F479837
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 766 | 309 | 766 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_101265543|Ga0068863_1012655431 |
| Length | 189 |
| Sequence | MTYRLVACLPHWLLGVAFPAQAHLKSYTTEKVLYMLKLTKKADYGLIAMRHLALCDAADGVPTASAKDIADEYGIPQQALAKILQRLAKSQLLISHHGTNGGYSLARPARSISALEVIKAIDGPLFMTACSSDHDCVQSSKCTVREPLRKVSEKIQEALERVKLADMGEDEKQSQAAGSPSIAELVRLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 11 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 217 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 218 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 219 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 222 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 232 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 240 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 245 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 246 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 247 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 248 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 249 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 250 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 251 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 290 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 291 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 292 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 293 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 294 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300059609 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.3 |
| Metatranscriptomes | 4.7 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.4 |
| Rhizosphere | 92.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_9210921 | 2162886011 | Bacteria | 1578 |
| 2 | MBSR1b_contig_694782 | 2162886012 | Bacteria | 850 |
| 3 | JGI24747J21853_1014241 | 3300001978 | Bacteria | 826 |
| 4 | JGI24737J22298_10012413 | 3300001990 | Bacteria | 2779 |
| 5 | JGI24743J22301_10005212 | 3300001991 | Bacteria | 2161 |
| 6 | JGI24743J22301_10010652 | 3300001991 | Unclassified | 1644 |
| 7 | JGI24748J21848_1022567 | 3300002074 | Unclassified | 762 |
| 8 | JGI24738J21930_10114464 | 3300002075 | Unclassified | 583 |
| 9 | JGI24034J26672_10001329 | 3300002239 | Bacteria | 3263 |
| 10 | JGI24751J29686_10004437 | 3300002459 | Bacteria | 2850 |
| 11 | Ga0058859_10968610 | 3300004798 | Unclassified | 589 |
| 12 | Ga0058860_12078993 | 3300004801 | Unclassified | 587 |
| 13 | Ga0065712_10331065 | 3300005290 | Bacteria | 806 |
| 14 | Ga0065715_10092929 | 3300005293 | Bacteria | 4875 |
| 15 | Ga0065707_10415556 | 3300005295 | Bacteria | 836 |
| 16 | Ga0070658_10016195 | 3300005327 | Bacteria | 5964 |
| 17 | Ga0070658_10071817 | 3300005327 | Bacteria | 2835 |
| 18 | Ga0070676_10001847 | 3300005328 | Bacteria | 10800 |
| 19 | Ga0070683_100000196 | 3300005329 | Bacteria | 40484 |
| 20 | Ga0070683_100024245 | 3300005329 | Bacteria | 5432 |
| 21 | Ga0070683_100116685 | 3300005329 | Unclassified | 2520 |
| 22 | Ga0070683_100466363 | 3300005329 | Bacteria | 1205 |
| 23 | Ga0070683_100466601 | 3300005329 | Bacteria | 1205 |
| 24 | Ga0070690_100038269 | 3300005330 | Bacteria | 3026 |
| 25 | Ga0070670_100003321 | 3300005331 | Bacteria | 13306 |
| 26 | Ga0070670_100049803 | 3300005331 | Bacteria | 3601 |
| 27 | Ga0070670_100120291 | 3300005331 | Bacteria | 2265 |
| 28 | Ga0070677_10008557 | 3300005333 | Bacteria | 3448 |
| 29 | Ga0068869_100001678 | 3300005334 | Bacteria | 13225 |
| 30 | Ga0068869_100010000 | 3300005334 | Bacteria | 6167 |
| 31 | Ga0068869_100101958 | 3300005334 | Bacteria | 2172 |
| 32 | Ga0068869_100211941 | 3300005334 | Bacteria | 1532 |
| 33 | Ga0068869_101907783 | 3300005334 | Unclassified | 532 |
| 34 | Ga0070666_10023121 | 3300005335 | Bacteria | 4043 |
| 35 | Ga0070666_10359023 | 3300005335 | Bacteria | 1044 |
| 36 | Ga0070680_100029534 | 3300005336 | Bacteria | 4404 |
| 37 | Ga0070680_100164168 | 3300005336 | Bacteria | 1867 |
| 38 | Ga0070682_100005289 | 3300005337 | Bacteria | 7183 |
| 39 | Ga0070682_100007543 | 3300005337 | Bacteria | 6130 |
| 40 | Ga0068868_100005839 | 3300005338 | Bacteria | 8678 |
| 41 | Ga0068868_100014727 | 3300005338 | Bacteria | 5769 |
| 42 | Ga0068868_100015053 | 3300005338 | Bacteria | 5712 |
| 43 | Ga0068868_100023318 | 3300005338 | Bacteria | 4683 |
| 44 | Ga0068868_100027007 | 3300005338 | Bacteria | 4377 |
| 45 | Ga0068868_100727948 | 3300005338 | Bacteria | 890 |
| 46 | Ga0070660_100068735 | 3300005339 | Bacteria | 2761 |
| 47 | Ga0070660_100175999 | 3300005339 | Bacteria | 1730 |
| 48 | Ga0070689_100001280 | 3300005340 | Bacteria | 15983 |
| 49 | Ga0070689_100059915 | 3300005340 | Bacteria | 2959 |
| 50 | Ga0070691_10043894 | 3300005341 | Bacteria | 2119 |
| 51 | Ga0070687_100010778 | 3300005343 | Unclassified | 3972 |
| 52 | Ga0070687_100107280 | 3300005343 | Bacteria | 1574 |
| 53 | Ga0070661_100031791 | 3300005344 | Bacteria | 3817 |
| 54 | Ga0070661_100065456 | 3300005344 | Bacteria | 2671 |
| 55 | Ga0070668_100005427 | 3300005347 | Bacteria | 9468 |
| 56 | Ga0070668_100161328 | 3300005347 | Bacteria | 1819 |
| 57 | Ga0070669_100021333 | 3300005353 | Bacteria | 4629 |
| 58 | Ga0070669_100138701 | 3300005353 | Bacteria | 1873 |
| 59 | Ga0070675_100024552 | 3300005354 | Bacteria | 4828 |
| 60 | Ga0070675_100379893 | 3300005354 | Bacteria | 1257 |
| 61 | Ga0070671_100057077 | 3300005355 | Bacteria | 3248 |
| 62 | Ga0070674_100046828 | 3300005356 | Bacteria | 2961 |
| 63 | Ga0070688_100006261 | 3300005365 | Bacteria | 6345 |
| 64 | Ga0070659_100031541 | 3300005366 | Bacteria | 4105 |
| 65 | Ga0070659_100078269 | 3300005366 | Unclassified | 2637 |
| 66 | Ga0070667_100008526 | 3300005367 | Bacteria | 8497 |
| 67 | Ga0070709_10450371 | 3300005434 | Bacteria | 970 |
| 68 | Ga0070709_10707984 | 3300005434 | Bacteria | 784 |
| 69 | Ga0070714_100046420 | 3300005435 | Bacteria | 3685 |
| 70 | Ga0070714_100069238 | 3300005435 | Bacteria | 3046 |
| 71 | Ga0070714_100176057 | 3300005435 | Bacteria | 1944 |
| 72 | Ga0070713_100000963 | 3300005436 | Bacteria | 18417 |
| 73 | Ga0070713_100052988 | 3300005436 | Bacteria | 3361 |
| 74 | Ga0070713_100117567 | 3300005436 | Bacteria | 2327 |
| 75 | Ga0070713_100239766 | 3300005436 | Bacteria | 1651 |
| 76 | Ga0070713_100332520 | 3300005436 | Bacteria | 1406 |
| 77 | Ga0070713_100795000 | 3300005436 | Bacteria | 907 |
| 78 | Ga0070713_101975275 | 3300005436 | Unclassified | 566 |
| 79 | Ga0070710_10038230 | 3300005437 | Bacteria | 2635 |
| 80 | Ga0070710_10143056 | 3300005437 | Bacteria | 1469 |
| 81 | Ga0070711_100001492 | 3300005439 | Bacteria | 12844 |
| 82 | Ga0070711_100021540 | 3300005439 | Bacteria | 4170 |
| 83 | Ga0070711_100113607 | 3300005439 | Bacteria | 1992 |
| 84 | Ga0070711_100218828 | 3300005439 | Bacteria | 1479 |
| 85 | Ga0070705_100489575 | 3300005440 | Bacteria | 931 |
| 86 | Ga0070705_100992322 | 3300005440 | Unclassified | 681 |
| 87 | Ga0070705_101002504 | 3300005440 | Unclassified | 678 |
| 88 | Ga0070700_100036844 | 3300005441 | Bacteria | 2970 |
| 89 | Ga0070700_100431182 | 3300005441 | Bacteria | 998 |
| 90 | Ga0070708_100000677 | 3300005445 | Bacteria | 25860 |
| 91 | Ga0070708_100004714 | 3300005445 | Bacteria | 10745 |
| 92 | Ga0070708_100015510 | 3300005445 | Bacteria | 6298 |
| 93 | Ga0070708_100062325 | 3300005445 | Bacteria | 3335 |
| 94 | Ga0070708_100105612 | 3300005445 | Bacteria | 2584 |
| 95 | Ga0070708_100110753 | 3300005445 | Bacteria | 2523 |
| 96 | Ga0070708_100148576 | 3300005445 | Bacteria | 2178 |
| 97 | Ga0070708_100194568 | 3300005445 | Bacteria | 1897 |
| 98 | Ga0070708_100216366 | 3300005445 | Bacteria | 1796 |
| 99 | Ga0070708_100336434 | 3300005445 | Bacteria | 1423 |
| 100 | Ga0070708_100347487 | 3300005445 | Bacteria | 1398 |
| 101 | Ga0070708_101517715 | 3300005445 | Bacteria | 624 |
| 102 | Ga0070663_100016752 | 3300005455 | Bacteria | 4769 |
| 103 | Ga0070663_100031137 | 3300005455 | Bacteria | 3664 |
| 104 | Ga0070663_100124491 | 3300005455 | Bacteria | 1951 |
| 105 | Ga0070663_100279421 | 3300005455 | Bacteria | 1330 |
| 106 | Ga0070678_100169228 | 3300005456 | Bacteria | 1778 |
| 107 | Ga0070662_100006064 | 3300005457 | Bacteria | 7760 |
| 108 | Ga0070662_100025048 | 3300005457 | Bacteria | 4117 |
| 109 | Ga0070662_100496795 | 3300005457 | Bacteria | 1017 |
| 110 | Ga0070681_10009378 | 3300005458 | Bacteria | 9631 |
| 111 | Ga0070681_10029426 | 3300005458 | Bacteria | 5516 |
| 112 | Ga0070681_10154389 | 3300005458 | Bacteria | 2221 |
| 113 | Ga0068867_100006756 | 3300005459 | Bacteria | 8111 |
| 114 | Ga0070685_10006837 | 3300005466 | Bacteria | 5824 |
| 115 | Ga0070706_100000734 | 3300005467 | Bacteria | 37002 |
| 116 | Ga0070706_100001749 | 3300005467 | Bacteria | 22543 |
| 117 | Ga0070706_100003331 | 3300005467 | Bacteria | 15864 |
| 118 | Ga0070706_100020469 | 3300005467 | Bacteria | 6098 |
| 119 | Ga0070706_100022304 | 3300005467 | Bacteria | 5830 |
| 120 | Ga0070706_100276189 | 3300005467 | Bacteria | 1568 |
| 121 | Ga0070706_100513905 | 3300005467 | Bacteria | 1114 |
| 122 | Ga0070707_100000190 | 3300005468 | Bacteria | 61096 |
| 123 | Ga0070707_100000413 | 3300005468 | Bacteria | 42232 |
| 124 | Ga0070707_100001198 | 3300005468 | Bacteria | 25503 |
| 125 | Ga0070707_100017806 | 3300005468 | Bacteria | 6679 |
| 126 | Ga0070707_100097105 | 3300005468 | Bacteria | 2854 |
| 127 | Ga0070707_100420646 | 3300005468 | Unclassified | 1297 |
| 128 | Ga0070707_100505114 | 3300005468 | Bacteria | 1171 |
| 129 | Ga0070707_100557603 | 3300005468 | Bacteria | 1108 |
| 130 | Ga0070707_100636979 | 3300005468 | Unclassified | 1029 |
| 131 | Ga0070707_100811028 | 3300005468 | Unclassified | 900 |
| 132 | Ga0070707_101074296 | 3300005468 | Bacteria | 771 |
| 133 | Ga0070698_100000248 | 3300005471 | Bacteria | 54156 |
| 134 | Ga0070698_101021644 | 3300005471 | Unclassified | 774 |
| 135 | Ga0070699_100002192 | 3300005518 | Bacteria | 17668 |
| 136 | Ga0070699_100007279 | 3300005518 | Bacteria | 9633 |
| 137 | Ga0070699_100018990 | 3300005518 | Bacteria | 5912 |
| 138 | Ga0070699_100052286 | 3300005518 | Bacteria | 3536 |
| 139 | Ga0070699_100066639 | 3300005518 | Unclassified | 3126 |
| 140 | Ga0070699_100209499 | 3300005518 | Bacteria | 1735 |
| 141 | Ga0070699_101344499 | 3300005518 | Unclassified | 655 |
| 142 | Ga0070679_100163782 | 3300005530 | Bacteria | 2198 |
| 143 | Ga0070679_100261993 | 3300005530 | Bacteria | 1684 |
| 144 | Ga0070684_100000283 | 3300005535 | Bacteria | 35271 |
| 145 | Ga0070684_100008624 | 3300005535 | Bacteria | 7985 |
| 146 | Ga0070684_100009031 | 3300005535 | Bacteria | 7833 |
| 147 | Ga0070684_100205317 | 3300005535 | Bacteria | 1795 |
| 148 | Ga0070684_100344579 | 3300005535 | Bacteria | 1370 |
| 149 | Ga0070697_100000788 | 3300005536 | Bacteria | 23812 |
| 150 | Ga0070697_100002694 | 3300005536 | Bacteria | 13677 |
| 151 | Ga0070697_100009349 | 3300005536 | Bacteria | 7659 |
| 152 | Ga0070697_100010875 | 3300005536 | Bacteria | 7107 |
| 153 | Ga0070697_100162364 | 3300005536 | Bacteria | 1888 |
| 154 | Ga0070697_100253439 | 3300005536 | Bacteria | 1505 |
| 155 | Ga0070697_100452400 | 3300005536 | Bacteria | 1119 |
| 156 | Ga0070697_100659715 | 3300005536 | Unclassified | 922 |
| 157 | Ga0070697_100745019 | 3300005536 | Unclassified | 866 |
| 158 | Ga0070697_101043174 | 3300005536 | Bacteria | 727 |
| 159 | Ga0068853_100000114 | 3300005539 | Bacteria | 55124 |
| 160 | Ga0068853_100041831 | 3300005539 | Unclassified | 3916 |
| 161 | Ga0068853_100443228 | 3300005539 | Bacteria | 1220 |
| 162 | Ga0070686_100003572 | 3300005544 | Bacteria | 8534 |
| 163 | Ga0070695_100026303 | 3300005545 | Bacteria | 3599 |
| 164 | Ga0070695_100125117 | 3300005545 | Bacteria | 1764 |
| 165 | Ga0070695_100236343 | 3300005545 | Bacteria | 1323 |
| 166 | Ga0070696_100018327 | 3300005546 | Bacteria | 4731 |
| 167 | Ga0070696_100303480 | 3300005546 | Bacteria | 1223 |
| 168 | Ga0070693_100044548 | 3300005547 | Bacteria | 2510 |
| 169 | Ga0070693_100105636 | 3300005547 | Bacteria | 1723 |
| 170 | Ga0070665_100016715 | 3300005548 | Bacteria | 7353 |
| 171 | Ga0070665_100119794 | 3300005548 | Bacteria | 2634 |
| 172 | Ga0070704_101055272 | 3300005549 | Unclassified | 737 |
| 173 | Ga0068855_100009737 | 3300005563 | Bacteria | 11593 |
| 174 | Ga0068855_100065756 | 3300005563 | Bacteria | 4227 |
| 175 | Ga0068855_100227498 | 3300005563 | Unclassified | 2090 |
| 176 | Ga0068855_100263463 | 3300005563 | Bacteria | 1919 |
| 177 | Ga0068855_100720602 | 3300005563 | Bacteria | 1066 |
| 178 | Ga0070664_100124450 | 3300005564 | Bacteria | 2260 |
| 179 | Ga0068857_100000606 | 3300005577 | Bacteria | 26405 |
| 180 | Ga0068857_100021825 | 3300005577 | Bacteria | 5634 |
| 181 | Ga0068857_100101920 | 3300005577 | Bacteria | 2576 |
| 182 | Ga0068854_100008827 | 3300005578 | Bacteria | 6487 |
| 183 | Ga0068854_100010438 | 3300005578 | Bacteria | 6024 |
| 184 | Ga0068854_100166302 | 3300005578 | Bacteria | 1712 |
| 185 | Ga0068854_100945747 | 3300005578 | Unclassified | 760 |
| 186 | Ga0068856_100015081 | 3300005614 | Bacteria | 7466 |
| 187 | Ga0068856_100018182 | 3300005614 | Bacteria | 6815 |
| 188 | Ga0068856_100022679 | 3300005614 | Bacteria | 6103 |
| 189 | Ga0070702_100006489 | 3300005615 | Bacteria | 5542 |
| 190 | Ga0068852_100000033 | 3300005616 | Bacteria | 101433 |
| 191 | Ga0068852_100185987 | 3300005616 | Bacteria | 1956 |
| 192 | Ga0068852_100441353 | 3300005616 | Bacteria | 1287 |
| 193 | Ga0068859_100003073 | 3300005617 | Bacteria | 16925 |
| 194 | Ga0068859_100008570 | 3300005617 | Bacteria | 10340 |
| 195 | Ga0068859_100111266 | 3300005617 | Bacteria | 2801 |
| 196 | Ga0068864_100000314 | 3300005618 | Bacteria | 42771 |
| 197 | Ga0068864_100080131 | 3300005618 | Bacteria | 2860 |
| 198 | Ga0068864_100083299 | 3300005618 | Bacteria | 2809 |
| 199 | Ga0068864_100105923 | 3300005618 | Bacteria | 2500 |
| 200 | Ga0068866_10218030 | 3300005718 | Unclassified | 1149 |
| 201 | Ga0068861_100013927 | 3300005719 | Bacteria | 5637 |
| 202 | Ga0068861_100034276 | 3300005719 | Bacteria | 3754 |
| 203 | Ga0068861_101398763 | 3300005719 | Unclassified | 683 |
| 204 | Ga0068851_10001735 | 3300005834 | Bacteria | 9527 |
| 205 | Ga0068851_10002075 | 3300005834 | Bacteria | 8827 |
| 206 | Ga0068851_10180128 | 3300005834 | Bacteria | 1170 |
| 207 | Ga0068851_10200490 | 3300005834 | Unclassified | 1113 |
| 208 | Ga0068870_10029294 | 3300005840 | Bacteria | 2772 |
| 209 | Ga0068870_10493820 | 3300005840 | Unclassified | 815 |
| 210 | Ga0068863_100002166 | 3300005841 | Bacteria | 19471 |
| 211 | Ga0068863_100643646 | 3300005841 | Bacteria | 1051 |
| 212 | Ga0068863_100709064 | 3300005841 | Unclassified | 1000 |
| 213 | Ga0068863_101265543 | 3300005841 | Unclassified | 744 |
| 214 | Ga0068863_101335669 | 3300005841 | Unclassified | 724 |
| 215 | Ga0068858_100001497 | 3300005842 | Bacteria | 24102 |
| 216 | Ga0068858_100068682 | 3300005842 | Bacteria | 3284 |
| 217 | Ga0068860_100000188 | 3300005843 | Bacteria | 98490 |
| 218 | Ga0068860_100080206 | 3300005843 | Bacteria | 3104 |
| 219 | Ga0068862_100029083 | 3300005844 | Bacteria | 4654 |
| 220 | Ga0068862_100053000 | 3300005844 | Bacteria | 3472 |
| 221 | Ga0068862_100332903 | 3300005844 | Bacteria | 1404 |
| 222 | Ga0070717_10001554 | 3300006028 | Bacteria | 15918 |
| 223 | Ga0070717_10013824 | 3300006028 | Bacteria | 6198 |
| 224 | Ga0070717_10015404 | 3300006028 | Bacteria | 5907 |
| 225 | Ga0070717_10034959 | 3300006028 | Bacteria | 4065 |
| 226 | Ga0070717_10055315 | 3300006028 | Bacteria | 3273 |
| 227 | Ga0070717_10065200 | 3300006028 | Bacteria | 3027 |
| 228 | Ga0070717_10319744 | 3300006028 | Bacteria | 1383 |
| 229 | Ga0070717_10486749 | 3300006028 | Bacteria | 1114 |
| 230 | Ga0070717_10585773 | 3300006028 | Bacteria | 1012 |
| 231 | Ga0070717_11178970 | 3300006028 | Unclassified | 697 |
| 232 | Ga0070715_10039516 | 3300006163 | Bacteria | 1966 |
| 233 | Ga0070716_100000362 | 3300006173 | Bacteria | 18659 |
| 234 | Ga0070716_100006011 | 3300006173 | Bacteria | 5912 |
| 235 | Ga0070716_100080931 | 3300006173 | Bacteria | 1938 |
| 236 | Ga0070716_100177412 | 3300006173 | Bacteria | 1396 |
| 237 | Ga0070716_100265942 | 3300006173 | Bacteria | 1176 |
| 238 | Ga0070716_100607214 | 3300006173 | Bacteria | 824 |
| 239 | Ga0070716_101147424 | 3300006173 | Bacteria | 622 |
| 240 | Ga0070712_100004680 | 3300006175 | Bacteria | 8461 |
| 241 | Ga0070712_100007747 | 3300006175 | Bacteria | 6722 |
| 242 | Ga0070712_100012554 | 3300006175 | Bacteria | 5386 |
| 243 | Ga0070712_100024155 | 3300006175 | Bacteria | 4024 |
| 244 | Ga0070712_100085022 | 3300006175 | Bacteria | 2302 |
| 245 | Ga0070712_101010320 | 3300006175 | Unclassified | 720 |
| 246 | Ga0070712_101358284 | 3300006175 | Unclassified | 620 |
| 247 | Ga0097621_100007205 | 3300006237 | Bacteria | 7935 |
| 248 | Ga0097621_100607160 | 3300006237 | Bacteria | 1000 |
| 249 | Ga0068871_100004472 | 3300006358 | Bacteria | 9732 |
| 250 | Ga0068871_100031432 | 3300006358 | Bacteria | 4187 |
| 251 | Ga0068871_100211589 | 3300006358 | Bacteria | 1677 |
| 252 | Ga0075433_10079886 | 3300006852 | Bacteria | 2882 |
| 253 | Ga0075433_10608442 | 3300006852 | Bacteria | 959 |
| 254 | Ga0075434_100001530 | 3300006871 | Bacteria | 19558 |
| 255 | Ga0075434_100814031 | 3300006871 | Unclassified | 950 |
| 256 | Ga0068865_100042964 | 3300006881 | Bacteria | 3085 |
| 257 | Ga0068865_100591690 | 3300006881 | Bacteria | 936 |
| 258 | Ga0075436_100035905 | 3300006914 | Unclassified | 3419 |
| 259 | Ga0075436_100321304 | 3300006914 | Bacteria | 1112 |
| 260 | Ga0097620_100003073 | 3300006931 | Bacteria | 16925 |
| 261 | Ga0097620_100008571 | 3300006931 | Bacteria | 10340 |
| 262 | Ga0097620_100111255 | 3300006931 | Bacteria | 2801 |
| 263 | Ga0075435_100015879 | 3300007076 | Bacteria | 5667 |
| 264 | Ga0075435_100488547 | 3300007076 | Bacteria | 1064 |
| 265 | Ga0105250_10022999 | 3300009092 | Bacteria | 2511 |
| 266 | Ga0105250_10185610 | 3300009092 | Bacteria | 874 |
| 267 | Ga0105240_10000125 | 3300009093 | Bacteria | 159027 |
| 268 | Ga0105240_10001204 | 3300009093 | Bacteria | 45110 |
| 269 | Ga0105240_10015304 | 3300009093 | Bacteria | 10436 |
| 270 | Ga0105240_10090699 | 3300009093 | Bacteria | 3735 |
| 271 | Ga0105240_10150805 | 3300009093 | Bacteria | 2769 |
| 272 | Ga0105240_10418606 | 3300009093 | Unclassified | 1506 |
| 273 | Ga0111539_12493572 | 3300009094 | Unclassified | 600 |
| 274 | Ga0105245_10008707 | 3300009098 | Bacteria | 8847 |
| 275 | Ga0105245_10009201 | 3300009098 | Bacteria | 8613 |
| 276 | Ga0105245_10171158 | 3300009098 | Bacteria | 2068 |
| 277 | Ga0105245_11508452 | 3300009098 | Unclassified | 723 |
| 278 | Ga0105247_10006936 | 3300009101 | Bacteria | 6974 |
| 279 | Ga0105247_10014624 | 3300009101 | Bacteria | 4704 |
| 280 | Ga0105247_10044374 | 3300009101 | Bacteria | 2726 |
| 281 | Ga0105247_10159623 | 3300009101 | Bacteria | 1492 |
| 282 | Ga0105243_10183153 | 3300009148 | Bacteria | 1823 |
| 283 | Ga0105241_10000043 | 3300009174 | Bacteria | 105124 |
| 284 | Ga0105241_10000092 | 3300009174 | Bacteria | 67501 |
| 285 | Ga0105241_10003508 | 3300009174 | Bacteria | 11669 |
| 286 | Ga0105241_10003987 | 3300009174 | Bacteria | 10913 |
| 287 | Ga0105241_10021431 | 3300009174 | Bacteria | 4776 |
| 288 | Ga0105241_10847957 | 3300009174 | Unclassified | 845 |
| 289 | Ga0105241_10960837 | 3300009174 | Bacteria | 797 |
| 290 | Ga0105241_10989076 | 3300009174 | Unclassified | 786 |
| 291 | Ga0105242_10074687 | 3300009176 | Bacteria | 2821 |
| 292 | Ga0105242_10383727 | 3300009176 | Bacteria | 1307 |
| 293 | Ga0105242_10417110 | 3300009176 | Bacteria | 1257 |
| 294 | Ga0105248_10019275 | 3300009177 | Bacteria | 7549 |
| 295 | Ga0105248_10024463 | 3300009177 | Bacteria | 6714 |
| 296 | Ga0105248_10159820 | 3300009177 | Bacteria | 2542 |
| 297 | Ga0105248_10350970 | 3300009177 | Bacteria | 1661 |
| 298 | Ga0105248_10537835 | 3300009177 | Unclassified | 1318 |
| 299 | Ga0105237_10000686 | 3300009545 | Bacteria | 46922 |
| 300 | Ga0105237_10015090 | 3300009545 | Bacteria | 8051 |
| 301 | Ga0105237_10016050 | 3300009545 | Bacteria | 7788 |
| 302 | Ga0105237_10095169 | 3300009545 | Bacteria | 2967 |
| 303 | Ga0105237_10333781 | 3300009545 | Bacteria | 1520 |
| 304 | Ga0105237_10488230 | 3300009545 | Unclassified | 1238 |
| 305 | Ga0105238_10000083 | 3300009551 | Bacteria | 107423 |
| 306 | Ga0105238_10000122 | 3300009551 | Bacteria | 85581 |
| 307 | Ga0105238_10185801 | 3300009551 | Bacteria | 2055 |
| 308 | Ga0105238_10824498 | 3300009551 | Bacteria | 944 |
| 309 | Ga0105238_10878342 | 3300009551 | Bacteria | 914 |
| 310 | Ga0105249_10016825 | 3300009553 | Bacteria | 6488 |
| 311 | Ga0105249_10017849 | 3300009553 | Bacteria | 6304 |
| 312 | Ga0105249_10068506 | 3300009553 | Bacteria | 3273 |
| 313 | Ga0105249_10288689 | 3300009553 | Bacteria | 1641 |
| 314 | Ga0099796_10236698 | 3300010159 | Bacteria | 753 |
| 315 | Ga0099796_10384050 | 3300010159 | Bacteria | 612 |
| 316 | Ga0105239_10010996 | 3300010375 | Bacteria | 10103 |
| 317 | Ga0105239_10051532 | 3300010375 | Bacteria | 4512 |
| 318 | Ga0105239_10052045 | 3300010375 | Unclassified | 4490 |
| 319 | Ga0105239_11718490 | 3300010375 | Unclassified | 726 |
| 320 | Ga0105246_10000284 | 3300011119 | Bacteria | 26540 |
| 321 | Ga0105246_10003685 | 3300011119 | Bacteria | 9277 |
| 322 | Ga0105246_10037058 | 3300011119 | Bacteria | 3271 |
| 323 | Ga0157347_1047219 | 3300012502 | Bacteria | 585 |
| 324 | Ga0157373_10004151 | 3300013100 | Bacteria | 10926 |
| 325 | Ga0157373_10060655 | 3300013100 | Bacteria | 2679 |
| 326 | Ga0157373_10225185 | 3300013100 | Bacteria | 1324 |
| 327 | Ga0157371_10005578 | 3300013102 | Bacteria | 10575 |
| 328 | Ga0157371_10038088 | 3300013102 | Bacteria | 3441 |
| 329 | Ga0157369_10001545 | 3300013105 | Bacteria | 28182 |
| 330 | Ga0157369_10003066 | 3300013105 | Bacteria | 19955 |
| 331 | Ga0157369_10019098 | 3300013105 | Bacteria | 7672 |
| 332 | Ga0157369_10031250 | 3300013105 | Bacteria | 5866 |
| 333 | Ga0157369_10138797 | 3300013105 | Bacteria | 2573 |
| 334 | Ga0157369_10896285 | 3300013105 | Unclassified | 910 |
| 335 | Ga0157374_10011719 | 3300013296 | Bacteria | 7605 |
| 336 | Ga0157374_10033040 | 3300013296 | Bacteria | 4718 |
| 337 | Ga0157374_10034477 | 3300013296 | Bacteria | 4623 |
| 338 | Ga0157374_10035275 | 3300013296 | Bacteria | 4576 |
| 339 | Ga0157374_10492431 | 3300013296 | Bacteria | 1230 |
| 340 | Ga0157378_10008928 | 3300013297 | Bacteria | 8725 |
| 341 | Ga0157378_10044780 | 3300013297 | Bacteria | 3930 |
| 342 | Ga0157378_10056338 | 3300013297 | Bacteria | 3503 |
| 343 | Ga0157378_10487820 | 3300013297 | Bacteria | 1229 |
| 344 | Ga0157378_10568063 | 3300013297 | Bacteria | 1142 |
| 345 | Ga0163162_10006846 | 3300013306 | Bacteria | 11062 |
| 346 | Ga0163162_10015578 | 3300013306 | Bacteria | 7431 |
| 347 | Ga0163162_10060056 | 3300013306 | Bacteria | 3835 |
| 348 | Ga0163162_10113732 | 3300013306 | Bacteria | 2805 |
| 349 | Ga0163162_11269317 | 3300013306 | Bacteria | 836 |
| 350 | Ga0157372_10018391 | 3300013307 | Bacteria | 7511 |
| 351 | Ga0157372_10114312 | 3300013307 | Bacteria | 3094 |
| 352 | Ga0157372_10146518 | 3300013307 | Bacteria | 2723 |
| 353 | Ga0157372_10373396 | 3300013307 | Bacteria | 1662 |
| 354 | Ga0157372_11006271 | 3300013307 | Bacteria | 965 |
| 355 | Ga0157375_10027050 | 3300013308 | Bacteria | 5356 |
| 356 | Ga0157375_10051079 | 3300013308 | Bacteria | 4058 |
| 357 | Ga0157375_11350087 | 3300013308 | Unclassified | 839 |
| 358 | Ga0163163_10000561 | 3300014325 | Bacteria | 32674 |
| 359 | Ga0163163_10002188 | 3300014325 | Bacteria | 16450 |
| 360 | Ga0163163_10036133 | 3300014325 | Bacteria | 4797 |
| 361 | Ga0163163_10060479 | 3300014325 | Bacteria | 3751 |
| 362 | Ga0163163_10355254 | 3300014325 | Bacteria | 1522 |
| 363 | Ga0163163_10507836 | 3300014325 | Bacteria | 1267 |
| 364 | Ga0157380_11337243 | 3300014326 | Unclassified | 765 |
| 365 | Ga0182008_10009202 | 3300014497 | Bacteria | 5340 |
| 366 | Ga0157377_10003729 | 3300014745 | Bacteria | 6916 |
| 367 | Ga0157379_10001207 | 3300014968 | Bacteria | 20999 |
| 368 | Ga0157379_10019539 | 3300014968 | Bacteria | 5984 |
| 369 | Ga0157379_10074088 | 3300014968 | Bacteria | 3047 |
| 370 | Ga0157379_10112678 | 3300014968 | Unclassified | 2445 |
| 371 | Ga0157379_10254833 | 3300014968 | Bacteria | 1594 |
| 372 | Ga0157379_10275784 | 3300014968 | Bacteria | 1530 |
| 373 | Ga0157376_10001660 | 3300014969 | Bacteria | 14782 |
| 374 | Ga0157376_10009673 | 3300014969 | Bacteria | 7015 |
| 375 | Ga0157376_10353171 | 3300014969 | Unclassified | 1408 |
| 376 | Ga0157376_10516468 | 3300014969 | Bacteria | 1177 |
| 377 | Ga0163161_10010741 | 3300017792 | Bacteria | 6343 |
| 378 | Ga0184600_131136 | 3300019190 | Bacteria | 2835 |
| 379 | Ga0184603_152930 | 3300019192 | Bacteria | 838 |
| 380 | Ga0197907_10226117 | 3300020069 | Unclassified | 1722 |
| 381 | Ga0197907_11139742 | 3300020069 | Bacteria | 675 |
| 382 | Ga0206356_11441786 | 3300020070 | Bacteria | 1198 |
| 383 | Ga0206349_1377318 | 3300020075 | Bacteria | 874 |
| 384 | Ga0206351_10177850 | 3300020077 | Unclassified | 851 |
| 385 | Ga0206352_10685474 | 3300020078 | Bacteria | 813 |
| 386 | Ga0206354_10122061 | 3300020081 | Unclassified | 1407 |
| 387 | Ga0206354_11661069 | 3300020081 | Unclassified | 518 |
| 388 | Ga0154015_1019090 | 3300020610 | Bacteria | 1007 |
| 389 | Ga0224712_10009934 | 3300022467 | Bacteria | 2890 |
| 390 | Ga0224712_10107193 | 3300022467 | Bacteria | 1193 |
| 391 | Ga0247553_102601 | 3300023672 | Bacteria | 842 |
| 392 | Ga0207697_10005610 | 3300025315 | Bacteria | 5806 |
| 393 | Ga0207656_10005061 | 3300025321 | Bacteria | 4635 |
| 394 | Ga0207656_10021437 | 3300025321 | Bacteria | 2582 |
| 395 | Ga0207656_10162827 | 3300025321 | Bacteria | 1062 |
| 396 | Ga0207682_10035732 | 3300025893 | Bacteria | 2008 |
| 397 | Ga0207692_10113367 | 3300025898 | Bacteria | 1507 |
| 398 | Ga0207692_10251918 | 3300025898 | Bacteria | 1058 |
| 399 | Ga0207642_10026795 | 3300025899 | Bacteria | 2351 |
| 400 | Ga0207642_10065874 | 3300025899 | Bacteria | 1704 |
| 401 | Ga0207710_10001709 | 3300025900 | Bacteria | 10617 |
| 402 | Ga0207710_10007231 | 3300025900 | Bacteria | 4704 |
| 403 | Ga0207710_10101856 | 3300025900 | Bacteria | 1355 |
| 404 | Ga0207688_10003510 | 3300025901 | Bacteria | 8557 |
| 405 | Ga0207680_10015013 | 3300025903 | Bacteria | 4031 |
| 406 | Ga0207680_10060671 | 3300025903 | Bacteria | 2303 |
| 407 | Ga0207680_10088737 | 3300025903 | Bacteria | 1961 |
| 408 | Ga0207647_10003391 | 3300025904 | Bacteria | 11937 |
| 409 | Ga0207647_10205354 | 3300025904 | Bacteria | 1139 |
| 410 | Ga0207647_10219273 | 3300025904 | Bacteria | 1097 |
| 411 | Ga0207685_10030785 | 3300025905 | Bacteria | 1914 |
| 412 | Ga0207685_10041938 | 3300025905 | Bacteria | 1715 |
| 413 | Ga0207699_10217291 | 3300025906 | Bacteria | 1303 |
| 414 | Ga0207699_10251978 | 3300025906 | Bacteria | 1217 |
| 415 | Ga0207699_10512924 | 3300025906 | Unclassified | 866 |
| 416 | Ga0207645_10027230 | 3300025907 | Bacteria | 3693 |
| 417 | Ga0207705_10103419 | 3300025909 | Bacteria | 2098 |
| 418 | Ga0207684_10000389 | 3300025910 | Bacteria | 59084 |
| 419 | Ga0207684_10000921 | 3300025910 | Bacteria | 33357 |
| 420 | Ga0207684_10007163 | 3300025910 | Bacteria | 10080 |
| 421 | Ga0207684_10009632 | 3300025910 | Bacteria | 8522 |
| 422 | Ga0207684_10116062 | 3300025910 | Bacteria | 2294 |
| 423 | Ga0207684_10126635 | 3300025910 | Bacteria | 2192 |
| 424 | Ga0207684_10421396 | 3300025910 | Bacteria | 1147 |
| 425 | Ga0207684_10773107 | 3300025910 | Bacteria | 813 |
| 426 | Ga0207654_10000019 | 3300025911 | Bacteria | 171031 |
| 427 | Ga0207654_10000858 | 3300025911 | Bacteria | 16815 |
| 428 | Ga0207654_10001656 | 3300025911 | Bacteria | 11641 |
| 429 | Ga0207654_10010963 | 3300025911 | Bacteria | 4616 |
| 430 | Ga0207654_10039744 | 3300025911 | Bacteria | 2648 |
| 431 | Ga0207654_10130487 | 3300025911 | Bacteria | 1590 |
| 432 | Ga0207707_10115018 | 3300025912 | Bacteria | 2351 |
| 433 | Ga0207707_10320182 | 3300025912 | Unclassified | 1339 |
| 434 | Ga0207695_10000210 | 3300025913 | Bacteria | 157198 |
| 435 | Ga0207695_10000338 | 3300025913 | Bacteria | 110289 |
| 436 | Ga0207695_10050253 | 3300025913 | Bacteria | 4388 |
| 437 | Ga0207695_10070920 | 3300025913 | Bacteria | 3560 |
| 438 | Ga0207695_10358830 | 3300025913 | Bacteria | 1344 |
| 439 | Ga0207695_10491572 | 3300025913 | Bacteria | 1109 |
| 440 | Ga0207671_10000068 | 3300025914 | Bacteria | 161429 |
| 441 | Ga0207671_10000145 | 3300025914 | Bacteria | 109306 |
| 442 | Ga0207671_10045869 | 3300025914 | Bacteria | 3233 |
| 443 | Ga0207693_10001531 | 3300025915 | Bacteria | 20431 |
| 444 | Ga0207693_10003230 | 3300025915 | Bacteria | 13991 |
| 445 | Ga0207693_10008387 | 3300025915 | Bacteria | 8455 |
| 446 | Ga0207693_10033483 | 3300025915 | Bacteria | 4055 |
| 447 | Ga0207693_10154904 | 3300025915 | Bacteria | 1802 |
| 448 | Ga0207693_10262606 | 3300025915 | Bacteria | 1354 |
| 449 | Ga0207663_10364544 | 3300025916 | Bacteria | 1097 |
| 450 | Ga0207663_10439460 | 3300025916 | Bacteria | 1004 |
| 451 | Ga0207660_10129081 | 3300025917 | Bacteria | 1922 |
| 452 | Ga0207660_10222738 | 3300025917 | Bacteria | 1481 |
| 453 | Ga0207660_10904507 | 3300025917 | Unclassified | 720 |
| 454 | Ga0207662_10708799 | 3300025918 | Unclassified | 706 |
| 455 | Ga0207657_10000626 | 3300025919 | Bacteria | 37555 |
| 456 | Ga0207657_10085411 | 3300025919 | Bacteria | 2643 |
| 457 | Ga0207649_10007611 | 3300025920 | Bacteria | 5890 |
| 458 | Ga0207649_10026936 | 3300025920 | Bacteria | 3368 |
| 459 | Ga0207652_10150233 | 3300025921 | Bacteria | 2085 |
| 460 | Ga0207646_10000054 | 3300025922 | Bacteria | 160414 |
| 461 | Ga0207646_10001021 | 3300025922 | Bacteria | 35814 |
| 462 | Ga0207646_10001731 | 3300025922 | Bacteria | 26548 |
| 463 | Ga0207646_10054314 | 3300025922 | Bacteria | 3584 |
| 464 | Ga0207646_10091800 | 3300025922 | Bacteria | 2717 |
| 465 | Ga0207646_10299492 | 3300025922 | Bacteria | 1453 |
| 466 | Ga0207646_10573364 | 3300025922 | Bacteria | 1014 |
| 467 | Ga0207646_11786158 | 3300025922 | Bacteria | 526 |
| 468 | Ga0207681_10012929 | 3300025923 | Bacteria | 5161 |
| 469 | Ga0207681_10154011 | 3300025923 | Bacteria | 1725 |
| 470 | Ga0207694_10000043 | 3300025924 | Bacteria | 171251 |
| 471 | Ga0207694_10000085 | 3300025924 | Bacteria | 108662 |
| 472 | Ga0207694_10050114 | 3300025924 | Bacteria | 3232 |
| 473 | Ga0207694_10658516 | 3300025924 | Unclassified | 882 |
| 474 | Ga0207650_10028268 | 3300025925 | Bacteria | 4019 |
| 475 | Ga0207650_10209867 | 3300025925 | Bacteria | 1563 |
| 476 | Ga0207659_10014351 | 3300025926 | Bacteria | 5105 |
| 477 | Ga0207687_10004706 | 3300025927 | Bacteria | 9078 |
| 478 | Ga0207687_10006238 | 3300025927 | Bacteria | 7889 |
| 479 | Ga0207700_10083686 | 3300025928 | Bacteria | 2498 |
| 480 | Ga0207700_10122573 | 3300025928 | Bacteria | 2110 |
| 481 | Ga0207700_10846102 | 3300025928 | Bacteria | 818 |
| 482 | Ga0207700_11816814 | 3300025928 | Unclassified | 535 |
| 483 | Ga0207664_10030871 | 3300025929 | Bacteria | 4095 |
| 484 | Ga0207664_10239080 | 3300025929 | Bacteria | 1581 |
| 485 | Ga0207664_10373287 | 3300025929 | Bacteria | 1265 |
| 486 | Ga0207664_10538248 | 3300025929 | Bacteria | 1047 |
| 487 | Ga0207644_10009734 | 3300025931 | Bacteria | 6319 |
| 488 | Ga0207644_10020673 | 3300025931 | Bacteria | 4479 |
| 489 | Ga0207690_10025891 | 3300025932 | Bacteria | 3689 |
| 490 | Ga0207706_10015203 | 3300025933 | Bacteria | 6965 |
| 491 | Ga0207686_10019537 | 3300025934 | Bacteria | 3856 |
| 492 | Ga0207686_10265160 | 3300025934 | Bacteria | 1261 |
| 493 | Ga0207709_10231845 | 3300025935 | Bacteria | 1338 |
| 494 | Ga0207670_10013296 | 3300025936 | Bacteria | 4847 |
| 495 | Ga0207670_10027036 | 3300025936 | Bacteria | 3623 |
| 496 | Ga0207669_10030663 | 3300025937 | Bacteria | 2991 |
| 497 | Ga0207704_10045185 | 3300025938 | Bacteria | 2615 |
| 498 | Ga0207704_10116602 | 3300025938 | Bacteria | 1818 |
| 499 | Ga0207665_10000680 | 3300025939 | Bacteria | 22941 |
| 500 | Ga0207665_10102811 | 3300025939 | Bacteria | 1997 |
| 501 | Ga0207665_10601784 | 3300025939 | Bacteria | 858 |
| 502 | Ga0207665_10602848 | 3300025939 | Bacteria | 858 |
| 503 | Ga0207711_10005920 | 3300025941 | Bacteria | 10330 |
| 504 | Ga0207711_10019631 | 3300025941 | Bacteria | 5627 |
| 505 | Ga0207711_10027489 | 3300025941 | Bacteria | 4778 |
| 506 | Ga0207711_10624748 | 3300025941 | Bacteria | 1005 |
| 507 | Ga0207689_10000875 | 3300025942 | Bacteria | 29020 |
| 508 | Ga0207689_10001635 | 3300025942 | Bacteria | 21241 |
| 509 | Ga0207689_10192475 | 3300025942 | Bacteria | 1683 |
| 510 | Ga0207661_10000402 | 3300025944 | Bacteria | 28027 |
| 511 | Ga0207661_10054639 | 3300025944 | Bacteria | 3200 |
| 512 | Ga0207661_10202856 | 3300025944 | Bacteria | 1744 |
| 513 | Ga0207679_10037566 | 3300025945 | Bacteria | 3443 |
| 514 | Ga0207667_10091353 | 3300025949 | Bacteria | 3145 |
| 515 | Ga0207667_10105131 | 3300025949 | Bacteria | 2912 |
| 516 | Ga0207667_10593589 | 3300025949 | Bacteria | 1117 |
| 517 | Ga0207667_10755070 | 3300025949 | Bacteria | 972 |
| 518 | Ga0207651_10023909 | 3300025960 | Bacteria | 3768 |
| 519 | Ga0207712_10045296 | 3300025961 | Bacteria | 3045 |
| 520 | Ga0207712_10076361 | 3300025961 | Bacteria | 2425 |
| 521 | Ga0207712_10188727 | 3300025961 | Bacteria | 1625 |
| 522 | Ga0207712_10196340 | 3300025961 | Bacteria | 1597 |
| 523 | Ga0207668_10011636 | 3300025972 | Bacteria | 5353 |
| 524 | Ga0207640_10012277 | 3300025981 | Bacteria | 4874 |
| 525 | Ga0207640_10012979 | 3300025981 | Bacteria | 4760 |
| 526 | Ga0207640_10042944 | 3300025981 | Bacteria | 2886 |
| 527 | Ga0207658_10002106 | 3300025986 | Bacteria | 14806 |
| 528 | Ga0207658_10006917 | 3300025986 | Bacteria | 7722 |
| 529 | Ga0207658_10025548 | 3300025986 | Bacteria | 4136 |
| 530 | Ga0207677_10000841 | 3300026023 | Bacteria | 17538 |
| 531 | Ga0207677_10007711 | 3300026023 | Bacteria | 5974 |
| 532 | Ga0207677_10010795 | 3300026023 | Bacteria | 5180 |
| 533 | Ga0207677_10064922 | 3300026023 | Bacteria | 2544 |
| 534 | Ga0207703_10003037 | 3300026035 | Bacteria | 14201 |
| 535 | Ga0207703_10006325 | 3300026035 | Bacteria | 9467 |
| 536 | Ga0207703_10063265 | 3300026035 | Bacteria | 3033 |
| 537 | Ga0207703_10239389 | 3300026035 | Bacteria | 1631 |
| 538 | Ga0207703_10760994 | 3300026035 | Bacteria | 923 |
| 539 | Ga0207639_10000072 | 3300026041 | Bacteria | 94533 |
| 540 | Ga0207639_10016958 | 3300026041 | Bacteria | 5160 |
| 541 | Ga0207678_10008082 | 3300026067 | Bacteria | 9277 |
| 542 | Ga0207678_10529187 | 3300026067 | Bacteria | 1029 |
| 543 | Ga0207678_10697689 | 3300026067 | Bacteria | 893 |
| 544 | Ga0207708_10040151 | 3300026075 | Bacteria | 3567 |
| 545 | Ga0207702_10000205 | 3300026078 | Bacteria | 70125 |
| 546 | Ga0207702_10021287 | 3300026078 | Bacteria | 5367 |
| 547 | Ga0207702_10177590 | 3300026078 | Bacteria | 1958 |
| 548 | Ga0207702_10307358 | 3300026078 | Bacteria | 1506 |
| 549 | Ga0207702_10437554 | 3300026078 | Unclassified | 1267 |
| 550 | Ga0207641_10006446 | 3300026088 | Bacteria | 9892 |
| 551 | Ga0207641_10453364 | 3300026088 | Bacteria | 1240 |
| 552 | Ga0207641_10809933 | 3300026088 | Bacteria | 927 |
| 553 | Ga0207641_10937218 | 3300026088 | Unclassified | 861 |
| 554 | Ga0207676_10005980 | 3300026095 | Bacteria | 8579 |
| 555 | Ga0207676_10122425 | 3300026095 | Bacteria | 2196 |
| 556 | Ga0207676_10736563 | 3300026095 | Bacteria | 958 |
| 557 | Ga0207674_10000239 | 3300026116 | Bacteria | 68575 |
| 558 | Ga0207674_10026228 | 3300026116 | Bacteria | 6196 |
| 559 | Ga0207674_10119579 | 3300026116 | Bacteria | 2603 |
| 560 | Ga0207675_100028244 | 3300026118 | Bacteria | 5223 |
| 561 | Ga0207675_100106606 | 3300026118 | Unclassified | 2642 |
| 562 | Ga0207683_10188949 | 3300026121 | Bacteria | 1869 |
| 563 | Ga0207698_10000040 | 3300026142 | Bacteria | 100053 |
| 564 | Ga0207698_10293941 | 3300026142 | Bacteria | 1509 |
| 565 | Ga0207698_10693122 | 3300026142 | Bacteria | 1013 |
| 566 | Ga0207698_10924680 | 3300026142 | Bacteria | 880 |
| 567 | Ga0207698_11309497 | 3300026142 | Bacteria | 739 |
| 568 | Ga0265354_1009546 | 3300028016 | Bacteria | 931 |
| 569 | Ga0268266_10049803 | 3300028379 | Bacteria | 3593 |
| 570 | Ga0268266_10066550 | 3300028379 | Bacteria | 3117 |
| 571 | Ga0268265_10033781 | 3300028380 | Bacteria | 3722 |
| 572 | Ga0268264_10004509 | 3300028381 | Bacteria | 11879 |
| 573 | Ga0268264_10131628 | 3300028381 | Bacteria | 2218 |
| 574 | Ga0265336_10086843 | 3300028666 | Bacteria | 933 |
| 575 | Ga0265338_10036712 | 3300028800 | Bacteria | 4684 |
| 576 | Ga0265338_10064140 | 3300028800 | Bacteria | 3197 |
| 577 | Ga0265338_10158716 | 3300028800 | Bacteria | 1749 |
| 578 | Ga0265338_10435094 | 3300028800 | Unclassified | 930 |
| 579 | Ga0265762_1115415 | 3300030760 | Unclassified | 609 |
| 580 | Ga0265775_103204 | 3300030762 | Bacteria | 878 |
| 581 | Ga0265765_1017299 | 3300030879 | Bacteria | 850 |
| 582 | Ga0265765_1029077 | 3300030879 | Bacteria | 698 |
| 583 | Ga0265760_10000187 | 3300031090 | Bacteria | 16292 |
| 584 | Ga0265760_10006194 | 3300031090 | Bacteria | 3421 |
| 585 | Ga0265760_10061558 | 3300031090 | Bacteria | 1141 |
| 586 | Ga0265340_10088073 | 3300031247 | Bacteria | 1455 |
| 587 | Ga0265339_10136882 | 3300031249 | Bacteria | 1249 |
| 588 | Ga0265339_10230716 | 3300031249 | Bacteria | 902 |
| 589 | Ga0265339_10346169 | 3300031249 | Unclassified | 701 |
| 590 | Ga0265316_10010452 | 3300031344 | Bacteria | 8456 |
| 591 | Ga0265316_10041556 | 3300031344 | Bacteria | 3679 |
| 592 | Ga0265316_10083170 | 3300031344 | Bacteria | 2452 |
| 593 | Ga0265314_10017548 | 3300031711 | Bacteria | 5614 |
| 594 | Ga0316053_100579 | 3300032120 | Bacteria | 1725 |
| 595 | Ga0316053_110970 | 3300032120 | Unclassified | 636 |
| 596 | Ga0316214_1007707 | 3300033545 | Bacteria | 1441 |
| 597 | Ga0316212_1020040 | 3300033547 | Unclassified | 939 |
| 598 | Ga0373950_0026472 | 3300034818 | Unclassified | 1053 |
| 599 | Ga0373928_0146853 | 3300035084 | Unclassified | 650 |
| 600 | Ga0373929_0080689 | 3300035085 | Bacteria | 792 |
| 601 | Ga0373940_0034564 | 3300035088 | Bacteria | 1364 |
| 602 | Ga0373940_0051096 | 3300035088 | Bacteria | 1162 |
| 603 | Ga0373944_0283063 | 3300035089 | Unclassified | 619 |
| 604 | Ga0373952_0046901 | 3300035092 | Bacteria | 1017 |
| 605 | Ga0373923_0170232 | 3300035111 | Bacteria | 997 |
| 606 | Ga0373936_0036192 | 3300035113 | Bacteria | 1967 |
| 607 | Ga0373941_0140399 | 3300035115 | Bacteria | 878 |
| 608 | Ga0373945_0147347 | 3300035116 | Unclassified | 952 |
| 609 | Ga0373954_0183246 | 3300035118 | Unclassified | 1027 |
| 610 | Ga0373956_0115153 | 3300035119 | Bacteria | 1253 |
| 611 | Ga0373957_0139218 | 3300035120 | Bacteria | 991 |
| 612 | Ga0373943_0008381 | 3300035170 | Bacteria | 4638 |
| 613 | Ga0373943_0203336 | 3300035170 | Bacteria | 1097 |
| 614 | Ga0373946_0218275 | 3300035171 | Bacteria | 920 |
| 615 | Ga0373955_0061711 | 3300035172 | Bacteria | 2071 |
| 616 | Ga0373961_0075587 | 3300035241 | Bacteria | 1050 |
| 617 | Ga0373924_0223758 | 3300035410 | Bacteria | 831 |
| 618 | Ga0373931_0080475 | 3300035691 | Bacteria | 1796 |
| 619 | Ga0373931_0238116 | 3300035691 | Unclassified | 1102 |
| 620 | Ga0373931_0598682 | 3300035691 | Bacteria | 720 |
| 621 | Ga0373935_0004159 | 3300035692 | Bacteria | 8472 |
| 622 | Ga0373927_0040349 | 3300035695 | Bacteria | 3028 |
| 623 | Ga0373927_0208838 | 3300035695 | Unclassified | 1282 |
| 624 | Ga0373927_0485890 | 3300035695 | Unclassified | 816 |
| 625 | Ga0373933_0037915 | 3300035724 | Bacteria | 2830 |
| 626 | Ga0373947_0065887 | 3300035725 | Bacteria | 2210 |
| 627 | Ga0373947_0319790 | 3300035725 | Unclassified | 1038 |
| 628 | Ga0373947_1080707 | 3300035725 | Unclassified | 547 |
| 629 | Ga0373937_0367435 | 3300036401 | Bacteria | 1364 |
| 630 | Ga0373937_0404424 | 3300036401 | Bacteria | 1295 |
| 631 | Ga0373937_1216376 | 3300036401 | Bacteria | 702 |
| 632 | Ga0373925_0018201 | 3300037068 | Bacteria | 5103 |
| 633 | Ga0373925_0034326 | 3300037068 | Bacteria | 3739 |
| 634 | Ga0373925_0104477 | 3300037068 | Bacteria | 2181 |
| 635 | Ga0373925_0873336 | 3300037068 | Unclassified | 741 |
| 636 | Ga0436360_0305246 | 3300039438 | Bacteria | 682 |
| 637 | Ga0436363_0901030 | 3300039450 | Bacteria | 1750 |
| 638 | Ga0436362_1210155 | 3300039453 | Bacteria | 811 |
| 639 | Ga0439448_0036989 | 3300042005 | Bacteria | 1567 |
| 640 | Ga0451577_0000885 | 3300042876 | Bacteria | 44482 |
| 641 | Ga0451577_0120857 | 3300042876 | Bacteria | 2346 |
| 642 | Ga0453683_0001795 | 3300044673 | Bacteria | 17751 |
| 643 | Ga0453683_0028183 | 3300044673 | Bacteria | 3557 |
| 644 | Ga0466964_0065841 | 3300044706 | Bacteria | 1519 |
| 645 | Ga0453684_0007009 | 3300044712 | Bacteria | 21065 |
| 646 | Ga0453684_0474829 | 3300044712 | Bacteria | 1388 |
| 647 | Ga0451576_0047334 | 3300045051 | Bacteria | 4522 |
| 648 | Ga0451576_0336904 | 3300045051 | Bacteria | 1579 |
| 649 | Ga0451576_0490606 | 3300045051 | Bacteria | 1290 |
| 650 | Ga0451576_0806605 | 3300045051 | Bacteria | 986 |
| 651 | Ga0451576_1158824 | 3300045051 | Bacteria | 808 |
| 652 | Ga0495603_0382887 | 3300046455 | Bacteria | 806 |
| 653 | Ga0495590_0092051 | 3300046457 | Bacteria | 1073 |
| 654 | Ga0495590_0112587 | 3300046457 | Bacteria | 972 |
| 655 | Ga0495629_0013831 | 3300046459 | Bacteria | 5823 |
| 656 | Ga0495580_0000007 | 3300046472 | Bacteria | 103420 |
| 657 | Ga0495580_0000600 | 3300046472 | Bacteria | 30472 |
| 658 | Ga0495580_0000831 | 3300046472 | Bacteria | 26753 |
| 659 | Ga0495580_0001059 | 3300046472 | Bacteria | 24199 |
| 660 | Ga0495580_0040984 | 3300046472 | Bacteria | 3305 |
| 661 | Ga0495580_0103100 | 3300046472 | Bacteria | 1983 |
| 662 | Ga0495580_0106965 | 3300046472 | Bacteria | 1943 |
| 663 | Ga0495580_0134143 | 3300046472 | Bacteria | 1717 |
| 664 | Ga0495580_0172639 | 3300046472 | Bacteria | 1494 |
| 665 | Ga0495580_0386901 | 3300046472 | Bacteria | 944 |
| 666 | Ga0495582_0014527 | 3300046473 | Bacteria | 4326 |
| 667 | Ga0495582_0579905 | 3300046473 | Unclassified | 649 |
| 668 | Ga0495605_0258391 | 3300046474 | Bacteria | 744 |
| 669 | Ga0495639_0290405 | 3300046475 | Bacteria | 814 |
| 670 | Ga0495639_0333402 | 3300046475 | Bacteria | 760 |
| 671 | Ga0495664_0278693 | 3300046477 | Unclassified | 1010 |
| 672 | Ga0495594_0118305 | 3300046499 | Bacteria | 1497 |
| 673 | Ga0495594_0285301 | 3300046499 | Bacteria | 941 |
| 674 | Ga0495594_0417039 | 3300046499 | Unclassified | 764 |
| 675 | Ga0495630_0275939 | 3300046517 | Bacteria | 1284 |
| 676 | Ga0495665_0047528 | 3300046531 | Bacteria | 2276 |
| 677 | Ga0495665_0163994 | 3300046531 | Bacteria | 1158 |
| 678 | Ga0495665_0193666 | 3300046531 | Bacteria | 1055 |
| 679 | Ga0495665_0319563 | 3300046531 | Bacteria | 793 |
| 680 | Ga0495587_0369925 | 3300046536 | Bacteria | 798 |
| 681 | Ga0495668_0305192 | 3300046616 | Bacteria | 873 |
| 682 | Ga0495659_0010209 | 3300046664 | Bacteria | 3008 |
| 683 | Ga0495588_0094928 | 3300046674 | Bacteria | 1564 |
| 684 | Ga0495657_0257271 | 3300046675 | Bacteria | 1050 |
| 685 | Ga0495657_0349084 | 3300046675 | Bacteria | 876 |
| 686 | Ga0495657_0528497 | 3300046675 | Unclassified | 686 |
| 687 | Ga0495658_0016509 | 3300046683 | Bacteria | 3800 |
| 688 | Ga0495669_0084006 | 3300046684 | Bacteria | 1464 |
| 689 | Ga0495624_0098992 | 3300046690 | Bacteria | 1796 |
| 690 | Ga0495670_0151067 | 3300046691 | Bacteria | 1218 |
| 691 | Ga0495674_0014419 | 3300047319 | Bacteria | 7399 |
| 692 | Ga0495674_1469901 | 3300047319 | Unclassified | 505 |
| 693 | Ga0495676_0157979 | 3300047321 | Bacteria | 1607 |
| 694 | Ga0495677_0085100 | 3300047445 | Bacteria | 1188 |
| 695 | Ga0495684_0254208 | 3300047471 | Bacteria | 1277 |
| 696 | Ga0495684_0409406 | 3300047471 | Bacteria | 950 |
| 697 | Ga0495684_0468512 | 3300047471 | Unclassified | 872 |
| 698 | Ga0495602_0340473 | 3300048088 | Bacteria | 1085 |
| 699 | Ga0496100_0200559 | 3300048903 | Bacteria | 1454 |
| 700 | Ga0496100_0370951 | 3300048903 | Unclassified | 1085 |
| 701 | Ga0496101_0543670 | 3300048904 | Bacteria | 918 |
| 702 | Ga0496101_1115419 | 3300048904 | Bacteria | 619 |
| 703 | Ga0496101_1136884 | 3300048904 | Unclassified | 613 |
| 704 | Ga0496102_0000730 | 3300048905 | Bacteria | 32303 |
| 705 | Ga0496102_0219202 | 3300048905 | Bacteria | 1793 |
| 706 | Ga0496102_0520438 | 3300048905 | Bacteria | 1112 |
| 707 | Ga0496102_0875147 | 3300048905 | Unclassified | 820 |
| 708 | Ga0496102_1164390 | 3300048905 | Unclassified | 690 |
| 709 | Ga0496102_1380758 | 3300048905 | Unclassified | 623 |
| 710 | Ga0496102_1507227 | 3300048905 | Unclassified | 591 |
| 711 | Ga0496103_0003239 | 3300048906 | Bacteria | 9985 |
| 712 | Ga0496103_0102813 | 3300048906 | Bacteria | 1809 |
| 713 | Ga0496103_0328011 | 3300048906 | Bacteria | 984 |
| 714 | Ga0496104_0100570 | 3300048907 | Bacteria | 2768 |
| 715 | Ga0496104_0179569 | 3300048907 | Unclassified | 2027 |
| 716 | Ga0496104_0968883 | 3300048907 | Unclassified | 755 |
| 717 | Ga0496105_0395219 | 3300048908 | Bacteria | 1098 |
| 718 | Ga0496105_0434234 | 3300048908 | Unclassified | 1038 |
| 719 | Ga0496106_0024052 | 3300048909 | Bacteria | 4528 |
| 720 | Ga0496106_0354737 | 3300048909 | Bacteria | 1178 |
| 721 | Ga0496106_0490117 | 3300048909 | Bacteria | 987 |
| 722 | Ga0496106_1313026 | 3300048909 | Unclassified | 561 |
| 723 | Ga0496107_0174101 | 3300048910 | Bacteria | 1597 |
| 724 | Ga0496107_0518921 | 3300048910 | Bacteria | 883 |
| 725 | Ga0496107_0560905 | 3300048910 | Bacteria | 845 |
| 726 | Ga0496108_0000535 | 3300048911 | Bacteria | 29618 |
| 727 | Ga0496109_0000323 | 3300048912 | Bacteria | 44606 |
| 728 | Ga0496109_0525315 | 3300048912 | Unclassified | 1117 |
| 729 | Ga0496110_0000505 | 3300048913 | Bacteria | 26465 |
| 730 | Ga0496110_0180279 | 3300048913 | Bacteria | 1918 |
| 731 | Ga0496111_0270943 | 3300048914 | Unclassified | 1259 |
| 732 | Ga0496111_0447546 | 3300048914 | Bacteria | 953 |
| 733 | Ga0496112_0013887 | 3300048915 | Bacteria | 7450 |
| 734 | Ga0496112_0028806 | 3300048915 | Bacteria | 5364 |
| 735 | Ga0496112_0066669 | 3300048915 | Bacteria | 3552 |
| 736 | Ga0496112_0153503 | 3300048915 | Bacteria | 2270 |
| 737 | Ga0496112_0237257 | 3300048915 | Bacteria | 1777 |
| 738 | Ga0496112_0621899 | 3300048915 | Bacteria | 1011 |
| 739 | Ga0496112_1031683 | 3300048915 | Bacteria | 742 |
| 740 | Ga0496113_0007627 | 3300048916 | Bacteria | 6980 |
| 741 | Ga0496113_0089709 | 3300048916 | Unclassified | 2367 |
| 742 | Ga0496113_0484113 | 3300048916 | Bacteria | 994 |
| 743 | Ga0496113_0501657 | 3300048916 | Bacteria | 974 |
| 744 | Ga0496114_1259891 | 3300048917 | Bacteria | 626 |
| 745 | Ga0496115_0045617 | 3300048918 | Bacteria | 3500 |
| 746 | Ga0496115_0401926 | 3300048918 | Bacteria | 1111 |
| 747 | Ga0496115_0991718 | 3300048918 | Unclassified | 642 |
| 748 | Ga0495682_0066902 | 3300049460 | Bacteria | 1295 |
| 749 | Ga0501067_0147087 | 3300049583 | Bacteria | 1313 |
| 750 | nmdc:mga08y16_1640348_c1 | 3300050511 | Unclassified | 600 |
| 751 | nmdc:mga0n895_3077_c1 | 3300050512 | Bacteria | 13275 |
| 752 | nmdc:mga0rr50_143419_c1 | 3300050513 | Bacteria | 1923 |
| 753 | nmdc:mga0rr50_244551_c1 | 3300050513 | Bacteria | 1488 |
| 754 | nmdc:mga08x19_410_c1 | 3300050514 | Bacteria | 30075 |
| 755 | nmdc:mga0a205_17360_c1 | 3300050515 | Bacteria | 2948 |
| 756 | Ga0587093_055070 | 3300059478 | Unclassified | 637 |
| 757 | Ga0587073_0072429 | 3300059492 | Bacteria | 835 |
| 758 | Ga0587073_0164074 | 3300059492 | Unclassified | 639 |
| 759 | Ga0587082_102117 | 3300059504 | Unclassified | 626 |
| 760 | Ga0587083_0108716 | 3300059505 | Bacteria | 701 |
| 761 | Ga0587088_102604 | 3300059508 | Unclassified | 641 |
| 762 | Ga0587131_007016 | 3300059609 | Bacteria | 742 |
| 763 | Ga0587128_079909 | 3300059630 | Bacteria | 653 |
| 764 | Ga0587128_156164 | 3300059630 | Unclassified | 523 |
| 765 | Ga0587079_127560 | 3300059647 | Unclassified | 636 |
| 766 | Ga0587114_066070 | 3300059655 | Unclassified | 645 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005436 | Ga0070713_100000963 | Ga0070713_1000009635 | 139 |
| 2 | 3300005439 | Ga0070711_100021540 | Ga0070711_1000215404 | 139 |
| 3 | 3300006028 | Ga0070717_10013824 | Ga0070717_100138244 | 139 |
| 4 | 3300006028 | Ga0070717_11178970 | Ga0070717_111789701 | 139 |
| 5 | 3300006173 | Ga0070716_100006011 | Ga0070716_1000060115 | 139 |
| 6 | 3300030879 | Ga0265765_1017299 | Ga0265765_10172991 | 139 |
| 7 | 3300005445 | Ga0070708_100148576 | Ga0070708_1001485763 | 142 |
| 8 | 3300044706 | Ga0466964_0065841 | Ga0466964_0065841_870_1337 | 142 |
| 9 | 3300006028 | Ga0070717_10034959 | Ga0070717_100349592 | 143 |
| 10 | 3300025916 | Ga0207663_10439460 | Ga0207663_104394601 | 143 |
| 11 | 3300025928 | Ga0207700_11816814 | Ga0207700_118168141 | 143 |
| 12 | 3300035116 | Ga0373945_0147347 | Ga0373945_0147347_387_839 | 143 |
| 13 | 3300035170 | Ga0373943_0203336 | Ga0373943_0203336_139_591 | 143 |
| 14 | 3300037068 | Ga0373925_0034326 | Ga0373925_0034326_869_1321 | 143 |
| 15 | 3300005445 | Ga0070708_100105612 | Ga0070708_1001056122 | 144 |
| 16 | 3300005468 | Ga0070707_100000190 | Ga0070707_10000019034 | 144 |
| 17 | 3300025922 | Ga0207646_10000054 | Ga0207646_1000005429 | 144 |
| 18 | 3300042876 | Ga0451577_0120857 | Ga0451577_0120857_116_553 | 144 |
| 19 | 3300044673 | Ga0453683_0001795 | Ga0453683_0001795_16480_16917 | 144 |
| 20 | 3300044712 | Ga0453684_0474829 | Ga0453684_0474829_604_1041 | 144 |
| 21 | 3300045051 | Ga0451576_0336904 | Ga0451576_0336904_1088_1525 | 144 |
| 22 | 3300033545 | Ga0316214_1007707 | Ga0316214_10077072 | 145 |
| 23 | 3300005718 | Ga0068866_10218030 | Ga0068866_102180302 | 146 |
| 24 | 3300014325 | Ga0163163_10060479 | Ga0163163_100604795 | 146 |
| 25 | 3300025899 | Ga0207642_10065874 | Ga0207642_100658743 | 146 |
| 26 | 3300025922 | Ga0207646_10299492 | Ga0207646_102994922 | 146 |
| 27 | 3300028379 | Ga0268266_10049803 | Ga0268266_100498031 | 146 |
| 28 | 3300046474 | Ga0495605_0258391 | Ga0495605_0258391_237_683 | 146 |
| 29 | 3300046531 | Ga0495665_0193666 | Ga0495665_0193666_591_1037 | 146 |
| 30 | 3300046616 | Ga0495668_0305192 | Ga0495668_0305192_333_779 | 146 |
| 31 | 3300046674 | Ga0495588_0094928 | Ga0495588_0094928_439_885 | 146 |
| 32 | 3300046684 | Ga0495669_0084006 | Ga0495669_0084006_954_1400 | 146 |
| 33 | 3300047445 | Ga0495677_0085100 | Ga0495677_0085100_572_1018 | 146 |
| 34 | 3300048915 | Ga0496112_1031683 | Ga0496112_1031683_106_552 | 146 |
| 35 | 3300049583 | Ga0501067_0147087 | Ga0501067_0147087_744_1211 | 146 |
| 36 | 3300001991 | JGI24743J22301_10005212 | JGI24743J22301_100052122 | 147 |
| 37 | 3300005290 | Ga0065712_10331065 | Ga0065712_103310652 | 147 |
| 38 | 3300005327 | Ga0070658_10016195 | Ga0070658_100161952 | 147 |
| 39 | 3300005329 | Ga0070683_100000196 | Ga0070683_10000019631 | 147 |
| 40 | 3300005329 | Ga0070683_100466363 | Ga0070683_1004663631 | 147 |
| 41 | 3300005331 | Ga0070670_100003321 | Ga0070670_1000033216 | 147 |
| 42 | 3300005334 | Ga0068869_100001678 | Ga0068869_1000016788 | 147 |
| 43 | 3300005334 | Ga0068869_100211941 | Ga0068869_1002119412 | 147 |
| 44 | 3300005335 | Ga0070666_10023121 | Ga0070666_100231216 | 147 |
| 45 | 3300005335 | Ga0070666_10359023 | Ga0070666_103590232 | 147 |
| 46 | 3300005337 | Ga0070682_100007543 | Ga0070682_1000075432 | 147 |
| 47 | 3300005338 | Ga0068868_100005839 | Ga0068868_1000058393 | 147 |
| 48 | 3300005338 | Ga0068868_100027007 | Ga0068868_1000270073 | 147 |
| 49 | 3300005339 | Ga0070660_100068735 | Ga0070660_1000687354 | 147 |
| 50 | 3300005340 | Ga0070689_100059915 | Ga0070689_1000599152 | 147 |
| 51 | 3300005341 | Ga0070691_10043894 | Ga0070691_100438942 | 147 |
| 52 | 3300005344 | Ga0070661_100031791 | Ga0070661_1000317912 | 147 |
| 53 | 3300005344 | Ga0070661_100065456 | Ga0070661_1000654562 | 147 |
| 54 | 3300005347 | Ga0070668_100161328 | Ga0070668_1001613282 | 147 |
| 55 | 3300005353 | Ga0070669_100138701 | Ga0070669_1001387012 | 147 |
| 56 | 3300005354 | Ga0070675_100379893 | Ga0070675_1003798933 | 147 |
| 57 | 3300005355 | Ga0070671_100057077 | Ga0070671_1000570772 | 147 |
| 58 | 3300005366 | Ga0070659_100078269 | Ga0070659_1000782694 | 147 |
| 59 | 3300005367 | Ga0070667_100008526 | Ga0070667_1000085269 | 147 |
| 60 | 3300005440 | Ga0070705_101002504 | Ga0070705_1010025041 | 147 |
| 61 | 3300005445 | Ga0070708_100110753 | Ga0070708_1001107533 | 147 |
| 62 | 3300005455 | Ga0070663_100031137 | Ga0070663_1000311374 | 147 |
| 63 | 3300005455 | Ga0070663_100279421 | Ga0070663_1002794212 | 147 |
| 64 | 3300005456 | Ga0070678_100169228 | Ga0070678_1001692282 | 147 |
| 65 | 3300005457 | Ga0070662_100006064 | Ga0070662_1000060643 | 147 |
| 66 | 3300005467 | Ga0070706_100001749 | Ga0070706_10000174911 | 147 |
| 67 | 3300005468 | Ga0070707_100811028 | Ga0070707_1008110281 | 147 |
| 68 | 3300005471 | Ga0070698_101021644 | Ga0070698_1010216441 | 147 |
| 69 | 3300005535 | Ga0070684_100000283 | Ga0070684_10000028330 | 147 |
| 70 | 3300005535 | Ga0070684_100205317 | Ga0070684_1002053172 | 147 |
| 71 | 3300005535 | Ga0070684_100344579 | Ga0070684_1003445792 | 147 |
| 72 | 3300005539 | Ga0068853_100000114 | Ga0068853_10000011452 | 147 |
| 73 | 3300005539 | Ga0068853_100443228 | Ga0068853_1004432281 | 147 |
| 74 | 3300005545 | Ga0070695_100236343 | Ga0070695_1002363432 | 147 |
| 75 | 3300005546 | Ga0070696_100303480 | Ga0070696_1003034802 | 147 |
| 76 | 3300005547 | Ga0070693_100044548 | Ga0070693_1000445482 | 147 |
| 77 | 3300005548 | Ga0070665_100016715 | Ga0070665_1000167153 | 147 |
| 78 | 3300005548 | Ga0070665_100119794 | Ga0070665_1001197945 | 147 |
| 79 | 3300005563 | Ga0068855_100009737 | Ga0068855_10000973711 | 147 |
| 80 | 3300005563 | Ga0068855_100227498 | Ga0068855_1002274981 | 147 |
| 81 | 3300005564 | Ga0070664_100124450 | Ga0070664_1001244502 | 147 |
| 82 | 3300005577 | Ga0068857_100000606 | Ga0068857_10000060610 | 147 |
| 83 | 3300005577 | Ga0068857_100101920 | Ga0068857_1001019202 | 147 |
| 84 | 3300005578 | Ga0068854_100166302 | Ga0068854_1001663022 | 147 |
| 85 | 3300005578 | Ga0068854_100945747 | Ga0068854_1009457471 | 147 |
| 86 | 3300005614 | Ga0068856_100015081 | Ga0068856_1000150814 | 147 |
| 87 | 3300005614 | Ga0068856_100018182 | Ga0068856_1000181825 | 147 |
| 88 | 3300005614 | Ga0068856_100022679 | Ga0068856_1000226796 | 147 |
| 89 | 3300005616 | Ga0068852_100000033 | Ga0068852_10000003385 | 147 |
| 90 | 3300005616 | Ga0068852_100441353 | Ga0068852_1004413532 | 147 |
| 91 | 3300005617 | Ga0068859_100008570 | Ga0068859_10000857011 | 147 |
| 92 | 3300005617 | Ga0068859_100111266 | Ga0068859_1001112665 | 147 |
| 93 | 3300005618 | Ga0068864_100000314 | Ga0068864_10000031424 | 147 |
| 94 | 3300005618 | Ga0068864_100083299 | Ga0068864_1000832992 | 147 |
| 95 | 3300005719 | Ga0068861_101398763 | Ga0068861_1013987632 | 147 |
| 96 | 3300005834 | Ga0068851_10001735 | Ga0068851_100017354 | 147 |
| 97 | 3300005834 | Ga0068851_10002075 | Ga0068851_100020754 | 147 |
| 98 | 3300005834 | Ga0068851_10180128 | Ga0068851_101801282 | 147 |
| 99 | 3300005840 | Ga0068870_10029294 | Ga0068870_100292944 | 147 |
| 100 | 3300005841 | Ga0068863_100002166 | Ga0068863_1000021664 | 147 |
| 101 | 3300005842 | Ga0068858_100001497 | Ga0068858_1000014973 | 147 |
| 102 | 3300005842 | Ga0068858_100068682 | Ga0068858_1000686822 | 147 |
| 103 | 3300005843 | Ga0068860_100000188 | Ga0068860_1000001886 | 147 |
| 104 | 3300005843 | Ga0068860_100080206 | Ga0068860_1000802062 | 147 |
| 105 | 3300005844 | Ga0068862_100053000 | Ga0068862_1000530002 | 147 |
| 106 | 3300005844 | Ga0068862_100332903 | Ga0068862_1003329034 | 147 |
| 107 | 3300006028 | Ga0070717_10065200 | Ga0070717_100652002 | 147 |
| 108 | 3300006237 | Ga0097621_100007205 | Ga0097621_1000072058 | 147 |
| 109 | 3300006358 | Ga0068871_100004472 | Ga0068871_1000044726 | 147 |
| 110 | 3300006358 | Ga0068871_100031432 | Ga0068871_1000314321 | 147 |
| 111 | 3300006881 | Ga0068865_100042964 | Ga0068865_1000429644 | 147 |
| 112 | 3300006931 | Ga0097620_100008571 | Ga0097620_1000085715 | 147 |
| 113 | 3300006931 | Ga0097620_100111255 | Ga0097620_1001112555 | 147 |
| 114 | 3300009093 | Ga0105240_10000125 | Ga0105240_1000012524 | 147 |
| 115 | 3300009093 | Ga0105240_10015304 | Ga0105240_100153047 | 147 |
| 116 | 3300009093 | Ga0105240_10090699 | Ga0105240_100906993 | 147 |
| 117 | 3300009093 | Ga0105240_10418606 | Ga0105240_104186063 | 147 |
| 118 | 3300009098 | Ga0105245_10009201 | Ga0105245_100092013 | 147 |
| 119 | 3300009098 | Ga0105245_11508452 | Ga0105245_115084521 | 147 |
| 120 | 3300009101 | Ga0105247_10006936 | Ga0105247_100069364 | 147 |
| 121 | 3300009101 | Ga0105247_10044374 | Ga0105247_100443743 | 147 |
| 122 | 3300009174 | Ga0105241_10000092 | Ga0105241_1000009256 | 147 |
| 123 | 3300009174 | Ga0105241_10003508 | Ga0105241_1000350810 | 147 |
| 124 | 3300009177 | Ga0105248_10019275 | Ga0105248_100192756 | 147 |
| 125 | 3300009177 | Ga0105248_10024463 | Ga0105248_100244638 | 147 |
| 126 | 3300009545 | Ga0105237_10000686 | Ga0105237_1000068634 | 147 |
| 127 | 3300009545 | Ga0105237_10015090 | Ga0105237_100150909 | 147 |
| 128 | 3300009545 | Ga0105237_10333781 | Ga0105237_103337812 | 147 |
| 129 | 3300009551 | Ga0105238_10000083 | Ga0105238_1000008314 | 147 |
| 130 | 3300009551 | Ga0105238_10000122 | Ga0105238_1000012274 | 147 |
| 131 | 3300009551 | Ga0105238_10185801 | Ga0105238_101858012 | 147 |
| 132 | 3300009553 | Ga0105249_10017849 | Ga0105249_100178494 | 147 |
| 133 | 3300009553 | Ga0105249_10068506 | Ga0105249_100685064 | 147 |
| 134 | 3300010159 | Ga0099796_10384050 | Ga0099796_103840501 | 147 |
| 135 | 3300010375 | Ga0105239_10010996 | Ga0105239_100109967 | 147 |
| 136 | 3300010375 | Ga0105239_10052045 | Ga0105239_100520455 | 147 |
| 137 | 3300011119 | Ga0105246_10003685 | Ga0105246_100036859 | 147 |
| 138 | 3300011119 | Ga0105246_10037058 | Ga0105246_100370582 | 147 |
| 139 | 3300013100 | Ga0157373_10060655 | Ga0157373_100606554 | 147 |
| 140 | 3300013102 | Ga0157371_10038088 | Ga0157371_100380884 | 147 |
| 141 | 3300013105 | Ga0157369_10001545 | Ga0157369_1000154528 | 147 |
| 142 | 3300013105 | Ga0157369_10031250 | Ga0157369_100312503 | 147 |
| 143 | 3300013105 | Ga0157369_10896285 | Ga0157369_108962851 | 147 |
| 144 | 3300013296 | Ga0157374_10011719 | Ga0157374_100117198 | 147 |
| 145 | 3300013296 | Ga0157374_10034477 | Ga0157374_100344775 | 147 |
| 146 | 3300013296 | Ga0157374_10035275 | Ga0157374_100352753 | 147 |
| 147 | 3300013297 | Ga0157378_10008928 | Ga0157378_1000892810 | 147 |
| 148 | 3300013306 | Ga0163162_10006846 | Ga0163162_100068466 | 147 |
| 149 | 3300013306 | Ga0163162_10060056 | Ga0163162_100600562 | 147 |
| 150 | 3300013307 | Ga0157372_10114312 | Ga0157372_101143124 | 147 |
| 151 | 3300013307 | Ga0157372_10146518 | Ga0157372_101465181 | 147 |
| 152 | 3300013308 | Ga0157375_10027050 | Ga0157375_100270506 | 147 |
| 153 | 3300014325 | Ga0163163_10000561 | Ga0163163_1000056128 | 147 |
| 154 | 3300014325 | Ga0163163_10036133 | Ga0163163_100361336 | 147 |
| 155 | 3300014968 | Ga0157379_10001207 | Ga0157379_100012076 | 147 |
| 156 | 3300014968 | Ga0157379_10254833 | Ga0157379_102548333 | 147 |
| 157 | 3300014969 | Ga0157376_10001660 | Ga0157376_100016604 | 147 |
| 158 | 3300014969 | Ga0157376_10516468 | Ga0157376_105164682 | 147 |
| 159 | 3300025321 | Ga0207656_10005061 | Ga0207656_100050616 | 147 |
| 160 | 3300025321 | Ga0207656_10162827 | Ga0207656_101628272 | 147 |
| 161 | 3300025900 | Ga0207710_10001709 | Ga0207710_1000170910 | 147 |
| 162 | 3300025903 | Ga0207680_10060671 | Ga0207680_100606714 | 147 |
| 163 | 3300025903 | Ga0207680_10088737 | Ga0207680_100887371 | 147 |
| 164 | 3300025904 | Ga0207647_10205354 | Ga0207647_102053542 | 147 |
| 165 | 3300025904 | Ga0207647_10219273 | Ga0207647_102192732 | 147 |
| 166 | 3300025907 | Ga0207645_10027230 | Ga0207645_100272305 | 147 |
| 167 | 3300025909 | Ga0207705_10103419 | Ga0207705_101034192 | 147 |
| 168 | 3300025910 | Ga0207684_10009632 | Ga0207684_1000963211 | 147 |
| 169 | 3300025910 | Ga0207684_10126635 | Ga0207684_101266352 | 147 |
| 170 | 3300025911 | Ga0207654_10000858 | Ga0207654_1000085814 | 147 |
| 171 | 3300025911 | Ga0207654_10001656 | Ga0207654_100016569 | 147 |
| 172 | 3300025911 | Ga0207654_10010963 | Ga0207654_100109636 | 147 |
| 173 | 3300025913 | Ga0207695_10000210 | Ga0207695_10000210125 | 147 |
| 174 | 3300025913 | Ga0207695_10000338 | Ga0207695_1000033814 | 147 |
| 175 | 3300025913 | Ga0207695_10050253 | Ga0207695_100502534 | 147 |
| 176 | 3300025914 | Ga0207671_10000068 | Ga0207671_1000006825 | 147 |
| 177 | 3300025914 | Ga0207671_10000145 | Ga0207671_1000014515 | 147 |
| 178 | 3300025914 | Ga0207671_10045869 | Ga0207671_100458692 | 147 |
| 179 | 3300025915 | Ga0207693_10262606 | Ga0207693_102626062 | 147 |
| 180 | 3300025916 | Ga0207663_10364544 | Ga0207663_103645441 | 147 |
| 181 | 3300025919 | Ga0207657_10000626 | Ga0207657_1000062617 | 147 |
| 182 | 3300025920 | Ga0207649_10007611 | Ga0207649_100076117 | 147 |
| 183 | 3300025920 | Ga0207649_10026936 | Ga0207649_100269364 | 147 |
| 184 | 3300025923 | Ga0207681_10012929 | Ga0207681_100129296 | 147 |
| 185 | 3300025924 | Ga0207694_10000043 | Ga0207694_1000004328 | 147 |
| 186 | 3300025924 | Ga0207694_10000085 | Ga0207694_1000008585 | 147 |
| 187 | 3300025924 | Ga0207694_10050114 | Ga0207694_100501143 | 147 |
| 188 | 3300025925 | Ga0207650_10028268 | Ga0207650_100282686 | 147 |
| 189 | 3300025927 | Ga0207687_10004706 | Ga0207687_100047066 | 147 |
| 190 | 3300025927 | Ga0207687_10006238 | Ga0207687_100062385 | 147 |
| 191 | 3300025931 | Ga0207644_10020673 | Ga0207644_100206733 | 147 |
| 192 | 3300025933 | Ga0207706_10015203 | Ga0207706_100152033 | 147 |
| 193 | 3300025934 | Ga0207686_10019537 | Ga0207686_100195371 | 147 |
| 194 | 3300025935 | Ga0207709_10231845 | Ga0207709_102318451 | 147 |
| 195 | 3300025936 | Ga0207670_10027036 | Ga0207670_100270362 | 147 |
| 196 | 3300025938 | Ga0207704_10116602 | Ga0207704_101166022 | 147 |
| 197 | 3300025941 | Ga0207711_10005920 | Ga0207711_100059204 | 147 |
| 198 | 3300025941 | Ga0207711_10019631 | Ga0207711_100196313 | 147 |
| 199 | 3300025942 | Ga0207689_10001635 | Ga0207689_100016354 | 147 |
| 200 | 3300025944 | Ga0207661_10000402 | Ga0207661_1000040224 | 147 |
| 201 | 3300025945 | Ga0207679_10037566 | Ga0207679_100375662 | 147 |
| 202 | 3300025949 | Ga0207667_10105131 | Ga0207667_101051314 | 147 |
| 203 | 3300025961 | Ga0207712_10045296 | Ga0207712_100452963 | 147 |
| 204 | 3300025961 | Ga0207712_10076361 | Ga0207712_100763613 | 147 |
| 205 | 3300025981 | Ga0207640_10012277 | Ga0207640_100122776 | 147 |
| 206 | 3300025981 | Ga0207640_10042944 | Ga0207640_100429442 | 147 |
| 207 | 3300025986 | Ga0207658_10002106 | Ga0207658_1000210613 | 147 |
| 208 | 3300025986 | Ga0207658_10025548 | Ga0207658_100255483 | 147 |
| 209 | 3300026023 | Ga0207677_10000841 | Ga0207677_100008419 | 147 |
| 210 | 3300026023 | Ga0207677_10010795 | Ga0207677_100107955 | 147 |
| 211 | 3300026035 | Ga0207703_10003037 | Ga0207703_100030375 | 147 |
| 212 | 3300026035 | Ga0207703_10760994 | Ga0207703_107609941 | 147 |
| 213 | 3300026041 | Ga0207639_10000072 | Ga0207639_1000007214 | 147 |
| 214 | 3300026067 | Ga0207678_10008082 | Ga0207678_100080822 | 147 |
| 215 | 3300026067 | Ga0207678_10529187 | Ga0207678_105291871 | 147 |
| 216 | 3300026078 | Ga0207702_10000205 | Ga0207702_1000020563 | 147 |
| 217 | 3300026078 | Ga0207702_10021287 | Ga0207702_100212873 | 147 |
| 218 | 3300026078 | Ga0207702_10177590 | Ga0207702_101775901 | 147 |
| 219 | 3300026078 | Ga0207702_10437554 | Ga0207702_104375543 | 147 |
| 220 | 3300026088 | Ga0207641_10006446 | Ga0207641_100064464 | 147 |
| 221 | 3300026088 | Ga0207641_10453364 | Ga0207641_104533642 | 147 |
| 222 | 3300026095 | Ga0207676_10005980 | Ga0207676_100059805 | 147 |
| 223 | 3300026095 | Ga0207676_10122425 | Ga0207676_101224253 | 147 |
| 224 | 3300026116 | Ga0207674_10000239 | Ga0207674_1000023921 | 147 |
| 225 | 3300026116 | Ga0207674_10026228 | Ga0207674_100262284 | 147 |
| 226 | 3300026116 | Ga0207674_10119579 | Ga0207674_101195792 | 147 |
| 227 | 3300026118 | Ga0207675_100106606 | Ga0207675_1001066064 | 147 |
| 228 | 3300026121 | Ga0207683_10188949 | Ga0207683_101889492 | 147 |
| 229 | 3300026142 | Ga0207698_10000040 | Ga0207698_1000004090 | 147 |
| 230 | 3300026142 | Ga0207698_10293941 | Ga0207698_102939414 | 147 |
| 231 | 3300028379 | Ga0268266_10066550 | Ga0268266_100665503 | 147 |
| 232 | 3300028380 | Ga0268265_10033781 | Ga0268265_100337812 | 147 |
| 233 | 3300028381 | Ga0268264_10004509 | Ga0268264_1000450910 | 147 |
| 234 | 3300028381 | Ga0268264_10131628 | Ga0268264_101316283 | 147 |
| 235 | 3300034818 | Ga0373950_0026472 | Ga0373950_0026472_141_629 | 147 |
| 236 | 3300035084 | Ga0373928_0146853 | Ga0373928_0146853_13_501 | 147 |
| 237 | 3300035088 | Ga0373940_0034564 | Ga0373940_0034564_244_732 | 147 |
| 238 | 3300035092 | Ga0373952_0046901 | Ga0373952_0046901_324_812 | 147 |
| 239 | 3300035111 | Ga0373923_0170232 | Ga0373923_0170232_23_484 | 147 |
| 240 | 3300035115 | Ga0373941_0140399 | Ga0373941_0140399_254_742 | 147 |
| 241 | 3300035691 | Ga0373931_0080475 | Ga0373931_0080475_1029_1517 | 147 |
| 242 | 3300035695 | Ga0373927_0040349 | Ga0373927_0040349_780_1241 | 147 |
| 243 | 3300046472 | Ga0495580_0000831 | Ga0495580_0000831_22636_23097 | 147 |
| 244 | 3300046473 | Ga0495582_0579905 | Ga0495582_0579905_167_628 | 147 |
| 245 | 3300046531 | Ga0495665_0047528 | Ga0495665_0047528_998_1459 | 147 |
| 246 | 3300046536 | Ga0495587_0369925 | Ga0495587_0369925_326_775 | 147 |
| 247 | 3300047471 | Ga0495684_0468512 | Ga0495684_0468512_35_496 | 147 |
| 248 | 3300048904 | Ga0496101_0543670 | Ga0496101_0543670_55_543 | 147 |
| 249 | 3300048905 | Ga0496102_0219202 | Ga0496102_0219202_270_758 | 147 |
| 250 | 3300048905 | Ga0496102_0520438 | Ga0496102_0520438_498_944 | 147 |
| 251 | 3300048906 | Ga0496103_0328011 | Ga0496103_0328011_25_513 | 147 |
| 252 | 3300048907 | Ga0496104_0100570 | Ga0496104_0100570_1026_1484 | 147 |
| 253 | 3300048915 | Ga0496112_0066669 | Ga0496112_0066669_823_1311 | 147 |
| 254 | 3300048916 | Ga0496113_0089709 | Ga0496113_0089709_1717_2205 | 147 |
| 255 | 3300049460 | Ga0495682_0066902 | Ga0495682_0066902_816_1265 | 147 |
| 256 | 3300059609 | Ga0587131_007016 | Ga0587131_007016_175_624 | 147 |
| 257 | 3300005329 | Ga0070683_100466601 | Ga0070683_1004666012 | 148 |
| 258 | 3300005445 | Ga0070708_100004714 | Ga0070708_1000047143 | 148 |
| 259 | 3300005467 | Ga0070706_100003331 | Ga0070706_1000033313 | 148 |
| 260 | 3300005468 | Ga0070707_100001198 | Ga0070707_10000119810 | 148 |
| 261 | 3300005468 | Ga0070707_100097105 | Ga0070707_1000971051 | 148 |
| 262 | 3300005518 | Ga0070699_100002192 | Ga0070699_1000021923 | 148 |
| 263 | 3300005535 | Ga0070684_100009031 | Ga0070684_1000090316 | 148 |
| 264 | 3300005536 | Ga0070697_100000788 | Ga0070697_10000078818 | 148 |
| 265 | 3300005563 | Ga0068855_100263463 | Ga0068855_1002634632 | 148 |
| 266 | 3300006028 | Ga0070717_10055315 | Ga0070717_100553153 | 148 |
| 267 | 3300013105 | Ga0157369_10138797 | Ga0157369_101387972 | 148 |
| 268 | 3300013307 | Ga0157372_10373396 | Ga0157372_103733962 | 148 |
| 269 | 3300020069 | Ga0197907_11139742 | Ga0197907_111397421 | 148 |
| 270 | 3300020070 | Ga0206356_11441786 | Ga0206356_114417862 | 148 |
| 271 | 3300020075 | Ga0206349_1377318 | Ga0206349_13773181 | 148 |
| 272 | 3300020078 | Ga0206352_10685474 | Ga0206352_106854741 | 148 |
| 273 | 3300020081 | Ga0206354_11661069 | Ga0206354_116610691 | 148 |
| 274 | 3300022467 | Ga0224712_10009934 | Ga0224712_100099341 | 148 |
| 275 | 3300025910 | Ga0207684_10000921 | Ga0207684_1000092120 | 148 |
| 276 | 3300025922 | Ga0207646_10001731 | Ga0207646_1000173119 | 148 |
| 277 | 3300025922 | Ga0207646_10054314 | Ga0207646_100543145 | 148 |
| 278 | 3300025944 | Ga0207661_10054639 | Ga0207661_100546394 | 148 |
| 279 | 3300025949 | Ga0207667_10593589 | Ga0207667_105935892 | 148 |
| 280 | 3300026142 | Ga0207698_10693122 | Ga0207698_106931221 | 148 |
| 281 | 3300005329 | Ga0070683_100116685 | Ga0070683_1001166852 | 149 |
| 282 | 3300005336 | Ga0070680_100029534 | Ga0070680_1000295345 | 149 |
| 283 | 3300005338 | Ga0068868_100015053 | Ga0068868_1000150532 | 149 |
| 284 | 3300005343 | Ga0070687_100107280 | Ga0070687_1001072802 | 149 |
| 285 | 3300005436 | Ga0070713_100117567 | Ga0070713_1001175671 | 149 |
| 286 | 3300005439 | Ga0070711_100113607 | Ga0070711_1001136074 | 149 |
| 287 | 3300005441 | Ga0070700_100431182 | Ga0070700_1004311822 | 149 |
| 288 | 3300005457 | Ga0070662_100496795 | Ga0070662_1004967952 | 149 |
| 289 | 3300005458 | Ga0070681_10029426 | Ga0070681_100294262 | 149 |
| 290 | 3300005530 | Ga0070679_100163782 | Ga0070679_1001637825 | 149 |
| 291 | 3300005546 | Ga0070696_100018327 | Ga0070696_1000183273 | 149 |
| 292 | 3300005563 | Ga0068855_100720602 | Ga0068855_1007206022 | 149 |
| 293 | 3300005617 | Ga0068859_100003073 | Ga0068859_10000307310 | 149 |
| 294 | 3300005719 | Ga0068861_100034276 | Ga0068861_1000342765 | 149 |
| 295 | 3300006931 | Ga0097620_100003073 | Ga0097620_10000307310 | 149 |
| 296 | 3300009093 | Ga0105240_10001204 | Ga0105240_1000120421 | 149 |
| 297 | 3300009093 | Ga0105240_10150805 | Ga0105240_101508054 | 149 |
| 298 | 3300009174 | Ga0105241_10000043 | Ga0105241_1000004343 | 149 |
| 299 | 3300009174 | Ga0105241_10847957 | Ga0105241_108479571 | 149 |
| 300 | 3300009174 | Ga0105241_10960837 | Ga0105241_109608372 | 149 |
| 301 | 3300009174 | Ga0105241_10989076 | Ga0105241_109890761 | 149 |
| 302 | 3300009176 | Ga0105242_10383727 | Ga0105242_103837272 | 149 |
| 303 | 3300009545 | Ga0105237_10016050 | Ga0105237_100160506 | 149 |
| 304 | 3300013100 | Ga0157373_10225185 | Ga0157373_102251852 | 149 |
| 305 | 3300013105 | Ga0157369_10003066 | Ga0157369_1000306617 | 149 |
| 306 | 3300013296 | Ga0157374_10033040 | Ga0157374_100330405 | 149 |
| 307 | 3300013306 | Ga0163162_10113732 | Ga0163162_101137324 | 149 |
| 308 | 3300013307 | Ga0157372_11006271 | Ga0157372_110062711 | 149 |
| 309 | 3300013308 | Ga0157375_11350087 | Ga0157375_113500872 | 149 |
| 310 | 3300014968 | Ga0157379_10112678 | Ga0157379_101126782 | 149 |
| 311 | 3300014968 | Ga0157379_10275784 | Ga0157379_102757842 | 149 |
| 312 | 3300019190 | Ga0184600_131136 | Ga0184600_1311364 | 149 |
| 313 | 3300019192 | Ga0184603_152930 | Ga0184603_1529301 | 149 |
| 314 | 3300020069 | Ga0197907_10226117 | Ga0197907_102261173 | 149 |
| 315 | 3300020077 | Ga0206351_10177850 | Ga0206351_101778502 | 149 |
| 316 | 3300020081 | Ga0206354_10122061 | Ga0206354_101220613 | 149 |
| 317 | 3300020610 | Ga0154015_1019090 | Ga0154015_10190902 | 149 |
| 318 | 3300022467 | Ga0224712_10107193 | Ga0224712_101071931 | 149 |
| 319 | 3300023672 | Ga0247553_102601 | Ga0247553_1026012 | 149 |
| 320 | 3300025904 | Ga0207647_10003391 | Ga0207647_100033917 | 149 |
| 321 | 3300025911 | Ga0207654_10000019 | Ga0207654_1000001962 | 149 |
| 322 | 3300025912 | Ga0207707_10320182 | Ga0207707_103201822 | 149 |
| 323 | 3300025913 | Ga0207695_10070920 | Ga0207695_100709204 | 149 |
| 324 | 3300025913 | Ga0207695_10358830 | Ga0207695_103588301 | 149 |
| 325 | 3300025917 | Ga0207660_10129081 | Ga0207660_101290812 | 149 |
| 326 | 3300025918 | Ga0207662_10708799 | Ga0207662_107087992 | 149 |
| 327 | 3300025921 | Ga0207652_10150233 | Ga0207652_101502334 | 149 |
| 328 | 3300025928 | Ga0207700_10083686 | Ga0207700_100836861 | 149 |
| 329 | 3300025942 | Ga0207689_10000875 | Ga0207689_100008759 | 149 |
| 330 | 3300025949 | Ga0207667_10755070 | Ga0207667_107550702 | 149 |
| 331 | 3300026035 | Ga0207703_10006325 | Ga0207703_100063259 | 149 |
| 332 | 3300026078 | Ga0207702_10307358 | Ga0207702_103073581 | 149 |
| 333 | 3300026142 | Ga0207698_10924680 | Ga0207698_109246802 | 149 |
| 334 | 3300032120 | Ga0316053_100579 | Ga0316053_1005791 | 149 |
| 335 | 3300032120 | Ga0316053_110970 | Ga0316053_1109702 | 149 |
| 336 | 3300042005 | Ga0439448_0036989 | Ga0439448_0036989_526_981 | 149 |
| 337 | 3300042876 | Ga0451577_0000885 | Ga0451577_0000885_21396_21869 | 149 |
| 338 | 3300044673 | Ga0453683_0028183 | Ga0453683_0028183_2495_2968 | 149 |
| 339 | 3300044712 | Ga0453684_0007009 | Ga0453684_0007009_9334_9807 | 149 |
| 340 | 3300045051 | Ga0451576_0490606 | Ga0451576_0490606_64_537 | 149 |
| 341 | 3300046472 | Ga0495580_0386901 | Ga0495580_0386901_152_613 | 149 |
| 342 | 3300046691 | Ga0495670_0151067 | Ga0495670_0151067_347_802 | 149 |
| 343 | 3300048905 | Ga0496102_1164390 | Ga0496102_1164390_71_526 | 149 |
| 344 | 3300048913 | Ga0496110_0180279 | Ga0496110_0180279_1312_1767 | 149 |
| 345 | 3300048914 | Ga0496111_0447546 | Ga0496111_0447546_483_938 | 149 |
| 346 | 3300048915 | Ga0496112_0013887 | Ga0496112_0013887_5867_6322 | 149 |
| 347 | 3300048916 | Ga0496113_0484113 | Ga0496113_0484113_364_819 | 149 |
| 348 | 3300048917 | Ga0496114_1259891 | Ga0496114_1259891_116_571 | 149 |
| 349 | 3300059492 | Ga0587073_0072429 | Ga0587073_0072429_186_641 | 149 |
| 350 | 3300059630 | Ga0587128_079909 | Ga0587128_079909_174_629 | 149 |
| 351 | 3300059630 | Ga0587128_156164 | Ga0587128_156164_26_481 | 149 |
| 352 | 3300005434 | Ga0070709_10707984 | Ga0070709_107079842 | 150 |
| 353 | 3300005436 | Ga0070713_101975275 | Ga0070713_1019752751 | 150 |
| 354 | 3300005439 | Ga0070711_100218828 | Ga0070711_1002188282 | 150 |
| 355 | 3300005445 | Ga0070708_100062325 | Ga0070708_1000623251 | 150 |
| 356 | 3300005468 | Ga0070707_100557603 | Ga0070707_1005576032 | 150 |
| 357 | 3300005518 | Ga0070699_100209499 | Ga0070699_1002094992 | 150 |
| 358 | 3300005536 | Ga0070697_100745019 | Ga0070697_1007450191 | 150 |
| 359 | 3300006173 | Ga0070716_100080931 | Ga0070716_1000809311 | 150 |
| 360 | 3300006175 | Ga0070712_100085022 | Ga0070712_1000850221 | 150 |
| 361 | 3300006914 | Ga0075436_100321304 | Ga0075436_1003213042 | 150 |
| 362 | 3300007076 | Ga0075435_100488547 | Ga0075435_1004885472 | 150 |
| 363 | 3300010159 | Ga0099796_10236698 | Ga0099796_102366982 | 150 |
| 364 | 3300014325 | Ga0163163_10507836 | Ga0163163_105078362 | 150 |
| 365 | 3300025906 | Ga0207699_10251978 | Ga0207699_102519782 | 150 |
| 366 | 3300025922 | Ga0207646_10573364 | Ga0207646_105733642 | 150 |
| 367 | 3300028800 | Ga0265338_10158716 | Ga0265338_101587162 | 150 |
| 368 | 3300031249 | Ga0265339_10136882 | Ga0265339_101368821 | 150 |
| 369 | 3300046457 | Ga0495590_0092051 | Ga0495590_0092051_90_542 | 150 |
| 370 | 3300046499 | Ga0495594_0285301 | Ga0495594_0285301_308_781 | 150 |
| 371 | 3300048908 | Ga0496105_0395219 | Ga0496105_0395219_479_934 | 150 |
| 372 | 3300048918 | Ga0496115_0401926 | Ga0496115_0401926_477_932 | 150 |
| 373 | 3300050513 | nmdc:mga0rr50_244551_c1 | nmdc:mga0rr50_244551_c1_727_1182 | 150 |
| 374 | 3300005334 | Ga0068869_101907783 | Ga0068869_1019077831 | 151 |
| 375 | 3300005336 | Ga0070680_100164168 | Ga0070680_1001641682 | 151 |
| 376 | 3300005338 | Ga0068868_100727948 | Ga0068868_1007279481 | 151 |
| 377 | 3300005435 | Ga0070714_100046420 | Ga0070714_1000464203 | 151 |
| 378 | 3300005435 | Ga0070714_100176057 | Ga0070714_1001760573 | 151 |
| 379 | 3300005436 | Ga0070713_100795000 | Ga0070713_1007950002 | 151 |
| 380 | 3300005437 | Ga0070710_10038230 | Ga0070710_100382302 | 151 |
| 381 | 3300005445 | Ga0070708_100194568 | Ga0070708_1001945684 | 151 |
| 382 | 3300005445 | Ga0070708_100216366 | Ga0070708_1002163663 | 151 |
| 383 | 3300005445 | Ga0070708_101517715 | Ga0070708_1015177151 | 151 |
| 384 | 3300005458 | Ga0070681_10009378 | Ga0070681_100093789 | 151 |
| 385 | 3300005458 | Ga0070681_10154389 | Ga0070681_101543893 | 151 |
| 386 | 3300005467 | Ga0070706_100022304 | Ga0070706_1000223047 | 151 |
| 387 | 3300005467 | Ga0070706_100276189 | Ga0070706_1002761892 | 151 |
| 388 | 3300005468 | Ga0070707_100017806 | Ga0070707_1000178062 | 151 |
| 389 | 3300005468 | Ga0070707_100420646 | Ga0070707_1004206462 | 151 |
| 390 | 3300005468 | Ga0070707_100505114 | Ga0070707_1005051141 | 151 |
| 391 | 3300005468 | Ga0070707_101074296 | Ga0070707_1010742961 | 151 |
| 392 | 3300005518 | Ga0070699_100018990 | Ga0070699_1000189902 | 151 |
| 393 | 3300005518 | Ga0070699_100066639 | Ga0070699_1000666394 | 151 |
| 394 | 3300005518 | Ga0070699_101344499 | Ga0070699_1013444991 | 151 |
| 395 | 3300005536 | Ga0070697_100253439 | Ga0070697_1002534392 | 151 |
| 396 | 3300005545 | Ga0070695_100125117 | Ga0070695_1001251172 | 151 |
| 397 | 3300005841 | Ga0068863_101265543 | Ga0068863_1012655431 | 151 |
| 398 | 3300006028 | Ga0070717_10015404 | Ga0070717_100154043 | 151 |
| 399 | 3300006028 | Ga0070717_10585773 | Ga0070717_105857732 | 151 |
| 400 | 3300006163 | Ga0070715_10039516 | Ga0070715_100395165 | 151 |
| 401 | 3300006173 | Ga0070716_100177412 | Ga0070716_1001774122 | 151 |
| 402 | 3300006173 | Ga0070716_100265942 | Ga0070716_1002659422 | 151 |
| 403 | 3300006173 | Ga0070716_101147424 | Ga0070716_1011474241 | 151 |
| 404 | 3300006175 | Ga0070712_100007747 | Ga0070712_1000077476 | 151 |
| 405 | 3300006914 | Ga0075436_100035905 | Ga0075436_1000359052 | 151 |
| 406 | 3300009177 | Ga0105248_10537835 | Ga0105248_105378352 | 151 |
| 407 | 3300009551 | Ga0105238_10878342 | Ga0105238_108783422 | 151 |
| 408 | 3300012502 | Ga0157347_1047219 | Ga0157347_10472192 | 151 |
| 409 | 3300013296 | Ga0157374_10492431 | Ga0157374_104924312 | 151 |
| 410 | 3300013297 | Ga0157378_10568063 | Ga0157378_105680631 | 151 |
| 411 | 3300014969 | Ga0157376_10353171 | Ga0157376_103531712 | 151 |
| 412 | 3300025898 | Ga0207692_10251918 | Ga0207692_102519182 | 151 |
| 413 | 3300025905 | Ga0207685_10030785 | Ga0207685_100307852 | 151 |
| 414 | 3300025906 | Ga0207699_10217291 | Ga0207699_102172912 | 151 |
| 415 | 3300025906 | Ga0207699_10512924 | Ga0207699_105129241 | 151 |
| 416 | 3300025910 | Ga0207684_10116062 | Ga0207684_101160622 | 151 |
| 417 | 3300025910 | Ga0207684_10773107 | Ga0207684_107731071 | 151 |
| 418 | 3300025912 | Ga0207707_10115018 | Ga0207707_101150182 | 151 |
| 419 | 3300025915 | Ga0207693_10001531 | Ga0207693_1000153117 | 151 |
| 420 | 3300025917 | Ga0207660_10222738 | Ga0207660_102227382 | 151 |
| 421 | 3300025922 | Ga0207646_10091800 | Ga0207646_100918002 | 151 |
| 422 | 3300025922 | Ga0207646_11786158 | Ga0207646_117861581 | 151 |
| 423 | 3300025928 | Ga0207700_10122573 | Ga0207700_101225732 | 151 |
| 424 | 3300025928 | Ga0207700_10846102 | Ga0207700_108461021 | 151 |
| 425 | 3300025929 | Ga0207664_10030871 | Ga0207664_100308713 | 151 |
| 426 | 3300025929 | Ga0207664_10239080 | Ga0207664_102390802 | 151 |
| 427 | 3300025939 | Ga0207665_10102811 | Ga0207665_101028113 | 151 |
| 428 | 3300025939 | Ga0207665_10602848 | Ga0207665_106028481 | 151 |
| 429 | 3300026088 | Ga0207641_10809933 | Ga0207641_108099332 | 151 |
| 430 | 3300028666 | Ga0265336_10086843 | Ga0265336_100868432 | 151 |
| 431 | 3300028800 | Ga0265338_10036712 | Ga0265338_100367124 | 151 |
| 432 | 3300028800 | Ga0265338_10064140 | Ga0265338_100641403 | 151 |
| 433 | 3300028800 | Ga0265338_10435094 | Ga0265338_104350942 | 151 |
| 434 | 3300030760 | Ga0265762_1115415 | Ga0265762_11154151 | 151 |
| 435 | 3300030762 | Ga0265775_103204 | Ga0265775_1032042 | 151 |
| 436 | 3300030879 | Ga0265765_1029077 | Ga0265765_10290771 | 151 |
| 437 | 3300031090 | Ga0265760_10006194 | Ga0265760_100061944 | 151 |
| 438 | 3300031247 | Ga0265340_10088073 | Ga0265340_100880731 | 151 |
| 439 | 3300031249 | Ga0265339_10230716 | Ga0265339_102307161 | 151 |
| 440 | 3300031249 | Ga0265339_10346169 | Ga0265339_103461691 | 151 |
| 441 | 3300031344 | Ga0265316_10010452 | Ga0265316_100104521 | 151 |
| 442 | 3300031344 | Ga0265316_10041556 | Ga0265316_100415563 | 151 |
| 443 | 3300031711 | Ga0265314_10017548 | Ga0265314_100175481 | 151 |
| 444 | 3300033547 | Ga0316212_1020040 | Ga0316212_10200402 | 151 |
| 445 | 3300035113 | Ga0373936_0036192 | Ga0373936_0036192_616_1101 | 151 |
| 446 | 3300035118 | Ga0373954_0183246 | Ga0373954_0183246_447_926 | 151 |
| 447 | 3300035119 | Ga0373956_0115153 | Ga0373956_0115153_342_800 | 151 |
| 448 | 3300035120 | Ga0373957_0139218 | Ga0373957_0139218_19_477 | 151 |
| 449 | 3300035170 | Ga0373943_0008381 | Ga0373943_0008381_110_568 | 151 |
| 450 | 3300035171 | Ga0373946_0218275 | Ga0373946_0218275_162_647 | 151 |
| 451 | 3300035172 | Ga0373955_0061711 | Ga0373955_0061711_323_781 | 151 |
| 452 | 3300035410 | Ga0373924_0223758 | Ga0373924_0223758_228_713 | 151 |
| 453 | 3300035692 | Ga0373935_0004159 | Ga0373935_0004159_6667_7152 | 151 |
| 454 | 3300035695 | Ga0373927_0208838 | Ga0373927_0208838_794_1270 | 151 |
| 455 | 3300035724 | Ga0373933_0037915 | Ga0373933_0037915_1259_1717 | 151 |
| 456 | 3300035725 | Ga0373947_0065887 | Ga0373947_0065887_835_1293 | 151 |
| 457 | 3300035725 | Ga0373947_0319790 | Ga0373947_0319790_485_970 | 151 |
| 458 | 3300035725 | Ga0373947_1080707 | Ga0373947_1080707_32_511 | 151 |
| 459 | 3300036401 | Ga0373937_0367435 | Ga0373937_0367435_228_707 | 151 |
| 460 | 3300036401 | Ga0373937_0404424 | Ga0373937_0404424_606_1064 | 151 |
| 461 | 3300036401 | Ga0373937_1216376 | Ga0373937_1216376_168_689 | 151 |
| 462 | 3300037068 | Ga0373925_0018201 | Ga0373925_0018201_4494_4979 | 151 |
| 463 | 3300037068 | Ga0373925_0104477 | Ga0373925_0104477_905_1363 | 151 |
| 464 | 3300037068 | Ga0373925_0873336 | Ga0373925_0873336_167_649 | 151 |
| 465 | 3300039438 | Ga0436360_0305246 | Ga0436360_0305246_173_631 | 151 |
| 466 | 3300045051 | Ga0451576_0047334 | Ga0451576_0047334_562_1041 | 151 |
| 467 | 3300046459 | Ga0495629_0013831 | Ga0495629_0013831_80_538 | 151 |
| 468 | 3300046472 | Ga0495580_0000007 | Ga0495580_0000007_11778_12236 | 151 |
| 469 | 3300046472 | Ga0495580_0040984 | Ga0495580_0040984_2309_2785 | 151 |
| 470 | 3300046472 | Ga0495580_0134143 | Ga0495580_0134143_1119_1577 | 151 |
| 471 | 3300046472 | Ga0495580_0172639 | Ga0495580_0172639_421_897 | 151 |
| 472 | 3300046473 | Ga0495582_0014527 | Ga0495582_0014527_2480_2938 | 151 |
| 473 | 3300046475 | Ga0495639_0290405 | Ga0495639_0290405_133_591 | 151 |
| 474 | 3300046475 | Ga0495639_0333402 | Ga0495639_0333402_164_643 | 151 |
| 475 | 3300046477 | Ga0495664_0278693 | Ga0495664_0278693_364_849 | 151 |
| 476 | 3300046499 | Ga0495594_0417039 | Ga0495594_0417039_126_584 | 151 |
| 477 | 3300046517 | Ga0495630_0275939 | Ga0495630_0275939_762_1259 | 151 |
| 478 | 3300046531 | Ga0495665_0163994 | Ga0495665_0163994_485_943 | 151 |
| 479 | 3300046531 | Ga0495665_0319563 | Ga0495665_0319563_83_562 | 151 |
| 480 | 3300046675 | Ga0495657_0257271 | Ga0495657_0257271_210_677 | 151 |
| 481 | 3300046675 | Ga0495657_0528497 | Ga0495657_0528497_183_668 | 151 |
| 482 | 3300046683 | Ga0495658_0016509 | Ga0495658_0016509_1616_2074 | 151 |
| 483 | 3300046690 | Ga0495624_0098992 | Ga0495624_0098992_421_906 | 151 |
| 484 | 3300047319 | Ga0495674_0014419 | Ga0495674_0014419_1412_1897 | 151 |
| 485 | 3300047319 | Ga0495674_1469901 | Ga0495674_1469901_15_473 | 151 |
| 486 | 3300047321 | Ga0495676_0157979 | Ga0495676_0157979_790_1248 | 151 |
| 487 | 3300047471 | Ga0495684_0254208 | Ga0495684_0254208_662_1138 | 151 |
| 488 | 3300047471 | Ga0495684_0409406 | Ga0495684_0409406_175_672 | 151 |
| 489 | 3300048904 | Ga0496101_1115419 | Ga0496101_1115419_28_495 | 151 |
| 490 | 3300048904 | Ga0496101_1136884 | Ga0496101_1136884_103_561 | 151 |
| 491 | 3300048905 | Ga0496102_0875147 | Ga0496102_0875147_160_618 | 151 |
| 492 | 3300048909 | Ga0496106_1313026 | Ga0496106_1313026_66_533 | 151 |
| 493 | 3300048915 | Ga0496112_0153503 | Ga0496112_0153503_209_676 | 151 |
| 494 | 3300048915 | Ga0496112_0237257 | Ga0496112_0237257_467_925 | 151 |
| 495 | 3300048916 | Ga0496113_0501657 | Ga0496113_0501657_114_581 | 151 |
| 496 | 3300048918 | Ga0496115_0991718 | Ga0496115_0991718_158_616 | 151 |
| 497 | 3300050514 | nmdc:mga08x19_410_c1 | nmdc:mga08x19_410_c1_14327_14803 | 151 |
| 498 | 3300059478 | Ga0587093_055070 | Ga0587093_055070_136_594 | 151 |
| 499 | 3300059492 | Ga0587073_0164074 | Ga0587073_0164074_139_597 | 151 |
| 500 | 3300059504 | Ga0587082_102117 | Ga0587082_102117_35_493 | 151 |
| 501 | 3300059505 | Ga0587083_0108716 | Ga0587083_0108716_35_493 | 151 |
| 502 | 3300059508 | Ga0587088_102604 | Ga0587088_102604_45_503 | 151 |
| 503 | 3300059647 | Ga0587079_127560 | Ga0587079_127560_45_503 | 151 |
| 504 | 3300059655 | Ga0587114_066070 | Ga0587114_066070_43_501 | 151 |
| 505 | 2162886011 | MRS1b_contig_9210921 | MRS1b_0584.00002870 | 152 |
| 506 | 2162886012 | MBSR1b_contig_694782 | MBSR1b_0859.00000310 | 152 |
| 507 | 3300001978 | JGI24747J21853_1014241 | JGI24747J21853_10142412 | 152 |
| 508 | 3300001990 | JGI24737J22298_10012413 | JGI24737J22298_100124132 | 152 |
| 509 | 3300001991 | JGI24743J22301_10010652 | JGI24743J22301_100106524 | 152 |
| 510 | 3300002074 | JGI24748J21848_1022567 | JGI24748J21848_10225671 | 152 |
| 511 | 3300002075 | JGI24738J21930_10114464 | JGI24738J21930_101144641 | 152 |
| 512 | 3300002239 | JGI24034J26672_10001329 | JGI24034J26672_100013292 | 152 |
| 513 | 3300002459 | JGI24751J29686_10004437 | JGI24751J29686_100044371 | 152 |
| 514 | 3300004798 | Ga0058859_10968610 | Ga0058859_109686101 | 152 |
| 515 | 3300004801 | Ga0058860_12078993 | Ga0058860_120789931 | 152 |
| 516 | 3300005293 | Ga0065715_10092929 | Ga0065715_100929293 | 152 |
| 517 | 3300005295 | Ga0065707_10415556 | Ga0065707_104155561 | 152 |
| 518 | 3300005327 | Ga0070658_10071817 | Ga0070658_100718174 | 152 |
| 519 | 3300005328 | Ga0070676_10001847 | Ga0070676_1000184710 | 152 |
| 520 | 3300005329 | Ga0070683_100024245 | Ga0070683_1000242453 | 152 |
| 521 | 3300005330 | Ga0070690_100038269 | Ga0070690_1000382691 | 152 |
| 522 | 3300005331 | Ga0070670_100049803 | Ga0070670_1000498031 | 152 |
| 523 | 3300005331 | Ga0070670_100120291 | Ga0070670_1001202913 | 152 |
| 524 | 3300005333 | Ga0070677_10008557 | Ga0070677_100085575 | 152 |
| 525 | 3300005334 | Ga0068869_100010000 | Ga0068869_1000100004 | 152 |
| 526 | 3300005334 | Ga0068869_100101958 | Ga0068869_1001019585 | 152 |
| 527 | 3300005337 | Ga0070682_100005289 | Ga0070682_1000052895 | 152 |
| 528 | 3300005338 | Ga0068868_100014727 | Ga0068868_1000147276 | 152 |
| 529 | 3300005338 | Ga0068868_100023318 | Ga0068868_1000233185 | 152 |
| 530 | 3300005339 | Ga0070660_100175999 | Ga0070660_1001759992 | 152 |
| 531 | 3300005340 | Ga0070689_100001280 | Ga0070689_1000012801 | 152 |
| 532 | 3300005343 | Ga0070687_100010778 | Ga0070687_1000107785 | 152 |
| 533 | 3300005347 | Ga0070668_100005427 | Ga0070668_1000054276 | 152 |
| 534 | 3300005353 | Ga0070669_100021333 | Ga0070669_1000213334 | 152 |
| 535 | 3300005354 | Ga0070675_100024552 | Ga0070675_1000245525 | 152 |
| 536 | 3300005356 | Ga0070674_100046828 | Ga0070674_1000468281 | 152 |
| 537 | 3300005365 | Ga0070688_100006261 | Ga0070688_1000062616 | 152 |
| 538 | 3300005366 | Ga0070659_100031541 | Ga0070659_1000315415 | 152 |
| 539 | 3300005434 | Ga0070709_10450371 | Ga0070709_104503711 | 152 |
| 540 | 3300005435 | Ga0070714_100069238 | Ga0070714_1000692382 | 152 |
| 541 | 3300005436 | Ga0070713_100052988 | Ga0070713_1000529884 | 152 |
| 542 | 3300005436 | Ga0070713_100239766 | Ga0070713_1002397661 | 152 |
| 543 | 3300005436 | Ga0070713_100332520 | Ga0070713_1003325202 | 152 |
| 544 | 3300005437 | Ga0070710_10143056 | Ga0070710_101430562 | 152 |
| 545 | 3300005439 | Ga0070711_100001492 | Ga0070711_1000014929 | 152 |
| 546 | 3300005440 | Ga0070705_100489575 | Ga0070705_1004895752 | 152 |
| 547 | 3300005440 | Ga0070705_100992322 | Ga0070705_1009923221 | 152 |
| 548 | 3300005441 | Ga0070700_100036844 | Ga0070700_1000368443 | 152 |
| 549 | 3300005445 | Ga0070708_100000677 | Ga0070708_10000067712 | 152 |
| 550 | 3300005445 | Ga0070708_100015510 | Ga0070708_1000155105 | 152 |
| 551 | 3300005445 | Ga0070708_100336434 | Ga0070708_1003364342 | 152 |
| 552 | 3300005445 | Ga0070708_100347487 | Ga0070708_1003474872 | 152 |
| 553 | 3300005455 | Ga0070663_100016752 | Ga0070663_1000167523 | 152 |
| 554 | 3300005455 | Ga0070663_100124491 | Ga0070663_1001244911 | 152 |
| 555 | 3300005457 | Ga0070662_100025048 | Ga0070662_1000250485 | 152 |
| 556 | 3300005459 | Ga0068867_100006756 | Ga0068867_1000067566 | 152 |
| 557 | 3300005466 | Ga0070685_10006837 | Ga0070685_100068376 | 152 |
| 558 | 3300005467 | Ga0070706_100000734 | Ga0070706_10000073415 | 152 |
| 559 | 3300005467 | Ga0070706_100020469 | Ga0070706_1000204699 | 152 |
| 560 | 3300005467 | Ga0070706_100513905 | Ga0070706_1005139052 | 152 |
| 561 | 3300005468 | Ga0070707_100000413 | Ga0070707_10000041329 | 152 |
| 562 | 3300005468 | Ga0070707_100636979 | Ga0070707_1006369792 | 152 |
| 563 | 3300005471 | Ga0070698_100000248 | Ga0070698_10000024835 | 152 |
| 564 | 3300005518 | Ga0070699_100007279 | Ga0070699_1000072797 | 152 |
| 565 | 3300005518 | Ga0070699_100052286 | Ga0070699_1000522862 | 152 |
| 566 | 3300005530 | Ga0070679_100261993 | Ga0070679_1002619932 | 152 |
| 567 | 3300005535 | Ga0070684_100008624 | Ga0070684_1000086245 | 152 |
| 568 | 3300005536 | Ga0070697_100002694 | Ga0070697_1000026942 | 152 |
| 569 | 3300005536 | Ga0070697_100009349 | Ga0070697_1000093495 | 152 |
| 570 | 3300005536 | Ga0070697_100010875 | Ga0070697_1000108753 | 152 |
| 571 | 3300005536 | Ga0070697_100162364 | Ga0070697_1001623643 | 152 |
| 572 | 3300005536 | Ga0070697_100452400 | Ga0070697_1004524001 | 152 |
| 573 | 3300005536 | Ga0070697_100659715 | Ga0070697_1006597151 | 152 |
| 574 | 3300005536 | Ga0070697_101043174 | Ga0070697_1010431741 | 152 |
| 575 | 3300005539 | Ga0068853_100041831 | Ga0068853_1000418315 | 152 |
| 576 | 3300005544 | Ga0070686_100003572 | Ga0070686_1000035723 | 152 |
| 577 | 3300005545 | Ga0070695_100026303 | Ga0070695_1000263033 | 152 |
| 578 | 3300005547 | Ga0070693_100105636 | Ga0070693_1001056361 | 152 |
| 579 | 3300005549 | Ga0070704_101055272 | Ga0070704_1010552721 | 152 |
| 580 | 3300005563 | Ga0068855_100065756 | Ga0068855_1000657564 | 152 |
| 581 | 3300005577 | Ga0068857_100021825 | Ga0068857_1000218256 | 152 |
| 582 | 3300005578 | Ga0068854_100008827 | Ga0068854_1000088276 | 152 |
| 583 | 3300005578 | Ga0068854_100010438 | Ga0068854_1000104385 | 152 |
| 584 | 3300005615 | Ga0070702_100006489 | Ga0070702_1000064892 | 152 |
| 585 | 3300005616 | Ga0068852_100185987 | Ga0068852_1001859875 | 152 |
| 586 | 3300005618 | Ga0068864_100080131 | Ga0068864_1000801314 | 152 |
| 587 | 3300005618 | Ga0068864_100105923 | Ga0068864_1001059232 | 152 |
| 588 | 3300005719 | Ga0068861_100013927 | Ga0068861_1000139274 | 152 |
| 589 | 3300005834 | Ga0068851_10200490 | Ga0068851_102004902 | 152 |
| 590 | 3300005840 | Ga0068870_10493820 | Ga0068870_104938201 | 152 |
| 591 | 3300005841 | Ga0068863_100643646 | Ga0068863_1006436462 | 152 |
| 592 | 3300005841 | Ga0068863_100709064 | Ga0068863_1007090642 | 152 |
| 593 | 3300005841 | Ga0068863_101335669 | Ga0068863_1013356691 | 152 |
| 594 | 3300005844 | Ga0068862_100029083 | Ga0068862_1000290836 | 152 |
| 595 | 3300006028 | Ga0070717_10001554 | Ga0070717_1000155412 | 152 |
| 596 | 3300006028 | Ga0070717_10319744 | Ga0070717_103197441 | 152 |
| 597 | 3300006028 | Ga0070717_10486749 | Ga0070717_104867492 | 152 |
| 598 | 3300006173 | Ga0070716_100000362 | Ga0070716_1000003623 | 152 |
| 599 | 3300006173 | Ga0070716_100607214 | Ga0070716_1006072142 | 152 |
| 600 | 3300006175 | Ga0070712_100004680 | Ga0070712_10000468010 | 152 |
| 601 | 3300006175 | Ga0070712_100012554 | Ga0070712_1000125546 | 152 |
| 602 | 3300006175 | Ga0070712_100024155 | Ga0070712_1000241555 | 152 |
| 603 | 3300006175 | Ga0070712_101010320 | Ga0070712_1010103202 | 152 |
| 604 | 3300006175 | Ga0070712_101358284 | Ga0070712_1013582841 | 152 |
| 605 | 3300006237 | Ga0097621_100607160 | Ga0097621_1006071602 | 152 |
| 606 | 3300006358 | Ga0068871_100211589 | Ga0068871_1002115894 | 152 |
| 607 | 3300006852 | Ga0075433_10079886 | Ga0075433_100798863 | 152 |
| 608 | 3300006852 | Ga0075433_10608442 | Ga0075433_106084422 | 152 |
| 609 | 3300006871 | Ga0075434_100001530 | Ga0075434_10000153020 | 152 |
| 610 | 3300006871 | Ga0075434_100814031 | Ga0075434_1008140312 | 152 |
| 611 | 3300006881 | Ga0068865_100591690 | Ga0068865_1005916902 | 152 |
| 612 | 3300007076 | Ga0075435_100015879 | Ga0075435_1000158799 | 152 |
| 613 | 3300009092 | Ga0105250_10022999 | Ga0105250_100229992 | 152 |
| 614 | 3300009092 | Ga0105250_10185610 | Ga0105250_101856101 | 152 |
| 615 | 3300009094 | Ga0111539_12493572 | Ga0111539_124935722 | 152 |
| 616 | 3300009098 | Ga0105245_10008707 | Ga0105245_100087078 | 152 |
| 617 | 3300009098 | Ga0105245_10171158 | Ga0105245_101711582 | 152 |
| 618 | 3300009101 | Ga0105247_10014624 | Ga0105247_100146245 | 152 |
| 619 | 3300009101 | Ga0105247_10159623 | Ga0105247_101596232 | 152 |
| 620 | 3300009148 | Ga0105243_10183153 | Ga0105243_101831532 | 152 |
| 621 | 3300009174 | Ga0105241_10003987 | Ga0105241_1000398711 | 152 |
| 622 | 3300009174 | Ga0105241_10021431 | Ga0105241_100214315 | 152 |
| 623 | 3300009176 | Ga0105242_10074687 | Ga0105242_100746874 | 152 |
| 624 | 3300009176 | Ga0105242_10417110 | Ga0105242_104171102 | 152 |
| 625 | 3300009177 | Ga0105248_10159820 | Ga0105248_101598201 | 152 |
| 626 | 3300009177 | Ga0105248_10350970 | Ga0105248_103509702 | 152 |
| 627 | 3300009545 | Ga0105237_10095169 | Ga0105237_100951692 | 152 |
| 628 | 3300009545 | Ga0105237_10488230 | Ga0105237_104882302 | 152 |
| 629 | 3300009551 | Ga0105238_10824498 | Ga0105238_108244982 | 152 |
| 630 | 3300009553 | Ga0105249_10016825 | Ga0105249_100168255 | 152 |
| 631 | 3300009553 | Ga0105249_10288689 | Ga0105249_102886893 | 152 |
| 632 | 3300010375 | Ga0105239_10051532 | Ga0105239_100515322 | 152 |
| 633 | 3300010375 | Ga0105239_11718490 | Ga0105239_117184901 | 152 |
| 634 | 3300011119 | Ga0105246_10000284 | Ga0105246_1000028423 | 152 |
| 635 | 3300013100 | Ga0157373_10004151 | Ga0157373_100041516 | 152 |
| 636 | 3300013102 | Ga0157371_10005578 | Ga0157371_100055786 | 152 |
| 637 | 3300013105 | Ga0157369_10019098 | Ga0157369_100190985 | 152 |
| 638 | 3300013297 | Ga0157378_10044780 | Ga0157378_100447801 | 152 |
| 639 | 3300013297 | Ga0157378_10056338 | Ga0157378_100563384 | 152 |
| 640 | 3300013297 | Ga0157378_10487820 | Ga0157378_104878202 | 152 |
| 641 | 3300013306 | Ga0163162_10015578 | Ga0163162_100155786 | 152 |
| 642 | 3300013306 | Ga0163162_11269317 | Ga0163162_112693171 | 152 |
| 643 | 3300013307 | Ga0157372_10018391 | Ga0157372_100183914 | 152 |
| 644 | 3300013308 | Ga0157375_10051079 | Ga0157375_100510794 | 152 |
| 645 | 3300014325 | Ga0163163_10002188 | Ga0163163_1000218816 | 152 |
| 646 | 3300014325 | Ga0163163_10355254 | Ga0163163_103552542 | 152 |
| 647 | 3300014326 | Ga0157380_11337243 | Ga0157380_113372432 | 152 |
| 648 | 3300014497 | Ga0182008_10009202 | Ga0182008_100092023 | 152 |
| 649 | 3300014745 | Ga0157377_10003729 | Ga0157377_100037295 | 152 |
| 650 | 3300014968 | Ga0157379_10019539 | Ga0157379_100195398 | 152 |
| 651 | 3300014968 | Ga0157379_10074088 | Ga0157379_100740883 | 152 |
| 652 | 3300014969 | Ga0157376_10009673 | Ga0157376_100096735 | 152 |
| 653 | 3300017792 | Ga0163161_10010741 | Ga0163161_100107416 | 152 |
| 654 | 3300025315 | Ga0207697_10005610 | Ga0207697_100056105 | 152 |
| 655 | 3300025321 | Ga0207656_10021437 | Ga0207656_100214372 | 152 |
| 656 | 3300025893 | Ga0207682_10035732 | Ga0207682_100357321 | 152 |
| 657 | 3300025898 | Ga0207692_10113367 | Ga0207692_101133672 | 152 |
| 658 | 3300025899 | Ga0207642_10026795 | Ga0207642_100267951 | 152 |
| 659 | 3300025900 | Ga0207710_10007231 | Ga0207710_100072314 | 152 |
| 660 | 3300025900 | Ga0207710_10101856 | Ga0207710_101018561 | 152 |
| 661 | 3300025901 | Ga0207688_10003510 | Ga0207688_100035104 | 152 |
| 662 | 3300025903 | Ga0207680_10015013 | Ga0207680_100150136 | 152 |
| 663 | 3300025905 | Ga0207685_10041938 | Ga0207685_100419382 | 152 |
| 664 | 3300025910 | Ga0207684_10000389 | Ga0207684_1000038934 | 152 |
| 665 | 3300025910 | Ga0207684_10007163 | Ga0207684_100071632 | 152 |
| 666 | 3300025910 | Ga0207684_10421396 | Ga0207684_104213962 | 152 |
| 667 | 3300025911 | Ga0207654_10039744 | Ga0207654_100397444 | 152 |
| 668 | 3300025911 | Ga0207654_10130487 | Ga0207654_101304872 | 152 |
| 669 | 3300025913 | Ga0207695_10491572 | Ga0207695_104915721 | 152 |
| 670 | 3300025915 | Ga0207693_10003230 | Ga0207693_100032307 | 152 |
| 671 | 3300025915 | Ga0207693_10008387 | Ga0207693_100083879 | 152 |
| 672 | 3300025915 | Ga0207693_10033483 | Ga0207693_100334835 | 152 |
| 673 | 3300025915 | Ga0207693_10154904 | Ga0207693_101549042 | 152 |
| 674 | 3300025917 | Ga0207660_10904507 | Ga0207660_109045071 | 152 |
| 675 | 3300025919 | Ga0207657_10085411 | Ga0207657_100854114 | 152 |
| 676 | 3300025922 | Ga0207646_10001021 | Ga0207646_1000102120 | 152 |
| 677 | 3300025923 | Ga0207681_10154011 | Ga0207681_101540112 | 152 |
| 678 | 3300025924 | Ga0207694_10658516 | Ga0207694_106585162 | 152 |
| 679 | 3300025925 | Ga0207650_10209867 | Ga0207650_102098672 | 152 |
| 680 | 3300025926 | Ga0207659_10014351 | Ga0207659_100143514 | 152 |
| 681 | 3300025929 | Ga0207664_10373287 | Ga0207664_103732871 | 152 |
| 682 | 3300025929 | Ga0207664_10538248 | Ga0207664_105382481 | 152 |
| 683 | 3300025931 | Ga0207644_10009734 | Ga0207644_100097345 | 152 |
| 684 | 3300025932 | Ga0207690_10025891 | Ga0207690_100258914 | 152 |
| 685 | 3300025934 | Ga0207686_10265160 | Ga0207686_102651602 | 152 |
| 686 | 3300025936 | Ga0207670_10013296 | Ga0207670_100132965 | 152 |
| 687 | 3300025937 | Ga0207669_10030663 | Ga0207669_100306635 | 152 |
| 688 | 3300025938 | Ga0207704_10045185 | Ga0207704_100451851 | 152 |
| 689 | 3300025939 | Ga0207665_10000680 | Ga0207665_1000068012 | 152 |
| 690 | 3300025939 | Ga0207665_10601784 | Ga0207665_106017841 | 152 |
| 691 | 3300025941 | Ga0207711_10027489 | Ga0207711_100274891 | 152 |
| 692 | 3300025941 | Ga0207711_10624748 | Ga0207711_106247482 | 152 |
| 693 | 3300025942 | Ga0207689_10192475 | Ga0207689_101924751 | 152 |
| 694 | 3300025944 | Ga0207661_10202856 | Ga0207661_102028563 | 152 |
| 695 | 3300025949 | Ga0207667_10091353 | Ga0207667_100913531 | 152 |
| 696 | 3300025960 | Ga0207651_10023909 | Ga0207651_100239095 | 152 |
| 697 | 3300025961 | Ga0207712_10188727 | Ga0207712_101887273 | 152 |
| 698 | 3300025961 | Ga0207712_10196340 | Ga0207712_101963403 | 152 |
| 699 | 3300025972 | Ga0207668_10011636 | Ga0207668_100116365 | 152 |
| 700 | 3300025981 | Ga0207640_10012979 | Ga0207640_100129794 | 152 |
| 701 | 3300025986 | Ga0207658_10006917 | Ga0207658_100069175 | 152 |
| 702 | 3300026023 | Ga0207677_10007711 | Ga0207677_100077116 | 152 |
| 703 | 3300026023 | Ga0207677_10064922 | Ga0207677_100649223 | 152 |
| 704 | 3300026035 | Ga0207703_10063265 | Ga0207703_100632651 | 152 |
| 705 | 3300026035 | Ga0207703_10239389 | Ga0207703_102393892 | 152 |
| 706 | 3300026041 | Ga0207639_10016958 | Ga0207639_100169584 | 152 |
| 707 | 3300026067 | Ga0207678_10697689 | Ga0207678_106976892 | 152 |
| 708 | 3300026075 | Ga0207708_10040151 | Ga0207708_100401513 | 152 |
| 709 | 3300026088 | Ga0207641_10937218 | Ga0207641_109372181 | 152 |
| 710 | 3300026095 | Ga0207676_10736563 | Ga0207676_107365631 | 152 |
| 711 | 3300026118 | Ga0207675_100028244 | Ga0207675_1000282446 | 152 |
| 712 | 3300026142 | Ga0207698_11309497 | Ga0207698_113094971 | 152 |
| 713 | 3300028016 | Ga0265354_1009546 | Ga0265354_10095462 | 152 |
| 714 | 3300031090 | Ga0265760_10000187 | Ga0265760_1000018712 | 152 |
| 715 | 3300031090 | Ga0265760_10061558 | Ga0265760_100615582 | 152 |
| 716 | 3300031344 | Ga0265316_10083170 | Ga0265316_100831702 | 152 |
| 717 | 3300035085 | Ga0373929_0080689 | Ga0373929_0080689_174_662 | 152 |
| 718 | 3300035088 | Ga0373940_0051096 | Ga0373940_0051096_323_796 | 152 |
| 719 | 3300035089 | Ga0373944_0283063 | Ga0373944_0283063_123_584 | 152 |
| 720 | 3300035241 | Ga0373961_0075587 | Ga0373961_0075587_138_626 | 152 |
| 721 | 3300035691 | Ga0373931_0238116 | Ga0373931_0238116_487_948 | 152 |
| 722 | 3300035691 | Ga0373931_0598682 | Ga0373931_0598682_64_525 | 152 |
| 723 | 3300035695 | Ga0373927_0485890 | Ga0373927_0485890_246_707 | 152 |
| 724 | 3300039450 | Ga0436363_0901030 | Ga0436363_0901030_603_1064 | 152 |
| 725 | 3300039453 | Ga0436362_1210155 | Ga0436362_1210155_197_658 | 152 |
| 726 | 3300045051 | Ga0451576_0806605 | Ga0451576_0806605_332_790 | 152 |
| 727 | 3300045051 | Ga0451576_1158824 | Ga0451576_1158824_164_652 | 152 |
| 728 | 3300046455 | Ga0495603_0382887 | Ga0495603_0382887_276_737 | 152 |
| 729 | 3300046457 | Ga0495590_0112587 | Ga0495590_0112587_37_498 | 152 |
| 730 | 3300046472 | Ga0495580_0000600 | Ga0495580_0000600_1730_2191 | 152 |
| 731 | 3300046472 | Ga0495580_0001059 | Ga0495580_0001059_16835_17296 | 152 |
| 732 | 3300046472 | Ga0495580_0103100 | Ga0495580_0103100_612_1073 | 152 |
| 733 | 3300046472 | Ga0495580_0106965 | Ga0495580_0106965_377_838 | 152 |
| 734 | 3300046499 | Ga0495594_0118305 | Ga0495594_0118305_653_1114 | 152 |
| 735 | 3300046664 | Ga0495659_0010209 | Ga0495659_0010209_1452_1913 | 152 |
| 736 | 3300046675 | Ga0495657_0349084 | Ga0495657_0349084_57_518 | 152 |
| 737 | 3300048088 | Ga0495602_0340473 | Ga0495602_0340473_231_692 | 152 |
| 738 | 3300048903 | Ga0496100_0200559 | Ga0496100_0200559_546_1019 | 152 |
| 739 | 3300048903 | Ga0496100_0370951 | Ga0496100_0370951_276_734 | 152 |
| 740 | 3300048905 | Ga0496102_0000730 | Ga0496102_0000730_14476_14949 | 152 |
| 741 | 3300048905 | Ga0496102_1380758 | Ga0496102_1380758_127_585 | 152 |
| 742 | 3300048905 | Ga0496102_1507227 | Ga0496102_1507227_80_538 | 152 |
| 743 | 3300048906 | Ga0496103_0003239 | Ga0496103_0003239_1109_1582 | 152 |
| 744 | 3300048906 | Ga0496103_0102813 | Ga0496103_0102813_1053_1511 | 152 |
| 745 | 3300048907 | Ga0496104_0179569 | Ga0496104_0179569_1330_1788 | 152 |
| 746 | 3300048907 | Ga0496104_0968883 | Ga0496104_0968883_93_581 | 152 |
| 747 | 3300048908 | Ga0496105_0434234 | Ga0496105_0434234_111_569 | 152 |
| 748 | 3300048909 | Ga0496106_0024052 | Ga0496106_0024052_3338_3811 | 152 |
| 749 | 3300048909 | Ga0496106_0354737 | Ga0496106_0354737_327_815 | 152 |
| 750 | 3300048909 | Ga0496106_0490117 | Ga0496106_0490117_398_856 | 152 |
| 751 | 3300048910 | Ga0496107_0174101 | Ga0496107_0174101_884_1342 | 152 |
| 752 | 3300048910 | Ga0496107_0518921 | Ga0496107_0518921_218_706 | 152 |
| 753 | 3300048910 | Ga0496107_0560905 | Ga0496107_0560905_85_558 | 152 |
| 754 | 3300048911 | Ga0496108_0000535 | Ga0496108_0000535_27348_27806 | 152 |
| 755 | 3300048912 | Ga0496109_0000323 | Ga0496109_0000323_29639_30097 | 152 |
| 756 | 3300048912 | Ga0496109_0525315 | Ga0496109_0525315_22_510 | 152 |
| 757 | 3300048913 | Ga0496110_0000505 | Ga0496110_0000505_1258_1716 | 152 |
| 758 | 3300048914 | Ga0496111_0270943 | Ga0496111_0270943_686_1144 | 152 |
| 759 | 3300048915 | Ga0496112_0028806 | Ga0496112_0028806_2442_2900 | 152 |
| 760 | 3300048915 | Ga0496112_0621899 | Ga0496112_0621899_444_902 | 152 |
| 761 | 3300048916 | Ga0496113_0007627 | Ga0496113_0007627_1850_2308 | 152 |
| 762 | 3300048918 | Ga0496115_0045617 | Ga0496115_0045617_1929_2387 | 152 |
| 763 | 3300050511 | nmdc:mga08y16_1640348_c1 | nmdc:mga08y16_1640348_c1_100_558 | 152 |
| 764 | 3300050512 | nmdc:mga0n895_3077_c1 | nmdc:mga0n895_3077_c1_6347_6808 | 152 |
| 765 | 3300050513 | nmdc:mga0rr50_143419_c1 | nmdc:mga0rr50_143419_c1_1357_1818 | 152 |
| 766 | 3300050515 | nmdc:mga0a205_17360_c1 | nmdc:mga0a205_17360_c1_893_1354 | 152 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f22-assembly1.cif.gz_B | crystal structure of zalpha in complex with d(cgtacg) | 0.9417 | 9 | 69 |
| 3f23-assembly1.cif.gz_A | crystal structure of zalpha in complex with d(cggccg) | 0.938 | 5 | 69 |
| 2acj-assembly1.cif.gz_D | crystal structure of the b/z junction containing dna bound to z-dna binding proteins | 0.9376 | 14 | 70 |
| 3irq-assembly1.cif.gz_A | crystal structure of a z-z junction | 0.9329 | 9 | 68 |
| 4hf2-assembly1.cif.gz_A | crystal structure of e43a iscr mutant bound to its promoter | 0.9326 | 3 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3f22A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9375 | 5 | 69 | 1.10.10.10 |
| 4hf2A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9326 | 3 | 130 | 1.10.10.10 |
| 2gxbB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9287 | 14 | 70 | 1.10.10.10 |
| af_P55265_129_209_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9283 | 7 | 70 | 1.10.10.10 |
| 3nrvB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9247 | 10 | 68 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2Z5G9Y9-F1-model_v4 | Iron-sulfur cluster regulator IscR | 0.9149 | 1 | 129 |
GO:0003700
GO:0005829 |
| AF-A0A1V5YW79-F1-model_v4 | HTH-type transcriptional regulator CymR | 0.9102 | 3 | 130 |
GO:0003700
GO:0005829 |
| AF-A0A2N9L592-F1-model_v4 | Rrf2 family protein | 0.908 | 1 | 130 |
GO:0003700
GO:0005829 |
| AF-A0A5M8SX12-F1-model_v4 | Rrf2 family transcriptional regulator | 0.902 | 1 | 135 |
GO:0003700
GO:0005829 |
| AF-A0A7C2WKU9-F1-model_v4 | Rrf2 family transcriptional regulator | 0.9017 | 3 | 130 |
GO:0003700
GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar