F479921

General Info

Members Datasets Scaffolds Average Seq Length
767 594 1532 329

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0004348|Ga0496125_0004348_13198_14373
Length 391
Sequence MLLLNNGRPMQELRETAPVPAPRYAANSGPFAGQNAAAAAPGHPIALTHRGLHVNRFIIALAAGLGILATAPAQAQTSNTLLNVSYDISRELYAEINVAFAKQWKAKTGQDVTINQSHNGSSRQARSILEGLEADVVTFNQVTDVQVLYDRGKLIPADWAKRLPNNSSPYYSLPAFLVRAGNPKGIKDWDDLVKPGVQVIFPNPKTSGNARYTYLAAYAFAKNKYGADKADDFIKKLFANVPVFDTGGRAATTTFVERGTGDVLITFEAETSSIRDLAGKDAGGKDKYEVVVPPTSVLAEFPVTVVDKYADKHGTKALATAYLEFLYSPEGQDIEAKGYNRVTDKTVMAKYKDKFPEVKLYRVEDEFGGWDKLNAEHLNPGAKLDTLFGGK

Samples

Sample ID Description Type Environment
1 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
51 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
106 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
111 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
138 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
139 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
140 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
151 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
152 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
193 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
194 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
197 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
198 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
199 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
200 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
201 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
202 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
203 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
204 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
205 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
206 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
207 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
210 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
213 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
214 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
215 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
216 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
217 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
224 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
225 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
226 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
227 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
228 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
229 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
230 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
231 2512875024
232 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
233 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
234 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
235 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
236 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
237 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
238 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
239 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
240 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
241 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
242 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
243 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
244 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
245 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
246 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
247 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
248 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
249 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
250 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
251 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
252 2643221557 Ensifer sp. Root558 Isolate Unclassified
253 2643221558 Rhizobium sp. Root149 Isolate Unclassified
254 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
255 2643221580 Devosia sp. Root635 Isolate Unclassified
256 2643221582 Rhizobium sp. Root651 Isolate Unclassified
257 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
258 2643221610 Ensifer sp. Root74 Isolate Unclassified
259 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
260 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
261 2643221668 Ensifer sp. Root423 Isolate Unclassified
262 2643221675 Ensifer sp. Root1298 Isolate Unclassified
263 2643221680 Ensifer sp. Root1312 Isolate Unclassified
264 2643221693 Rhizobium sp. Root491 Isolate Unclassified
265 2643221726 Ensifer sp. Root954 Isolate Unclassified
266 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
267 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
268 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
269 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
270 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
271 2738543024 Aminobacter sp. AP02 Isolate Unclassified
272 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
273 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
274 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
275 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
276 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
277 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
278 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
279 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
280 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
281 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
282 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
283 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
284 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
285 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
286 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
287 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
288 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
289 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
290 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
291 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
292 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
293 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
294 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
295 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
296 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
297 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
298 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
299 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
300 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
301 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
302 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
303 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
304 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
305 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
306 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
307 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
308 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
309 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
310 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
311 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
312 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
313 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
314 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
315 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
316 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
317 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
318 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
319 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
320 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
321 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
322 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
323 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
324 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
325 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
326 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
327 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
328 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
329 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
330 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
331 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
332 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
333 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
334 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
335 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
336 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
337 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
338 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
339 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
340 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
341 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
342 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
343 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
344 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
345 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
346 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
347 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
348 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
349 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
350 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
351 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
352 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
353 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
354 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
355 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
356 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
357 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
358 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
359 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
360 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
361 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
362 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
363 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
364 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
365 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
366 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
367 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
368 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
369 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
370 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
371 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
372 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
373 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
374 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
375 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
376 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
377 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
378 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
379 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
380 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
381 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
382 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
383 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
384 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
385 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
386 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
387 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
388 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
389 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
390 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
391 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
392 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
393 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
394 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
395 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
396 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
397 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
398 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
399 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
400 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
401 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
402 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
403 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
404 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
405 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
406 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
407 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
408 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
409 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
410 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
411 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
412 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
413 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
414 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
415 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
416 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
417 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
418 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
419 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
420 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
421 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
422 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
423 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
424 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
425 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
426 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
427 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
428 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
429 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
430 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
431 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
432 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
433 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
434 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
435 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
436 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
437 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
438 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
439 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
440 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
441 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
442 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
443 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
444 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
445 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
446 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
447 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
448 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
449 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
450 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
451 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
452 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
453 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
454 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
455 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
456 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
457 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
458 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
459 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
460 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
461 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
462 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
463 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
464 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
465 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
466 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
467 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
468 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
469 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
470 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
471 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
472 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
473 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
474 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
475 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
476 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
477 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
478 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
479 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
480 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
481 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
482 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
483 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
484 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
485 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
486 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
487 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
488 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
489 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
490 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
491 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
492 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
493 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
494 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
495 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
496 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
497 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
498 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
499 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
500 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
501 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
502 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
503 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
504 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
505 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
506 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
507 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
508 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
509 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
510 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
511 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
512 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
513 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
514 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
515 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
516 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
517 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
518 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
519 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
520 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
521 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
522 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
523 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
524 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
525 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
526 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
527 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
528 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
529 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
530 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
531 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
532 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
533 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
534 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
535 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
536 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
537 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
538 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
539 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
540 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
541 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
542 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
543 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
544 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
545 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
546 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
547 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
548 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
549 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
550 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
551 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
552 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
553 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
554 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
555 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
556 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
557 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
558 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
559 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
560 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
561 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
562 3004167301 Mesorhizobium loti 582 Isolate Unclassified
563 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
564 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
565 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
566 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
567 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
568 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
569 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
570 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
571 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
572 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
573 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
574 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
575 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
576 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
577 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
578 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
579 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
580 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
581 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
582 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
583 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
584 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
585 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
586 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
587 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
588 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
589 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
590 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
591 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
592 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
593 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
594 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 51.11
Metatranscriptomes 0.39
Isolates 48.5

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 12.91
Nodule 34.68
Rhizoplane 2.35
Rhizosphere 32.2
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496125_0004348 3300048928 Bacteria 16435
2 JGI24735J21928_10019950 3300002067 Bacteria 2057
3 JGI25156J39149_1002906 3300002705 Bacteria 5853
4 JGI25162J39368_1000525 3300002737 Bacteria 28580
5 JGI25157J39369_1001345 3300002741 Bacteria 9708
6 JGI25159J45721_1016495 3300002987 Bacteria 1571
7 JGI25151J46595_10009032 3300003187 Bacteria 4752
8 JGI25406J46586_10028012 3300003203 Bacteria 2152
9 JGI25165J46597_1000015 3300003214 Bacteria 380891
10 JGI25165J46597_1000632 3300003214 Bacteria 29113
11 rootH1_10010014 3300003323 Bacteria 5308
12 JGI25160J50197_1015000 3300003354 Bacteria 2563
13 Ga0055542_1000406 3300003762 Bacteria 42163
14 Ga0055526_1035186 3300003771 Bacteria 1355
15 Ga0055524_1000633 3300003775 Bacteria 25060
16 Ga0058692_1001955 3300003856 Bacteria 7181
17 Ga0065165_1033194 3300005262 Bacteria 1609
18 Ga0065707_10135447 3300005295 Bacteria 1849
19 Ga0070670_100000186 3300005331 Bacteria 56675
20 Ga0070666_10000951 3300005335 Bacteria 17634
21 Ga0070666_10142575 3300005335 Bacteria 1669
22 Ga0070660_100263138 3300005339 Bacteria 1409
23 Ga0070691_10004979 3300005341 Bacteria 6045
24 Ga0070668_100182157 3300005347 Bacteria 1716
25 Ga0070668_100186686 3300005347 Bacteria 1696
26 Ga0070673_100002855 3300005364 Bacteria 10628
27 Ga0070667_100000061 3300005367 Bacteria 143754
28 Ga0070667_100104767 3300005367 Bacteria 2447
29 Ga0070663_100000771 3300005455 Bacteria 17457
30 Ga0070707_100059348 3300005468 Bacteria 3670
31 Ga0070707_100374326 3300005468 Bacteria 1384
32 Ga0068853_100000738 3300005539 Bacteria 22660
33 Ga0068853_100177309 3300005539 Bacteria 1931
34 Ga0070686_100203058 3300005544 Bacteria 1422
35 Ga0070665_100041488 3300005548 Bacteria 4626
36 Ga0070665_100048847 3300005548 Bacteria 4247
37 Ga0070665_100475866 3300005548 Bacteria 1260
38 Ga0070704_100062147 3300005549 Bacteria 2676
39 Ga0068855_100449391 3300005563 Bacteria 1406
40 Ga0068857_100055754 3300005577 Bacteria 3507
41 Ga0068854_100275582 3300005578 Bacteria 1352
42 Ga0068856_100425642 3300005614 Bacteria 1348
43 Ga0068852_100319448 3300005616 Bacteria 1507
44 Ga0068861_100056704 3300005719 Bacteria 2991
45 Ga0068860_100188747 3300005843 Bacteria 1994
46 Ga0068862_100220468 3300005844 Bacteria 1717
47 Ga0081455_10001150 3300005937 Bacteria 33155
48 Ga0081455_10284553 3300005937 Bacteria 1193
49 Ga0081539_10000302 3300005985 Bacteria 111364
50 Ga0075365_10014077 3300006038 Bacteria 4805
51 Ga0075365_10042506 3300006038 Bacteria 2972
52 Ga0075365_10044407 3300006038 Bacteria 2911
53 Ga0075365_10103788 3300006038 Bacteria 1949
54 Ga0075365_10123584 3300006038 Bacteria 1787
55 Ga0075368_10028753 3300006042 Bacteria 2148
56 Ga0075363_100016219 3300006048 Bacteria 3677
57 Ga0075363_100052355 3300006048 Bacteria 2179
58 Ga0075364_10128124 3300006051 Bacteria 1702
59 Ga0075367_10047435 3300006178 Bacteria 2527
60 Ga0075367_10049242 3300006178 Bacteria 2483
61 Ga0075369_10003698 3300006186 Bacteria 5590
62 Ga0075369_10011657 3300006186 Bacteria 3461
63 Ga0075369_10045387 3300006186 Bacteria 1889
64 Ga0075366_10016952 3300006195 Bacteria 4188
65 Ga0075366_10051190 3300006195 Bacteria 2454
66 Ga0075370_10046776 3300006353 Bacteria 2449
67 Ga0075370_10086907 3300006353 Bacteria 1801
68 Ga0068871_100137083 3300006358 Bacteria 2079
69 Ga0079104_1000063 3300006946 Bacteria 159519
70 Ga0099826_10000590 3300006948 Bacteria 18363
71 Ga0099826_10006096 3300006948 Bacteria 8735
72 Ga0105247_10209881 3300009101 Bacteria 1313
73 Ga0105241_10268978 3300009174 Bacteria 1451
74 Ga0105248_10000844 3300009177 Bacteria 34450
75 Ga0105248_10002580 3300009177 Bacteria 20127
76 Ga0105248_10185110 3300009177 Bacteria 2347
77 Ga0105237_10003173 3300009545 Bacteria 19725
78 Ga0105237_10183770 3300009545 Bacteria 2091
79 Ga0105237_10246797 3300009545 Bacteria 1787
80 Ga0105238_10002443 3300009551 Bacteria 18648
81 Ga0105249_10001401 3300009553 Bacteria 21100
82 Ga0105249_10117192 3300009553 Bacteria 2526
83 Ga0105239_10038661 3300010375 Bacteria 5229
84 Ga0105239_10237693 3300010375 Bacteria 2045
85 Ga0105239_10397820 3300010375 Bacteria 1559
86 Ga0157373_10044793 3300013100 Bacteria 3159
87 Ga0157371_10000002 3300013102 Bacteria 665040
88 Ga0157371_10021906 3300013102 Bacteria 4689
89 Ga0157370_10000143 3300013104 Bacteria 87289
90 Ga0157372_10243173 3300013307 Bacteria 2088
91 Ga0157372_10383891 3300013307 Bacteria 1637
92 Ga0157375_10347688 3300013308 Bacteria 1648
93 Ga0182008_10129200 3300014497 Bacteria 1259
94 Ga0157379_10037584 3300014968 Bacteria 4318
95 Ga0163161_10000613 3300017792 Bacteria 28530
96 Ga0209437_100248 3300025233 Bacteria 86351
97 Ga0209646_1018222 3300025246 Bacteria 1030
98 Ga0209026_1000025 3300025250 Bacteria 352548
99 Ga0209148_1000181 3300025254 Bacteria 124691
100 Ga0209759_1000226 3300025256 Bacteria 84383
101 Ga0209233_1000010 3300025261 Bacteria 1194329
102 Ga0209233_1000241 3300025261 Bacteria 90643
103 Ga0209455_1000127 3300025272 Bacteria 162518
104 Ga0209130_1000345 3300025284 Bacteria 53433
105 Ga0209025_1000245 3300025294 Bacteria 127801
106 Ga0209564_1000762 3300025295 Bacteria 45471
107 Ga0209758_1044499 3300025297 Bacteria 1621
108 Ga0209256_1000310 3300025299 Bacteria 85227
109 Ga0207426_1000065 3300025302 Bacteria 353625
110 Ga0207653_10045568 3300025885 Bacteria 1449
111 Ga0207680_10000902 3300025903 Bacteria 14031
112 Ga0207647_10004726 3300025904 Bacteria 10086
113 Ga0207705_10140607 3300025909 Bacteria 1802
114 Ga0207654_10080310 3300025911 Bacteria 1961
115 Ga0207707_10154653 3300025912 Bacteria 2006
116 Ga0207671_10005674 3300025914 Bacteria 11408
117 Ga0207671_10094056 3300025914 Bacteria 2262
118 Ga0207694_10013751 3300025924 Bacteria 6101
119 Ga0207650_10001166 3300025925 Bacteria 19321
120 Ga0207687_10233008 3300025927 Bacteria 1455
121 Ga0207664_10217187 3300025929 Bacteria 1657
122 Ga0207709_10073703 3300025935 Bacteria 2176
123 Ga0207709_10258365 3300025935 Bacteria 1276
124 Ga0207669_10164838 3300025937 Bacteria 1570
125 Ga0207665_10070784 3300025939 Bacteria 2380
126 Ga0207711_10001830 3300025941 Bacteria 19386
127 Ga0207667_10410605 3300025949 Bacteria 1378
128 Ga0207712_10000267 3300025961 Bacteria 50698
129 Ga0207712_10096037 3300025961 Bacteria 2193
130 Ga0207668_10264766 3300025972 Bacteria 1403
131 Ga0207668_10378878 3300025972 Bacteria 1190
132 Ga0207658_10000166 3300025986 Bacteria 70441
133 Ga0207639_10200416 3300026041 Bacteria 1711
134 Ga0207639_10426290 3300026041 Bacteria 1200
135 Ga0207678_10003795 3300026067 Bacteria 13582
136 Ga0207678_10004017 3300026067 Bacteria 13239
137 Ga0207678_10283120 3300026067 Bacteria 1423
138 Ga0207641_10334806 3300026088 Bacteria 1439
139 Ga0207648_10466818 3300026089 Bacteria 1151
140 Ga0207675_100110041 3300026118 Bacteria 2600
141 Ga0207683_10168462 3300026121 Bacteria 1983
142 Ga0209281_1000110 3300027111 Bacteria 215631
143 Ga0209371_1000003 3300027312 Bacteria 1122971
144 Ga0209371_1001357 3300027312 Bacteria 16945
145 Ga0209371_1001699 3300027312 Bacteria 13954
146 Ga0209282_1001047 3300027666 Bacteria 14588
147 Ga0209813_10006356 3300027866 Bacteria 2916
148 Ga0307515_10000556 3300028794 Bacteria 88174
149 Ga0307515_10145550 3300028794 Bacteria 2512
150 Ga0268256_1000004 3300030500 Bacteria 1122967
151 Ga0316181_1029509 3300030744 Bacteria 1991
152 Ga0307409_100236817 3300031995 Bacteria 1659
153 Ga0307414_10377532 3300032004 Bacteria 1225
154 Ga0395899_0000442 3300037312 Bacteria 47552
155 Ga0395899_0107687 3300037312 Bacteria 2006
156 Ga0395900_0000643 3300037418 Bacteria 46926
157 Ga0395900_0419769 3300037418 Bacteria 1299
158 Ga0395898_0000914 3300037466 Bacteria 47305
159 Ga0395898_0286411 3300037466 Bacteria 1572
160 Ga0395905_0000621 3300037471 Bacteria 47593
161 Ga0395905_0031722 3300037471 Bacteria 4971
162 Ga0395905_0178288 3300037471 Bacteria 1995
163 Ga0395901_0000466 3300038443 Bacteria 47044
164 Ga0395901_0002791 3300038443 Bacteria 17615
165 Ga0395901_0075618 3300038443 Bacteria 3513
166 Ga0451577_0000029 3300042876 Bacteria 395301
167 Ga0451577_0000644 3300042876 Bacteria 55517
168 Ga0451577_0013426 3300042876 Bacteria 7664
169 Ga0466972_0013553 3300044658 Bacteria 4092
170 Ga0453683_0000565 3300044673 Bacteria 40909
171 Ga0453683_0152717 3300044673 Bacteria 1459
172 Ga0453684_0000088 3300044712 Bacteria 395200
173 Ga0453684_0001135 3300044712 Bacteria 83367
174 Ga0453684_0022167 3300044712 Bacteria 9442
175 Ga0453684_0096723 3300044712 Bacteria 3626
176 Ga0453684_0363266 3300044712 Bacteria 1629
177 Ga0466960_0023417 3300044901 Bacteria 2773
178 Ga0451576_0000897 3300045051 Bacteria 56638
179 Ga0451576_0001707 3300045051 Bacteria 36278
180 Ga0451576_0005334 3300045051 Bacteria 16159
181 Ga0451576_0029032 3300045051 Bacteria 5920
182 Ga0495638_0007422 3300046460 Bacteria 7863
183 Ga0495638_0055862 3300046460 Bacteria 2451
184 Ga0495638_0060795 3300046460 Bacteria 2335
185 Ga0495650_0042945 3300046471 Bacteria 1922
186 Ga0495606_0005945 3300046507 Bacteria 11454
187 Ga0495606_0015529 3300046507 Bacteria 5861
188 Ga0495606_0095129 3300046507 Unclassified 1825
189 Ga0495610_0098369 3300046512 Bacteria 1314
190 Ga0495620_0022922 3300046515 Bacteria 2995
191 Ga0495632_0093743 3300046519 Bacteria 1421
192 Ga0495648_0035152 3300046524 Bacteria 3251
193 Ga0495654_0000121 3300046530 Bacteria 86743
194 Ga0495597_0024438 3300046542 Bacteria 2789
195 Ga0495622_0029791 3300046557 Bacteria 2550
196 Ga0495611_0072796 3300046648 Bacteria 1573
197 Ga0495625_0088412 3300046660 Bacteria 2146
198 Ga0495661_0020810 3300046665 Bacteria 4277
199 Ga0495588_0001686 3300046674 Bacteria 9404
200 Ga0495588_0044756 3300046674 Bacteria 2268
201 Ga0495671_0013808 3300046692 Bacteria 4360
202 Ga0495671_0089992 3300046692 Bacteria 1502
203 Ga0495681_0003679 3300047470 Bacteria 10645
204 Ga0495686_0000090 3300047472 Bacteria 193179
205 Ga0495686_0002924 3300047472 Bacteria 15317
206 Ga0495686_0015281 3300047472 Bacteria 5248
207 Ga0495686_0053679 3300047472 Bacteria 2525
208 Ga0495686_0131658 3300047472 Bacteria 1482
209 Ga0495686_0138786 3300047472 Bacteria 1436
210 Ga0496100_0025877 3300048903 Bacteria 3591
211 Ga0496104_0171806 3300048907 Bacteria 2078
212 Ga0496105_0016376 3300048908 Bacteria 5917
213 Ga0496106_0097841 3300048909 Bacteria 2272
214 Ga0496107_0001872 3300048910 Bacteria 13311
215 Ga0496107_0008338 3300048910 Bacteria 7169
216 Ga0496107_0031857 3300048910 Bacteria 3765
217 Ga0496112_0102569 3300048915 Bacteria 2831
218 Ga0496113_0018640 3300048916 Bacteria 4838
219 Ga0496113_0197748 3300048916 Bacteria 1597
220 Ga0496115_0280960 3300048918 Bacteria 1367
221 Ga0496116_0000167 3300048919 Bacteria 132540
222 Ga0496116_0006837 3300048919 Bacteria 10250
223 Ga0496116_0010207 3300048919 Bacteria 7900
224 Ga0496116_0083598 3300048919 Bacteria 1970
225 Ga0496117_0000016 3300048920 Bacteria 523642
226 Ga0496117_0022136 3300048920 Bacteria 5105
227 Ga0496117_0032023 3300048920 Bacteria 4004
228 Ga0496118_0002108 3300048921 Bacteria 27877
229 Ga0496118_0021360 3300048921 Bacteria 5700
230 Ga0496118_0062078 3300048921 Bacteria 2762
231 Ga0496119_0001369 3300048922 Bacteria 29726
232 Ga0496119_0016216 3300048922 Bacteria 5687
233 Ga0496119_0065976 3300048922 Bacteria 2141
234 Ga0496119_0067689 3300048922 Bacteria 2105
235 Ga0496120_0000164 3300048923 Bacteria 111959
236 Ga0496120_0004133 3300048923 Bacteria 12496
237 Ga0496121_0000523 3300048924 Bacteria 73281
238 Ga0496121_0017943 3300048924 Bacteria 7178
239 Ga0496121_0082903 3300048924 Bacteria 2533
240 Ga0496122_0000002 3300048925 Bacteria 905834
241 Ga0496122_0000374 3300048925 Bacteria 96140
242 Ga0496122_0001100 3300048925 Bacteria 46751
243 Ga0496122_0003869 3300048925 Bacteria 19213
244 Ga0496122_0032435 3300048925 Bacteria 4319
245 Ga0496122_0034574 3300048925 Bacteria 4133
246 Ga0496122_0042421 3300048925 Bacteria 3580
247 Ga0496122_0068401 3300048925 Bacteria 2550
248 Ga0496123_0000002 3300048926 Bacteria 1811682
249 Ga0496123_0001129 3300048926 Bacteria 39855
250 Ga0496123_0003310 3300048926 Bacteria 18254
251 Ga0496123_0008338 3300048926 Bacteria 9535
252 Ga0496123_0012303 3300048926 Bacteria 7311
253 Ga0496123_0042635 3300048926 Bacteria 3129
254 Ga0496123_0055004 3300048926 Bacteria 2614
255 Ga0496123_0057214 3300048926 Bacteria 2540
256 Ga0496124_0010543 3300048927 Bacteria 9343
257 Ga0496124_0049939 3300048927 Bacteria 3565
258 Ga0496124_0067023 3300048927 Bacteria 2988
259 Ga0496124_0069674 3300048927 Bacteria 2920
260 Ga0496124_0074950 3300048927 Bacteria 2796
261 Ga0496124_0341390 3300048927 Bacteria 1063
262 Ga0496125_0000176 3300048928 Bacteria 140746
263 Ga0496125_0000564 3300048928 Bacteria 63635
264 Ga0496125_0003773 3300048928 Bacteria 18023
265 Ga0496125_0006078 3300048928 Bacteria 13179
266 Ga0496125_0041344 3300048928 Bacteria 3942
267 Ga0496125_0083303 3300048928 Bacteria 2433
268 Ga0496126_0000768 3300048929 Bacteria 58074
269 Ga0496126_0002716 3300048929 Bacteria 23394
270 Ga0496126_0024086 3300048929 Bacteria 5881
271 Ga0496126_0115981 3300048929 Bacteria 2328
272 Ga0496126_0278417 3300048929 Bacteria 1386
273 Ga0501031_0000010 3300049568 Bacteria 146435
274 Ga0501031_0137982 3300049568 Bacteria 1593
275 Ga0501032_0000023 3300049569 Bacteria 146435
276 Ga0501032_0066256 3300049569 Bacteria 2414
277 Ga0501033_0000308 3300049570 Bacteria 46219
278 Ga0501033_0207467 3300049570 Bacteria 1398
279 Ga0501034_0000116 3300049571 Bacteria 146442
280 Ga0501034_0114855 3300049571 Bacteria 2681
281 Ga0501034_0143318 3300049571 Bacteria 2368
282 Ga0501034_0148496 3300049571 Bacteria 2320
283 Ga0501034_0157550 3300049571 Bacteria 2244
284 Ga0501034_0190808 3300049571 Bacteria 2011
285 Ga0501034_0292826 3300049571 Bacteria 1565
286 Ga0501036_0000015 3300049572 Bacteria 146442
287 Ga0501036_0224544 3300049572 Bacteria 1577
288 Ga0501037_0000023 3300049573 Bacteria 146542
289 Ga0501037_0033165 3300049573 Bacteria 3814
290 Ga0501037_0170074 3300049573 Bacteria 1549
291 Ga0501038_0000025 3300049574 Bacteria 146542
292 Ga0501038_0244223 3300049574 Bacteria 1424
293 Ga0501039_0000037 3300049575 Bacteria 122286
294 Ga0501040_0044072 3300049576 Bacteria 3041
295 Ga0501041_0245794 3300049577 Bacteria 1124
296 Ga0501043_0000449 3300049579 Bacteria 36900
297 Ga0501043_0001865 3300049579 Bacteria 18055
298 Ga0501043_0013344 3300049579 Bacteria 6424
299 Ga0501043_0026052 3300049579 Bacteria 4588
300 Ga0501046_0020720 3300049580 Bacteria 5434
301 Ga0501046_0027024 3300049580 Bacteria 4685
302 Ga0501046_0031319 3300049580 Bacteria 4313
303 Ga0501046_0171993 3300049580 Bacteria 1625
304 Ga0501047_0001418 3300049581 Bacteria 23519
305 Ga0501047_0003874 3300049581 Bacteria 14078
306 Ga0501048_0050475 3300049582 Bacteria 2963
307 Ga0501067_0004489 3300049583 Bacteria 7697
308 Ga0501067_0016882 3300049583 Bacteria 4033
309 Ga0501067_0037891 3300049583 Bacteria 2678
310 Ga0501073_0045762 3300049589 Bacteria 3081
311 Ga0501073_0059516 3300049589 Bacteria 2667
312 Ga0501073_0062139 3300049589 Bacteria 2605
313 Ga0501073_0068183 3300049589 Bacteria 2479
314 Ga0501074_0147519 3300049590 Bacteria 1682
315 Ga0501075_0239491 3300049591 Bacteria 1383
316 Ga0501076_0067376 3300049592 Bacteria 2858
317 Ga0501077_0101171 3300049593 Bacteria 1826
318 Ga0501079_0117213 3300049741 Bacteria 2070
319 Ga0501080_0064535 3300049742 Bacteria 3405
320 Ga0501083_0000420 3300049744 Bacteria 27191
321 Ga0501083_0009682 3300049744 Bacteria 6806
322 Ga0501035_0000074 3300049822 Bacteria 122269
323 Ga0501035_0026442 3300049822 Bacteria 5309
324 Ga0501044_0000069 3300049823 Bacteria 125974
325 Ga0501044_0077145 3300049823 Bacteria 3380
326 Ga0501044_0287437 3300049823 Bacteria 1576
327 Ga0501045_0267488 3300049824 Bacteria 1273
328 nmdc:mga00v17_1002_c1 3300050491 Bacteria 15107
329 nmdc:mga00v17_5182_c1 3300050491 Bacteria 6856
330 nmdc:mga00v17_53_c1 3300050491 Bacteria 72424
331 nmdc:mga00v17_57866_c1 3300050491 Bacteria 2372
332 nmdc:mga00v17_66077_c1 3300050491 Bacteria 2232
333 nmdc:mga0yw44_139511_c1 3300050492 Bacteria 1575
334 nmdc:mga0yw44_15153_c1 3300050492 Bacteria 4120
335 nmdc:mga0yw44_15432_c1 3300050492 Bacteria 4092
336 nmdc:mga0yw44_260_c1 3300050492 Bacteria 18045
337 nmdc:mga0yw44_26881_c1 3300050492 Bacteria 3291
338 nmdc:mga0yw44_4634_c1 3300050492 Bacteria 6348
339 nmdc:mga06z11_152216_c1 3300050494 Bacteria 1316
340 nmdc:mga06z11_49950_c1 3300050494 Bacteria 2136
341 nmdc:mga04h51_17733_c1 3300050495 Bacteria 2088
342 nmdc:mga07m45_26376_c1 3300050496 Bacteria 3194
343 nmdc:mga0sz30_19862_c1 3300050516 Bacteria 2705
344 nmdc:mga0sz30_27041_c1 3300050516 Bacteria 2354
345 nmdc:mga0sz30_38021_c1 3300050516 Bacteria 2016
346 nmdc:mga0sz30_6268_c1 3300050516 Bacteria 4411
347 nmdc:mga0sz30_6399_c1 3300050516 Bacteria 4370
348 Ga0500635_0000170 3300053080 Bacteria 33760
349 Ga0500643_002593 3300053087 Bacteria 9171
350 Ga0500643_011679 3300053087 Bacteria 3188
351 Ga0500643_044840 3300053087 Bacteria 1283
352 Ga0500644_0026583 3300053088 Bacteria 1792
353 Ga0500641_0042103 3300053096 Bacteria 1849
354 Ga0500650_0091396 3300053098 Bacteria 1424
355 Ga0500556_0000003 3300053104 Bacteria 679379
356 Ga0500556_0000113 3300053104 Bacteria 70501
357 Ga0500560_000068 3300053107 Bacteria 10023
358 Ga0500593_000061 3300053117 Bacteria 40152
359 Ga0500594_0029832 3300053118 Bacteria 1428
360 Ga0500597_000278 3300053120 Bacteria 10323
361 Ga0500608_018918 3300053122 Bacteria 3150
362 Ga0500618_000171 3300053125 Bacteria 54421
363 Ga0500618_000243 3300053125 Bacteria 43364
364 Ga0500618_000581 3300053125 Bacteria 22578
365 Ga0500618_038282 3300053125 Bacteria 1107
366 Ga0500642_0000015 3300053130 Bacteria 181424
367 Ga0500652_001262 3300053131 Bacteria 8040
368 Ga0500652_088978 3300053131 Bacteria 1289
369 Ga0500559_0001373 3300053136 Bacteria 13958
370 Ga0500561_0000227 3300053137 Bacteria 10167
371 Ga0500568_0000005 3300053139 Bacteria 614296
372 Ga0500568_0000118 3300053139 Bacteria 70929
373 Ga0500568_0000600 3300053139 Bacteria 26168
374 Ga0500573_0006872 3300053140 Bacteria 6176
375 Ga0500586_000891 3300053145 Bacteria 6150
376 Ga0500616_0000114 3300053153 Bacteria 148574
377 Ga0500620_000059 3300053155 Bacteria 20299
378 Ga0500622_0003486 3300053156 Bacteria 10454
379 Ga0500634_0000697 3300053161 Bacteria 11540
380 Ga0500634_0041749 3300053161 Bacteria 2490
381 Ga0500634_0041841 3300053161 Bacteria 2487
382 Ga0500636_0004051 3300053177 Bacteria 8269
383 Ga0500636_0115044 3300053177 Bacteria 1515
384 Ga0500637_0013874 3300053178 Bacteria 4237
385 Ga0500645_018141 3300053730 Bacteria 2199
386 Ga0500645_029953 3300053730 Bacteria 1640
387 Ga0501084_0004215 3300054114 Bacteria 11725
388 Ga0501084_0243992 3300054114 Bacteria 1516
389 Ga0587077_026497 3300059493 Bacteria 1071
390 Ga0587062_010218 3300059639 Bacteria 1159
391 Ga0587072_027467 3300059643 Bacteria 1045
392 Ga0501082_0030641 3300060353 Bacteria 4635
393 Ga0501082_0194006 3300060353 Bacteria 1766
394 Ga0530510_0213389 3300061734 Bacteria 1434
395 2509113084 2508501123 Bacteria 6283661
396 2509143942 2508501127 Bacteria 7037543
397 2509367877 2509276018 Bacteria 6910194
398 2509396258 2509276022 Bacteria 6200534
399 2510315559 2510065059 Bacteria 6847884
400 2511389751 2511231027 Bacteria 5013807
401 2512931552 2512875016 Bacteria 6529530
402 2512959385 2512875024 Bacteria 7195110
403 2513591190 2513237087 Bacteria 5817514
404 2513611341 2513237090 Bacteria 7096802
405 2514033558 2513237164 Bacteria 7563725
406 2514419698 2513237305 Bacteria 7293571
407 2523103013 2522572158 Bacteria 6514390
408 2537875800 2537561587 Bacteria 5425293
409 2554245389 2554235003 Bacteria 5877155
410 2559296782 2558860242 Bacteria 5568029
411 2585204701 2582581294 Bacteria 6626667
412 2585334593 2582581316 Bacteria 7774528
413 2588517391 2588253730 Bacteria 6881675
414 2597813278 2597489875 Bacteria 7010078
415 2599602727 2599185210 Bacteria 5624189
416 2599936800 2599185301 Bacteria 6161860
417 2601610348 2600255279 Bacteria 5605316
418 2601747322 2600255308 Bacteria 5611129
419 2603860031 2602042107 Bacteria 6226103
420 2643771146 2643221550 Bacteria 4619371
421 2643776159 2643221551 Bacteria 3750538
422 2643794606 2643221555 Bacteria 3749717
423 2643809461 2643221557 Bacteria 7184309
424 2643813360 2643221558 Bacteria 5460675
425 2643839984 2643221564 Bacteria 4193379
426 2643911622 2643221580 Bacteria 3816678
427 2643917241 2643221582 Bacteria 5804683
428 2643986850 2643221595 Bacteria 6565519
429 2644066857 2643221610 Bacteria 7480339
430 2644129249 2643221623 Bacteria 5239945
431 2644157013 2643221627 Bacteria 6761570
432 2644375802 2643221668 Bacteria 7306521
433 2644418060 2643221675 Bacteria 7473456
434 2644451315 2643221680 Bacteria 7473610
435 2644520909 2643221693 Bacteria 5513853
436 2644691660 2643221726 Bacteria 7455827
437 2671694539 2671180139 Bacteria 4196045
438 2688598394 2687453392 Bacteria 6880454
439 2694631027 2693429783 Bacteria 7019804
440 2694636475 2693429784 Bacteria 7241525
441 2723575329 2721755686 Bacteria 7343952
442 2739308354 2738543024 Bacteria 5603683
443 2756672555 2756170246 Bacteria 7451806
444 2757569651 2757320392 Bacteria 3737298
445 2758641937 2758568016 Bacteria 5645291
446 2765464739 2765235802 Bacteria 5618596
447 2770195339 2767802442 Bacteria 5747986
448 2776270713 2775506902 Bacteria 6208009
449 2776280464 2775506904 Bacteria 5954060
450 2776914963 2775507049 Bacteria 6284736
451 2792752738 2791355123 Bacteria 8049106
452 2793280783 2791355253 Bacteria 5171699
453 2808987235 2808606387 Bacteria 5697198
454 2819557429 2818991439 Bacteria 6907412
455 2821126308 2821123053 Bacteria 7836056
456 2828307920 2828305725 Bacteria 4916900
457 2834579759 2834578030 Bacteria 3530182
458 2838678065 2838675328 Bacteria 4909118
459 2838717029 2838714209 Bacteria 5525906
460 2838722360 2838719591 Bacteria 5523910
461 2838727778 2838724970 Bacteria 4908691
462 2838737216 2838736955 Bacteria 5760694
463 2839996911 2839993093 Bacteria 5512535
464 2840880137 2840878972 Bacteria 5483153
465 2841739149 2841734538 Bacteria 6784580
466 2841842415 2841840854 Bacteria 5761912
467 2841849435 2841846520 Bacteria 5345850
468 2841861523 2841859092 Bacteria 5436171
469 2842127816 2842124991 Bacteria 5346824
470 2842132958 2842130223 Bacteria 4909145
471 2842142195 2842140634 Bacteria 5759631
472 2842154951 2842152218 Bacteria 4908957
473 2842173450 2842170452 Bacteria 5525737
474 2842178572 2842175837 Bacteria 4908771
475 2842190137 2842187318 Bacteria 5524014
476 2842214451 2842211629 Bacteria 5523832
477 2842227170 2842224351 Bacteria 5524473
478 2842518211 2842515876 Bacteria 5436280
479 2842871847 2842871566 Bacteria 4827117
480 2844007484 2844002411 Bacteria 7168230
481 2844013647 2844009547 Bacteria 6728125
482 2844533508 2844533157 Bacteria 7517899
483 2847675566 2847670302 Bacteria 6165597
484 2847692208 2847686936 Bacteria 6278406
485 2854681561 2854681122 Bacteria 4548679
486 2854897424 2854896431 Bacteria 5869725
487 2856319452 2856314179 Bacteria 6477897
488 2856327533 2856320880 Bacteria 7263508
489 2856334513 2856328259 Bacteria 6528202
490 2856340365 2856334872 Bacteria 7037011
491 2856343894 2856342000 Bacteria 7176905
492 2856355146 2856349417 Bacteria 6230045
493 2856364034 2856356410 Bacteria 6297484
494 2856369410 2856364286 Bacteria 6939991
495 2857351198 2857349434 Bacteria 7926032
496 2857372750 2857367948 Bacteria 6965560
497 2857525029 2857524615 Bacteria 6615449
498 2857532869 2857531043 Bacteria 6754041
499 2869168242 2869162929 Bacteria 6399702
500 2869171912 2869169390 Bacteria 6659796
501 2869237492 2869234852 Bacteria 6654993
502 2869251822 2869249662 Bacteria 6868783
503 2869260802 2869256925 Bacteria 6981691
504 2869269407 2869264136 Bacteria 6880765
505 2869276480 2869271264 Bacteria 6908218
506 2869280422 2869278585 Bacteria 7077053
507 2869286517 2869285874 Bacteria 6901219
508 2871434670 2871429161 Bacteria 6547891
509 2871437353 2871435913 Bacteria 6880295
510 2871444547 2871444079 Bacteria 6423508
511 2871459208 2871451962 Bacteria 7336357
512 2871463859 2871459585 Bacteria 6866887
513 2871472381 2871466892 Bacteria 6923287
514 2871474624 2871474448 Bacteria 6806570
515 2871482598 2871481445 Bacteria 6700002
516 2871494591 2871488783 Bacteria 6929816
517 2871501445 2871495908 Bacteria 6935695
518 2874109172 2874102143 Bacteria 6342645
519 2874113487 2874109183 Bacteria 6517025
520 2874122997 2874116593 Bacteria 6674494
521 2874130555 2874123672 Bacteria 7238285
522 2874137861 2874131515 Bacteria 6820270
523 2874144166 2874139085 Bacteria 7021506
524 2874149875 2874146452 Bacteria 7533118
525 2874158133 2874155637 Bacteria 6724144
526 2874164476 2874162495 Bacteria 6174670
527 2874169799 2874168670 Bacteria 8062617
528 2876368534 2876363079 Bacteria 6544991
529 2876375313 2876369609 Bacteria 6807521
530 2876384393 2876377896 Bacteria 6565995
531 2876390883 2876386047 Bacteria 6698674
532 2876398392 2876392853 Bacteria 6660880
533 2876403677 2876399893 Bacteria 6927900
534 2876416337 2876413966 Bacteria 6831344
535 2876427815 2876420981 Bacteria 6687741
536 2878040687 2878035449 Bacteria 6555736
537 2878731042 2878730984 Bacteria 6380721
538 2878745161 2878738818 Bacteria 7136951
539 2878751803 2878745973 Bacteria 6867388
540 2878758827 2878753008 Bacteria 6922523
541 2878765425 2878760144 Bacteria 6823465
542 2878773133 2878767105 Bacteria 6898628
543 2878775661 2878774303 Bacteria 6108671
544 2878781272 2878781027 Bacteria 6834456
545 2878793907 2878788777 Bacteria 6567085
546 2881151282 2881147464 Bacteria 7779814
547 2881161755 2881155292 Bacteria 6461656
548 2881167482 2881161766 Bacteria 7127907
549 2881852309 2881845957 Bacteria 6611900
550 2881856724 2881853255 Bacteria 6698367
551 2881864644 2881861095 Bacteria 7128710
552 2882636224 2882632389 Bacteria 8154593
553 2882918521 2882912400 Bacteria 6801539
554 2885309381 2885305155 Bacteria 7348390
555 2885318033 2885312484 Bacteria 6415165
556 2885322405 2885318864 Bacteria 6729568
557 2885330043 2885326080 Bacteria 7134805
558 2885334666 2885334103 Bacteria 7216818
559 2885350083 2885342637 Bacteria 7011821
560 2885355632 2885350715 Bacteria 6787678
561 2888339373 2888337043 Bacteria 6629336
562 2888346749 2888343758 Bacteria 6611049
563 2888355711 2888350351 Bacteria 7372807
564 2889010646 2889010040 Bacteria 6749192
565 2889017653 2889016732 Bacteria 6700763
566 2891049509 2891048133 Bacteria 4447501
567 2893071268 2893066018 Bacteria 6158120
568 2894656087 2894652903 Bacteria 4587256
569 2898796513 2898795034 Bacteria 4294459
570 2899279491 2899275550 Bacteria 3958688
571 2899792645 2899792073 Bacteria 4926588
572 2899850089 2899845264 Bacteria 5672268
573 2903451260 2903448605 Bacteria 7357801
574 2903503934 2903492973 Bacteria 13473544
575 2903504749 2903492973 Bacteria 13473544
576 2903518783 2903513507 Bacteria 6344008
577 2903527533 2903521522 Bacteria 6525694
578 2903533987 2903528002 Bacteria 6586099
579 2903546256 2903540706 Bacteria 7062119
580 2904664947 2904659560 Bacteria 6685615
581 2906314201 2906308376 Bacteria 6841989
582 2906327367 2906321335 Bacteria 6579571
583 2906330057 2906328253 Bacteria 6585166
584 2906355158 2906354277 Bacteria 6991324
585 2906364302 2906363423 Bacteria 6856682
586 2906371554 2906370794 Bacteria 6881062
587 2906382064 2906378014 Bacteria 6911440
588 2906391605 2906386501 Bacteria 5977019
589 2906398253 2906393657 Bacteria 6790866
590 2906402853 2906401398 Bacteria 6693206
591 2906408852 2906408224 Bacteria 6162342
592 2906420172 2906414383 Bacteria 6580790
593 2906429846 2906427513 Bacteria 6375796
594 2919078914 2919073203 Bacteria 6531949
595 2919103611 2919100787 Bacteria 7710546
596 2919117287 2919114240 Bacteria 5700270
597 2919453762 2919450847 Bacteria 5631160
598 2919680515 2919679072 Bacteria 4629602
599 2922136368 2922130491 Bacteria 7173936
600 2922152231 2922151315 Bacteria 6902399
601 2922175286 2922172374 Bacteria 6167644
602 2922183350 2922178524 Bacteria 6025201
603 2924715567 2924710171 Bacteria 6752351
604 2924724125 2924718760 Bacteria 6331356
605 2924733254 2924726620 Bacteria 6271473
606 2924742217 2924741084 Bacteria 6661321
607 2924748376 2924748358 Bacteria 6154725
608 2924760865 2924754689 Bacteria 6774424
609 2924765069 2924762789 Bacteria 6561353
610 2924783298 2924776078 Bacteria 7492003
611 2924789029 2924784321 Bacteria 7416538
612 2926758734 2926754445 Bacteria 5964435
613 2926763735 2926760298 Bacteria 5505990
614 2928523782 2928521798 Bacteria 4960112
615 2933009666 2933006813 Bacteria 4912075
616 2933013839 2933011516 Bacteria 5439334
617 2933595653 2933594066 Bacteria 5594265
618 2937815689 2937813078 Bacteria 7783518
619 2937824402 2937822353 Bacteria 7290551
620 2937839336 2937836603 Bacteria 6811263
621 2937851874 2937848649 Bacteria 6983481
622 2937867929 2937861824 Bacteria 6660327
623 2937875790 2937868953 Bacteria 6639878
624 2937882175 2937877337 Bacteria 7246526
625 2937898050 2937891427 Bacteria 6357007
626 2937978636 2937972304 Bacteria 7532020
627 2937981338 2937980651 Bacteria 6517427
628 2938000114 2937994558 Bacteria 7036190
629 2938020268 2938014810 Bacteria 6700592
630 2954016066 2954011201 Bacteria 4762601
631 2958036292 2958034702 Bacteria 6989922
632 2958045656 2958041894 Bacteria 13082850
633 2958064423 2958064165 Bacteria 7158582
634 2958072073 2958071322 Bacteria 6815895
635 2958089297 2958084443 Bacteria 7312792
636 2958104493 2958100919 Bacteria 6800575
637 2958111584 2958108152 Bacteria 6681128
638 2958118410 2958115193 Bacteria 6923548
639 2958122757 2958122699 Bacteria 7280457
640 2958130920 2958130278 Bacteria 6897202
641 2958139976 2958137437 Bacteria 6050276
642 2958150005 2958144490 Bacteria 6677056
643 2958160182 2958158011 Bacteria 6058449
644 2958170578 2958165035 Bacteria 6906348
645 2958179072 2958172287 Bacteria 6716688
646 2958184841 2958179912 Bacteria 6874908
647 2961083008 2961077736 Bacteria 7079850
648 2961119946 2961114664 Bacteria 6680456
649 2961136772 2961127735 Bacteria 7196641
650 2961142487 2961136820 Bacteria 6775228
651 2961169033 2961163497 Bacteria 6901077
652 2961176095 2961170736 Bacteria 7072258
653 2961184326 2961183825 Bacteria 6688536
654 2963647659 2963644680 Bacteria 6530403
655 2965024320 2965018300 Bacteria 6883036
656 2965031806 2965025482 Bacteria 6532201
657 2965036733 2965032056 Bacteria 6887443
658 2965041828 2965040258 Bacteria 6855979
659 2965052884 2965047637 Bacteria 6623551
660 2965064197 2965062239 Bacteria 7412989
661 2965094729 2965089291 Bacteria 6866420
662 2965105632 2965102966 Bacteria 6800987
663 2965112156 2965110997 Bacteria 6693150
664 2965119820 2965119406 Bacteria 6956431
665 2968001982 2967996073 Bacteria 6787468
666 2968008994 2968003550 Bacteria 6929263
667 2968018503 2968016561 Bacteria 7022047
668 2968090290 2968083720 Bacteria 7351627
669 2968096318 2968091066 Bacteria 6052692
670 2968098817 2968097103 Bacteria 6107094
671 2968116303 2968110612 Bacteria 6814636
672 2968119903 2968117919 Bacteria 6536078
673 2968129138 2968128360 Bacteria 6270294
674 2968143958 2968138860 Bacteria 6605449
675 2968177427 2968171901 Bacteria 6894245
676 2970471324 2970469710 Bacteria 6969209
677 2970492937 2970489779 Bacteria 6517260
678 2970508761 2970503327 Bacteria 7099517
679 2970515559 2970510686 Bacteria 7006402
680 2970528532 2970524798 Bacteria 6840927
681 2970539713 2970532167 Bacteria 6553173
682 2970547165 2970540015 Bacteria 6977556
683 2970548954 2970547951 Bacteria 6931819
684 2970560273 2970554993 Bacteria 6814252
685 2970595019 2970593180 Bacteria 7073582
686 2970620497 2970619444 Bacteria 6986144
687 2970629073 2970627176 Bacteria 6680862
688 2977827367 2977821940 Bacteria 6906439
689 2977830472 2977828996 Bacteria 7007971
690 2977845925 2977843712 Bacteria 6753583
691 2977855864 2977851361 Bacteria 6694324
692 2977862329 2977858184 Bacteria 6215359
693 2977867132 2977864932 Bacteria 7534097
694 2977874826 2977872689 Bacteria 7270173
695 2977905458 2977898635 Bacteria 6675551
696 2977911047 2977907340 Bacteria 6577984
697 2977918818 2977915119 Bacteria 6829656
698 2977924168 2977922695 Bacteria 6956781
699 2977936067 2977935797 Bacteria 6252826
700 2977942703 2977942078 Bacteria 7570577
701 2977954874 2977950692 Bacteria 6893264
702 2977963960 2977957713 Bacteria 6877875
703 2977978558 2977971508 Bacteria 7472917
704 2977991730 2977986579 Bacteria 6581278
705 2979091223 2979089926 Bacteria 5670289
706 2979096747 2979095461 Bacteria 5669583
707 2979102469 2979100975 Bacteria 5423623
708 2979713630 2979710463 Bacteria 6785254
709 2979750434 2979742915 Bacteria 7301278
710 2979770882 2979764755 Bacteria 6610066
711 2979778476 2979772303 Bacteria 6618277
712 2979785543 2979779861 Bacteria 6219781
713 2979799344 2979793036 Bacteria 6808957
714 2979811591 2979808191 Bacteria 7179355
715 2984509645 2984509177 Bacteria 5274802
716 2984519656 2984518228 Bacteria 5277463
717 2984537983 2984537506 Bacteria 5277481
718 2984604727 2984601300 Bacteria 5455244
719 2987638382 2987636660 Bacteria 8088555
720 2987649559 2987645492 Bacteria 6117018
721 2987657283 2987652177 Bacteria 6969023
722 2987665064 2987659509 Bacteria 6966464
723 2987667975 2987666974 Bacteria 6509233
724 2987675180 2987673487 Bacteria 6884027
725 2989771372 2989771324 Bacteria 5605128
726 2995396089 2995392953 Bacteria 4539380
727 2996336495 2996336353 Bacteria 5511628
728 2996342325 2996341866 Bacteria 6643098
729 2996350116 2996348954 Bacteria 7239054
730 2996392296 2996386984 Bacteria 6978667
731 3000019284 3000017691 Bacteria 3772574
732 3000140714 3000135777 Bacteria 6891109
733 3003930847 3003930520 Bacteria 5667563
734 3004168839 3004167301 Bacteria 8330599
735 3004194121 3004188549 Bacteria 6952365
736 3004203765 3004195979 Bacteria 6776956
737 3004205374 3004203850 Bacteria 7307914
738 3004215903 3004211236 Bacteria 7417683
739 3004221931 3004218560 Bacteria 7421728
740 3004237066 3004232784 Bacteria 6662140
741 3004242816 3004239961 Bacteria 6892290
742 3004250491 3004248173 Bacteria 6563236
743 3004274884 3004268573 Bacteria 7043476
744 3004276815 3004275668 Bacteria 7114440
745 3004334417 3004334049 Bacteria 8449246
746 637074652 637000159 Bacteria 7596297
747 649872921 649633066 Bacteria 6690028
748 650843204 650716007 Bacteria 5573770
749 8001846712 8001845381 Bacteria 5804942
750 8002288908 8002285264 Bacteria 6717907
751 8003572779 8003570095 Bacteria 5747666
752 8004306011 8004300914 Bacteria 6132239
753 8004320383 8004312739 Bacteria 7444653
754 8004362400 8004361976 Bacteria 6858373
755 8004380348 8004374579 Bacteria 6898112
756 8004393691 8004387939 Bacteria 7049250
757 8004396963 8004395343 Bacteria 6620908
758 8004451721 8004445564 Bacteria 6322258
759 8004638628 8004633249 Bacteria 6723080
760 8004640874 8004640170 Bacteria 6723001
761 8004702841 8004695233 Bacteria 6731676
762 8004709312 8004703790 Bacteria 8006957
763 8004720459 8004714634 Bacteria 6776161
764 8018152226 8018150411 Bacteria 5549903
765 8055620726 8055617313 Bacteria 7548464
766 8057134816 8057132660 Bacteria 4061191
767 Ga0496125_0004348
768 JGI24735J21928_10019950
769 JGI25156J39149_1002906
770 JGI25162J39368_1000525
771 JGI25157J39369_1001345
772 JGI25159J45721_1016495
773 JGI25151J46595_10009032
774 JGI25406J46586_10028012
775 JGI25165J46597_1000015
776 JGI25165J46597_1000632
777 rootH1_10010014
778 JGI25160J50197_1015000
779 Ga0055542_1000406
780 Ga0055526_1035186
781 Ga0055524_1000633
782 Ga0058692_1001955
783 Ga0065165_1033194
784 Ga0065707_10135447
785 Ga0070670_100000186
786 Ga0070666_10000951
787 Ga0070666_10142575
788 Ga0070660_100263138
789 Ga0070691_10004979
790 Ga0070668_100182157
791 Ga0070668_100186686
792 Ga0070673_100002855
793 Ga0070667_100000061
794 Ga0070667_100104767
795 Ga0070663_100000771
796 Ga0070707_100059348
797 Ga0070707_100374326
798 Ga0068853_100000738
799 Ga0068853_100177309
800 Ga0070686_100203058
801 Ga0070665_100041488
802 Ga0070665_100048847
803 Ga0070665_100475866
804 Ga0070704_100062147
805 Ga0068855_100449391
806 Ga0068857_100055754
807 Ga0068854_100275582
808 Ga0068856_100425642
809 Ga0068852_100319448
810 Ga0068861_100056704
811 Ga0068860_100188747
812 Ga0068862_100220468
813 Ga0081455_10001150
814 Ga0081455_10284553
815 Ga0081539_10000302
816 Ga0075365_10014077
817 Ga0075365_10042506
818 Ga0075365_10044407
819 Ga0075365_10103788
820 Ga0075365_10123584
821 Ga0075368_10028753
822 Ga0075363_100016219
823 Ga0075363_100052355
824 Ga0075364_10128124
825 Ga0075367_10047435
826 Ga0075367_10049242
827 Ga0075369_10003698
828 Ga0075369_10011657
829 Ga0075369_10045387
830 Ga0075366_10016952
831 Ga0075366_10051190
832 Ga0075370_10046776
833 Ga0075370_10086907
834 Ga0068871_100137083
835 Ga0079104_1000063
836 Ga0099826_10000590
837 Ga0099826_10006096
838 Ga0105247_10209881
839 Ga0105241_10268978
840 Ga0105248_10000844
841 Ga0105248_10002580
842 Ga0105248_10185110
843 Ga0105237_10003173
844 Ga0105237_10183770
845 Ga0105237_10246797
846 Ga0105238_10002443
847 Ga0105249_10001401
848 Ga0105249_10117192
849 Ga0105239_10038661
850 Ga0105239_10237693
851 Ga0105239_10397820
852 Ga0157373_10044793
853 Ga0157371_10000002
854 Ga0157371_10021906
855 Ga0157370_10000143
856 Ga0157372_10243173
857 Ga0157372_10383891
858 Ga0157375_10347688
859 Ga0182008_10129200
860 Ga0157379_10037584
861 Ga0163161_10000613
862 Ga0209437_100248
863 Ga0209646_1018222
864 Ga0209026_1000025
865 Ga0209148_1000181
866 Ga0209759_1000226
867 Ga0209233_1000010
868 Ga0209233_1000241
869 Ga0209455_1000127
870 Ga0209130_1000345
871 Ga0209025_1000245
872 Ga0209564_1000762
873 Ga0209758_1044499
874 Ga0209256_1000310
875 Ga0207426_1000065
876 Ga0207653_10045568
877 Ga0207680_10000902
878 Ga0207647_10004726
879 Ga0207705_10140607
880 Ga0207654_10080310
881 Ga0207707_10154653
882 Ga0207671_10005674
883 Ga0207671_10094056
884 Ga0207694_10013751
885 Ga0207650_10001166
886 Ga0207687_10233008
887 Ga0207664_10217187
888 Ga0207709_10073703
889 Ga0207709_10258365
890 Ga0207669_10164838
891 Ga0207665_10070784
892 Ga0207711_10001830
893 Ga0207667_10410605
894 Ga0207712_10000267
895 Ga0207712_10096037
896 Ga0207668_10264766
897 Ga0207668_10378878
898 Ga0207658_10000166
899 Ga0207639_10200416
900 Ga0207639_10426290
901 Ga0207678_10003795
902 Ga0207678_10004017
903 Ga0207678_10283120
904 Ga0207641_10334806
905 Ga0207648_10466818
906 Ga0207675_100110041
907 Ga0207683_10168462
908 Ga0209281_1000110
909 Ga0209371_1000003
910 Ga0209371_1001357
911 Ga0209371_1001699
912 Ga0209282_1001047
913 Ga0209813_10006356
914 Ga0307515_10000556
915 Ga0307515_10145550
916 Ga0268256_1000004
917 Ga0316181_1029509
918 Ga0307409_100236817
919 Ga0307414_10377532
920 Ga0395899_0000442
921 Ga0395899_0107687
922 Ga0395900_0000643
923 Ga0395900_0419769
924 Ga0395898_0000914
925 Ga0395898_0286411
926 Ga0395905_0000621
927 Ga0395905_0031722
928 Ga0395905_0178288
929 Ga0395901_0000466
930 Ga0395901_0002791
931 Ga0395901_0075618
932 Ga0451577_0000029
933 Ga0451577_0000644
934 Ga0451577_0013426
935 Ga0466972_0013553
936 Ga0453683_0000565
937 Ga0453683_0152717
938 Ga0453684_0000088
939 Ga0453684_0001135
940 Ga0453684_0022167
941 Ga0453684_0096723
942 Ga0453684_0363266
943 Ga0466960_0023417
944 Ga0451576_0000897
945 Ga0451576_0001707
946 Ga0451576_0005334
947 Ga0451576_0029032
948 Ga0495638_0007422
949 Ga0495638_0055862
950 Ga0495638_0060795
951 Ga0495650_0042945
952 Ga0495606_0005945
953 Ga0495606_0015529
954 Ga0495606_0095129
955 Ga0495610_0098369
956 Ga0495620_0022922
957 Ga0495632_0093743
958 Ga0495648_0035152
959 Ga0495654_0000121
960 Ga0495597_0024438
961 Ga0495622_0029791
962 Ga0495611_0072796
963 Ga0495625_0088412
964 Ga0495661_0020810
965 Ga0495588_0001686
966 Ga0495588_0044756
967 Ga0495671_0013808
968 Ga0495671_0089992
969 Ga0495681_0003679
970 Ga0495686_0000090
971 Ga0495686_0002924
972 Ga0495686_0015281
973 Ga0495686_0053679
974 Ga0495686_0131658
975 Ga0495686_0138786
976 Ga0496100_0025877
977 Ga0496104_0171806
978 Ga0496105_0016376
979 Ga0496106_0097841
980 Ga0496107_0001872
981 Ga0496107_0008338
982 Ga0496107_0031857
983 Ga0496112_0102569
984 Ga0496113_0018640
985 Ga0496113_0197748
986 Ga0496115_0280960
987 Ga0496116_0000167
988 Ga0496116_0006837
989 Ga0496116_0010207
990 Ga0496116_0083598
991 Ga0496117_0000016
992 Ga0496117_0022136
993 Ga0496117_0032023
994 Ga0496118_0002108
995 Ga0496118_0021360
996 Ga0496118_0062078
997 Ga0496119_0001369
998 Ga0496119_0016216
999 Ga0496119_0065976
1000 Ga0496119_0067689
1001 Ga0496120_0000164
1002 Ga0496120_0004133
1003 Ga0496121_0000523
1004 Ga0496121_0017943
1005 Ga0496121_0082903
1006 Ga0496122_0000002
1007 Ga0496122_0000374
1008 Ga0496122_0001100
1009 Ga0496122_0003869
1010 Ga0496122_0032435
1011 Ga0496122_0034574
1012 Ga0496122_0042421
1013 Ga0496122_0068401
1014 Ga0496123_0000002
1015 Ga0496123_0001129
1016 Ga0496123_0003310
1017 Ga0496123_0008338
1018 Ga0496123_0012303
1019 Ga0496123_0042635
1020 Ga0496123_0055004
1021 Ga0496123_0057214
1022 Ga0496124_0010543
1023 Ga0496124_0049939
1024 Ga0496124_0067023
1025 Ga0496124_0069674
1026 Ga0496124_0074950
1027 Ga0496124_0341390
1028 Ga0496125_0000176
1029 Ga0496125_0000564
1030 Ga0496125_0003773
1031 Ga0496125_0006078
1032 Ga0496125_0041344
1033 Ga0496125_0083303
1034 Ga0496126_0000768
1035 Ga0496126_0002716
1036 Ga0496126_0024086
1037 Ga0496126_0115981
1038 Ga0496126_0278417
1039 Ga0501031_0000010
1040 Ga0501031_0137982
1041 Ga0501032_0000023
1042 Ga0501032_0066256
1043 Ga0501033_0000308
1044 Ga0501033_0207467
1045 Ga0501034_0000116
1046 Ga0501034_0114855
1047 Ga0501034_0143318
1048 Ga0501034_0148496
1049 Ga0501034_0157550
1050 Ga0501034_0190808
1051 Ga0501034_0292826
1052 Ga0501036_0000015
1053 Ga0501036_0224544
1054 Ga0501037_0000023
1055 Ga0501037_0033165
1056 Ga0501037_0170074
1057 Ga0501038_0000025
1058 Ga0501038_0244223
1059 Ga0501039_0000037
1060 Ga0501040_0044072
1061 Ga0501041_0245794
1062 Ga0501043_0000449
1063 Ga0501043_0001865
1064 Ga0501043_0013344
1065 Ga0501043_0026052
1066 Ga0501046_0020720
1067 Ga0501046_0027024
1068 Ga0501046_0031319
1069 Ga0501046_0171993
1070 Ga0501047_0001418
1071 Ga0501047_0003874
1072 Ga0501048_0050475
1073 Ga0501067_0004489
1074 Ga0501067_0016882
1075 Ga0501067_0037891
1076 Ga0501073_0045762
1077 Ga0501073_0059516
1078 Ga0501073_0062139
1079 Ga0501073_0068183
1080 Ga0501074_0147519
1081 Ga0501075_0239491
1082 Ga0501076_0067376
1083 Ga0501077_0101171
1084 Ga0501079_0117213
1085 Ga0501080_0064535
1086 Ga0501083_0000420
1087 Ga0501083_0009682
1088 Ga0501035_0000074
1089 Ga0501035_0026442
1090 Ga0501044_0000069
1091 Ga0501044_0077145
1092 Ga0501044_0287437
1093 Ga0501045_0267488
1094 nmdc:mga00v17_1002_c1
1095 nmdc:mga00v17_5182_c1
1096 nmdc:mga00v17_53_c1
1097 nmdc:mga00v17_57866_c1
1098 nmdc:mga00v17_66077_c1
1099 nmdc:mga0yw44_139511_c1
1100 nmdc:mga0yw44_15153_c1
1101 nmdc:mga0yw44_15432_c1
1102 nmdc:mga0yw44_260_c1
1103 nmdc:mga0yw44_26881_c1
1104 nmdc:mga0yw44_4634_c1
1105 nmdc:mga06z11_152216_c1
1106 nmdc:mga06z11_49950_c1
1107 nmdc:mga04h51_17733_c1
1108 nmdc:mga07m45_26376_c1
1109 nmdc:mga0sz30_19862_c1
1110 nmdc:mga0sz30_27041_c1
1111 nmdc:mga0sz30_38021_c1
1112 nmdc:mga0sz30_6268_c1
1113 nmdc:mga0sz30_6399_c1
1114 Ga0500635_0000170
1115 Ga0500643_002593
1116 Ga0500643_011679
1117 Ga0500643_044840
1118 Ga0500644_0026583
1119 Ga0500641_0042103
1120 Ga0500650_0091396
1121 Ga0500556_0000003
1122 Ga0500556_0000113
1123 Ga0500560_000068
1124 Ga0500593_000061
1125 Ga0500594_0029832
1126 Ga0500597_000278
1127 Ga0500608_018918
1128 Ga0500618_000171
1129 Ga0500618_000243
1130 Ga0500618_000581
1131 Ga0500618_038282
1132 Ga0500642_0000015
1133 Ga0500652_001262
1134 Ga0500652_088978
1135 Ga0500559_0001373
1136 Ga0500561_0000227
1137 Ga0500568_0000005
1138 Ga0500568_0000118
1139 Ga0500568_0000600
1140 Ga0500573_0006872
1141 Ga0500586_000891
1142 Ga0500616_0000114
1143 Ga0500620_000059
1144 Ga0500622_0003486
1145 Ga0500634_0000697
1146 Ga0500634_0041749
1147 Ga0500634_0041841
1148 Ga0500636_0004051
1149 Ga0500636_0115044
1150 Ga0500637_0013874
1151 Ga0500645_018141
1152 Ga0500645_029953
1153 Ga0501084_0004215
1154 Ga0501084_0243992
1155 Ga0587077_026497
1156 Ga0587062_010218
1157 Ga0587072_027467
1158 Ga0501082_0030641
1159 Ga0501082_0194006
1160 Ga0530510_0213389
1161 2509113084
1162 2509143942
1163 2509367877
1164 2509396258
1165 2510315559
1166 2511389751
1167 2512931552
1168 2512959385
1169 2513591190
1170 2513611341
1171 2514033558
1172 2514419698
1173 2523103013
1174 2537875800
1175 2554245389
1176 2559296782
1177 2585204701
1178 2585334593
1179 2588517391
1180 2597813278
1181 2599602727
1182 2599936800
1183 2601610348
1184 2601747322
1185 2603860031
1186 2643771146
1187 2643776159
1188 2643794606
1189 2643809461
1190 2643813360
1191 2643839984
1192 2643911622
1193 2643917241
1194 2643986850
1195 2644066857
1196 2644129249
1197 2644157013
1198 2644375802
1199 2644418060
1200 2644451315
1201 2644520909
1202 2644691660
1203 2671694539
1204 2688598394
1205 2694631027
1206 2694636475
1207 2723575329
1208 2739308354
1209 2756672555
1210 2757569651
1211 2758641937
1212 2765464739
1213 2770195339
1214 2776270713
1215 2776280464
1216 2776914963
1217 2792752738
1218 2793280783
1219 2808987235
1220 2819557429
1221 2821126308
1222 2828307920
1223 2834579759
1224 2838678065
1225 2838717029
1226 2838722360
1227 2838727778
1228 2838737216
1229 2839996911
1230 2840880137
1231 2841739149
1232 2841842415
1233 2841849435
1234 2841861523
1235 2842127816
1236 2842132958
1237 2842142195
1238 2842154951
1239 2842173450
1240 2842178572
1241 2842190137
1242 2842214451
1243 2842227170
1244 2842518211
1245 2842871847
1246 2844007484
1247 2844013647
1248 2844533508
1249 2847675566
1250 2847692208
1251 2854681561
1252 2854897424
1253 2856319452
1254 2856327533
1255 2856334513
1256 2856340365
1257 2856343894
1258 2856355146
1259 2856364034
1260 2856369410
1261 2857351198
1262 2857372750
1263 2857525029
1264 2857532869
1265 2869168242
1266 2869171912
1267 2869237492
1268 2869251822
1269 2869260802
1270 2869269407
1271 2869276480
1272 2869280422
1273 2869286517
1274 2871434670
1275 2871437353
1276 2871444547
1277 2871459208
1278 2871463859
1279 2871472381
1280 2871474624
1281 2871482598
1282 2871494591
1283 2871501445
1284 2874109172
1285 2874113487
1286 2874122997
1287 2874130555
1288 2874137861
1289 2874144166
1290 2874149875
1291 2874158133
1292 2874164476
1293 2874169799
1294 2876368534
1295 2876375313
1296 2876384393
1297 2876390883
1298 2876398392
1299 2876403677
1300 2876416337
1301 2876427815
1302 2878040687
1303 2878731042
1304 2878745161
1305 2878751803
1306 2878758827
1307 2878765425
1308 2878773133
1309 2878775661
1310 2878781272
1311 2878793907
1312 2881151282
1313 2881161755
1314 2881167482
1315 2881852309
1316 2881856724
1317 2881864644
1318 2882636224
1319 2882918521
1320 2885309381
1321 2885318033
1322 2885322405
1323 2885330043
1324 2885334666
1325 2885350083
1326 2885355632
1327 2888339373
1328 2888346749
1329 2888355711
1330 2889010646
1331 2889017653
1332 2891049509
1333 2893071268
1334 2894656087
1335 2898796513
1336 2899279491
1337 2899792645
1338 2899850089
1339 2903451260
1340 2903503934
1341 2903504749
1342 2903518783
1343 2903527533
1344 2903533987
1345 2903546256
1346 2904664947
1347 2906314201
1348 2906327367
1349 2906330057
1350 2906355158
1351 2906364302
1352 2906371554
1353 2906382064
1354 2906391605
1355 2906398253
1356 2906402853
1357 2906408852
1358 2906420172
1359 2906429846
1360 2919078914
1361 2919103611
1362 2919117287
1363 2919453762
1364 2919680515
1365 2922136368
1366 2922152231
1367 2922175286
1368 2922183350
1369 2924715567
1370 2924724125
1371 2924733254
1372 2924742217
1373 2924748376
1374 2924760865
1375 2924765069
1376 2924783298
1377 2924789029
1378 2926758734
1379 2926763735
1380 2928523782
1381 2933009666
1382 2933013839
1383 2933595653
1384 2937815689
1385 2937824402
1386 2937839336
1387 2937851874
1388 2937867929
1389 2937875790
1390 2937882175
1391 2937898050
1392 2937978636
1393 2937981338
1394 2938000114
1395 2938020268
1396 2954016066
1397 2958036292
1398 2958045656
1399 2958064423
1400 2958072073
1401 2958089297
1402 2958104493
1403 2958111584
1404 2958118410
1405 2958122757
1406 2958130920
1407 2958139976
1408 2958150005
1409 2958160182
1410 2958170578
1411 2958179072
1412 2958184841
1413 2961083008
1414 2961119946
1415 2961136772
1416 2961142487
1417 2961169033
1418 2961176095
1419 2961184326
1420 2963647659
1421 2965024320
1422 2965031806
1423 2965036733
1424 2965041828
1425 2965052884
1426 2965064197
1427 2965094729
1428 2965105632
1429 2965112156
1430 2965119820
1431 2968001982
1432 2968008994
1433 2968018503
1434 2968090290
1435 2968096318
1436 2968098817
1437 2968116303
1438 2968119903
1439 2968129138
1440 2968143958
1441 2968177427
1442 2970471324
1443 2970492937
1444 2970508761
1445 2970515559
1446 2970528532
1447 2970539713
1448 2970547165
1449 2970548954
1450 2970560273
1451 2970595019
1452 2970620497
1453 2970629073
1454 2977827367
1455 2977830472
1456 2977845925
1457 2977855864
1458 2977862329
1459 2977867132
1460 2977874826
1461 2977905458
1462 2977911047
1463 2977918818
1464 2977924168
1465 2977936067
1466 2977942703
1467 2977954874
1468 2977963960
1469 2977978558
1470 2977991730
1471 2979091223
1472 2979096747
1473 2979102469
1474 2979713630
1475 2979750434
1476 2979770882
1477 2979778476
1478 2979785543
1479 2979799344
1480 2979811591
1481 2984509645
1482 2984519656
1483 2984537983
1484 2984604727
1485 2987638382
1486 2987649559
1487 2987657283
1488 2987665064
1489 2987667975
1490 2987675180
1491 2989771372
1492 2995396089
1493 2996336495
1494 2996342325
1495 2996350116
1496 2996392296
1497 3000019284
1498 3000140714
1499 3003930847
1500 3004168839
1501 3004194121
1502 3004203765
1503 3004205374
1504 3004215903
1505 3004221931
1506 3004237066
1507 3004242816
1508 3004250491
1509 3004274884
1510 3004276815
1511 3004334417
1512 637074652
1513 649872921
1514 650843204
1515 8001846712
1516 8002288908
1517 8003572779
1518 8004306011
1519 8004320383
1520 8004362400
1521 8004380348
1522 8004393691
1523 8004396963
1524 8004451721
1525 8004638628
1526 8004640874
1527 8004702841
1528 8004709312
1529 8004720459
1530 8018152226
1531 8055620726
1532 8057134816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

89

340

0.89

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

179

375

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.9512 26 326
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.9417 26 328
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.9246 26 326
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.9017 26 328
6ddn-assembly2.cif.gz_B the sulfate-binding protein subi from mycobacterium tuberculosis h37rv 0.8984 24 312
ID Description Score Start End Superfamily
af_P16700_120_332_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9653 112 323 3.40.190.10
4rxlA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9603 27 97 3.40.190.10
af_P0AG78_114_326_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9596 112 323 3.40.190.10
af_P16700_120_332_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9565 112 323 3.40.190.10
1sbpA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9565 112 326 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A531KX11-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9951 39 328 GO:0042597
GO:1901681
GO:1902358
AF-A0A531KX11-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9917 39 328 GO:0042597
GO:1901681
GO:1902358
AF-A0A098U544-F1-model_v4 deleted 0.9799 109 231
AF-A0A351BCR6-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9758 95 325 GO:0042597
GO:1902358
AF-X6C3Q0-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9705 95 248 GO:0042597
GO:1901681
GO:1902358

Map