F479982

General Info

Members Datasets Scaffolds Average Seq Length
769 302 1538 95

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_101491466|Ga0068852_1014914662
Length 113
Sequence MAITREDVLHVARLARLEIPEGEVDRVRDELGAILEAVGKVAELDLSDVEPTSHPLAVVNVWAEDEPRPSLSREDALANAPDPVDGAFRVRRSARERFTLSCRSARHGRAFPR

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
159 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
160 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
194 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
195 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
196 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
199 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
200 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
201 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
202 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
203 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
204 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
214 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
215 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
218 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
232 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
235 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
236 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 5.85
Rhizosphere 93.63
Stem 0
Stem Tuber 0
Unclassified 5.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_101491466 3300005616 Bacteria 698
2 JGI25406J46586_10030110 3300003203 Bacteria 2046
3 JGI25406J46586_10080228 3300003203 Bacteria 1002
4 Ga0070676_10208442 3300005328 Bacteria 1285
5 Ga0070676_10755961 3300005328 Unclassified 714
6 Ga0070683_101136103 3300005329 Bacteria 750
7 Ga0070690_100960011 3300005330 Bacteria 671
8 Ga0068869_100140946 3300005334 Bacteria 1861
9 Ga0068869_100652395 3300005334 Bacteria 893
10 Ga0068869_100946328 3300005334 Bacteria 747
11 Ga0070680_100384828 3300005336 Bacteria 1195
12 Ga0068868_100166839 3300005338 Bacteria 1821
13 Ga0068868_100347501 3300005338 Bacteria 1270
14 Ga0068868_101863457 3300005338 Bacteria 569
15 Ga0070689_100571713 3300005340 Bacteria 976
16 Ga0070691_10067556 3300005341 Bacteria 1729
17 Ga0070691_10622286 3300005341 Bacteria 639
18 Ga0070687_100267132 3300005343 Bacteria 1071
19 Ga0070687_100325431 3300005343 Bacteria 984
20 Ga0070692_10039981 3300005345 Bacteria 2396
21 Ga0070692_10368552 3300005345 Bacteria 897
22 Ga0070692_10445284 3300005345 Bacteria 828
23 Ga0070692_10700292 3300005345 Bacteria 681
24 Ga0070692_11177594 3300005345 Bacteria 545
25 Ga0070668_100454640 3300005347 Bacteria 1101
26 Ga0070669_100338007 3300005353 Bacteria 1219
27 Ga0070675_100288084 3300005354 Bacteria 1445
28 Ga0070674_100171735 3300005356 Bacteria 1653
29 Ga0070674_100177059 3300005356 Bacteria 1630
30 Ga0070674_100202903 3300005356 Bacteria 1532
31 Ga0070688_101195051 3300005365 Bacteria 611
32 Ga0070659_100316764 3300005366 Bacteria 1303
33 Ga0070659_100935334 3300005366 Bacteria 759
34 Ga0070703_10167374 3300005406 Bacteria 839
35 Ga0070709_11021303 3300005434 Bacteria 658
36 Ga0070709_11587847 3300005434 Bacteria 532
37 Ga0070714_100241768 3300005435 Bacteria 1666
38 Ga0070714_100516637 3300005435 Bacteria 1140
39 Ga0070713_100119495 3300005436 Bacteria 2309
40 Ga0070710_10026228 3300005437 Bacteria 3094
41 Ga0070710_10058435 3300005437 Bacteria 2187
42 Ga0070710_10128629 3300005437 Bacteria 1541
43 Ga0070710_10603364 3300005437 Bacteria 764
44 Ga0070701_10078981 3300005438 Bacteria 1777
45 Ga0070701_10495033 3300005438 Bacteria 792
46 Ga0070711_100012812 3300005439 Bacteria 5252
47 Ga0070711_100070845 3300005439 Bacteria 2456
48 Ga0070711_100816826 3300005439 Bacteria 791
49 Ga0070711_101085655 3300005439 Bacteria 689
50 Ga0070711_101621506 3300005439 Unclassified 566
51 Ga0070705_100392122 3300005440 Bacteria 1025
52 Ga0070705_101241534 3300005440 Bacteria 615
53 Ga0070700_100066550 3300005441 Bacteria 2287
54 Ga0070694_100092625 3300005444 Archaea 2123
55 Ga0070694_100100916 3300005444 Bacteria 2042
56 Ga0070708_101064881 3300005445 Unclassified 758
57 Ga0070708_101206439 3300005445 Bacteria 708
58 Ga0070663_100208955 3300005455 Bacteria 1527
59 Ga0070662_100880404 3300005457 Bacteria 763
60 Ga0070662_101421692 3300005457 Bacteria 598
61 Ga0070681_11380559 3300005458 Unclassified 628
62 Ga0068867_100162795 3300005459 Bacteria 1760
63 Ga0068867_100241403 3300005459 Bacteria 1465
64 Ga0068867_101869727 3300005459 Bacteria 566
65 Ga0070685_10111310 3300005466 Bacteria 1687
66 Ga0070706_100266575 3300005467 Bacteria 1598
67 Ga0070706_100461713 3300005467 Bacteria 1181
68 Ga0070706_100462501 3300005467 Bacteria 1180
69 Ga0070706_100870387 3300005467 Bacteria 833
70 Ga0070707_100006447 3300005468 Bacteria 10907
71 Ga0070707_100640432 3300005468 Bacteria 1025
72 Ga0070707_101270551 3300005468 Bacteria 702
73 Ga0070698_100003138 3300005471 Bacteria 18207
74 Ga0070698_100419503 3300005471 Bacteria 1272
75 Ga0070698_101054180 3300005471 Unclassified 761
76 Ga0070698_101885836 3300005471 Bacteria 551
77 Ga0070698_101926596 3300005471 Bacteria 544
78 Ga0070699_100130470 3300005518 Bacteria 2216
79 Ga0070699_100145670 3300005518 Bacteria 2092
80 Ga0070699_100761226 3300005518 Bacteria 886
81 Ga0070679_100862417 3300005530 Bacteria 849
82 Ga0070679_101055190 3300005530 Bacteria 757
83 Ga0070684_100248859 3300005535 Bacteria 1624
84 Ga0070684_101246665 3300005535 Bacteria 699
85 Ga0070697_100134724 3300005536 Bacteria 2074
86 Ga0070697_100596586 3300005536 Bacteria 970
87 Ga0070697_100623406 3300005536 Bacteria 949
88 Ga0070697_100775568 3300005536 Bacteria 848
89 Ga0070697_101460167 3300005536 Bacteria 611
90 Ga0070672_100275460 3300005543 Bacteria 1422
91 Ga0070686_100103938 3300005544 Bacteria 1923
92 Ga0070686_100268488 3300005544 Bacteria 1253
93 Ga0070686_100421377 3300005544 Bacteria 1020
94 Ga0070686_100563964 3300005544 Bacteria 892
95 Ga0070686_101016809 3300005544 Bacteria 680
96 Ga0070695_100691689 3300005545 Bacteria 809
97 Ga0070695_100796195 3300005545 Bacteria 757
98 Ga0070695_101106324 3300005545 Bacteria 648
99 Ga0070696_100071025 3300005546 Bacteria 2449
100 Ga0070696_100750408 3300005546 Bacteria 799
101 Ga0070696_101863367 3300005546 Bacteria 520
102 Ga0070693_101400591 3300005547 Bacteria 543
103 Ga0070704_100275116 3300005549 Unclassified 1393
104 Ga0070704_100345402 3300005549 Bacteria 1254
105 Ga0070704_100846844 3300005549 Bacteria 819
106 Ga0070704_101412363 3300005549 Unclassified 639
107 Ga0070664_100085222 3300005564 Bacteria 2728
108 Ga0068857_100008126 3300005577 Bacteria 9059
109 Ga0068857_100404605 3300005577 Bacteria 1270
110 Ga0068857_101240634 3300005577 Bacteria 722
111 Ga0068854_100479972 3300005578 Bacteria 1044
112 Ga0068854_101135759 3300005578 Bacteria 697
113 Ga0068854_101343507 3300005578 Bacteria 644
114 Ga0068856_100074163 3300005614 Bacteria 3369
115 Ga0070702_101126293 3300005615 Bacteria 628
116 Ga0068852_102565617 3300005616 Bacteria 529
117 Ga0068866_10915330 3300005718 Bacteria 618
118 Ga0068861_100089472 3300005719 Bacteria 2426
119 Ga0068861_100333813 3300005719 Bacteria 1324
120 Ga0068851_10078037 3300005834 Bacteria 1725
121 Ga0068870_10026003 3300005840 Bacteria 2912
122 Ga0068870_11446303 3300005840 Bacteria 505
123 Ga0068863_102748515 3300005841 Unclassified 501
124 Ga0068860_100347225 3300005843 Bacteria 1460
125 Ga0068862_100707392 3300005844 Bacteria 976
126 Ga0081455_10015003 3300005937 Bacteria 7547
127 Ga0081455_10022328 3300005937 Bacteria 5917
128 Ga0081455_10085528 3300005937 Bacteria 2571
129 Ga0081455_10114311 3300005937 Bacteria 2139
130 Ga0081538_10002473 3300005981 Bacteria 18041
131 Ga0081538_10002782 3300005981 Bacteria 16758
132 Ga0081538_10027901 3300005981 Bacteria 3898
133 Ga0081538_10035383 3300005981 Bacteria 3282
134 Ga0081539_10000711 3300005985 Bacteria 66648
135 Ga0081539_10005523 3300005985 Bacteria 12824
136 Ga0081539_10273896 3300005985 Bacteria 738
137 Ga0070717_10376426 3300006028 Bacteria 1273
138 Ga0070717_10396608 3300006028 Bacteria 1239
139 Ga0075365_10040399 3300006038 Bacteria 3042
140 Ga0075364_10046893 3300006051 Bacteria 2814
141 Ga0075432_10018259 3300006058 Bacteria 2392
142 Ga0075432_10046771 3300006058 Bacteria 1520
143 Ga0070716_100057961 3300006173 Bacteria 2227
144 Ga0070716_101330937 3300006173 Unclassified 582
145 Ga0070716_101678973 3300006173 Bacteria 523
146 Ga0070712_100039954 3300006175 Bacteria 3213
147 Ga0070712_100048530 3300006175 Bacteria 2943
148 Ga0070712_100055999 3300006175 Bacteria 2764
149 Ga0070712_101497552 3300006175 Bacteria 590
150 Ga0068871_101432013 3300006358 Bacteria 652
151 Ga0068871_101970675 3300006358 Unclassified 556
152 Ga0075428_100048277 3300006844 Bacteria 4672
153 Ga0075428_100104059 3300006844 Bacteria 3095
154 Ga0075428_100174052 3300006844 Bacteria 2332
155 Ga0075430_100303528 3300006846 Bacteria 1320
156 Ga0075430_100544829 3300006846 Bacteria 957
157 Ga0075430_100929577 3300006846 Bacteria 716
158 Ga0075431_100482074 3300006847 Bacteria 1233
159 Ga0075431_100493375 3300006847 Bacteria 1216
160 Ga0075431_100901263 3300006847 Bacteria 854
161 Ga0075433_10000119 3300006852 Bacteria 39528
162 Ga0075433_10218448 3300006852 Bacteria 1693
163 Ga0075433_10594674 3300006852 Bacteria 971
164 Ga0075433_10698212 3300006852 Bacteria 889
165 Ga0075434_100001296 3300006871 Bacteria 20850
166 Ga0075434_100185084 3300006871 Bacteria 2103
167 Ga0075434_100499211 3300006871 Bacteria 1238
168 Ga0075429_100032016 3300006880 Bacteria 4572
169 Ga0075429_100843507 3300006880 Unclassified 802
170 Ga0075429_100946912 3300006880 Bacteria 753
171 Ga0075429_101228884 3300006880 Bacteria 654
172 Ga0075429_101586353 3300006880 Unclassified 569
173 Ga0068865_100438337 3300006881 Bacteria 1078
174 Ga0075436_100107131 3300006914 Bacteria 1949
175 Ga0075436_100649958 3300006914 Unclassified 779
176 Ga0075435_100134380 3300007076 Bacteria 2071
177 Ga0075435_100392495 3300007076 Bacteria 1193
178 Ga0075435_100402780 3300007076 Bacteria 1177
179 Ga0075435_101911282 3300007076 Bacteria 521
180 Ga0105251_10243648 3300009011 Bacteria 810
181 Ga0105240_10533139 3300009093 Bacteria 1301
182 Ga0105240_11087158 3300009093 Bacteria 851
183 Ga0111539_10005856 3300009094 Bacteria 15887
184 Ga0111539_10029299 3300009094 Bacteria 6707
185 Ga0111539_10126884 3300009094 Bacteria 2989
186 Ga0111539_10671872 3300009094 Bacteria 1206
187 Ga0111539_11114667 3300009094 Bacteria 917
188 Ga0105245_10228718 3300009098 Bacteria 1798
189 Ga0105245_10496160 3300009098 Bacteria 1236
190 Ga0105245_10547691 3300009098 Bacteria 1179
191 Ga0105247_10292522 3300009101 Bacteria 1127
192 Ga0114129_10057362 3300009147 Bacteria 5450
193 Ga0114129_10065641 3300009147 Bacteria 5065
194 Ga0114129_11452184 3300009147 Bacteria 844
195 Ga0114129_11512669 3300009147 Unclassified 824
196 Ga0114129_11595508 3300009147 Bacteria 799
197 Ga0114129_12907863 3300009147 Bacteria 566
198 Ga0105243_10320007 3300009148 Bacteria 1413
199 Ga0105243_10460401 3300009148 Bacteria 1196
200 Ga0105241_10396858 3300009174 Bacteria 1209
201 Ga0105242_10139784 3300009176 Bacteria 2100
202 Ga0105242_10898219 3300009176 Bacteria 886
203 Ga0105242_10939510 3300009176 Bacteria 868
204 Ga0105242_11928695 3300009176 Bacteria 632
205 Ga0105248_11144508 3300009177 Bacteria 880
206 Ga0105237_10855107 3300009545 Bacteria 916
207 Ga0105238_10703137 3300009551 Bacteria 1023
208 Ga0105249_10253986 3300009553 Bacteria 1744
209 Ga0105249_10258236 3300009553 Bacteria 1730
210 Ga0105249_10349857 3300009553 Bacteria 1497
211 Ga0105249_10844414 3300009553 Bacteria 981
212 Ga0105239_10384143 3300010375 Bacteria 1588
213 Ga0105239_10707910 3300010375 Bacteria 1152
214 Ga0105239_10888657 3300010375 Bacteria 1022
215 Ga0105239_11199706 3300010375 Bacteria 874
216 Ga0105239_11656403 3300010375 Bacteria 740
217 Ga0105246_10075058 3300011119 Bacteria 2393
218 Ga0105246_10234661 3300011119 Bacteria 1446
219 Ga0157371_10194615 3300013102 Bacteria 1452
220 Ga0157370_10024122 3300013104 Bacteria 6029
221 Ga0157369_10316899 3300013105 Bacteria 1621
222 Ga0157369_11234494 3300013105 Bacteria 762
223 Ga0157369_12487312 3300013105 Bacteria 524
224 Ga0157374_10132302 3300013296 Bacteria 2415
225 Ga0157374_10274466 3300013296 Bacteria 1663
226 Ga0157378_10260361 3300013297 Bacteria 1664
227 Ga0157378_10765872 3300013297 Bacteria 989
228 Ga0163162_10247016 3300013306 Bacteria 1916
229 Ga0163162_10964611 3300013306 Bacteria 963
230 Ga0163162_11645602 3300013306 Bacteria 733
231 Ga0157372_10218915 3300013307 Bacteria 2207
232 Ga0157372_12291964 3300013307 Unclassified 620
233 Ga0157375_10190658 3300013308 Bacteria 2205
234 Ga0157375_11420941 3300013308 Bacteria 818
235 Ga0163163_10138811 3300014325 Bacteria 2472
236 Ga0163163_10257560 3300014325 Bacteria 1795
237 Ga0157380_10025891 3300014326 Bacteria 4451
238 Ga0157380_11316705 3300014326 Bacteria 770
239 Ga0157377_10182039 3300014745 Bacteria 1322
240 Ga0157377_10721846 3300014745 Bacteria 726
241 Ga0157379_10596197 3300014968 Bacteria 1031
242 Ga0157376_10142803 3300014969 Bacteria 2150
243 Ga0157376_11635117 3300014969 Unclassified 679
244 Ga0182005_1288904 3300015265 Bacteria 515
245 Ga0163161_10240649 3300017792 Bacteria 1407
246 Ga0163161_10244550 3300017792 Bacteria 1396
247 Ga0163161_10530406 3300017792 Bacteria 962
248 Ga0206353_11677646 3300020082 Bacteria 701
249 Ga0206353_11920349 3300020082 Bacteria 6117
250 Ga0213871_10049976 3300021441 Bacteria 1143
251 Ga0207692_10292961 3300025898 Bacteria 988
252 Ga0207642_10047587 3300025899 Bacteria 1918
253 Ga0207688_10096107 3300025901 Bacteria 1706
254 Ga0207688_10549885 3300025901 Bacteria 725
255 Ga0207647_10155092 3300025904 Bacteria 1337
256 Ga0207685_10561069 3300025905 Bacteria 608
257 Ga0207699_10105143 3300025906 Bacteria 1799
258 Ga0207699_11048327 3300025906 Bacteria 603
259 Ga0207645_10170195 3300025907 Bacteria 1427
260 Ga0207645_10664465 3300025907 Bacteria 708
261 Ga0207684_10041561 3300025910 Bacteria 3897
262 Ga0207684_10427487 3300025910 Bacteria 1138
263 Ga0207684_10462111 3300025910 Bacteria 1089
264 Ga0207684_10787387 3300025910 Bacteria 804
265 Ga0207684_10935922 3300025910 Bacteria 727
266 Ga0207693_10002056 3300025915 Bacteria 17601
267 Ga0207693_10009046 3300025915 Bacteria 8127
268 Ga0207693_10086412 3300025915 Bacteria 2457
269 Ga0207693_10096515 3300025915 Bacteria 2317
270 Ga0207663_10006143 3300025916 Bacteria 6118
271 Ga0207663_10051622 3300025916 Bacteria 2562
272 Ga0207663_10222469 3300025916 Bacteria 1374
273 Ga0207663_10566741 3300025916 Bacteria 889
274 Ga0207662_10123348 3300025918 Bacteria 1626
275 Ga0207652_11439945 3300025921 Bacteria 592
276 Ga0207646_10002821 3300025922 Bacteria 20211
277 Ga0207646_10899590 3300025922 Unclassified 785
278 Ga0207681_10750539 3300025923 Bacteria 813
279 Ga0207687_10126409 3300025927 Bacteria 1920
280 Ga0207700_10000022 3300025928 Bacteria 166246
281 Ga0207664_10159065 3300025929 Bacteria 1925
282 Ga0207664_10198160 3300025929 Bacteria 1732
283 Ga0207664_10307331 3300025929 Bacteria 1396
284 Ga0207664_11096714 3300025929 Bacteria 712
285 Ga0207690_10548334 3300025932 Bacteria 940
286 Ga0207690_11457559 3300025932 Unclassified 572
287 Ga0207706_10409618 3300025933 Bacteria 1175
288 Ga0207706_10887644 3300025933 Bacteria 754
289 Ga0207686_10501914 3300025934 Bacteria 941
290 Ga0207686_11115267 3300025934 Unclassified 644
291 Ga0207709_10154830 3300025935 Archaea 1592
292 Ga0207709_10939110 3300025935 Bacteria 705
293 Ga0207669_10211852 3300025937 Bacteria 1415
294 Ga0207669_10611981 3300025937 Bacteria 887
295 Ga0207704_10762602 3300025938 Bacteria 805
296 Ga0207704_11481595 3300025938 Unclassified 582
297 Ga0207665_10022653 3300025939 Bacteria 4134
298 Ga0207665_10313891 3300025939 Bacteria 1175
299 Ga0207665_10844818 3300025939 Bacteria 725
300 Ga0207665_11459834 3300025939 Unclassified 544
301 Ga0207691_10083581 3300025940 Bacteria 2866
302 Ga0207691_10826203 3300025940 Bacteria 778
303 Ga0207689_10161384 3300025942 Bacteria 1847
304 Ga0207689_11192419 3300025942 Bacteria 641
305 Ga0207661_10063777 3300025944 Bacteria 2985
306 Ga0207661_10126793 3300025944 Bacteria 2181
307 Ga0207667_10176432 3300025949 Bacteria 2195
308 Ga0207667_10478838 3300025949 Bacteria 1264
309 Ga0207712_10135123 3300025961 Bacteria 1885
310 Ga0207712_10187939 3300025961 Bacteria 1628
311 Ga0207712_10501248 3300025961 Bacteria 1038
312 Ga0207668_10137378 3300025972 Bacteria 1875
313 Ga0207640_10328174 3300025981 Bacteria 1221
314 Ga0207677_10465136 3300026023 Bacteria 1086
315 Ga0207703_10205899 3300026035 Bacteria 1751
316 Ga0207678_10130989 3300026067 Bacteria 2139
317 Ga0207678_10692796 3300026067 Bacteria 896
318 Ga0207708_10045164 3300026075 Bacteria 3358
319 Ga0207702_10073047 3300026078 Bacteria 2957
320 Ga0207641_10537091 3300026088 Bacteria 1139
321 Ga0207648_10293407 3300026089 Bacteria 1456
322 Ga0207648_10748091 3300026089 Bacteria 908
323 Ga0207674_10013501 3300026116 Bacteria 9057
324 Ga0207674_10171570 3300026116 Bacteria 2122
325 Ga0207674_10261859 3300026116 Bacteria 1676
326 Ga0207674_10700403 3300026116 Bacteria 978
327 Ga0207675_100023645 3300026118 Bacteria 5716
328 Ga0207675_100095244 3300026118 Bacteria 2801
329 Ga0207683_10096149 3300026121 Bacteria 2641
330 Ga0207698_10073843 3300026142 Bacteria 2717
331 Ga0209966_1021332 3300027695 Bacteria 1260
332 Ga0207428_10734195 3300027907 Bacteria 705
333 Ga0207428_11112278 3300027907 Unclassified 552
334 Ga0268265_10614397 3300028380 Bacteria 1040
335 Ga0268264_10979561 3300028381 Bacteria 851
336 Ga0268264_11160610 3300028381 Bacteria 781
337 Ga0265334_10083208 3300028573 Bacteria 1176
338 Ga0265318_10008463 3300028577 Bacteria 4577
339 Ga0265322_10012369 3300028654 Bacteria 2469
340 Ga0265336_10125609 3300028666 Bacteria 764
341 Ga0265338_10023187 3300028800 Bacteria 6391
342 Ga0265338_10121494 3300028800 Bacteria 2081
343 Ga0265324_10188846 3300029957 Bacteria 700
344 Ga0265328_10279141 3300031239 Bacteria 643
345 Ga0265320_10089879 3300031240 Bacteria 1423
346 Ga0265325_10043014 3300031241 Bacteria 2359
347 Ga0265329_10051190 3300031242 Bacteria 1315
348 Ga0265340_10026499 3300031247 Bacteria 2930
349 Ga0265339_10190957 3300031249 Bacteria 1015
350 Ga0265327_10158190 3300031251 Bacteria 1048
351 Ga0265316_10076247 3300031344 Bacteria 2576
352 Ga0307408_100351182 3300031548 Unclassified 1251
353 Ga0307413_10029510 3300031824 Bacteria 3069
354 Ga0307410_10006439 3300031852 Bacteria 6337
355 Ga0307410_10481466 3300031852 Bacteria 1018
356 Ga0307406_10009717 3300031901 Bacteria 5409
357 Ga0307406_10113317 3300031901 Bacteria 1871
358 Ga0307406_10192613 3300031901 Bacteria 1494
359 Ga0307407_10014784 3300031903 Bacteria 3834
360 Ga0307412_10018654 3300031911 Bacteria 4181
361 Ga0307412_11590727 3300031911 Unclassified 596
362 Ga0307409_100034872 3300031995 Bacteria 3681
363 Ga0307409_101535857 3300031995 Bacteria 693
364 Ga0307416_100085439 3300032002 Bacteria 2685
365 Ga0307416_100214970 3300032002 Bacteria 1838
366 Ga0307416_101060279 3300032002 Unclassified 914
367 Ga0307416_103559893 3300032002 Bacteria 521
368 Ga0307414_10612961 3300032004 Bacteria 977
369 Ga0307414_10698914 3300032004 Bacteria 918
370 Ga0307415_100014984 3300032126 Bacteria 4576
371 Ga0307415_100019112 3300032126 Bacteria 4153
372 Ga0373938_0241937 3300034957 Unclassified 513
373 Ga0373932_0145325 3300035112 Bacteria 810
374 Ga0373960_0154939 3300035121 Bacteria 785
375 Ga0373962_0074258 3300035242 Bacteria 1022
376 Ga0395899_0000727 3300037312 Bacteria 32895
377 Ga0395899_0036525 3300037312 Bacteria 3685
378 Ga0395899_0167954 3300037312 Bacteria 1546
379 Ga0395899_0225202 3300037312 Bacteria 1297
380 Ga0395899_0461322 3300037312 Bacteria 830
381 Ga0395900_0005981 3300037418 Bacteria 12702
382 Ga0395900_0011622 3300037418 Bacteria 9009
383 Ga0395900_0022419 3300037418 Bacteria 6458
384 Ga0395900_0023812 3300037418 Bacteria 6265
385 Ga0395900_0830767 3300037418 Bacteria 850
386 Ga0395898_0022336 3300037466 Bacteria 6407
387 Ga0395898_0059095 3300037466 Bacteria 3731
388 Ga0395898_0102915 3300037466 Bacteria 2740
389 Ga0395898_0191605 3300037466 Bacteria 1953
390 Ga0395898_0278316 3300037466 Bacteria 1596
391 Ga0395898_0293039 3300037466 Bacteria 1552
392 Ga0395898_0431939 3300037466 Bacteria 1255
393 Ga0395898_1956057 3300037466 Bacteria 506
394 Ga0395905_0289606 3300037471 Bacteria 1524
395 Ga0395905_0389252 3300037471 Bacteria 1288
396 Ga0395905_0622296 3300037471 Bacteria 981
397 Ga0436364_1389342 3300037853 Bacteria 540
398 Ga0395901_0015943 3300038443 Bacteria 7654
399 Ga0395901_0019775 3300038443 Bacteria 6886
400 Ga0395901_0066779 3300038443 Bacteria 3745
401 Ga0395901_0082476 3300038443 Bacteria 3359
402 Ga0395901_0107498 3300038443 Bacteria 2928
403 Ga0395901_0141835 3300038443 Bacteria 2525
404 Ga0395901_0246926 3300038443 Bacteria 1860
405 Ga0395901_0633700 3300038443 Bacteria 1074
406 Ga0395901_1936079 3300038443 Unclassified 536
407 Ga0436360_0059844 3300039438 Bacteria 7930
408 Ga0436362_0316721 3300039453 Bacteria 1234
409 Ga0436362_0977634 3300039453 Bacteria 868
410 Ga0439466_0161500 3300041411 Bacteria 685
411 Ga0451804_0069903 3300041463 Bacteria 697
412 Ga0439433_0206979 3300041999 Bacteria 520
413 Ga0439445_0031477 3300042004 Bacteria 1379
414 Ga0439448_0101521 3300042005 Bacteria 978
415 Ga0439450_068492 3300042008 Bacteria 868
416 Ga0450920_004039 3300042122 Bacteria 2567
417 Ga0450910_028620 3300042147 Bacteria 867
418 Ga0439446_0081065 3300042156 Bacteria 1005
419 Ga0439458_0198111 3300042157 Unclassified 549
420 Ga0450909_051759 3300042185 Bacteria 642
421 Ga0439434_0337891 3300042435 Bacteria 524
422 Ga0439464_0037630 3300042439 Bacteria 1373
423 Ga0466964_0019634 3300044706 Bacteria 2599
424 Ga0466964_0069313 3300044706 Bacteria 1487
425 Ga0466964_0685491 3300044706 Bacteria 570
426 Ga0466960_0048226 3300044901 Bacteria 2046
427 Ga0466960_0089156 3300044901 Bacteria 1569
428 Ga0466960_0099810 3300044901 Bacteria 1493
429 Ga0466960_0220016 3300044901 Bacteria 1045
430 Ga0466960_0257184 3300044901 Bacteria 972
431 Ga0466960_0315493 3300044901 Bacteria 884
432 Ga0451576_0313810 3300045051 Bacteria 1640
433 Ga0466967_0406334 3300045976 Bacteria 1326
434 Ga0466967_1486990 3300045976 Bacteria 675
435 Ga0495590_0037401 3300046457 Bacteria 1693
436 Ga0495584_0047761 3300046491 Bacteria 2159
437 Ga0495584_0071038 3300046491 Bacteria 1749
438 Ga0495607_0493419 3300046501 Bacteria 544
439 Ga0495616_0249079 3300046513 Bacteria 764
440 Ga0495620_0192790 3300046515 Bacteria 785
441 Ga0495632_0433267 3300046519 Bacteria 572
442 Ga0495644_0076071 3300046523 Bacteria 1264
443 Ga0495644_0378866 3300046523 Bacteria 559
444 Ga0495663_0004137 3300046525 Bacteria 4104
445 Ga0495642_0349753 3300046528 Unclassified 650
446 Ga0495609_0071619 3300046538 Bacteria 1523
447 Ga0495609_0130188 3300046538 Bacteria 1078
448 Ga0495621_0077381 3300046539 Bacteria 1235
449 Ga0495656_0739430 3300046615 Bacteria 530
450 Ga0495668_0350855 3300046616 Bacteria 810
451 Ga0495611_0076298 3300046648 Bacteria 1536
452 Ga0495659_0227955 3300046664 Bacteria 771
453 Ga0495661_0340192 3300046665 Bacteria 741
454 Ga0495669_0273566 3300046684 Bacteria 812
455 Ga0495669_0297582 3300046684 Bacteria 778
456 Ga0495613_0792550 3300046689 Bacteria 619
457 Ga0495670_0147687 3300046691 Bacteria 1232
458 Ga0495671_0393902 3300046692 Unclassified 663
459 Ga0495589_0214829 3300046794 Bacteria 905
460 Ga0495660_0259088 3300046810 Bacteria 804
461 Ga0495636_0040580 3300047318 Bacteria 1930
462 Ga0495680_0078784 3300047322 Bacteria 2493
463 Ga0495683_0123458 3300047323 Bacteria 1227
464 Ga0495681_0068954 3300047470 Bacteria 1608
465 Ga0495615_0089909 3300048090 Bacteria 854
466 Ga0496100_0172827 3300048903 Bacteria 1557
467 Ga0496101_0002657 3300048904 Bacteria 10974
468 Ga0496101_0250527 3300048904 Bacteria 1380
469 Ga0496101_0563126 3300048904 Bacteria 901
470 Ga0496102_0016337 3300048905 Bacteria 6484
471 Ga0496102_0037873 3300048905 Bacteria 4350
472 Ga0496102_0286900 3300048905 Bacteria 1551
473 Ga0496103_0186885 3300048906 Bacteria 1332
474 Ga0496104_0050985 3300048907 Bacteria 3905
475 Ga0496104_0120337 3300048907 Bacteria 2520
476 Ga0496104_0143273 3300048907 Bacteria 2296
477 Ga0496104_0445648 3300048907 Bacteria 1206
478 Ga0496104_0750582 3300048907 Bacteria 883
479 Ga0496105_0034107 3300048908 Bacteria 4184
480 Ga0496105_0045645 3300048908 Bacteria 3616
481 Ga0496106_0003528 3300048909 Bacteria 11653
482 Ga0496106_0051381 3300048909 Bacteria 3108
483 Ga0496106_0264998 3300048909 Bacteria 1375
484 Ga0496107_0607810 3300048910 Bacteria 808
485 Ga0496107_1183102 3300048910 Bacteria 550
486 Ga0496108_0581655 3300048911 Bacteria 976
487 Ga0496108_1618523 3300048911 Unclassified 535
488 Ga0496109_0002295 3300048912 Bacteria 15905
489 Ga0496109_0018664 3300048912 Bacteria 6095
490 Ga0496109_0093326 3300048912 Bacteria 2785
491 Ga0496109_0215550 3300048912 Bacteria 1805
492 Ga0496110_0001066 3300048913 Bacteria 19357
493 Ga0496110_0036762 3300048913 Bacteria 4254
494 Ga0496110_0071408 3300048913 Bacteria 3078
495 Ga0496110_1520346 3300048913 Bacteria 579
496 Ga0496110_1628692 3300048913 Bacteria 555
497 Ga0496111_0001736 3300048914 Bacteria 12755
498 Ga0496111_0015720 3300048914 Bacteria 5203
499 Ga0496111_0214896 3300048914 Bacteria 1428
500 Ga0496111_0277561 3300048914 Bacteria 1243
501 Ga0496112_0122482 3300048915 Bacteria 2571
502 Ga0496112_0164263 3300048915 Bacteria 2186
503 Ga0496112_0423240 3300048915 Bacteria 1270
504 Ga0496112_1456950 3300048915 Bacteria 599
505 Ga0496113_0047599 3300048916 Bacteria 3187
506 Ga0496113_0645669 3300048916 Bacteria 846
507 Ga0496113_1297529 3300048916 Bacteria 566
508 Ga0496114_0175517 3300048917 Bacteria 1869
509 Ga0496115_0003812 3300048918 Bacteria 10859
510 Ga0501031_0000423 3300049568 Bacteria 24274
511 Ga0501031_0045461 3300049568 Bacteria 2864
512 Ga0501031_0052077 3300049568 Bacteria 2667
513 Ga0501031_0180230 3300049568 Bacteria 1380
514 Ga0501032_0004171 3300049569 Bacteria 10947
515 Ga0501032_0159643 3300049569 Bacteria 1480
516 Ga0501032_0161265 3300049569 Bacteria 1472
517 Ga0501033_0000701 3300049570 Bacteria 30994
518 Ga0501033_0001167 3300049570 Bacteria 23710
519 Ga0501033_1204110 3300049570 Bacteria 501
520 Ga0501034_0064981 3300049571 Bacteria 3662
521 Ga0501034_0167335 3300049571 Bacteria 2167
522 Ga0501034_0388552 3300049571 Bacteria 1319
523 Ga0501034_1066800 3300049571 Bacteria 690
524 Ga0501036_0001232 3300049572 Bacteria 19542
525 Ga0501036_0003366 3300049572 Bacteria 12769
526 Ga0501036_0029990 3300049572 Bacteria 4596
527 Ga0501036_0162018 3300049572 Bacteria 1885
528 Ga0501036_0808967 3300049572 Bacteria 771
529 Ga0501037_0000071 3300049573 Bacteria 94548
530 Ga0501037_0029448 3300049573 Bacteria 4056
531 Ga0501037_0217721 3300049573 Bacteria 1344
532 Ga0501037_0742986 3300049573 Bacteria 650
533 Ga0501037_1050616 3300049573 Bacteria 529
534 Ga0501038_0000282 3300049574 Bacteria 43214
535 Ga0501038_0002599 3300049574 Bacteria 16869
536 Ga0501038_0263061 3300049574 Bacteria 1362
537 Ga0501038_0610440 3300049574 Bacteria 824
538 Ga0501039_0001238 3300049575 Bacteria 18696
539 Ga0501039_0018650 3300049575 Bacteria 5327
540 Ga0501039_0159976 3300049575 Bacteria 1770
541 Ga0501040_0005050 3300049576 Bacteria 8527
542 Ga0501040_0014257 3300049576 Bacteria 5235
543 Ga0501040_0022273 3300049576 Bacteria 4239
544 Ga0501040_0043888 3300049576 Bacteria 3047
545 Ga0501040_0100663 3300049576 Bacteria 2015
546 Ga0501040_0333557 3300049576 Bacteria 1085
547 Ga0501040_0953288 3300049576 Bacteria 622
548 Ga0501041_0006621 3300049577 Bacteria 6785
549 Ga0501041_0024753 3300049577 Bacteria 3604
550 Ga0501041_0089921 3300049577 Bacteria 1895
551 Ga0501041_0148317 3300049577 Bacteria 1464
552 Ga0501041_0593335 3300049577 Unclassified 707
553 Ga0501042_0050503 3300049578 Bacteria 2966
554 Ga0501042_0176934 3300049578 Bacteria 1539
555 Ga0501042_0201314 3300049578 Bacteria 1436
556 Ga0501042_0224270 3300049578 Bacteria 1355
557 Ga0501042_0327920 3300049578 Bacteria 1106
558 Ga0501043_0006430 3300049579 Bacteria 9437
559 Ga0501043_0018673 3300049579 Bacteria 5442
560 Ga0501043_0553770 3300049579 Bacteria 854
561 Ga0501043_1010767 3300049579 Unclassified 591
562 Ga0501046_0001202 3300049580 Bacteria 25181
563 Ga0501046_0022209 3300049580 Bacteria 5228
564 Ga0501046_0243313 3300049580 Bacteria 1326
565 Ga0501046_0258469 3300049580 Bacteria 1280
566 Ga0501046_0309080 3300049580 Bacteria 1153
567 Ga0501046_0423661 3300049580 Bacteria 959
568 Ga0501046_0490873 3300049580 Bacteria 880
569 Ga0501046_0862292 3300049580 Bacteria 633
570 Ga0501047_0021170 3300049581 Bacteria 6245
571 Ga0501047_0119947 3300049581 Bacteria 2512
572 Ga0501047_0256323 3300049581 Bacteria 1597
573 Ga0501047_0278211 3300049581 Bacteria 1519
574 Ga0501047_0308132 3300049581 Bacteria 1424
575 Ga0501047_1243070 3300049581 Bacteria 558
576 Ga0501047_1246775 3300049581 Bacteria 557
577 Ga0501048_0002033 3300049582 Bacteria 15373
578 Ga0501048_0035795 3300049582 Bacteria 3570
579 Ga0501048_0161853 3300049582 Bacteria 1584
580 Ga0501048_0167625 3300049582 Bacteria 1555
581 Ga0501048_0873581 3300049582 Bacteria 646
582 Ga0501067_0013586 3300049583 Bacteria 4509
583 Ga0501067_0226433 3300049583 Bacteria 1041
584 Ga0501068_0000165 3300049584 Bacteria 30724
585 Ga0501068_0001849 3300049584 Bacteria 11236
586 Ga0501068_0044099 3300049584 Bacteria 2684
587 Ga0501068_0122378 3300049584 Bacteria 1623
588 Ga0501068_0123185 3300049584 Bacteria 1618
589 Ga0501068_0155305 3300049584 Bacteria 1440
590 Ga0501069_0001055 3300049585 Bacteria 13196
591 Ga0501069_0008336 3300049585 Bacteria 5442
592 Ga0501069_0014233 3300049585 Bacteria 4249
593 Ga0501069_0048902 3300049585 Bacteria 2349
594 Ga0501069_0090958 3300049585 Bacteria 1726
595 Ga0501069_0389598 3300049585 Bacteria 824
596 Ga0501069_0475644 3300049585 Bacteria 744
597 Ga0501069_0795716 3300049585 Bacteria 573
598 Ga0501070_0026892 3300049586 Bacteria 4825
599 Ga0501070_0037934 3300049586 Bacteria 4021
600 Ga0501070_0066698 3300049586 Bacteria 2980
601 Ga0501070_0282019 3300049586 Bacteria 1355
602 Ga0501070_0397996 3300049586 Bacteria 1114
603 Ga0501070_0488860 3300049586 Bacteria 989
604 Ga0501070_0871721 3300049586 Bacteria 703
605 Ga0501071_0001246 3300049587 Bacteria 14418
606 Ga0501071_0005825 3300049587 Bacteria 7961
607 Ga0501071_0027693 3300049587 Bacteria 3990
608 Ga0501071_0125393 3300049587 Bacteria 1905
609 Ga0501071_0263741 3300049587 Bacteria 1301
610 Ga0501071_0297843 3300049587 Bacteria 1222
611 Ga0501071_0320555 3300049587 Bacteria 1177
612 Ga0501071_0678292 3300049587 Bacteria 793
613 Ga0501071_0837135 3300049587 Bacteria 710
614 Ga0501072_0019515 3300049588 Bacteria 5242
615 Ga0501072_0085306 3300049588 Bacteria 2504
616 Ga0501072_0200269 3300049588 Bacteria 1592
617 Ga0501072_0238678 3300049588 Bacteria 1447
618 Ga0501072_0241479 3300049588 Bacteria 1439
619 Ga0501072_0299548 3300049588 Bacteria 1278
620 Ga0501072_0621142 3300049588 Bacteria 851
621 Ga0501072_1536086 3300049588 Unclassified 514
622 Ga0501073_0007453 3300049589 Bacteria 8134
623 Ga0501073_0009624 3300049589 Bacteria 7128
624 Ga0501073_0294092 3300049589 Bacteria 1120
625 Ga0501073_1025818 3300049589 Unclassified 567
626 Ga0501074_0000396 3300049590 Bacteria 25931
627 Ga0501074_0042237 3300049590 Bacteria 3299
628 Ga0501074_0118466 3300049590 Bacteria 1894
629 Ga0501074_0141919 3300049590 Bacteria 1718
630 Ga0501074_0244005 3300049590 Bacteria 1277
631 Ga0501074_0424660 3300049590 Bacteria 943
632 Ga0501074_0537415 3300049590 Unclassified 828
633 Ga0501075_0000942 3300049591 Bacteria 18518
634 Ga0501075_0006270 3300049591 Bacteria 8175
635 Ga0501075_0032266 3300049591 Bacteria 3890
636 Ga0501075_0043056 3300049591 Bacteria 3386
637 Ga0501075_0092578 3300049591 Bacteria 2294
638 Ga0501075_0112688 3300049591 Bacteria 2068
639 Ga0501075_0552460 3300049591 Bacteria 879
640 Ga0501075_0931092 3300049591 Unclassified 660
641 Ga0501075_1016218 3300049591 Bacteria 630
642 Ga0501076_0000313 3300049592 Bacteria 30201
643 Ga0501076_0029406 3300049592 Bacteria 4273
644 Ga0501076_0041544 3300049592 Bacteria 3618
645 Ga0501076_0093559 3300049592 Bacteria 2419
646 Ga0501076_0146315 3300049592 Bacteria 1921
647 Ga0501076_0262290 3300049592 Bacteria 1415
648 Ga0501076_0717453 3300049592 Bacteria 825
649 Ga0501076_0809545 3300049592 Bacteria 773
650 Ga0501076_0882106 3300049592 Bacteria 738
651 Ga0501077_0000128 3300049593 Bacteria 41409
652 Ga0501077_0003675 3300049593 Bacteria 9230
653 Ga0501077_0238857 3300049593 Bacteria 1155
654 Ga0501077_0336598 3300049593 Bacteria 962
655 Ga0501233_265265 3300049668 Unclassified 520
656 Ga0501079_0000275 3300049741 Bacteria 31649
657 Ga0501079_0009954 3300049741 Bacteria 7218
658 Ga0501079_0075238 3300049741 Bacteria 2611
659 Ga0501079_0098434 3300049741 Bacteria 2267
660 Ga0501079_0474911 3300049741 Bacteria 982
661 Ga0501079_1599241 3300049741 Bacteria 513
662 Ga0501080_0003178 3300049742 Bacteria 14480
663 Ga0501080_0007567 3300049742 Bacteria 9819
664 Ga0501080_0043076 3300049742 Bacteria 4202
665 Ga0501080_0286845 3300049742 Bacteria 1495
666 Ga0501080_0825836 3300049742 Bacteria 812
667 Ga0501081_0001872 3300049743 Bacteria 13078
668 Ga0501081_0003247 3300049743 Bacteria 10351
669 Ga0501081_0092059 3300049743 Bacteria 2133
670 Ga0501081_0139229 3300049743 Bacteria 1738
671 Ga0501081_0223888 3300049743 Bacteria 1368
672 Ga0501081_0272891 3300049743 Bacteria 1237
673 Ga0501081_0289184 3300049743 Bacteria 1201
674 Ga0501081_0328038 3300049743 Bacteria 1126
675 Ga0501081_0362320 3300049743 Bacteria 1069
676 Ga0501081_0973078 3300049743 Bacteria 641
677 Ga0501083_0000523 3300049744 Bacteria 24484
678 Ga0501083_0020768 3300049744 Bacteria 4565
679 Ga0501083_0138534 3300049744 Bacteria 1594
680 Ga0501083_0406197 3300049744 Bacteria 886
681 Ga0501083_0670211 3300049744 Bacteria 674
682 Ga0501083_0789205 3300049744 Bacteria 618
683 Ga0501035_0001459 3300049822 Bacteria 24225
684 Ga0501035_0011064 3300049822 Bacteria 8355
685 Ga0501035_0201307 3300049822 Bacteria 1708
686 Ga0501035_0797603 3300049822 Bacteria 754
687 Ga0501035_1446702 3300049822 Bacteria 525
688 Ga0501044_0002766 3300049823 Bacteria 19969
689 Ga0501044_0059800 3300049823 Bacteria 3903
690 Ga0501044_0096915 3300049823 Bacteria 2971
691 Ga0501044_0279863 3300049823 Bacteria 1602
692 Ga0501044_0519803 3300049823 Bacteria 1090
693 Ga0501044_0655743 3300049823 Bacteria 938
694 Ga0501044_0760873 3300049823 Bacteria 850
695 Ga0501045_0000995 3300049824 Bacteria 18590
696 Ga0501045_0014347 3300049824 Bacteria 5614
697 Ga0501045_0015710 3300049824 Bacteria 5371
698 Ga0501045_0028429 3300049824 Bacteria 4034
699 Ga0501045_0028582 3300049824 Bacteria 4023
700 Ga0501045_0186121 3300049824 Bacteria 1547
701 Ga0501045_0295909 3300049824 Bacteria 1204
702 Ga0501045_1335077 3300049824 Bacteria 521
703 nmdc:mga00v17_60674_c1 3300050491 Bacteria 2323
704 nmdc:mga05p37_1081526_c1 3300050507 Unclassified 842
705 nmdc:mga05p37_138356_c1 3300050507 Unclassified 2247
706 nmdc:mga05p37_238267_c1 3300050507 Bacteria 2189
707 nmdc:mga05p37_243507_c1 3300050507 Bacteria 2161
708 nmdc:mga05p37_399898_c1 3300050507 Bacteria 1604
709 nmdc:mga05p37_85942_c1 3300050507 Bacteria 3877
710 nmdc:mga05p37_970416_c1 3300050507 Bacteria 907
711 nmdc:mga09592_1307159_c1 3300050508 Bacteria 596
712 nmdc:mga09592_1713350_c1 3300050508 Unclassified 506
713 nmdc:mga09592_18243_c1 3300050508 Bacteria 5755
714 nmdc:mga0qj67_1452021_c1 3300050509 Bacteria 528
715 nmdc:mga0qj67_31209_c1 3300050509 Bacteria 4150
716 nmdc:mga06r32_298045_c1 3300050510 Bacteria 1598
717 nmdc:mga06r32_340296_c1 3300050510 Bacteria 1485
718 nmdc:mga06r32_544283_c1 3300050510 Bacteria 1135
719 nmdc:mga08y16_22314_c1 3300050511 Bacteria 6680
720 nmdc:mga08y16_25158_c1 3300050511 Bacteria 6278
721 nmdc:mga08y16_568041_c1 3300050511 Bacteria 1146
722 nmdc:mga08y16_67021_c1 3300050511 Bacteria 3746
723 nmdc:mga08y16_939927_c1 3300050511 Bacteria 848
724 nmdc:mga0n895_18845_c1 3300050512 Bacteria 6398
725 nmdc:mga0n895_2268_c1 3300050512 Bacteria 14909
726 nmdc:mga0n895_311153_c1 3300050512 Bacteria 1596
727 nmdc:mga0n895_459163_c1 3300050512 Bacteria 1286
728 nmdc:mga0n895_465669_c1 3300050512 Bacteria 1275
729 nmdc:mga0rr50_1215657_c1 3300050513 Unclassified 640
730 nmdc:mga0rr50_1797596_c1 3300050513 Bacteria 516
731 nmdc:mga0rr50_270655_c1 3300050513 Bacteria 1416
732 nmdc:mga08x19_70560_c1 3300050514 Bacteria 2277
733 nmdc:mga0a205_115921_c1 3300050515 Bacteria 2578
734 nmdc:mga0a205_325_c1 3300050515 Bacteria 35736
735 nmdc:mga0a205_813927_c1 3300050515 Bacteria 782
736 Ga0495655_0016953 3300053083 Bacteria 1578
737 Ga0495655_0031670 3300053083 Bacteria 1288
738 Ga0501084_0026979 3300054114 Bacteria 4798
739 Ga0501084_0103174 3300054114 Bacteria 2395
740 Ga0501084_0112570 3300054114 Bacteria 2287
741 Ga0501084_0118298 3300054114 Bacteria 2227
742 Ga0501084_0128406 3300054114 Bacteria 2133
743 Ga0501084_0163217 3300054114 Bacteria 1879
744 Ga0501084_0233367 3300054114 Bacteria 1553
745 Ga0501084_0424380 3300054114 Bacteria 1124
746 Ga0501084_0441143 3300054114 Bacteria 1100
747 Ga0501084_0883394 3300054114 Bacteria 752
748 Ga0590075_044817 3300059424 Bacteria 1132
749 Ga0587082_019302 3300059504 Bacteria 1093
750 Ga0501082_0003090 3300060353 Bacteria 14517
751 Ga0501082_0003840 3300060353 Bacteria 13136
752 Ga0501082_0058613 3300060353 Bacteria 3317
753 Ga0501082_0115724 3300060353 Bacteria 2322
754 Ga0501082_0139391 3300060353 Bacteria 2105
755 Ga0501082_0197741 3300060353 Bacteria 1749
756 Ga0501082_0360929 3300060353 Bacteria 1267
757 Ga0501082_0720596 3300060353 Unclassified 873
758 Ga0501082_0734479 3300060353 Bacteria 864
759 Ga0501082_0748866 3300060353 Bacteria 855
760 Ga0501082_0912144 3300060353 Unclassified 768
761 Ga0530510_0000191 3300061734 Bacteria 37694
762 Ga0530510_0004781 3300061734 Bacteria 9377
763 Ga0530510_0023943 3300061734 Bacteria 4355
764 Ga0530510_0039831 3300061734 Bacteria 3391
765 Ga0530510_0073357 3300061734 Bacteria 2484
766 Ga0530510_0077770 3300061734 Bacteria 2411
767 Ga0530510_0303760 3300061734 Bacteria 1194
768 Ga0530510_1015014 3300061734 Bacteria 635
769 Ga0530510_1235102 3300061734 Bacteria 573
770 Ga0068852_101491466
771 JGI25406J46586_10030110
772 JGI25406J46586_10080228
773 Ga0070676_10208442
774 Ga0070676_10755961
775 Ga0070683_101136103
776 Ga0070690_100960011
777 Ga0068869_100140946
778 Ga0068869_100652395
779 Ga0068869_100946328
780 Ga0070680_100384828
781 Ga0068868_100166839
782 Ga0068868_100347501
783 Ga0068868_101863457
784 Ga0070689_100571713
785 Ga0070691_10067556
786 Ga0070691_10622286
787 Ga0070687_100267132
788 Ga0070687_100325431
789 Ga0070692_10039981
790 Ga0070692_10368552
791 Ga0070692_10445284
792 Ga0070692_10700292
793 Ga0070692_11177594
794 Ga0070668_100454640
795 Ga0070669_100338007
796 Ga0070675_100288084
797 Ga0070674_100171735
798 Ga0070674_100177059
799 Ga0070674_100202903
800 Ga0070688_101195051
801 Ga0070659_100316764
802 Ga0070659_100935334
803 Ga0070703_10167374
804 Ga0070709_11021303
805 Ga0070709_11587847
806 Ga0070714_100241768
807 Ga0070714_100516637
808 Ga0070713_100119495
809 Ga0070710_10026228
810 Ga0070710_10058435
811 Ga0070710_10128629
812 Ga0070710_10603364
813 Ga0070701_10078981
814 Ga0070701_10495033
815 Ga0070711_100012812
816 Ga0070711_100070845
817 Ga0070711_100816826
818 Ga0070711_101085655
819 Ga0070711_101621506
820 Ga0070705_100392122
821 Ga0070705_101241534
822 Ga0070700_100066550
823 Ga0070694_100092625
824 Ga0070694_100100916
825 Ga0070708_101064881
826 Ga0070708_101206439
827 Ga0070663_100208955
828 Ga0070662_100880404
829 Ga0070662_101421692
830 Ga0070681_11380559
831 Ga0068867_100162795
832 Ga0068867_100241403
833 Ga0068867_101869727
834 Ga0070685_10111310
835 Ga0070706_100266575
836 Ga0070706_100461713
837 Ga0070706_100462501
838 Ga0070706_100870387
839 Ga0070707_100006447
840 Ga0070707_100640432
841 Ga0070707_101270551
842 Ga0070698_100003138
843 Ga0070698_100419503
844 Ga0070698_101054180
845 Ga0070698_101885836
846 Ga0070698_101926596
847 Ga0070699_100130470
848 Ga0070699_100145670
849 Ga0070699_100761226
850 Ga0070679_100862417
851 Ga0070679_101055190
852 Ga0070684_100248859
853 Ga0070684_101246665
854 Ga0070697_100134724
855 Ga0070697_100596586
856 Ga0070697_100623406
857 Ga0070697_100775568
858 Ga0070697_101460167
859 Ga0070672_100275460
860 Ga0070686_100103938
861 Ga0070686_100268488
862 Ga0070686_100421377
863 Ga0070686_100563964
864 Ga0070686_101016809
865 Ga0070695_100691689
866 Ga0070695_100796195
867 Ga0070695_101106324
868 Ga0070696_100071025
869 Ga0070696_100750408
870 Ga0070696_101863367
871 Ga0070693_101400591
872 Ga0070704_100275116
873 Ga0070704_100345402
874 Ga0070704_100846844
875 Ga0070704_101412363
876 Ga0070664_100085222
877 Ga0068857_100008126
878 Ga0068857_100404605
879 Ga0068857_101240634
880 Ga0068854_100479972
881 Ga0068854_101135759
882 Ga0068854_101343507
883 Ga0068856_100074163
884 Ga0070702_101126293
885 Ga0068852_102565617
886 Ga0068866_10915330
887 Ga0068861_100089472
888 Ga0068861_100333813
889 Ga0068851_10078037
890 Ga0068870_10026003
891 Ga0068870_11446303
892 Ga0068863_102748515
893 Ga0068860_100347225
894 Ga0068862_100707392
895 Ga0081455_10015003
896 Ga0081455_10022328
897 Ga0081455_10085528
898 Ga0081455_10114311
899 Ga0081538_10002473
900 Ga0081538_10002782
901 Ga0081538_10027901
902 Ga0081538_10035383
903 Ga0081539_10000711
904 Ga0081539_10005523
905 Ga0081539_10273896
906 Ga0070717_10376426
907 Ga0070717_10396608
908 Ga0075365_10040399
909 Ga0075364_10046893
910 Ga0075432_10018259
911 Ga0075432_10046771
912 Ga0070716_100057961
913 Ga0070716_101330937
914 Ga0070716_101678973
915 Ga0070712_100039954
916 Ga0070712_100048530
917 Ga0070712_100055999
918 Ga0070712_101497552
919 Ga0068871_101432013
920 Ga0068871_101970675
921 Ga0075428_100048277
922 Ga0075428_100104059
923 Ga0075428_100174052
924 Ga0075430_100303528
925 Ga0075430_100544829
926 Ga0075430_100929577
927 Ga0075431_100482074
928 Ga0075431_100493375
929 Ga0075431_100901263
930 Ga0075433_10000119
931 Ga0075433_10218448
932 Ga0075433_10594674
933 Ga0075433_10698212
934 Ga0075434_100001296
935 Ga0075434_100185084
936 Ga0075434_100499211
937 Ga0075429_100032016
938 Ga0075429_100843507
939 Ga0075429_100946912
940 Ga0075429_101228884
941 Ga0075429_101586353
942 Ga0068865_100438337
943 Ga0075436_100107131
944 Ga0075436_100649958
945 Ga0075435_100134380
946 Ga0075435_100392495
947 Ga0075435_100402780
948 Ga0075435_101911282
949 Ga0105251_10243648
950 Ga0105240_10533139
951 Ga0105240_11087158
952 Ga0111539_10005856
953 Ga0111539_10029299
954 Ga0111539_10126884
955 Ga0111539_10671872
956 Ga0111539_11114667
957 Ga0105245_10228718
958 Ga0105245_10496160
959 Ga0105245_10547691
960 Ga0105247_10292522
961 Ga0114129_10057362
962 Ga0114129_10065641
963 Ga0114129_11452184
964 Ga0114129_11512669
965 Ga0114129_11595508
966 Ga0114129_12907863
967 Ga0105243_10320007
968 Ga0105243_10460401
969 Ga0105241_10396858
970 Ga0105242_10139784
971 Ga0105242_10898219
972 Ga0105242_10939510
973 Ga0105242_11928695
974 Ga0105248_11144508
975 Ga0105237_10855107
976 Ga0105238_10703137
977 Ga0105249_10253986
978 Ga0105249_10258236
979 Ga0105249_10349857
980 Ga0105249_10844414
981 Ga0105239_10384143
982 Ga0105239_10707910
983 Ga0105239_10888657
984 Ga0105239_11199706
985 Ga0105239_11656403
986 Ga0105246_10075058
987 Ga0105246_10234661
988 Ga0157371_10194615
989 Ga0157370_10024122
990 Ga0157369_10316899
991 Ga0157369_11234494
992 Ga0157369_12487312
993 Ga0157374_10132302
994 Ga0157374_10274466
995 Ga0157378_10260361
996 Ga0157378_10765872
997 Ga0163162_10247016
998 Ga0163162_10964611
999 Ga0163162_11645602
1000 Ga0157372_10218915
1001 Ga0157372_12291964
1002 Ga0157375_10190658
1003 Ga0157375_11420941
1004 Ga0163163_10138811
1005 Ga0163163_10257560
1006 Ga0157380_10025891
1007 Ga0157380_11316705
1008 Ga0157377_10182039
1009 Ga0157377_10721846
1010 Ga0157379_10596197
1011 Ga0157376_10142803
1012 Ga0157376_11635117
1013 Ga0182005_1288904
1014 Ga0163161_10240649
1015 Ga0163161_10244550
1016 Ga0163161_10530406
1017 Ga0206353_11677646
1018 Ga0206353_11920349
1019 Ga0213871_10049976
1020 Ga0207692_10292961
1021 Ga0207642_10047587
1022 Ga0207688_10096107
1023 Ga0207688_10549885
1024 Ga0207647_10155092
1025 Ga0207685_10561069
1026 Ga0207699_10105143
1027 Ga0207699_11048327
1028 Ga0207645_10170195
1029 Ga0207645_10664465
1030 Ga0207684_10041561
1031 Ga0207684_10427487
1032 Ga0207684_10462111
1033 Ga0207684_10787387
1034 Ga0207684_10935922
1035 Ga0207693_10002056
1036 Ga0207693_10009046
1037 Ga0207693_10086412
1038 Ga0207693_10096515
1039 Ga0207663_10006143
1040 Ga0207663_10051622
1041 Ga0207663_10222469
1042 Ga0207663_10566741
1043 Ga0207662_10123348
1044 Ga0207652_11439945
1045 Ga0207646_10002821
1046 Ga0207646_10899590
1047 Ga0207681_10750539
1048 Ga0207687_10126409
1049 Ga0207700_10000022
1050 Ga0207664_10159065
1051 Ga0207664_10198160
1052 Ga0207664_10307331
1053 Ga0207664_11096714
1054 Ga0207690_10548334
1055 Ga0207690_11457559
1056 Ga0207706_10409618
1057 Ga0207706_10887644
1058 Ga0207686_10501914
1059 Ga0207686_11115267
1060 Ga0207709_10154830
1061 Ga0207709_10939110
1062 Ga0207669_10211852
1063 Ga0207669_10611981
1064 Ga0207704_10762602
1065 Ga0207704_11481595
1066 Ga0207665_10022653
1067 Ga0207665_10313891
1068 Ga0207665_10844818
1069 Ga0207665_11459834
1070 Ga0207691_10083581
1071 Ga0207691_10826203
1072 Ga0207689_10161384
1073 Ga0207689_11192419
1074 Ga0207661_10063777
1075 Ga0207661_10126793
1076 Ga0207667_10176432
1077 Ga0207667_10478838
1078 Ga0207712_10135123
1079 Ga0207712_10187939
1080 Ga0207712_10501248
1081 Ga0207668_10137378
1082 Ga0207640_10328174
1083 Ga0207677_10465136
1084 Ga0207703_10205899
1085 Ga0207678_10130989
1086 Ga0207678_10692796
1087 Ga0207708_10045164
1088 Ga0207702_10073047
1089 Ga0207641_10537091
1090 Ga0207648_10293407
1091 Ga0207648_10748091
1092 Ga0207674_10013501
1093 Ga0207674_10171570
1094 Ga0207674_10261859
1095 Ga0207674_10700403
1096 Ga0207675_100023645
1097 Ga0207675_100095244
1098 Ga0207683_10096149
1099 Ga0207698_10073843
1100 Ga0209966_1021332
1101 Ga0207428_10734195
1102 Ga0207428_11112278
1103 Ga0268265_10614397
1104 Ga0268264_10979561
1105 Ga0268264_11160610
1106 Ga0265334_10083208
1107 Ga0265318_10008463
1108 Ga0265322_10012369
1109 Ga0265336_10125609
1110 Ga0265338_10023187
1111 Ga0265338_10121494
1112 Ga0265324_10188846
1113 Ga0265328_10279141
1114 Ga0265320_10089879
1115 Ga0265325_10043014
1116 Ga0265329_10051190
1117 Ga0265340_10026499
1118 Ga0265339_10190957
1119 Ga0265327_10158190
1120 Ga0265316_10076247
1121 Ga0307408_100351182
1122 Ga0307413_10029510
1123 Ga0307410_10006439
1124 Ga0307410_10481466
1125 Ga0307406_10009717
1126 Ga0307406_10113317
1127 Ga0307406_10192613
1128 Ga0307407_10014784
1129 Ga0307412_10018654
1130 Ga0307412_11590727
1131 Ga0307409_100034872
1132 Ga0307409_101535857
1133 Ga0307416_100085439
1134 Ga0307416_100214970
1135 Ga0307416_101060279
1136 Ga0307416_103559893
1137 Ga0307414_10612961
1138 Ga0307414_10698914
1139 Ga0307415_100014984
1140 Ga0307415_100019112
1141 Ga0373938_0241937
1142 Ga0373932_0145325
1143 Ga0373960_0154939
1144 Ga0373962_0074258
1145 Ga0395899_0000727
1146 Ga0395899_0036525
1147 Ga0395899_0167954
1148 Ga0395899_0225202
1149 Ga0395899_0461322
1150 Ga0395900_0005981
1151 Ga0395900_0011622
1152 Ga0395900_0022419
1153 Ga0395900_0023812
1154 Ga0395900_0830767
1155 Ga0395898_0022336
1156 Ga0395898_0059095
1157 Ga0395898_0102915
1158 Ga0395898_0191605
1159 Ga0395898_0278316
1160 Ga0395898_0293039
1161 Ga0395898_0431939
1162 Ga0395898_1956057
1163 Ga0395905_0289606
1164 Ga0395905_0389252
1165 Ga0395905_0622296
1166 Ga0436364_1389342
1167 Ga0395901_0015943
1168 Ga0395901_0019775
1169 Ga0395901_0066779
1170 Ga0395901_0082476
1171 Ga0395901_0107498
1172 Ga0395901_0141835
1173 Ga0395901_0246926
1174 Ga0395901_0633700
1175 Ga0395901_1936079
1176 Ga0436360_0059844
1177 Ga0436362_0316721
1178 Ga0436362_0977634
1179 Ga0439466_0161500
1180 Ga0451804_0069903
1181 Ga0439433_0206979
1182 Ga0439445_0031477
1183 Ga0439448_0101521
1184 Ga0439450_068492
1185 Ga0450920_004039
1186 Ga0450910_028620
1187 Ga0439446_0081065
1188 Ga0439458_0198111
1189 Ga0450909_051759
1190 Ga0439434_0337891
1191 Ga0439464_0037630
1192 Ga0466964_0019634
1193 Ga0466964_0069313
1194 Ga0466964_0685491
1195 Ga0466960_0048226
1196 Ga0466960_0089156
1197 Ga0466960_0099810
1198 Ga0466960_0220016
1199 Ga0466960_0257184
1200 Ga0466960_0315493
1201 Ga0451576_0313810
1202 Ga0466967_0406334
1203 Ga0466967_1486990
1204 Ga0495590_0037401
1205 Ga0495584_0047761
1206 Ga0495584_0071038
1207 Ga0495607_0493419
1208 Ga0495616_0249079
1209 Ga0495620_0192790
1210 Ga0495632_0433267
1211 Ga0495644_0076071
1212 Ga0495644_0378866
1213 Ga0495663_0004137
1214 Ga0495642_0349753
1215 Ga0495609_0071619
1216 Ga0495609_0130188
1217 Ga0495621_0077381
1218 Ga0495656_0739430
1219 Ga0495668_0350855
1220 Ga0495611_0076298
1221 Ga0495659_0227955
1222 Ga0495661_0340192
1223 Ga0495669_0273566
1224 Ga0495669_0297582
1225 Ga0495613_0792550
1226 Ga0495670_0147687
1227 Ga0495671_0393902
1228 Ga0495589_0214829
1229 Ga0495660_0259088
1230 Ga0495636_0040580
1231 Ga0495680_0078784
1232 Ga0495683_0123458
1233 Ga0495681_0068954
1234 Ga0495615_0089909
1235 Ga0496100_0172827
1236 Ga0496101_0002657
1237 Ga0496101_0250527
1238 Ga0496101_0563126
1239 Ga0496102_0016337
1240 Ga0496102_0037873
1241 Ga0496102_0286900
1242 Ga0496103_0186885
1243 Ga0496104_0050985
1244 Ga0496104_0120337
1245 Ga0496104_0143273
1246 Ga0496104_0445648
1247 Ga0496104_0750582
1248 Ga0496105_0034107
1249 Ga0496105_0045645
1250 Ga0496106_0003528
1251 Ga0496106_0051381
1252 Ga0496106_0264998
1253 Ga0496107_0607810
1254 Ga0496107_1183102
1255 Ga0496108_0581655
1256 Ga0496108_1618523
1257 Ga0496109_0002295
1258 Ga0496109_0018664
1259 Ga0496109_0093326
1260 Ga0496109_0215550
1261 Ga0496110_0001066
1262 Ga0496110_0036762
1263 Ga0496110_0071408
1264 Ga0496110_1520346
1265 Ga0496110_1628692
1266 Ga0496111_0001736
1267 Ga0496111_0015720
1268 Ga0496111_0214896
1269 Ga0496111_0277561
1270 Ga0496112_0122482
1271 Ga0496112_0164263
1272 Ga0496112_0423240
1273 Ga0496112_1456950
1274 Ga0496113_0047599
1275 Ga0496113_0645669
1276 Ga0496113_1297529
1277 Ga0496114_0175517
1278 Ga0496115_0003812
1279 Ga0501031_0000423
1280 Ga0501031_0045461
1281 Ga0501031_0052077
1282 Ga0501031_0180230
1283 Ga0501032_0004171
1284 Ga0501032_0159643
1285 Ga0501032_0161265
1286 Ga0501033_0000701
1287 Ga0501033_0001167
1288 Ga0501033_1204110
1289 Ga0501034_0064981
1290 Ga0501034_0167335
1291 Ga0501034_0388552
1292 Ga0501034_1066800
1293 Ga0501036_0001232
1294 Ga0501036_0003366
1295 Ga0501036_0029990
1296 Ga0501036_0162018
1297 Ga0501036_0808967
1298 Ga0501037_0000071
1299 Ga0501037_0029448
1300 Ga0501037_0217721
1301 Ga0501037_0742986
1302 Ga0501037_1050616
1303 Ga0501038_0000282
1304 Ga0501038_0002599
1305 Ga0501038_0263061
1306 Ga0501038_0610440
1307 Ga0501039_0001238
1308 Ga0501039_0018650
1309 Ga0501039_0159976
1310 Ga0501040_0005050
1311 Ga0501040_0014257
1312 Ga0501040_0022273
1313 Ga0501040_0043888
1314 Ga0501040_0100663
1315 Ga0501040_0333557
1316 Ga0501040_0953288
1317 Ga0501041_0006621
1318 Ga0501041_0024753
1319 Ga0501041_0089921
1320 Ga0501041_0148317
1321 Ga0501041_0593335
1322 Ga0501042_0050503
1323 Ga0501042_0176934
1324 Ga0501042_0201314
1325 Ga0501042_0224270
1326 Ga0501042_0327920
1327 Ga0501043_0006430
1328 Ga0501043_0018673
1329 Ga0501043_0553770
1330 Ga0501043_1010767
1331 Ga0501046_0001202
1332 Ga0501046_0022209
1333 Ga0501046_0243313
1334 Ga0501046_0258469
1335 Ga0501046_0309080
1336 Ga0501046_0423661
1337 Ga0501046_0490873
1338 Ga0501046_0862292
1339 Ga0501047_0021170
1340 Ga0501047_0119947
1341 Ga0501047_0256323
1342 Ga0501047_0278211
1343 Ga0501047_0308132
1344 Ga0501047_1243070
1345 Ga0501047_1246775
1346 Ga0501048_0002033
1347 Ga0501048_0035795
1348 Ga0501048_0161853
1349 Ga0501048_0167625
1350 Ga0501048_0873581
1351 Ga0501067_0013586
1352 Ga0501067_0226433
1353 Ga0501068_0000165
1354 Ga0501068_0001849
1355 Ga0501068_0044099
1356 Ga0501068_0122378
1357 Ga0501068_0123185
1358 Ga0501068_0155305
1359 Ga0501069_0001055
1360 Ga0501069_0008336
1361 Ga0501069_0014233
1362 Ga0501069_0048902
1363 Ga0501069_0090958
1364 Ga0501069_0389598
1365 Ga0501069_0475644
1366 Ga0501069_0795716
1367 Ga0501070_0026892
1368 Ga0501070_0037934
1369 Ga0501070_0066698
1370 Ga0501070_0282019
1371 Ga0501070_0397996
1372 Ga0501070_0488860
1373 Ga0501070_0871721
1374 Ga0501071_0001246
1375 Ga0501071_0005825
1376 Ga0501071_0027693
1377 Ga0501071_0125393
1378 Ga0501071_0263741
1379 Ga0501071_0297843
1380 Ga0501071_0320555
1381 Ga0501071_0678292
1382 Ga0501071_0837135
1383 Ga0501072_0019515
1384 Ga0501072_0085306
1385 Ga0501072_0200269
1386 Ga0501072_0238678
1387 Ga0501072_0241479
1388 Ga0501072_0299548
1389 Ga0501072_0621142
1390 Ga0501072_1536086
1391 Ga0501073_0007453
1392 Ga0501073_0009624
1393 Ga0501073_0294092
1394 Ga0501073_1025818
1395 Ga0501074_0000396
1396 Ga0501074_0042237
1397 Ga0501074_0118466
1398 Ga0501074_0141919
1399 Ga0501074_0244005
1400 Ga0501074_0424660
1401 Ga0501074_0537415
1402 Ga0501075_0000942
1403 Ga0501075_0006270
1404 Ga0501075_0032266
1405 Ga0501075_0043056
1406 Ga0501075_0092578
1407 Ga0501075_0112688
1408 Ga0501075_0552460
1409 Ga0501075_0931092
1410 Ga0501075_1016218
1411 Ga0501076_0000313
1412 Ga0501076_0029406
1413 Ga0501076_0041544
1414 Ga0501076_0093559
1415 Ga0501076_0146315
1416 Ga0501076_0262290
1417 Ga0501076_0717453
1418 Ga0501076_0809545
1419 Ga0501076_0882106
1420 Ga0501077_0000128
1421 Ga0501077_0003675
1422 Ga0501077_0238857
1423 Ga0501077_0336598
1424 Ga0501233_265265
1425 Ga0501079_0000275
1426 Ga0501079_0009954
1427 Ga0501079_0075238
1428 Ga0501079_0098434
1429 Ga0501079_0474911
1430 Ga0501079_1599241
1431 Ga0501080_0003178
1432 Ga0501080_0007567
1433 Ga0501080_0043076
1434 Ga0501080_0286845
1435 Ga0501080_0825836
1436 Ga0501081_0001872
1437 Ga0501081_0003247
1438 Ga0501081_0092059
1439 Ga0501081_0139229
1440 Ga0501081_0223888
1441 Ga0501081_0272891
1442 Ga0501081_0289184
1443 Ga0501081_0328038
1444 Ga0501081_0362320
1445 Ga0501081_0973078
1446 Ga0501083_0000523
1447 Ga0501083_0020768
1448 Ga0501083_0138534
1449 Ga0501083_0406197
1450 Ga0501083_0670211
1451 Ga0501083_0789205
1452 Ga0501035_0001459
1453 Ga0501035_0011064
1454 Ga0501035_0201307
1455 Ga0501035_0797603
1456 Ga0501035_1446702
1457 Ga0501044_0002766
1458 Ga0501044_0059800
1459 Ga0501044_0096915
1460 Ga0501044_0279863
1461 Ga0501044_0519803
1462 Ga0501044_0655743
1463 Ga0501044_0760873
1464 Ga0501045_0000995
1465 Ga0501045_0014347
1466 Ga0501045_0015710
1467 Ga0501045_0028429
1468 Ga0501045_0028582
1469 Ga0501045_0186121
1470 Ga0501045_0295909
1471 Ga0501045_1335077
1472 nmdc:mga00v17_60674_c1
1473 nmdc:mga05p37_1081526_c1
1474 nmdc:mga05p37_138356_c1
1475 nmdc:mga05p37_238267_c1
1476 nmdc:mga05p37_243507_c1
1477 nmdc:mga05p37_399898_c1
1478 nmdc:mga05p37_85942_c1
1479 nmdc:mga05p37_970416_c1
1480 nmdc:mga09592_1307159_c1
1481 nmdc:mga09592_1713350_c1
1482 nmdc:mga09592_18243_c1
1483 nmdc:mga0qj67_1452021_c1
1484 nmdc:mga0qj67_31209_c1
1485 nmdc:mga06r32_298045_c1
1486 nmdc:mga06r32_340296_c1
1487 nmdc:mga06r32_544283_c1
1488 nmdc:mga08y16_22314_c1
1489 nmdc:mga08y16_25158_c1
1490 nmdc:mga08y16_568041_c1
1491 nmdc:mga08y16_67021_c1
1492 nmdc:mga08y16_939927_c1
1493 nmdc:mga0n895_18845_c1
1494 nmdc:mga0n895_2268_c1
1495 nmdc:mga0n895_311153_c1
1496 nmdc:mga0n895_459163_c1
1497 nmdc:mga0n895_465669_c1
1498 nmdc:mga0rr50_1215657_c1
1499 nmdc:mga0rr50_1797596_c1
1500 nmdc:mga0rr50_270655_c1
1501 nmdc:mga08x19_70560_c1
1502 nmdc:mga0a205_115921_c1
1503 nmdc:mga0a205_325_c1
1504 nmdc:mga0a205_813927_c1
1505 Ga0495655_0016953
1506 Ga0495655_0031670
1507 Ga0501084_0026979
1508 Ga0501084_0103174
1509 Ga0501084_0112570
1510 Ga0501084_0118298
1511 Ga0501084_0128406
1512 Ga0501084_0163217
1513 Ga0501084_0233367
1514 Ga0501084_0424380
1515 Ga0501084_0441143
1516 Ga0501084_0883394
1517 Ga0590075_044817
1518 Ga0587082_019302
1519 Ga0501082_0003090
1520 Ga0501082_0003840
1521 Ga0501082_0058613
1522 Ga0501082_0115724
1523 Ga0501082_0139391
1524 Ga0501082_0197741
1525 Ga0501082_0360929
1526 Ga0501082_0720596
1527 Ga0501082_0734479
1528 Ga0501082_0748866
1529 Ga0501082_0912144
1530 Ga0530510_0000191
1531 Ga0530510_0004781
1532 Ga0530510_0023943
1533 Ga0530510_0039831
1534 Ga0530510_0073357
1535 Ga0530510_0077770
1536 Ga0530510_0303760
1537 Ga0530510_1015014
1538 Ga0530510_1235102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02686

GatC

Glu-tRNAGln amidotransferase C subunit

19

90

0.95

Map