0209258_100246 Ga0209258_10024627 172
188 3300025242 Ga0209258_100806 Ga0209258_1008062 172
189 3300025246 Ga0209646_1000500 Ga0209646_10005008 172
190 3300025250 Ga0209026_1000105 Ga0209026_100010574 172
191 3300025250 Ga0209026_1001092 Ga0209026_10010923 172
192 3300025250 Ga0209026_1009956 Ga0209026_10099562 172
193 3300025254 Ga0209148_1000024 Ga0209148_1000024505 172
194 3300025256 Ga0209759_1000907 Ga0209759_10009074 172
195 3300025256 Ga0209759_1001941 Ga0209759_10019415 172
196 3300025256 Ga0209759_1017742 Ga0209759_10177422 172
197 3300025261 Ga0209233_1000020 Ga0209233_1000020432 172
198 3300025261 Ga0209233_1000108 Ga0209233_1000108159 172
199 3300025261 Ga0209233_1000121 Ga0209233_1000121180 172
200 3300025272 Ga0209455_1000025 Ga0209455_1000025505 172
201 3300025903 Ga0207680_10000006 Ga0207680_10000006444 172
202 3300025903 Ga0207680_10125419 Ga0207680_101254192 172
203 3300025907 Ga0207645_10008128 Ga0207645_100081286 172
204 3300025908 Ga0207643_10126130 Ga0207643_101261302 172
205 3300025909 Ga0207705_10031472 Ga0207705_100314722 172
206 3300025909 Ga0207705_11080398 Ga0207705_110803981 172
207 3300025911 Ga0207654_10000065 Ga0207654_1000006535 172
208 3300025911 Ga0207654_10025227 Ga0207654_100252274 172
209 3300025912 Ga0207707_10000641 Ga0207707_100006414 172
210 3300025913 Ga0207695_10009244 Ga0207695_100092443 172
211 3300025913 Ga0207695_10013791 Ga0207695_100137916 172
212 3300025913 Ga0207695_10595603 Ga0207695_105956032 172
213 3300025914 Ga0207671_10000726 Ga0207671_1000072630 172
214 3300025914 Ga0207671_10001709 Ga0207671_1000170920 172
215 3300025914 Ga0207671_10004311 Ga0207671_100043115 172
216 3300025920 Ga0207649_10184952 Ga0207649_101849522 172
217 3300025921 Ga0207652_11511933 Ga0207652_115119331 172
218 3300025924 Ga0207694_10000162 Ga0207694_100001622 172
219 3300025924 Ga0207694_10005909 Ga0207694_100059094 172
220 3300025924 Ga0207694_10031338 Ga0207694_100313383 172
221 3300025925 Ga0207650_10249151 Ga0207650_102491512 172
222 3300025926 Ga0207659_10189913 Ga0207659_101899131 172
223 3300025928 Ga0207700_10003472 Ga0207700_100034725 172
224 3300025929 Ga0207664_10003176 Ga0207664_100031763 172
225 3300025929 Ga0207664_10216281 Ga0207664_102162812 172
226 3300025932 Ga0207690_10318815 Ga0207690_103188152 172
227 3300025936 Ga0207670_10137570 Ga0207670_101375702 172
228 3300025938 Ga0207704_10004475 Ga0207704_100044756 172
229 3300025938 Ga0207704_10628631 Ga0207704_106286312 172
230 3300025940 Ga0207691_10063560 Ga0207691_100635604 172
231 3300025940 Ga0207691_11045615 Ga0207691_110456151 172
232 3300025941 Ga0207711_10007760 Ga0207711_100077602 172
233 3300025941 Ga0207711_10231908 Ga0207711_102319082 172
234 3300025941 Ga0207711_10345179 Ga0207711_103451793 172
235 3300025942 Ga0207689_10307716 Ga0207689_103077161 172
236 3300025949 Ga0207667_10320311 Ga0207667_103203111 172
237 3300025961 Ga0207712_10000677 Ga0207712_1000067720 172
238 3300025972 Ga0207668_10243186 Ga0207668_102431861 172
239 3300025981 Ga0207640_10017628 Ga0207640_100176284 172
240 3300025981 Ga0207640_10244153 Ga0207640_102441532 172
241 3300025981 Ga0207640_10559357 Ga0207640_105593572 172
242 3300025981 Ga0207640_10596196 Ga0207640_105961961 172
243 3300025986 Ga0207658_10000006 Ga0207658_10000006366 172
244 3300025986 Ga0207658_10112380 Ga0207658_101123803 172
245 3300026023 Ga0207677_10275189 Ga0207677_102751891 172
246 3300026041 Ga0207639_10000955 Ga0207639_100009553 172
247 3300026041 Ga0207639_10063785 Ga0207639_100637852 172
248 3300026041 Ga0207639_10243867 Ga0207639_102438673 172
249 3300026041 Ga0207639_10502276 Ga0207639_105022761 172
250 3300026041 Ga0207639_10661296 Ga0207639_106612962 172
251 3300026041 Ga0207639_10916584 Ga0207639_109165841 172
252 3300026041 Ga0207639_11078295 Ga0207639_110782951 172
253 3300026067 Ga0207678_10004860 Ga0207678_1000486012 172
254 3300026067 Ga0207678_10206327 Ga0207678_102063273 172
255 3300026078 Ga0207702_10028139 Ga0207702_100281393 172
256 3300026078 Ga0207702_10319521 Ga0207702_103195212 172
257 3300026088 Ga0207641_10185918 Ga0207641_101859183 172
258 3300026088 Ga0207641_10480936 Ga0207641_104809362 172
259 3300026095 Ga0207676_10020708 Ga0207676_100207084 172
260 3300026095 Ga0207676_10131613 Ga0207676_101316133 172
261 3300026116 Ga0207674_10014829 Ga0207674_100148293 172
262 3300026121 Ga0207683_10002105 Ga0207683_100021059 172
263 3300026121 Ga0207683_10003087 Ga0207683_1000308716 172
264 3300026121 Ga0207683_10178672 Ga0207683_101786722 172
265 3300026142 Ga0207698_10342443 Ga0207698_103424431 172
266 3300028379 Ga0268266_10000021 Ga0268266_10000021374 172
267 3300028379 Ga0268266_10058826 Ga0268266_100588262 172
268 3300028379 Ga0268266_10275366 Ga0268266_102753662 172
269 3300028379 Ga0268266_10516068 Ga0268266_105160682 172
270 3300028380 Ga0268265_10120047 Ga0268265_101200472 172
271 3300028381 Ga0268264_10009178 Ga0268264_100091781 172
272 3300028381 Ga0268264_10339490 Ga0268264_103394903 172
273 3300031238 Ga0265332_10110878 Ga0265332_101108782 172
274 3300031616 Ga0307508_10012852 Ga0307508_100128526 172
275 3300033180 Ga0307510_10014110 Ga0307510_100141106 172
276 3300035089 Ga0373944_0010152 Ga0373944_0010152_215_733 172
277 3300035117 Ga0373953_0161241 Ga0373953_0161241_284_802 172
278 3300035410 Ga0373924_0264281 Ga0373924_0264281_182_700 172
279 3300035724 Ga0373933_0203783 Ga0373933_0203783_110_628 172
280 3300036401 Ga0373937_0015568 Ga0373937_0015568_2141_2659 172
281 3300038443 Ga0395901_1101987 Ga0395901_1101987_131_652 172
282 3300039437 Ga0436365_1382606 Ga0436365_1382606_1184_1711 172
283 3300039437 Ga0436365_1829561 Ga0436365_1829561_178_705 172
284 3300041463 Ga0451804_0461783 Ga0451804_0461783_164_688 172
285 3300041486 Ga0451807_2640286 Ga0451807_2640286_884_1414 172
286 3300041509 Ga0451843_1653258 Ga0451843_1653258_640_1170 172
287 3300042005 Ga0439448_0125511 Ga0439448_0125511_156_677 172
288 3300044712 Ga0453684_0499313 Ga0453684_0499313_668_1195 172
289 3300046473 Ga0495582_0022480 Ga0495582_0022480_988_1506 172
290 3300046507 Ga0495606_0001000 Ga0495606_0001000_16830_17363 172
291 3300046535 Ga0495586_0135540 Ga0495586_0135540_574_1092 172
292 3300046678 Ga0495599_0669546 Ga0495599_0669546_18_536 172
293 3300046681 Ga0495647_0086713 Ga0495647_0086713_189_707 172
294 3300046683 Ga0495658_0006329 Ga0495658_0006329_3934_4452 172
295 3300046683 Ga0495658_0684504 Ga0495658_0684504_15_533 172
296 3300047322 Ga0495680_0215176 Ga0495680_0215176_643_1161 172
297 3300048905 Ga0496102_0359306 Ga0496102_0359306_389_919 172
298 3300048906 Ga0496103_0053287 Ga0496103_0053287_463_993 172
299 3300048907 Ga0496104_0000011 Ga0496104_0000011_234234_234752 172
300 3300048908 Ga0496105_0000071 Ga0496105_0000071_13387_13905 172
301 3300048918 Ga0496115_0000153 Ga0496115_0000153_22665_23192 172
302 3300048921 Ga0496118_0018115 Ga0496118_0018115_819_1349 172
303 3300048924 Ga0496121_0068082 Ga0496121_0068082_1902_2423 172
304 3300048925 Ga0496122_0001419 Ga0496122_0001419_18678_19199 172
305 3300048926 Ga0496123_0001240 Ga0496123_0001240_13048_13569 172
306 3300048929 Ga0496126_0000199 Ga0496126_0000199_62943_63470 172
307 3300048929 Ga0496126_0092387 Ga0496126_0092387_63_584 172
308 3300049459 Ga0495678_164343 Ga0495678_164343_46_579 172
309 3300049568 Ga0501031_0396754 Ga0501031_0396754_161_688 172
310 3300049569 Ga0501032_0002312 Ga0501032_0002312_5183_5710 172
311 3300049569 Ga0501032_0203665 Ga0501032_0203665_407_925 172
312 3300049570 Ga0501033_0002545 Ga0501033_0002545_669_1190 172
313 3300049570 Ga0501033_0005030 Ga0501033_0005030_5183_5710 172
314 3300049571 Ga0501034_0000462 Ga0501034_0000462_13834_14352 172
315 3300049571 Ga0501034_0008806 Ga0501034_0008806_4715_5242 172
316 3300049571 Ga0501034_0045875 Ga0501034_0045875_893_1411 172
317 3300049572 Ga0501036_0033157 Ga0501036_0033157_1210_1731 172
318 3300049572 Ga0501036_0038435 Ga0501036_0038435_1730_2257 172
319 3300049573 Ga0501037_0001246 Ga0501037_0001246_2910_3437 172
320 3300049573 Ga0501037_0164498 Ga0501037_0164498_671_1192 172
321 3300049573 Ga0501037_0169325 Ga0501037_0169325_544_1092 172
322 3300049574 Ga0501038_0001377 Ga0501038_0001377_5183_5710 172
323 3300049575 Ga0501039_0143013 Ga0501039_0143013_1058_1585 172
324 3300049575 Ga0501039_0567220 Ga0501039_0567220_197_718 172
325 3300049578 Ga0501042_0284719 Ga0501042_0284719_613_1137 172
326 3300049579 Ga0501043_0044929 Ga0501043_0044929_2269_2796 172
327 3300049580 Ga0501046_0006111 Ga0501046_0006111_10041_10568 172
328 3300049580 Ga0501046_0020493 Ga0501046_0020493_1202_1723 172
329 3300049581 Ga0501047_0000442 Ga0501047_0000442_3472_3990 172
330 3300049581 Ga0501047_0009516 Ga0501047_0009516_3190_3717 172
331 3300049581 Ga0501047_0564776 Ga0501047_0564776_324_842 172
332 3300049582 Ga0501048_0378663 Ga0501048_0378663_67_594 172
333 3300049586 Ga0501070_0007994 Ga0501070_0007994_3095_3613 172
334 3300049586 Ga0501070_0012356 Ga0501070_0012356_4172_4690 172
335 3300049589 Ga0501073_0013158 Ga0501073_0013158_4926_5453 172
336 3300049589 Ga0501073_0015900 Ga0501073_0015900_846_1364 172
337 3300049590 Ga0501074_0027269 Ga0501074_0027269_447_965 172
338 3300049590 Ga0501074_0028263 Ga0501074_0028263_3514_4032 172
339 3300049741 Ga0501079_0130892 Ga0501079_0130892_1058_1576 172
340 3300049742 Ga0501080_0010508 Ga0501080_0010508_2387_2905 172
341 3300049742 Ga0501080_0069799 Ga0501080_0069799_2614_3132 172
342 3300049742 Ga0501080_0245097 Ga0501080_0245097_274_795 172
343 3300049742 Ga0501080_0249898 Ga0501080_0249898_1075_1602 172
344 3300049742 Ga0501080_1048044 Ga0501080_1048044_95_616 172
345 3300049822 Ga0501035_0005822 Ga0501035_0005822_5913_6440 172
346 3300049822 Ga0501035_0438295 Ga0501035_0438295_543_1064 172
347 3300049823 Ga0501044_0048316 Ga0501044_0048316_3190_3717 172
348 3300053079 Ga0500610_0000123 Ga0500610_0000123_148_669 172
349 3300053087 Ga0500643_001529 Ga0500643_001529_843_1364 172
350 3300053094 Ga0500566_0078691 Ga0500566_0078691_1276_1794 172
351 3300055283 Ga0500661_003635 Ga0500661_003635_55_576 172
352 3300060353 Ga0501082_0254058 Ga0501082_0254058_297_815 172
353 3300060353 Ga0501082_0538245 Ga0501082_0538245_316_834 172
354 2162886007 SwRhRL2b_contig_3830080 SwRhRL2b_0142.00007830 173
355 3300001904 JGI24736J21556_1013939 JGI24736J21556_10139392 173
356 3300003316 rootH1_10040100 rootH1_100401002 173
357 3300003320 rootH2_10227379 rootH2_102273793 173
358 3300003323 rootH1_10150984 rootH1_101509841 173
359 3300005262 Ga0065165_1000001 Ga0065165_1000001194 173
360 3300005293 Ga0065715_10190471 Ga0065715_101904712 173
361 3300005327 Ga0070658_10033211 Ga0070658_100332114 173
362 3300005327 Ga0070658_10318006 Ga0070658_103180062 173
363 3300005328 Ga0070676_10256726 Ga0070676_102567261 173
364 3300005329 Ga0070683_100039765 Ga0070683_1000397655 173
365 3300005329 Ga0070683_100570161 Ga0070683_1005701612 173
366 3300005330 Ga0070690_100049423 Ga0070690_1000494233 173
367 3300005330 Ga0070690_100102383 Ga0070690_1001023832 173
368 3300005331 Ga0070670_100277141 Ga0070670_1002771412 173
369 3300005334 Ga0068869_100141183 Ga0068869_1001411833 173
370 3300005334 Ga0068869_100948339 Ga0068869_1009483391 173
371 3300005335 Ga0070666_10000109 Ga0070666_1000010943 173
372 3300005335 Ga0070666_10002838 Ga0070666_100028384 173
373 3300005335 Ga0070666_10259770 Ga0070666_102597703 173
374 3300005336 Ga0070680_100111346 Ga0070680_1001113463 173
375 3300005338 Ga0068868_100046371 Ga0068868_1000463712 173
376 3300005338 Ga0068868_100134985 Ga0068868_1001349853 173
377 3300005339 Ga0070660_100111133 Ga0070660_1001111333 173
378 3300005339 Ga0070660_101212630 Ga0070660_1012126301 173
379 3300005344 Ga0070661_100000840 Ga0070661_10000084020 173
380 3300005344 Ga0070661_100019824 Ga0070661_1000198244 173
381 3300005344 Ga0070661_100112784 Ga0070661_1001127842 173
382 3300005344 Ga0070661_100260185 Ga0070661_1002601852 173
383 3300005344 Ga0070661_100413944 Ga0070661_1004139441 173
384 3300005347 Ga0070668_100614023 Ga0070668_1006140231 173
385 3300005353 Ga0070669_100034776 Ga0070669_1000347762 173
386 3300005355 Ga0070671_100065196 Ga0070671_1000651964 173
387 3300005355 Ga0070671_100104112 Ga0070671_1001041122 173
388 3300005364 Ga0070673_100799579 Ga0070673_1007995791 173
389 3300005367 Ga0070667_100015468 Ga0070667_1000154684 173
390 3300005367 Ga0070667_100038266 Ga0070667_1000382663 173
391 3300005367 Ga0070667_100050855 Ga0070667_1000508552 173
392 3300005367 Ga0070667_100073428 Ga0070667_1000734284 173
393 3300005367 Ga0070667_100192722 Ga0070667_1001927223 173
394 3300005367 Ga0070667_100503208 Ga0070667_1005032081 173
395 3300005367 Ga0070667_100560384 Ga0070667_1005603842 173
396 3300005367 Ga0070667_100667310 Ga0070667_1006673101 173
397 3300005435 Ga0070714_100535247 Ga0070714_1005352472 173
398 3300005457 Ga0070662_100215387 Ga0070662_1002153873 173
399 3300005457 Ga0070662_100220665 Ga0070662_1002206651 173
400 3300005458 Ga0070681_10248744 Ga0070681_102487442 173
401 3300005458 Ga0070681_10268180 Ga0070681_102681804 173
402 3300005459 Ga0068867_100170221 Ga0068867_1001702213 173
403 3300005459 Ga0068867_100943849 Ga0068867_1009438491 173
404 3300005535 Ga0070684_100258913 Ga0070684_1002589133 173
405 3300005539 Ga0068853_100027763 Ga0068853_1000277634 173
406 3300005539 Ga0068853_100166264 Ga0068853_1001662641 173
407 3300005543 Ga0070672_101142998 Ga0070672_1011429981 173
408 3300005548 Ga0070665_100000057 Ga0070665_100000057203 173
409 3300005548 Ga0070665_100000838 Ga0070665_10000083826 173
410 3300005548 Ga0070665_100117114 Ga0070665_1001171144 173
411 3300005548 Ga0070665_100781849 Ga0070665_1007818492 173
412 3300005548 Ga0070665_101480519 Ga0070665_1014805191 173
413 3300005563 Ga0068855_100003960 Ga0068855_1000039608 173
414 3300005563 Ga0068855_100067485 Ga0068855_1000674854 173
415 3300005563 Ga0068855_100584817 Ga0068855_1005848172 173
416 3300005564 Ga0070664_100019492 Ga0070664_1000194926 173
417 3300005564 Ga0070664_100079048 Ga0070664_1000790483 173
418 3300005577 Ga0068857_100126595 Ga0068857_1001265953 173
419 3300005577 Ga0068857_100134512 Ga0068857_1001345123 173
420 3300005578 Ga0068854_100088088 Ga0068854_1000880883 173
421 3300005614 Ga0068856_100008809 Ga0068856_1000088094 173
422 3300005614 Ga0068856_100011032 Ga0068856_1000110326 173
423 3300005614 Ga0068856_100081913 Ga0068856_1000819134 173
424 3300005614 Ga0068856_100188138 Ga0068856_1001881383 173
425 3300005616 Ga0068852_100040124 Ga0068852_1000401241 173
426 3300005617 Ga0068859_100015799 Ga0068859_1000157994 173
427 3300005617 Ga0068859_101026992 Ga0068859_1010269921 173
428 3300005618 Ga0068864_101409508 Ga0068864_1014095082 173
429 3300005834 Ga0068851_10002611 Ga0068851_100026117 173
430 3300005834 Ga0068851_10470272 Ga0068851_104702722 173
431 3300005841 Ga0068863_100190876 Ga0068863_1001908762 173
432 3300005841 Ga0068863_100269277 Ga0068863_1002692772 173
433 3300005842 Ga0068858_100008089 Ga0068858_1000080897 173
434 3300005843 Ga0068860_100254503 Ga0068860_1002545031 173
435 3300005843 Ga0068860_100636891 Ga0068860_1006368912 173
436 3300005843 Ga0068860_101764052 Ga0068860_1017640521 173
437 3300005844 Ga0068862_100000354 Ga0068862_10000035435 173
438 3300005844 Ga0068862_100407715 Ga0068862_1004077151 173
439 3300005983 Ga0081540_1002130 Ga0081540_100213017 173
440 3300005985 Ga0081539_10082143 Ga0081539_100821432 173
441 3300006175 Ga0070712_100305876 Ga0070712_1003058762 173
442 3300006177 Ga0075362_10097059 Ga0075362_100970592 173
443 3300006237 Ga0097621_100021693 Ga0097621_1000216935 173
444 3300006237 Ga0097621_100023998 Ga0097621_1000239984 173
445 3300006237 Ga0097621_100053409 Ga0097621_1000534093 173
446 3300006237 Ga0097621_100240442 Ga0097621_1002404422 173
447 3300006237 Ga0097621_100652511 Ga0097621_1006525112 173
448 3300006358 Ga0068871_100045937 Ga0068871_1000459371 173
449 3300006358 Ga0068871_100093093 Ga0068871_1000930934 173
450 3300006358 Ga0068871_100877089 Ga0068871_1008770892 173
451 3300006881 Ga0068865_100025332 Ga0068865_1000253322 173
452 3300006881 Ga0068865_100318826 Ga0068865_1003188262 173
453 3300006931 Ga0097620_100015798 Ga0097620_1000157984 173
454 3300006931 Ga0097620_101027042 Ga0097620_1010270422 173
455 3300009093 Ga0105240_10015501 Ga0105240_100155017 173
456 3300009093 Ga0105240_10074524 Ga0105240_100745245 173
457 3300009093 Ga0105240_10095619 Ga0105240_100956193 173
458 3300009094 Ga0111539_10886538 Ga0111539_108865382 173
459 3300009101 Ga0105247_10165443 Ga0105247_101654432 173
460 3300009101 Ga0105247_10243910 Ga0105247_102439101 173
461 3300009174 Ga0105241_10009386 Ga0105241_100093862 173
462 3300009174 Ga0105241_10091566 Ga0105241_100915662 173
463 3300009174 Ga0105241_10656940 Ga0105241_106569401 173
464 3300009174 Ga0105241_10729508 Ga0105241_107295082 173
465 3300009174 Ga0105241_10952460 Ga0105241_109524602 173
466 3300009176 Ga0105242_10047025 Ga0105242_100470253 173
467 3300009176 Ga0105242_11013304 Ga0105242_110133042 173
468 3300009177 Ga0105248_10038118 Ga0105248_100381184 173
469 3300009177 Ga0105248_10401968 Ga0105248_104019682 173
470 3300009177 Ga0105248_10531864 Ga0105248_105318641 173
471 3300009177 Ga0105248_10790463 Ga0105248_107904632 173
472 3300009545 Ga0105237_10018893 Ga0105237_100188933 173
473 3300009545 Ga0105237_10020473 Ga0105237_100204735 173
474 3300009545 Ga0105237_10055037 Ga0105237_100550374 173
475 3300009545 Ga0105237_10166841 Ga0105237_101668412 173
476 3300009545 Ga0105237_10311236 Ga0105237_103112363 173
477 3300009545 Ga0105237_10516804 Ga0105237_105168042 173
478 3300009545 Ga0105237_10582001 Ga0105237_105820012 173
479 3300009551 Ga0105238_10032357 Ga0105238_100323572 173
480 3300009551 Ga0105238_10099145 Ga0105238_100991454 173
481 3300009551 Ga0105238_10134714 Ga0105238_101347144 173
482 3300009551 Ga0105238_10269754 Ga0105238_102697542 173
483 3300009553 Ga0105249_10008901 Ga0105249_100089012 173
484 3300010375 Ga0105239_10019312 Ga0105239_100193129 173
485 3300010375 Ga0105239_10161115 Ga0105239_101611153 173
486 3300010375 Ga0105239_10203852 Ga0105239_102038522 173
487 3300010375 Ga0105239_10205582 Ga0105239_102055822 173
488 3300010375 Ga0105239_10392182 Ga0105239_103921822 173
489 3300010375 Ga0105239_10410468 Ga0105239_104104682 173
490 3300011119 Ga0105246_10027734 Ga0105246_100277343 173
491 3300012513 Ga0157326_1016886 Ga0157326_10168862 173
492 3300013100 Ga0157373_10014849 Ga0157373_100148493 173
493 3300013102 Ga0157371_10003647 Ga0157371_100036476 173
494 3300013102 Ga0157371_10014602 Ga0157371_100146024 173
495 3300013102 Ga0157371_10028462 Ga0157371_100284624 173
496 3300013104 Ga0157370_10125618 Ga0157370_101256183 173
497 3300013104 Ga0157370_10171705 Ga0157370_101717054 173
498 3300013104 Ga0157370_10997638 Ga0157370_109976381 173
499 3300013105 Ga0157369_10004547 Ga0157369_1000454711 173
500 3300013105 Ga0157369_10012799 Ga0157369_100127992 173
501 3300013105 Ga0157369_10209993 Ga0157369_102099933 173
502 3300013296 Ga0157374_10011793 Ga0157374_100117933 173
503 3300013296 Ga0157374_10284900 Ga0157374_102849004 173
504 3300013297 Ga0157378_10045866 Ga0157378_100458663 173
505 3300013297 Ga0157378_10595795 Ga0157378_105957952 173
506 3300013307 Ga0157372_10005441 Ga0157372_1000544114 173
507 3300013307 Ga0157372_10007019 Ga0157372_100070195 173
508 3300013307 Ga0157372_10019326 Ga0157372_100193268 173
509 3300013307 Ga0157372_11797896 Ga0157372_117978961 173
510 3300013308 Ga0157375_10080866 Ga0157375_100808662 173
511 3300013308 Ga0157375_10361666 Ga0157375_103616662 173
512 3300014325 Ga0163163_10000196 Ga0163163_1000019620 173
513 3300014325 Ga0163163_10381420 Ga0163163_103814202 173
514 3300014326 Ga0157380_11007094 Ga0157380_110070941 173
515 3300014968 Ga0157379_10266710 Ga0157379_102667103 173
516 3300014968 Ga0157379_10345633 Ga0157379_103456332 173
517 3300014969 Ga0157376_10101988 Ga0157376_101019883 173
518 3300014969 Ga0157376_10264663 Ga0157376_102646632 173
519 3300015265 Ga0182005_1000004 Ga0182005_1000004329 173
520 3300017792 Ga0163161_10002464 Ga0163161_100024646 173
521 3300025302 Ga0207426_1017394 Ga0207426_10173943 173
522 3300025304 Ga0209257_1000145 Ga0209257_100014569 173
523 3300025321 Ga0207656_10000750 Ga0207656_100007509 173
524 3300025321 Ga0207656_10072651 Ga0207656_100726512 173
525 3300025903 Ga0207680_10010093 Ga0207680_100100934 173
526 3300025903 Ga0207680_10151500 Ga0207680_101515002 173
527 3300025904 Ga0207647_10000091 Ga0207647_1000009148 173
528 3300025904 Ga0207647_10002917 Ga0207647_100029175 173
529 3300025907 Ga0207645_10042438 Ga0207645_100424382 173
530 3300025909 Ga0207705_10500109 Ga0207705_105001093 173
531 3300025911 Ga0207654_10020184 Ga0207654_100201843 173
532 3300025911 Ga0207654_10044869 Ga0207654_100448694 173
533 3300025911 Ga0207654_10095886 Ga0207654_100958864 173
534 3300025911 Ga0207654_10445749 Ga0207654_104457492 173
535 3300025912 Ga0207707_10052739 Ga0207707_100527394 173
536 3300025912 Ga0207707_10245050 Ga0207707_102450502 173
537 3300025913 Ga0207695_10001492 Ga0207695_1000149234 173
538 3300025913 Ga0207695_10010430 Ga0207695_100104308 173
539 3300025913 Ga0207695_10058089 Ga0207695_100580894 173
540 3300025913 Ga0207695_10112306 Ga0207695_101123063 173
541 3300025914 Ga0207671_10011034 Ga0207671_100110344 173
542 3300025914 Ga0207671_10042128 Ga0207671_100421283 173
543 3300025914 Ga0207671_10068319 Ga0207671_100683192 173
544 3300025914 Ga0207671_10247644 Ga0207671_102476442 173
545 3300025914 Ga0207671_10505242 Ga0207671_105052422 173
546 3300025914 Ga0207671_10776506 Ga0207671_107765061 173
547 3300025917 Ga0207660_10297938 Ga0207660_102979383 173
548 3300025919 Ga0207657_10003100 Ga0207657_1000310014 173
549 3300025920 Ga0207649_10000447 Ga0207649_1000044717 173
550 3300025920 Ga0207649_10054552 Ga0207649_100545521 173
551 3300025923 Ga0207681_10387327 Ga0207681_103873271 173
552 3300025923 Ga0207681_10649757 Ga0207681_106497571 173
553 3300025923 Ga0207681_11068835 Ga0207681_110688351 173
554 3300025924 Ga0207694_10010020 Ga0207694_100100204 173
555 3300025924 Ga0207694_10046795 Ga0207694_100467953 173
556 3300025924 Ga0207694_10135584 Ga0207694_101355842 173
557 3300025925 Ga0207650_10012333 Ga0207650_100123336 173
558 3300025925 Ga0207650_10625677 Ga0207650_106256771 173
559 3300025927 Ga0207687_10381976 Ga0207687_103819763 173
560 3300025931 Ga0207644_10019889 Ga0207644_100198896 173
561 3300025931 Ga0207644_10603820 Ga0207644_106038202 173
562 3300025931 Ga0207644_10719428 Ga0207644_107194282 173
563 3300025933 Ga0207706_10001761 Ga0207706_100017617 173
564 3300025933 Ga0207706_10070574 Ga0207706_100705743 173
565 3300025934 Ga0207686_10902852 Ga0207686_109028521 173
566 3300025938 Ga0207704_10101378 Ga0207704_101013782 173
567 3300025938 Ga0207704_10259950 Ga0207704_102599502 173
568 3300025941 Ga0207711_10036542 Ga0207711_100365422 173
569 3300025942 Ga0207689_10056528 Ga0207689_100565283 173
570 3300025942 Ga0207689_10112245 Ga0207689_101122452 173
571 3300025942 Ga0207689_10224681 Ga0207689_102246812 173
572 3300025942 Ga0207689_10343794 Ga0207689_103437943 173
573 3300025944 Ga0207661_10042331 Ga0207661_100423314 173
574 3300025944 Ga0207661_11379533 Ga0207661_113795331 173
575 3300025945 Ga0207679_10091567 Ga0207679_100915673 173
576 3300025945 Ga0207679_10238823 Ga0207679_102388231 173
577 3300025949 Ga0207667_10017535 Ga0207667_100175358 173
578 3300025949 Ga0207667_10049480 Ga0207667_100494804 173
579 3300025949 Ga0207667_10592568 Ga0207667_105925682 173
580 3300025949 Ga0207667_10684266 Ga0207667_106842662 173
581 3300025960 Ga0207651_10493077 Ga0207651_104930771 173
582 3300025961 Ga0207712_10000354 Ga0207712_1000035427 173
583 3300025972 Ga0207668_10139484 Ga0207668_101394841 173
584 3300025972 Ga0207668_10647632 Ga0207668_106476322 173
585 3300025981 Ga0207640_10143997 Ga0207640_101439973 173
586 3300025981 Ga0207640_10200658 Ga0207640_102006583 173
587 3300025986 Ga0207658_10017811 Ga0207658_100178113 173
588 3300025986 Ga0207658_10035782 Ga0207658_100357823 173
589 3300025986 Ga0207658_10093763 Ga0207658_100937632 173
590 3300025986 Ga0207658_10193339 Ga0207658_101933393 173
591 3300025986 Ga0207658_10510794 Ga0207658_105107941 173
592 3300025986 Ga0207658_10537771 Ga0207658_105377712 173
593 3300026035 Ga0207703_10008155 Ga0207703_100081556 173
594 3300026035 Ga0207703_10238645 Ga0207703_102386453 173
595 3300026035 Ga0207703_11469480 Ga0207703_114694801 173
596 3300026041 Ga0207639_10001472 Ga0207639_1000147210 173
597 3300026041 Ga0207639_10006738 Ga0207639_100067385 173
598 3300026067 Ga0207678_10019625 Ga0207678_100196254 173
599 3300026067 Ga0207678_11107666 Ga0207678_111076662 173
600 3300026078 Ga0207702_10009340 Ga0207702_100093404 173
601 3300026078 Ga0207702_10080298 Ga0207702_100802983 173
602 3300026078 Ga0207702_11347938 Ga0207702_113479381 173
603 3300026088 Ga0207641_10283783 Ga0207641_102837833 173
604 3300026089 Ga0207648_10082156 Ga0207648_100821562 173
605 3300026089 Ga0207648_10801246 Ga0207648_108012461 173
606 3300026095 Ga0207676_10547304 Ga0207676_105473042 173
607 3300026116 Ga0207674_10002998 Ga0207674_100029988 173
608 3300026116 Ga0207674_10045181 Ga0207674_100451813 173
609 3300026118 Ga0207675_100085274 Ga0207675_1000852742 173
610 3300026121 Ga0207683_10413038 Ga0207683_104130382 173
611 3300026142 Ga0207698_10037983 Ga0207698_100379833 173
612 3300026142 Ga0207698_10103822 Ga0207698_101038223 173
613 3300026142 Ga0207698_11122631 Ga0207698_111226311 173
614 3300028379 Ga0268266_10000001 Ga0268266_100000012834 173
615 3300028379 Ga0268266_10000006 Ga0268266_10000006316 173
616 3300028379 Ga0268266_10031052 Ga0268266_100310525 173
617 3300028379 Ga0268266_10051990 Ga0268266_100519902 173
618 3300028379 Ga0268266_10080418 Ga0268266_100804183 173
619 3300028380 Ga0268265_10002801 Ga0268265_1000280112 173
620 3300028381 Ga0268264_10107393 Ga0268264_101073932 173
621 3300031730 Ga0307516_10136241 Ga0307516_101362413 173
622 3300031731 Ga0307405_10197212 Ga0307405_101972122 173
623 3300031731 Ga0307405_10268704 Ga0307405_102687042 173
624 3300031903 Ga0307407_10228419 Ga0307407_102284192 173
625 3300031911 Ga0307412_10186234 Ga0307412_101862342 173
626 3300031995 Ga0307409_100104473 Ga0307409_1001044732 173
627 3300032004 Ga0307414_10163842 Ga0307414_101638421 173
628 3300032004 Ga0307414_10251535 Ga0307414_102515352 173
629 3300033179 Ga0307507_10322001 Ga0307507_103220011 173
630 3300037418 Ga0395900_0193227 Ga0395900_0193227_1310_1858 173
631 3300037471 Ga0395905_0000577 Ga0395905_0000577_3479_4027 173
632 3300038443 Ga0395901_0080831 Ga0395901_0080831_1987_2535 173
633 3300038443 Ga0395901_0501959 Ga0395901_0501959_517_1065 173
634 3300041441 Ga0451787_313061 Ga0451787_313061_84_878 173
635 3300041443 Ga0451789_0232468 Ga0451789_0232468_397_921 173
636 3300041451 Ga0451791_1139757 Ga0451791_1139757_439_963 173
637 3300041452 Ga0451793_0324997 Ga0451793_0324997_864_1388 173
638 3300041458 Ga0451798_1175536 Ga0451798_1175536_56_580 173
639 3300041460 Ga0451802_1618475 Ga0451802_1618475_467_1168 173
640 3300041462 Ga0451806_196532 Ga0451806_196532_151_675 173
641 3300041463 Ga0451804_0515953 Ga0451804_0515953_235_759 173
642 3300041486 Ga0451807_1293046 Ga0451807_1293046_151_681 173
643 3300041494 Ga0451837_0354769 Ga0451837_0354769_70_597 173
644 3300041494 Ga0451837_1800117 Ga0451837_1800117_24_572 173
645 3300041496 Ga0451839_1321482 Ga0451839_1321482_358_882 173
646 3300041509 Ga0451843_0934667 Ga0451843_0934667_463_1011 173
647 3300041512 Ga0451853_3308297 Ga0451853_3308297_227_751 173
648 3300042007 Ga0439449_0103205 Ga0439449_0103205_291_821 173
649 3300042438 Ga0439459_0001975 Ga0439459_0001975_1114_1638 173
650 3300044765 Ga0466970_0007619 Ga0466970_0007619_3865_4389 173
651 3300046460 Ga0495638_0000063 Ga0495638_0000063_102654_103178 173
652 3300046460 Ga0495638_0064037 Ga0495638_0064037_414_938 173
653 3300046471 Ga0495650_0002554 Ga0495650_0002554_3057_3581 173
654 3300046501 Ga0495607_0000003 Ga0495607_0000003_77555_78079 173
655 3300046507 Ga0495606_0015836 Ga0495606_0015836_749_1273 173
656 3300046507 Ga0495606_0031819 Ga0495606_0031819_1613_2137 173
657 3300046512 Ga0495610_0021270 Ga0495610_0021270_2639_3163 173
658 3300046512 Ga0495610_0115460 Ga0495610_0115460_72_596 173
659 3300046513 Ga0495616_0183344 Ga0495616_0183344_70_600 173
660 3300046515 Ga0495620_0008202 Ga0495620_0008202_4601_5125 173
661 3300046518 Ga0495631_0003861 Ga0495631_0003861_3275_3799 173
662 3300046519 Ga0495632_0000011 Ga0495632_0000011_150451_150999 173
663 3300046519 Ga0495632_0019552 Ga0495632_0019552_1912_2436 173
664 3300046524 Ga0495648_0025746 Ga0495648_0025746_3096_3620 173
665 3300046557 Ga0495622_0062103 Ga0495622_0062103_248_772 173
666 3300046558 Ga0495633_0189155 Ga0495633_0189155_63_599 173
667 3300046648 Ga0495611_0000068 Ga0495611_0000068_36040_36564 173
668 3300046660 Ga0495625_0054963 Ga0495625_0054963_1921_2445 173
669 3300046660 Ga0495625_0088678 Ga0495625_0088678_1041_1565 173
670 3300047318 Ga0495636_0000522 Ga0495636_0000522_6223_6753 173
671 3300047469 Ga0495673_0000229 Ga0495673_0000229_905_1429 173
672 3300047472 Ga0495686_0000037 Ga0495686_0000037_295426_295950 173
673 3300047472 Ga0495686_0037360 Ga0495686_0037360_1962_2486 173
674 3300048904 Ga0496101_0007405 Ga0496101_0007405_4286_4810 173
675 3300048904 Ga0496101_0207430 Ga0496101_0207430_482_1030 173
676 3300048905 Ga0496102_1544009 Ga0496102_1544009_28_552 173
677 3300048908 Ga0496105_0349928 Ga0496105_0349928_425_952 173
678 3300048911 Ga0496108_0471812 Ga0496108_0471812_31_579 173
679 3300048912 Ga0496109_0174386 Ga0496109_0174386_899_1447 173
680 3300048915 Ga0496112_0891872 Ga0496112_0891872_10_558 173
681 3300048917 Ga0496114_0383774 Ga0496114_0383774_99_623 173
682 3300048918 Ga0496115_0119821 Ga0496115_0119821_1214_1738 173
683 3300048919 Ga0496116_0162714 Ga0496116_0162714_276_800 173
684 3300048920 Ga0496117_0005879 Ga0496117_0005879_2751_3278 173
685 3300048921 Ga0496118_0000362 Ga0496118_0000362_9316_9843 173
686 3300048922 Ga0496119_0000851 Ga0496119_0000851_28846_29367 173
687 3300048922 Ga0496119_0024644 Ga0496119_0024644_3636_4160 173
688 3300048923 Ga0496120_0001387 Ga0496120_0001387_17979_18500 173
689 3300048924 Ga0496121_0253006 Ga0496121_0253006_494_1015 173
690 3300048925 Ga0496122_0012114 Ga0496122_0012114_395_922 173
691 3300048925 Ga0496122_0013791 Ga0496122_0013791_1715_2245 173
692 3300048925 Ga0496122_0045754 Ga0496122_0045754_1872_2396 173
693 3300048926 Ga0496123_0033997 Ga0496123_0033997_537_1061 173
694 3300048926 Ga0496123_0050317 Ga0496123_0050317_394_921 173
695 3300048926 Ga0496123_0377951 Ga0496123_0377951_50_577 173
696 3300048927 Ga0496124_0000893 Ga0496124_0000893_27428_27952 173
697 3300048927 Ga0496124_0015807 Ga0496124_0015807_2060_2587 173
698 3300048928 Ga0496125_0065237 Ga0496125_0065237_1444_1971 173
699 3300048928 Ga0496125_0252505 Ga0496125_0252505_460_981 173
700 3300048929 Ga0496126_0361429 Ga0496126_0361429_403_924 173
701 3300049568 Ga0501031_0039849 Ga0501031_0039849_2069_2596 173
702 3300049569 Ga0501032_0002816 Ga0501032_0002816_10991_11518 173
703 3300049569 Ga0501032_0352007 Ga0501032_0352007_39_566 173
704 3300049570 Ga0501033_0000329 Ga0501033_0000329_28785_29312 173
705 3300049570 Ga0501033_0113682 Ga0501033_0113682_295_819 173
706 3300049570 Ga0501033_0149050 Ga0501033_0149050_79_726 173
707 3300049571 Ga0501034_0005495 Ga0501034_0005495_43_591 173
708 3300049571 Ga0501034_0009780 Ga0501034_0009780_1703_2230 173
709 3300049571 Ga0501034_0245487 Ga0501034_0245487_693_1220 173
710 3300049571 Ga0501034_1127123 Ga0501034_1127123_62_586 173
711 3300049572 Ga0501036_0008335 Ga0501036_0008335_4746_5273 173
712 3300049573 Ga0501037_0000815 Ga0501037_0000815_6771_7298 173
713 3300049573 Ga0501037_0169510 Ga0501037_0169510_897_1424 173
714 3300049574 Ga0501038_0003503 Ga0501038_0003503_1370_1897 173
715 3300049574 Ga0501038_0069785 Ga0501038_0069785_1833_2360 173
716 3300049575 Ga0501039_0006941 Ga0501039_0006941_4198_4725 173
717 3300049575 Ga0501039_0896089 Ga0501039_0896089_121_648 173
718 3300049578 Ga0501042_0129517 Ga0501042_0129517_989_1516 173
719 3300049579 Ga0501043_0018924 Ga0501043_0018924_1158_1685 173
720 3300049580 Ga0501046_0004658 Ga0501046_0004658_7108_7635 173
721 3300049580 Ga0501046_0062606 Ga0501046_0062606_1679_2206 173
722 3300049581 Ga0501047_0039527 Ga0501047_0039527_316_843 173
723 3300049581 Ga0501047_0135765 Ga0501047_0135765_1311_1838 173
724 3300049581 Ga0501047_0371243 Ga0501047_0371243_181_705 173
725 3300049582 Ga0501048_0011657 Ga0501048_0011657_6013_6537 173
726 3300049582 Ga0501048_0089741 Ga0501048_0089741_1515_2042 173
727 3300049583 Ga0501067_0040303 Ga0501067_0040303_61_588 173
728 3300049583 Ga0501067_0270395 Ga0501067_0270395_179_706 173
729 3300049584 Ga0501068_0061005 Ga0501068_0061005_62_589 173
730 3300049584 Ga0501068_0101517 Ga0501068_0101517_718_1245 173
731 3300049585 Ga0501069_0123731 Ga0501069_0123731_661_1188 173
732 3300049586 Ga0501070_0019143 Ga0501070_0019143_4652_5179 173
733 3300049586 Ga0501070_0379252 Ga0501070_0379252_154_798 173
734 3300049586 Ga0501070_0513722 Ga0501070_0513722_401_928 173
735 3300049587 Ga0501071_0008690 Ga0501071_0008690_782_1309 173
736 3300049587 Ga0501071_0040952 Ga0501071_0040952_2285_2812 173
737 3300049588 Ga0501072_0096613 Ga0501072_0096613_1106_1753 173
738 3300049589 Ga0501073_0008238 Ga0501073_0008238_4141_4668 173
739 3300049589 Ga0501073_0032725 Ga0501073_0032725_1627_2154 173
740 3300049589 Ga0501073_0135137 Ga0501073_0135137_523_1050 173
741 3300049590 Ga0501074_0042555 Ga0501074_0042555_1840_2367 173
742 3300049592 Ga0501076_0561196 Ga0501076_0561196_63_590 173
743 3300049674 Ga0501242_006330 Ga0501242_006330_783_1331 173
744 3300049675 Ga0501243_012743 Ga0501243_012743_152_700 173
745 3300049683 Ga0501253_045559 Ga0501253_045559_73_621 173
746 3300049686 Ga0501257_058346 Ga0501257_058346_17_565 173
747 3300049708 Ga0501245_009677 Ga0501245_009677_134_682 173
748 3300049741 Ga0501079_0126479 Ga0501079_0126479_50_577 173
749 3300049741 Ga0501079_1056387 Ga0501079_1056387_65_592 173
750 3300049742 Ga0501080_0749441 Ga0501080_0749441_22_549 173
751 3300049742 Ga0501080_0924075 Ga0501080_0924075_50_577 173
752 3300049743 Ga0501081_0073885 Ga0501081_0073885_72_599 173
753 3300049744 Ga0501083_0070334 Ga0501083_0070334_1580_2107 173
754 3300049763 Ga0501266_023267 Ga0501266_023267_115_663 173
755 3300049822 Ga0501035_0130250 Ga0501035_0130250_1037_1564 173
756 3300049822 Ga0501035_0380373 Ga0501035_0380373_359_883 173
757 3300049823 Ga0501044_0029625 Ga0501044_0029625_1524_2051 173
758 3300049823 Ga0501044_0159940 Ga0501044_0159940_1657_2184 173
759 3300049823 Ga0501044_0188919 Ga0501044_0188919_561_1085 173
760 3300049823 Ga0501044_0346733 Ga0501044_0346733_34_654 173
761 3300049824 Ga0501045_0088995 Ga0501045_0088995_78_605 173
762 3300050491 nmdc:mga00v17_26539_c1 nmdc:mga00v17_26539_c1_449_997 173
763 3300053093 Ga0500651_0108545 Ga0500651_0108545_1037_1561 173
764 3300053139 Ga0500568_0000145 Ga0500568_0000145_32510_33034 173
765 3300053155 Ga0500620_007813 Ga0500620_007813_834_1358 173
766 3300053160 Ga0500633_0006033 Ga0500633_0006033_2219_2743 173
767 3300054114 Ga0501084_0305625 Ga0501084_0305625_279_806 173
768 3300060353 Ga0501082_0000082 Ga0501082_0000082_29208_29729 173
769 3300060353 Ga0501082_0132506 Ga0501082_0132506_1043_1687 173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06052

3-HAO

3-hydroxyanthranilic acid dioxygenase

41

192

0.98

PF07883

Cupin_2

Cupin domain

75

142

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v26-assembly1.cif.gz_A 1.78 angstrom crystal structure of p97h 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans 0.9466 1 166
4hvq-assembly1.cif.gz_A x-ray crystal structure of fecu reconstituted 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans 0.9437 1 149
6bvp-assembly1.cif.gz_A crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase n27a from cupriavidus metallidurans 0.9423 3 166
5v28-assembly1.cif.gz_A 2.72 angstrom crystal structure of p97a 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans 0.9368 1 166
5v27-assembly1.cif.gz_A 2.35 angstrom crystal structure of p97v 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans 0.9364 1 166
ID Description Score Start End Superfamily
af_Q59K86_4_170_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9642 3 165 2.60.120.10
af_Q54S02_3_181_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9543 4 169 2.60.120.10
4hvqA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9437 1 149 2.60.120.10
1yfuA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.942 7 166 2.60.120.10
af_Q59K86_4_170_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9362 3 165 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A6P7X5F2-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase-like 0.9997 36 117 GO:0000334
GO:0005506
GO:0005737
GO:0034354
GO:0046874
AF-A0A7F8RKZ4-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase 0.9922 2 117 GO:0000334
GO:0005506
GO:0005737
GO:0034354
GO:0046874
AF-A0A7W1FBJ5-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) 0.985 26 149 GO:0000334
GO:0005506
GO:0019363
AF-A0A142EKN5-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) (3-hydroxyanthranilate oxygenase) (3-HAO) (3-hydroxyanthranilic acid dioxygenase) (HAD) 0.9833 1 167 GO:0000334
GO:0005737
GO:0006569
GO:0008198
GO:0019805
GO:0034354
GO:0043420
AF-A0A2T0WT71-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) (3-hydroxyanthranilate oxygenase) (3-HAO) (3-hydroxyanthranilic acid dioxygenase) (HAD) 0.9814 1 168 GO:0000334
GO:0006569
GO:0008198
GO:0016020
GO:0019805
GO:0034354
GO:0043420

Feature Viewer

pLDDT pTM Quality
93.99 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map