F479837

General Info

Members Datasets Scaffolds Average Seq Length
766 309 766 153

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_101265543|Ga0068863_1012655431
Length 189
Sequence MTYRLVACLPHWLLGVAFPAQAHLKSYTTEKVLYMLKLTKKADYGLIAMRHLALCDAADGVPTASAKDIADEYGIPQQALAKILQRLAKSQLLISHHGTNGGYSLARPARSISALEVIKAIDGPLFMTACSSDHDCVQSSKCTVREPLRKVSEKIQEALERVKLADMGEDEKQSQAAGSPSIAELVRLT

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
213 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
217 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
218 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
219 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
220 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
221 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
222 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
223 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
224 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
228 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
233 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
246 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
247 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
250 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
272 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
295 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.3
Metatranscriptomes 4.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.4
Rhizosphere 92.95
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_9210921 2162886011 Bacteria 1578
2 MBSR1b_contig_694782 2162886012 Bacteria 850
3 JGI24747J21853_1014241 3300001978 Bacteria 826
4 JGI24737J22298_10012413 3300001990 Bacteria 2779
5 JGI24743J22301_10005212 3300001991 Bacteria 2161
6 JGI24743J22301_10010652 3300001991 Unclassified 1644
7 JGI24748J21848_1022567 3300002074 Unclassified 762
8 JGI24738J21930_10114464 3300002075 Unclassified 583
9 JGI24034J26672_10001329 3300002239 Bacteria 3263
10 JGI24751J29686_10004437 3300002459 Bacteria 2850
11 Ga0058859_10968610 3300004798 Unclassified 589
12 Ga0058860_12078993 3300004801 Unclassified 587
13 Ga0065712_10331065 3300005290 Bacteria 806
14 Ga0065715_10092929 3300005293 Bacteria 4875
15 Ga0065707_10415556 3300005295 Bacteria 836
16 Ga0070658_10016195 3300005327 Bacteria 5964
17 Ga0070658_10071817 3300005327 Bacteria 2835
18 Ga0070676_10001847 3300005328 Bacteria 10800
19 Ga0070683_100000196 3300005329 Bacteria 40484
20 Ga0070683_100024245 3300005329 Bacteria 5432
21 Ga0070683_100116685 3300005329 Unclassified 2520
22 Ga0070683_100466363 3300005329 Bacteria 1205
23 Ga0070683_100466601 3300005329 Bacteria 1205
24 Ga0070690_100038269 3300005330 Bacteria 3026
25 Ga0070670_100003321 3300005331 Bacteria 13306
26 Ga0070670_100049803 3300005331 Bacteria 3601
27 Ga0070670_100120291 3300005331 Bacteria 2265
28 Ga0070677_10008557 3300005333 Bacteria 3448
29 Ga0068869_100001678 3300005334 Bacteria 13225
30 Ga0068869_100010000 3300005334 Bacteria 6167
31 Ga0068869_100101958 3300005334 Bacteria 2172
32 Ga0068869_100211941 3300005334 Bacteria 1532
33 Ga0068869_101907783 3300005334 Unclassified 532
34 Ga0070666_10023121 3300005335 Bacteria 4043
35 Ga0070666_10359023 3300005335 Bacteria 1044
36 Ga0070680_100029534 3300005336 Bacteria 4404
37 Ga0070680_100164168 3300005336 Bacteria 1867
38 Ga0070682_100005289 3300005337 Bacteria 7183
39 Ga0070682_100007543 3300005337 Bacteria 6130
40 Ga0068868_100005839 3300005338 Bacteria 8678
41 Ga0068868_100014727 3300005338 Bacteria 5769
42 Ga0068868_100015053 3300005338 Bacteria 5712
43 Ga0068868_100023318 3300005338 Bacteria 4683
44 Ga0068868_100027007 3300005338 Bacteria 4377
45 Ga0068868_100727948 3300005338 Bacteria 890
46 Ga0070660_100068735 3300005339 Bacteria 2761
47 Ga0070660_100175999 3300005339 Bacteria 1730
48 Ga0070689_100001280 3300005340 Bacteria 15983
49 Ga0070689_100059915 3300005340 Bacteria 2959
50 Ga0070691_10043894 3300005341 Bacteria 2119
51 Ga0070687_100010778 3300005343 Unclassified 3972
52 Ga0070687_100107280 3300005343 Bacteria 1574
53 Ga0070661_100031791 3300005344 Bacteria 3817
54 Ga0070661_100065456 3300005344 Bacteria 2671
55 Ga0070668_100005427 3300005347 Bacteria 9468
56 Ga0070668_100161328 3300005347 Bacteria 1819
57 Ga0070669_100021333 3300005353 Bacteria 4629
58 Ga0070669_100138701 3300005353 Bacteria 1873
59 Ga0070675_100024552 3300005354 Bacteria 4828
60 Ga0070675_100379893 3300005354 Bacteria 1257
61 Ga0070671_100057077 3300005355 Bacteria 3248
62 Ga0070674_100046828 3300005356 Bacteria 2961
63 Ga0070688_100006261 3300005365 Bacteria 6345
64 Ga0070659_100031541 3300005366 Bacteria 4105
65 Ga0070659_100078269 3300005366 Unclassified 2637
66 Ga0070667_100008526 3300005367 Bacteria 8497
67 Ga0070709_10450371 3300005434 Bacteria 970
68 Ga0070709_10707984 3300005434 Bacteria 784
69 Ga0070714_100046420 3300005435 Bacteria 3685
70 Ga0070714_100069238 3300005435 Bacteria 3046
71 Ga0070714_100176057 3300005435 Bacteria 1944
72 Ga0070713_100000963 3300005436 Bacteria 18417
73 Ga0070713_100052988 3300005436 Bacteria 3361
74 Ga0070713_100117567 3300005436 Bacteria 2327
75 Ga0070713_100239766 3300005436 Bacteria 1651
76 Ga0070713_100332520 3300005436 Bacteria 1406
77 Ga0070713_100795000 3300005436 Bacteria 907
78 Ga0070713_101975275 3300005436 Unclassified 566
79 Ga0070710_10038230 3300005437 Bacteria 2635
80 Ga0070710_10143056 3300005437 Bacteria 1469
81 Ga0070711_100001492 3300005439 Bacteria 12844
82 Ga0070711_100021540 3300005439 Bacteria 4170
83 Ga0070711_100113607 3300005439 Bacteria 1992
84 Ga0070711_100218828 3300005439 Bacteria 1479
85 Ga0070705_100489575 3300005440 Bacteria 931
86 Ga0070705_100992322 3300005440 Unclassified 681
87 Ga0070705_101002504 3300005440 Unclassified 678
88 Ga0070700_100036844 3300005441 Bacteria 2970
89 Ga0070700_100431182 3300005441 Bacteria 998
90 Ga0070708_100000677 3300005445 Bacteria 25860
91 Ga0070708_100004714 3300005445 Bacteria 10745
92 Ga0070708_100015510 3300005445 Bacteria 6298
93 Ga0070708_100062325 3300005445 Bacteria 3335
94 Ga0070708_100105612 3300005445 Bacteria 2584
95 Ga0070708_100110753 3300005445 Bacteria 2523
96 Ga0070708_100148576 3300005445 Bacteria 2178
97 Ga0070708_100194568 3300005445 Bacteria 1897
98 Ga0070708_100216366 3300005445 Bacteria 1796
99 Ga0070708_100336434 3300005445 Bacteria 1423
100 Ga0070708_100347487 3300005445 Bacteria 1398
101 Ga0070708_101517715 3300005445 Bacteria 624
102 Ga0070663_100016752 3300005455 Bacteria 4769
103 Ga0070663_100031137 3300005455 Bacteria 3664
104 Ga0070663_100124491 3300005455 Bacteria 1951
105 Ga0070663_100279421 3300005455 Bacteria 1330
106 Ga0070678_100169228 3300005456 Bacteria 1778
107 Ga0070662_100006064 3300005457 Bacteria 7760
108 Ga0070662_100025048 3300005457 Bacteria 4117
109 Ga0070662_100496795 3300005457 Bacteria 1017
110 Ga0070681_10009378 3300005458 Bacteria 9631
111 Ga0070681_10029426 3300005458 Bacteria 5516
112 Ga0070681_10154389 3300005458 Bacteria 2221
113 Ga0068867_100006756 3300005459 Bacteria 8111
114 Ga0070685_10006837 3300005466 Bacteria 5824
115 Ga0070706_100000734 3300005467 Bacteria 37002
116 Ga0070706_100001749 3300005467 Bacteria 22543
117 Ga0070706_100003331 3300005467 Bacteria 15864
118 Ga0070706_100020469 3300005467 Bacteria 6098
119 Ga0070706_100022304 3300005467 Bacteria 5830
120 Ga0070706_100276189 3300005467 Bacteria 1568
121 Ga0070706_100513905 3300005467 Bacteria 1114
122 Ga0070707_100000190 3300005468 Bacteria 61096
123 Ga0070707_100000413 3300005468 Bacteria 42232
124 Ga0070707_100001198 3300005468 Bacteria 25503
125 Ga0070707_100017806 3300005468 Bacteria 6679
126 Ga0070707_100097105 3300005468 Bacteria 2854
127 Ga0070707_100420646 3300005468 Unclassified 1297
128 Ga0070707_100505114 3300005468 Bacteria 1171
129 Ga0070707_100557603 3300005468 Bacteria 1108
130 Ga0070707_100636979 3300005468 Unclassified 1029
131 Ga0070707_100811028 3300005468 Unclassified 900
132 Ga0070707_101074296 3300005468 Bacteria 771
133 Ga0070698_100000248 3300005471 Bacteria 54156
134 Ga0070698_101021644 3300005471 Unclassified 774
135 Ga0070699_100002192 3300005518 Bacteria 17668
136 Ga0070699_100007279 3300005518 Bacteria 9633
137 Ga0070699_100018990 3300005518 Bacteria 5912
138 Ga0070699_100052286 3300005518 Bacteria 3536
139 Ga0070699_100066639 3300005518 Unclassified 3126
140 Ga0070699_100209499 3300005518 Bacteria 1735
141 Ga0070699_101344499 3300005518 Unclassified 655
142 Ga0070679_100163782 3300005530 Bacteria 2198
143 Ga0070679_100261993 3300005530 Bacteria 1684
144 Ga0070684_100000283 3300005535 Bacteria 35271
145 Ga0070684_100008624 3300005535 Bacteria 7985
146 Ga0070684_100009031 3300005535 Bacteria 7833
147 Ga0070684_100205317 3300005535 Bacteria 1795
148 Ga0070684_100344579 3300005535 Bacteria 1370
149 Ga0070697_100000788 3300005536 Bacteria 23812
150 Ga0070697_100002694 3300005536 Bacteria 13677
151 Ga0070697_100009349 3300005536 Bacteria 7659
152 Ga0070697_100010875 3300005536 Bacteria 7107
153 Ga0070697_100162364 3300005536 Bacteria 1888
154 Ga0070697_100253439 3300005536 Bacteria 1505
155 Ga0070697_100452400 3300005536 Bacteria 1119
156 Ga0070697_100659715 3300005536 Unclassified 922
157 Ga0070697_100745019 3300005536 Unclassified 866
158 Ga0070697_101043174 3300005536 Bacteria 727
159 Ga0068853_100000114 3300005539 Bacteria 55124
160 Ga0068853_100041831 3300005539 Unclassified 3916
161 Ga0068853_100443228 3300005539 Bacteria 1220
162 Ga0070686_100003572 3300005544 Bacteria 8534
163 Ga0070695_100026303 3300005545 Bacteria 3599
164 Ga0070695_100125117 3300005545 Bacteria 1764
165 Ga0070695_100236343 3300005545 Bacteria 1323
166 Ga0070696_100018327 3300005546 Bacteria 4731
167 Ga0070696_100303480 3300005546 Bacteria 1223
168 Ga0070693_100044548 3300005547 Bacteria 2510
169 Ga0070693_100105636 3300005547 Bacteria 1723
170 Ga0070665_100016715 3300005548 Bacteria 7353
171 Ga0070665_100119794 3300005548 Bacteria 2634
172 Ga0070704_101055272 3300005549 Unclassified 737
173 Ga0068855_100009737 3300005563 Bacteria 11593
174 Ga0068855_100065756 3300005563 Bacteria 4227
175 Ga0068855_100227498 3300005563 Unclassified 2090
176 Ga0068855_100263463 3300005563 Bacteria 1919
177 Ga0068855_100720602 3300005563 Bacteria 1066
178 Ga0070664_100124450 3300005564 Bacteria 2260
179 Ga0068857_100000606 3300005577 Bacteria 26405
180 Ga0068857_100021825 3300005577 Bacteria 5634
181 Ga0068857_100101920 3300005577 Bacteria 2576
182 Ga0068854_100008827 3300005578 Bacteria 6487
183 Ga0068854_100010438 3300005578 Bacteria 6024
184 Ga0068854_100166302 3300005578 Bacteria 1712
185 Ga0068854_100945747 3300005578 Unclassified 760
186 Ga0068856_100015081 3300005614 Bacteria 7466
187 Ga0068856_100018182 3300005614 Bacteria 6815
188 Ga0068856_100022679 3300005614 Bacteria 6103
189 Ga0070702_100006489 3300005615 Bacteria 5542
190 Ga0068852_100000033 3300005616 Bacteria 101433
191 Ga0068852_100185987 3300005616 Bacteria 1956
192 Ga0068852_100441353 3300005616 Bacteria 1287
193 Ga0068859_100003073 3300005617 Bacteria 16925
194 Ga0068859_100008570 3300005617 Bacteria 10340
195 Ga0068859_100111266 3300005617 Bacteria 2801
196 Ga0068864_100000314 3300005618 Bacteria 42771
197 Ga0068864_100080131 3300005618 Bacteria 2860
198 Ga0068864_100083299 3300005618 Bacteria 2809
199 Ga0068864_100105923 3300005618 Bacteria 2500
200 Ga0068866_10218030 3300005718 Unclassified 1149
201 Ga0068861_100013927 3300005719 Bacteria 5637
202 Ga0068861_100034276 3300005719 Bacteria 3754
203 Ga0068861_101398763 3300005719 Unclassified 683
204 Ga0068851_10001735 3300005834 Bacteria 9527
205 Ga0068851_10002075 3300005834 Bacteria 8827
206 Ga0068851_10180128 3300005834 Bacteria 1170
207 Ga0068851_10200490 3300005834 Unclassified 1113
208 Ga0068870_10029294 3300005840 Bacteria 2772
209 Ga0068870_10493820 3300005840 Unclassified 815
210 Ga0068863_100002166 3300005841 Bacteria 19471
211 Ga0068863_100643646 3300005841 Bacteria 1051
212 Ga0068863_100709064 3300005841 Unclassified 1000
213 Ga0068863_101265543 3300005841 Unclassified 744
214 Ga0068863_101335669 3300005841 Unclassified 724
215 Ga0068858_100001497 3300005842 Bacteria 24102
216 Ga0068858_100068682 3300005842 Bacteria 3284
217 Ga0068860_100000188 3300005843 Bacteria 98490
218 Ga0068860_100080206 3300005843 Bacteria 3104
219 Ga0068862_100029083 3300005844 Bacteria 4654
220 Ga0068862_100053000 3300005844 Bacteria 3472
221 Ga0068862_100332903 3300005844 Bacteria 1404
222 Ga0070717_10001554 3300006028 Bacteria 15918
223 Ga0070717_10013824 3300006028 Bacteria 6198
224 Ga0070717_10015404 3300006028 Bacteria 5907
225 Ga0070717_10034959 3300006028 Bacteria 4065
226 Ga0070717_10055315 3300006028 Bacteria 3273
227 Ga0070717_10065200 3300006028 Bacteria 3027
228 Ga0070717_10319744 3300006028 Bacteria 1383
229 Ga0070717_10486749 3300006028 Bacteria 1114
230 Ga0070717_10585773 3300006028 Bacteria 1012
231 Ga0070717_11178970 3300006028 Unclassified 697
232 Ga0070715_10039516 3300006163 Bacteria 1966
233 Ga0070716_100000362 3300006173 Bacteria 18659
234 Ga0070716_100006011 3300006173 Bacteria 5912
235 Ga0070716_100080931 3300006173 Bacteria 1938
236 Ga0070716_100177412 3300006173 Bacteria 1396
237 Ga0070716_100265942 3300006173 Bacteria 1176
238 Ga0070716_100607214 3300006173 Bacteria 824
239 Ga0070716_101147424 3300006173 Bacteria 622
240 Ga0070712_100004680 3300006175 Bacteria 8461
241 Ga0070712_100007747 3300006175 Bacteria 6722
242 Ga0070712_100012554 3300006175 Bacteria 5386
243 Ga0070712_100024155 3300006175 Bacteria 4024
244 Ga0070712_100085022 3300006175 Bacteria 2302
245 Ga0070712_101010320 3300006175 Unclassified 720
246 Ga0070712_101358284 3300006175 Unclassified 620
247 Ga0097621_100007205 3300006237 Bacteria 7935
248 Ga0097621_100607160 3300006237 Bacteria 1000
249 Ga0068871_100004472 3300006358 Bacteria 9732
250 Ga0068871_100031432 3300006358 Bacteria 4187
251 Ga0068871_100211589 3300006358 Bacteria 1677
252 Ga0075433_10079886 3300006852 Bacteria 2882
253 Ga0075433_10608442 3300006852 Bacteria 959
254 Ga0075434_100001530 3300006871 Bacteria 19558
255 Ga0075434_100814031 3300006871 Unclassified 950
256 Ga0068865_100042964 3300006881 Bacteria 3085
257 Ga0068865_100591690 3300006881 Bacteria 936
258 Ga0075436_100035905 3300006914 Unclassified 3419
259 Ga0075436_100321304 3300006914 Bacteria 1112
260 Ga0097620_100003073 3300006931 Bacteria 16925
261 Ga0097620_100008571 3300006931 Bacteria 10340
262 Ga0097620_100111255 3300006931 Bacteria 2801
263 Ga0075435_100015879 3300007076 Bacteria 5667
264 Ga0075435_100488547 3300007076 Bacteria 1064
265 Ga0105250_10022999 3300009092 Bacteria 2511
266 Ga0105250_10185610 3300009092 Bacteria 874
267 Ga0105240_10000125 3300009093 Bacteria 159027
268 Ga0105240_10001204 3300009093 Bacteria 45110
269 Ga0105240_10015304 3300009093 Bacteria 10436
270 Ga0105240_10090699 3300009093 Bacteria 3735
271 Ga0105240_10150805 3300009093 Bacteria 2769
272 Ga0105240_10418606 3300009093 Unclassified 1506
273 Ga0111539_12493572 3300009094 Unclassified 600
274 Ga0105245_10008707 3300009098 Bacteria 8847
275 Ga0105245_10009201 3300009098 Bacteria 8613
276 Ga0105245_10171158 3300009098 Bacteria 2068
277 Ga0105245_11508452 3300009098 Unclassified 723
278 Ga0105247_10006936 3300009101 Bacteria 6974
279 Ga0105247_10014624 3300009101 Bacteria 4704
280 Ga0105247_10044374 3300009101 Bacteria 2726
281 Ga0105247_10159623 3300009101 Bacteria 1492
282 Ga0105243_10183153 3300009148 Bacteria 1823
283 Ga0105241_10000043 3300009174 Bacteria 105124
284 Ga0105241_10000092 3300009174 Bacteria 67501
285 Ga0105241_10003508 3300009174 Bacteria 11669
286 Ga0105241_10003987 3300009174 Bacteria 10913
287 Ga0105241_10021431 3300009174 Bacteria 4776
288 Ga0105241_10847957 3300009174 Unclassified 845
289 Ga0105241_10960837 3300009174 Bacteria 797
290 Ga0105241_10989076 3300009174 Unclassified 786
291 Ga0105242_10074687 3300009176 Bacteria 2821
292 Ga0105242_10383727 3300009176 Bacteria 1307
293 Ga0105242_10417110 3300009176 Bacteria 1257
294 Ga0105248_10019275 3300009177 Bacteria 7549
295 Ga0105248_10024463 3300009177 Bacteria 6714
296 Ga0105248_10159820 3300009177 Bacteria 2542
297 Ga0105248_10350970 3300009177 Bacteria 1661
298 Ga0105248_10537835 3300009177 Unclassified 1318
299 Ga0105237_10000686 3300009545 Bacteria 46922
300 Ga0105237_10015090 3300009545 Bacteria 8051
301 Ga0105237_10016050 3300009545 Bacteria 7788
302 Ga0105237_10095169 3300009545 Bacteria 2967
303 Ga0105237_10333781 3300009545 Bacteria 1520
304 Ga0105237_10488230 3300009545 Unclassified 1238
305 Ga0105238_10000083 3300009551 Bacteria 107423
306 Ga0105238_10000122 3300009551 Bacteria 85581
307 Ga0105238_10185801 3300009551 Bacteria 2055
308 Ga0105238_10824498 3300009551 Bacteria 944
309 Ga0105238_10878342 3300009551 Bacteria 914
310 Ga0105249_10016825 3300009553 Bacteria 6488
311 Ga0105249_10017849 3300009553 Bacteria 6304
312 Ga0105249_10068506 3300009553 Bacteria 3273
313 Ga0105249_10288689 3300009553 Bacteria 1641
314 Ga0099796_10236698 3300010159 Bacteria 753
315 Ga0099796_10384050 3300010159 Bacteria 612
316 Ga0105239_10010996 3300010375 Bacteria 10103
317 Ga0105239_10051532 3300010375 Bacteria 4512
318 Ga0105239_10052045 3300010375 Unclassified 4490
319 Ga0105239_11718490 3300010375 Unclassified 726
320 Ga0105246_10000284 3300011119 Bacteria 26540
321 Ga0105246_10003685 3300011119 Bacteria 9277
322 Ga0105246_10037058 3300011119 Bacteria 3271
323 Ga0157347_1047219 3300012502 Bacteria 585
324 Ga0157373_10004151 3300013100 Bacteria 10926
325 Ga0157373_10060655 3300013100 Bacteria 2679
326 Ga0157373_10225185 3300013100 Bacteria 1324
327 Ga0157371_10005578 3300013102 Bacteria 10575
328 Ga0157371_10038088 3300013102 Bacteria 3441
329 Ga0157369_10001545 3300013105 Bacteria 28182
330 Ga0157369_10003066 3300013105 Bacteria 19955
331 Ga0157369_10019098 3300013105 Bacteria 7672
332 Ga0157369_10031250 3300013105 Bacteria 5866
333 Ga0157369_10138797 3300013105 Bacteria 2573
334 Ga0157369_10896285 3300013105 Unclassified 910
335 Ga0157374_10011719 3300013296 Bacteria 7605
336 Ga0157374_10033040 3300013296 Bacteria 4718
337 Ga0157374_10034477 3300013296 Bacteria 4623
338 Ga0157374_10035275 3300013296 Bacteria 4576
339 Ga0157374_10492431 3300013296 Bacteria 1230
340 Ga0157378_10008928 3300013297 Bacteria 8725
341 Ga0157378_10044780 3300013297 Bacteria 3930
342 Ga0157378_10056338 3300013297 Bacteria 3503
343 Ga0157378_10487820 3300013297 Bacteria 1229
344 Ga0157378_10568063 3300013297 Bacteria 1142
345 Ga0163162_10006846 3300013306 Bacteria 11062
346 Ga0163162_10015578 3300013306 Bacteria 7431
347 Ga0163162_10060056 3300013306 Bacteria 3835
348 Ga0163162_10113732 3300013306 Bacteria 2805
349 Ga0163162_11269317 3300013306 Bacteria 836
350 Ga0157372_10018391 3300013307 Bacteria 7511
351 Ga0157372_10114312 3300013307 Bacteria 3094
352 Ga0157372_10146518 3300013307 Bacteria 2723
353 Ga0157372_10373396 3300013307 Bacteria 1662
354 Ga0157372_11006271 3300013307 Bacteria 965
355 Ga0157375_10027050 3300013308 Bacteria 5356
356 Ga0157375_10051079 3300013308 Bacteria 4058
357 Ga0157375_11350087 3300013308 Unclassified 839
358 Ga0163163_10000561 3300014325 Bacteria 32674
359 Ga0163163_10002188 3300014325 Bacteria 16450
360 Ga0163163_10036133 3300014325 Bacteria 4797
361 Ga0163163_10060479 3300014325 Bacteria 3751
362 Ga0163163_10355254 3300014325 Bacteria 1522
363 Ga0163163_10507836 3300014325 Bacteria 1267
364 Ga0157380_11337243 3300014326 Unclassified 765
365 Ga0182008_10009202 3300014497 Bacteria 5340
366 Ga0157377_10003729 3300014745 Bacteria 6916
367 Ga0157379_10001207 3300014968 Bacteria 20999
368 Ga0157379_10019539 3300014968 Bacteria 5984
369 Ga0157379_10074088 3300014968 Bacteria 3047
370 Ga0157379_10112678 3300014968 Unclassified 2445
371 Ga0157379_10254833 3300014968 Bacteria 1594
372 Ga0157379_10275784 3300014968 Bacteria 1530
373 Ga0157376_10001660 3300014969 Bacteria 14782
374 Ga0157376_10009673 3300014969 Bacteria 7015
375 Ga0157376_10353171 3300014969 Unclassified 1408
376 Ga0157376_10516468 3300014969 Bacteria 1177
377 Ga0163161_10010741 3300017792 Bacteria 6343
378 Ga0184600_131136 3300019190 Bacteria 2835
379 Ga0184603_152930 3300019192 Bacteria 838
380 Ga0197907_10226117 3300020069 Unclassified 1722
381 Ga0197907_11139742 3300020069 Bacteria 675
382 Ga0206356_11441786 3300020070 Bacteria 1198
383 Ga0206349_1377318 3300020075 Bacteria 874
384 Ga0206351_10177850 3300020077 Unclassified 851
385 Ga0206352_10685474 3300020078 Bacteria 813
386 Ga0206354_10122061 3300020081 Unclassified 1407
387 Ga0206354_11661069 3300020081 Unclassified 518
388 Ga0154015_1019090 3300020610 Bacteria 1007
389 Ga0224712_10009934 3300022467 Bacteria 2890
390 Ga0224712_10107193 3300022467 Bacteria 1193
391 Ga0247553_102601 3300023672 Bacteria 842
392 Ga0207697_10005610 3300025315 Bacteria 5806
393 Ga0207656_10005061 3300025321 Bacteria 4635
394 Ga0207656_10021437 3300025321 Bacteria 2582
395 Ga0207656_10162827 3300025321 Bacteria 1062
396 Ga0207682_10035732 3300025893 Bacteria 2008
397 Ga0207692_10113367 3300025898 Bacteria 1507
398 Ga0207692_10251918 3300025898 Bacteria 1058
399 Ga0207642_10026795 3300025899 Bacteria 2351
400 Ga0207642_10065874 3300025899 Bacteria 1704
401 Ga0207710_10001709 3300025900 Bacteria 10617
402 Ga0207710_10007231 3300025900 Bacteria 4704
403 Ga0207710_10101856 3300025900 Bacteria 1355
404 Ga0207688_10003510 3300025901 Bacteria 8557
405 Ga0207680_10015013 3300025903 Bacteria 4031
406 Ga0207680_10060671 3300025903 Bacteria 2303
407 Ga0207680_10088737 3300025903 Bacteria 1961
408 Ga0207647_10003391 3300025904 Bacteria 11937
409 Ga0207647_10205354 3300025904 Bacteria 1139
410 Ga0207647_10219273 3300025904 Bacteria 1097
411 Ga0207685_10030785 3300025905 Bacteria 1914
412 Ga0207685_10041938 3300025905 Bacteria 1715
413 Ga0207699_10217291 3300025906 Bacteria 1303
414 Ga0207699_10251978 3300025906 Bacteria 1217
415 Ga0207699_10512924 3300025906 Unclassified 866
416 Ga0207645_10027230 3300025907 Bacteria 3693
417 Ga0207705_10103419 3300025909 Bacteria 2098
418 Ga0207684_10000389 3300025910 Bacteria 59084
419 Ga0207684_10000921 3300025910 Bacteria 33357
420 Ga0207684_10007163 3300025910 Bacteria 10080
421 Ga0207684_10009632 3300025910 Bacteria 8522
422 Ga0207684_10116062 3300025910 Bacteria 2294
423 Ga0207684_10126635 3300025910 Bacteria 2192
424 Ga0207684_10421396 3300025910 Bacteria 1147
425 Ga0207684_10773107 3300025910 Bacteria 813
426 Ga0207654_10000019 3300025911 Bacteria 171031
427 Ga0207654_10000858 3300025911 Bacteria 16815
428 Ga0207654_10001656 3300025911 Bacteria 11641
429 Ga0207654_10010963 3300025911 Bacteria 4616
430 Ga0207654_10039744 3300025911 Bacteria 2648
431 Ga0207654_10130487 3300025911 Bacteria 1590
432 Ga0207707_10115018 3300025912 Bacteria 2351
433 Ga0207707_10320182 3300025912 Unclassified 1339
434 Ga0207695_10000210 3300025913 Bacteria 157198
435 Ga0207695_10000338 3300025913 Bacteria 110289
436 Ga0207695_10050253 3300025913 Bacteria 4388
437 Ga0207695_10070920 3300025913 Bacteria 3560
438 Ga0207695_10358830 3300025913 Bacteria 1344
439 Ga0207695_10491572 3300025913 Bacteria 1109
440 Ga0207671_10000068 3300025914 Bacteria 161429
441 Ga0207671_10000145 3300025914 Bacteria 109306
442 Ga0207671_10045869 3300025914 Bacteria 3233
443 Ga0207693_10001531 3300025915 Bacteria 20431
444 Ga0207693_10003230 3300025915 Bacteria 13991
445 Ga0207693_10008387 3300025915 Bacteria 8455
446 Ga0207693_10033483 3300025915 Bacteria 4055
447 Ga0207693_10154904 3300025915 Bacteria 1802
448 Ga0207693_10262606 3300025915 Bacteria 1354
449 Ga0207663_10364544 3300025916 Bacteria 1097
450 Ga0207663_10439460 3300025916 Bacteria 1004
451 Ga0207660_10129081 3300025917 Bacteria 1922
452 Ga0207660_10222738 3300025917 Bacteria 1481
453 Ga0207660_10904507 3300025917 Unclassified 720
454 Ga0207662_10708799 3300025918 Unclassified 706
455 Ga0207657_10000626 3300025919 Bacteria 37555
456 Ga0207657_10085411 3300025919 Bacteria 2643
457 Ga0207649_10007611 3300025920 Bacteria 5890
458 Ga0207649_10026936 3300025920 Bacteria 3368
459 Ga0207652_10150233 3300025921 Bacteria 2085
460 Ga0207646_10000054 3300025922 Bacteria 160414
461 Ga0207646_10001021 3300025922 Bacteria 35814
462 Ga0207646_10001731 3300025922 Bacteria 26548
463 Ga0207646_10054314 3300025922 Bacteria 3584
464 Ga0207646_10091800 3300025922 Bacteria 2717
465 Ga0207646_10299492 3300025922 Bacteria 1453
466 Ga0207646_10573364 3300025922 Bacteria 1014
467 Ga0207646_11786158 3300025922 Bacteria 526
468 Ga0207681_10012929 3300025923 Bacteria 5161
469 Ga0207681_10154011 3300025923 Bacteria 1725
470 Ga0207694_10000043 3300025924 Bacteria 171251
471 Ga0207694_10000085 3300025924 Bacteria 108662
472 Ga0207694_10050114 3300025924 Bacteria 3232
473 Ga0207694_10658516 3300025924 Unclassified 882
474 Ga0207650_10028268 3300025925 Bacteria 4019
475 Ga0207650_10209867 3300025925 Bacteria 1563
476 Ga0207659_10014351 3300025926 Bacteria 5105
477 Ga0207687_10004706 3300025927 Bacteria 9078
478 Ga0207687_10006238 3300025927 Bacteria 7889
479 Ga0207700_10083686 3300025928 Bacteria 2498
480 Ga0207700_10122573 3300025928 Bacteria 2110
481 Ga0207700_10846102 3300025928 Bacteria 818
482 Ga0207700_11816814 3300025928 Unclassified 535
483 Ga0207664_10030871 3300025929 Bacteria 4095
484 Ga0207664_10239080 3300025929 Bacteria 1581
485 Ga0207664_10373287 3300025929 Bacteria 1265
486 Ga0207664_10538248 3300025929 Bacteria 1047
487 Ga0207644_10009734 3300025931 Bacteria 6319
488 Ga0207644_10020673 3300025931 Bacteria 4479
489 Ga0207690_10025891 3300025932 Bacteria 3689
490 Ga0207706_10015203 3300025933 Bacteria 6965
491 Ga0207686_10019537 3300025934 Bacteria 3856
492 Ga0207686_10265160 3300025934 Bacteria 1261
493 Ga0207709_10231845 3300025935 Bacteria 1338
494 Ga0207670_10013296 3300025936 Bacteria 4847
495 Ga0207670_10027036 3300025936 Bacteria 3623
496 Ga0207669_10030663 3300025937 Bacteria 2991
497 Ga0207704_10045185 3300025938 Bacteria 2615
498 Ga0207704_10116602 3300025938 Bacteria 1818
499 Ga0207665_10000680 3300025939 Bacteria 22941
500 Ga0207665_10102811 3300025939 Bacteria 1997
501 Ga0207665_10601784 3300025939 Bacteria 858
502 Ga0207665_10602848 3300025939 Bacteria 858
503 Ga0207711_10005920 3300025941 Bacteria 10330
504 Ga0207711_10019631 3300025941 Bacteria 5627
505 Ga0207711_10027489 3300025941 Bacteria 4778
506 Ga0207711_10624748 3300025941 Bacteria 1005
507 Ga0207689_10000875 3300025942 Bacteria 29020
508 Ga0207689_10001635 3300025942 Bacteria 21241
509 Ga0207689_10192475 3300025942 Bacteria 1683
510 Ga0207661_10000402 3300025944 Bacteria 28027
511 Ga0207661_10054639 3300025944 Bacteria 3200
512 Ga0207661_10202856 3300025944 Bacteria 1744
513 Ga0207679_10037566 3300025945 Bacteria 3443
514 Ga0207667_10091353 3300025949 Bacteria 3145
515 Ga0207667_10105131 3300025949 Bacteria 2912
516 Ga0207667_10593589 3300025949 Bacteria 1117
517 Ga0207667_10755070 3300025949 Bacteria 972
518 Ga0207651_10023909 3300025960 Bacteria 3768
519 Ga0207712_10045296 3300025961 Bacteria 3045
520 Ga0207712_10076361 3300025961 Bacteria 2425
521 Ga0207712_10188727 3300025961 Bacteria 1625
522 Ga0207712_10196340 3300025961 Bacteria 1597
523 Ga0207668_10011636 3300025972 Bacteria 5353
524 Ga0207640_10012277 3300025981 Bacteria 4874
525 Ga0207640_10012979 3300025981 Bacteria 4760
526 Ga0207640_10042944 3300025981 Bacteria 2886
527 Ga0207658_10002106 3300025986 Bacteria 14806
528 Ga0207658_10006917 3300025986 Bacteria 7722
529 Ga0207658_10025548 3300025986 Bacteria 4136
530 Ga0207677_10000841 3300026023 Bacteria 17538
531 Ga0207677_10007711 3300026023 Bacteria 5974
532 Ga0207677_10010795 3300026023 Bacteria 5180
533 Ga0207677_10064922 3300026023 Bacteria 2544
534 Ga0207703_10003037 3300026035 Bacteria 14201
535 Ga0207703_10006325 3300026035 Bacteria 9467
536 Ga0207703_10063265 3300026035 Bacteria 3033
537 Ga0207703_10239389 3300026035 Bacteria 1631
538 Ga0207703_10760994 3300026035 Bacteria 923
539 Ga0207639_10000072 3300026041 Bacteria 94533
540 Ga0207639_10016958 3300026041 Bacteria 5160
541 Ga0207678_10008082 3300026067 Bacteria 9277
542 Ga0207678_10529187 3300026067 Bacteria 1029
543 Ga0207678_10697689 3300026067 Bacteria 893
544 Ga0207708_10040151 3300026075 Bacteria 3567
545 Ga0207702_10000205 3300026078 Bacteria 70125
546 Ga0207702_10021287 3300026078 Bacteria 5367
547 Ga0207702_10177590 3300026078 Bacteria 1958
548 Ga0207702_10307358 3300026078 Bacteria 1506
549 Ga0207702_10437554 3300026078 Unclassified 1267
550 Ga0207641_10006446 3300026088 Bacteria 9892
551 Ga0207641_10453364 3300026088 Bacteria 1240
552 Ga0207641_10809933 3300026088 Bacteria 927
553 Ga0207641_10937218 3300026088 Unclassified 861
554 Ga0207676_10005980 3300026095 Bacteria 8579
555 Ga0207676_10122425 3300026095 Bacteria 2196
556 Ga0207676_10736563 3300026095 Bacteria 958
557 Ga0207674_10000239 3300026116 Bacteria 68575
558 Ga0207674_10026228 3300026116 Bacteria 6196
559 Ga0207674_10119579 3300026116 Bacteria 2603
560 Ga0207675_100028244 3300026118 Bacteria 5223
561 Ga0207675_100106606 3300026118 Unclassified 2642
562 Ga0207683_10188949 3300026121 Bacteria 1869
563 Ga0207698_10000040 3300026142 Bacteria 100053
564 Ga0207698_10293941 3300026142 Bacteria 1509
565 Ga0207698_10693122 3300026142 Bacteria 1013
566 Ga0207698_10924680 3300026142 Bacteria 880
567 Ga0207698_11309497 3300026142 Bacteria 739
568 Ga0265354_1009546 3300028016 Bacteria 931
569 Ga0268266_10049803 3300028379 Bacteria 3593
570 Ga0268266_10066550 3300028379 Bacteria 3117
571 Ga0268265_10033781 3300028380 Bacteria 3722
572 Ga0268264_10004509 3300028381 Bacteria 11879
573 Ga0268264_10131628 3300028381 Bacteria 2218
574 Ga0265336_10086843 3300028666 Bacteria 933
575 Ga0265338_10036712 3300028800 Bacteria 4684
576 Ga0265338_10064140 3300028800 Bacteria 3197
577 Ga0265338_10158716 3300028800 Bacteria 1749
578 Ga0265338_10435094 3300028800 Unclassified 930
579 Ga0265762_1115415 3300030760 Unclassified 609
580 Ga0265775_103204 3300030762 Bacteria 878
581 Ga0265765_1017299 3300030879 Bacteria 850
582 Ga0265765_1029077 3300030879 Bacteria 698
583 Ga0265760_10000187 3300031090 Bacteria 16292
584 Ga0265760_10006194 3300031090 Bacteria 3421
585 Ga0265760_10061558 3300031090 Bacteria 1141
586 Ga0265340_10088073 3300031247 Bacteria 1455
587 Ga0265339_10136882 3300031249 Bacteria 1249
588 Ga0265339_10230716 3300031249 Bacteria 902
589 Ga0265339_10346169 3300031249 Unclassified 701
590 Ga0265316_10010452 3300031344 Bacteria 8456
591 Ga0265316_10041556 3300031344 Bacteria 3679
592 Ga0265316_10083170 3300031344 Bacteria 2452
593 Ga0265314_10017548 3300031711 Bacteria 5614
594 Ga0316053_100579 3300032120 Bacteria 1725
595 Ga0316053_110970 3300032120 Unclassified 636
596 Ga0316214_1007707 3300033545 Bacteria 1441
597 Ga0316212_1020040 3300033547 Unclassified 939
598 Ga0373950_0026472 3300034818 Unclassified 1053
599 Ga0373928_0146853 3300035084 Unclassified 650
600 Ga0373929_0080689 3300035085 Bacteria 792
601 Ga0373940_0034564 3300035088 Bacteria 1364
602 Ga0373940_0051096 3300035088 Bacteria 1162
603 Ga0373944_0283063 3300035089 Unclassified 619
604 Ga0373952_0046901 3300035092 Bacteria 1017
605 Ga0373923_0170232 3300035111 Bacteria 997
606 Ga0373936_0036192 3300035113 Bacteria 1967
607 Ga0373941_0140399 3300035115 Bacteria 878
608 Ga0373945_0147347 3300035116 Unclassified 952
609 Ga0373954_0183246 3300035118 Unclassified 1027
610 Ga0373956_0115153 3300035119 Bacteria 1253
611 Ga0373957_0139218 3300035120 Bacteria 991
612 Ga0373943_0008381 3300035170 Bacteria 4638
613 Ga0373943_0203336 3300035170 Bacteria 1097
614 Ga0373946_0218275 3300035171 Bacteria 920
615 Ga0373955_0061711 3300035172 Bacteria 2071
616 Ga0373961_0075587 3300035241 Bacteria 1050
617 Ga0373924_0223758 3300035410 Bacteria 831
618 Ga0373931_0080475 3300035691 Bacteria 1796
619 Ga0373931_0238116 3300035691 Unclassified 1102
620 Ga0373931_0598682 3300035691 Bacteria 720
621 Ga0373935_0004159 3300035692 Bacteria 8472
622 Ga0373927_0040349 3300035695 Bacteria 3028
623 Ga0373927_0208838 3300035695 Unclassified 1282
624 Ga0373927_0485890 3300035695 Unclassified 816
625 Ga0373933_0037915 3300035724 Bacteria 2830
626 Ga0373947_0065887 3300035725 Bacteria 2210
627 Ga0373947_0319790 3300035725 Unclassified 1038
628 Ga0373947_1080707 3300035725 Unclassified 547
629 Ga0373937_0367435 3300036401 Bacteria 1364
630 Ga0373937_0404424 3300036401 Bacteria 1295
631 Ga0373937_1216376 3300036401 Bacteria 702
632 Ga0373925_0018201 3300037068 Bacteria 5103
633 Ga0373925_0034326 3300037068 Bacteria 3739
634 Ga0373925_0104477 3300037068 Bacteria 2181
635 Ga0373925_0873336 3300037068 Unclassified 741
636 Ga0436360_0305246 3300039438 Bacteria 682
637 Ga0436363_0901030 3300039450 Bacteria 1750
638 Ga0436362_1210155 3300039453 Bacteria 811
639 Ga0439448_0036989 3300042005 Bacteria 1567
640 Ga0451577_0000885 3300042876 Bacteria 44482
641 Ga0451577_0120857 3300042876 Bacteria 2346
642 Ga0453683_0001795 3300044673 Bacteria 17751
643 Ga0453683_0028183 3300044673 Bacteria 3557
644 Ga0466964_0065841 3300044706 Bacteria 1519
645 Ga0453684_0007009 3300044712 Bacteria 21065
646 Ga0453684_0474829 3300044712 Bacteria 1388
647 Ga0451576_0047334 3300045051 Bacteria 4522
648 Ga0451576_0336904 3300045051 Bacteria 1579
649 Ga0451576_0490606 3300045051 Bacteria 1290
650 Ga0451576_0806605 3300045051 Bacteria 986
651 Ga0451576_1158824 3300045051 Bacteria 808
652 Ga0495603_0382887 3300046455 Bacteria 806
653 Ga0495590_0092051 3300046457 Bacteria 1073
654 Ga0495590_0112587 3300046457 Bacteria 972
655 Ga0495629_0013831 3300046459 Bacteria 5823
656 Ga0495580_0000007 3300046472 Bacteria 103420
657 Ga0495580_0000600 3300046472 Bacteria 30472
658 Ga0495580_0000831 3300046472 Bacteria 26753
659 Ga0495580_0001059 3300046472 Bacteria 24199
660 Ga0495580_0040984 3300046472 Bacteria 3305
661 Ga0495580_0103100 3300046472 Bacteria 1983
662 Ga0495580_0106965 3300046472 Bacteria 1943
663 Ga0495580_0134143 3300046472 Bacteria 1717
664 Ga0495580_0172639 3300046472 Bacteria 1494
665 Ga0495580_0386901 3300046472 Bacteria 944
666 Ga0495582_0014527 3300046473 Bacteria 4326
667 Ga0495582_0579905 3300046473 Unclassified 649
668 Ga0495605_0258391 3300046474 Bacteria 744
669 Ga0495639_0290405 3300046475 Bacteria 814
670 Ga0495639_0333402 3300046475 Bacteria 760
671 Ga0495664_0278693 3300046477 Unclassified 1010
672 Ga0495594_0118305 3300046499 Bacteria 1497
673 Ga0495594_0285301 3300046499 Bacteria 941
674 Ga0495594_0417039 3300046499 Unclassified 764
675 Ga0495630_0275939 3300046517 Bacteria 1284
676 Ga0495665_0047528 3300046531 Bacteria 2276
677 Ga0495665_0163994 3300046531 Bacteria 1158
678 Ga0495665_0193666 3300046531 Bacteria 1055
679 Ga0495665_0319563 3300046531 Bacteria 793
680 Ga0495587_0369925 3300046536 Bacteria 798
681 Ga0495668_0305192 3300046616 Bacteria 873
682 Ga0495659_0010209 3300046664 Bacteria 3008
683 Ga0495588_0094928 3300046674 Bacteria 1564
684 Ga0495657_0257271 3300046675 Bacteria 1050
685 Ga0495657_0349084 3300046675 Bacteria 876
686 Ga0495657_0528497 3300046675 Unclassified 686
687 Ga0495658_0016509 3300046683 Bacteria 3800
688 Ga0495669_0084006 3300046684 Bacteria 1464
689 Ga0495624_0098992 3300046690 Bacteria 1796
690 Ga0495670_0151067 3300046691 Bacteria 1218
691 Ga0495674_0014419 3300047319 Bacteria 7399
692 Ga0495674_1469901 3300047319 Unclassified 505
693 Ga0495676_0157979 3300047321 Bacteria 1607
694 Ga0495677_0085100 3300047445 Bacteria 1188
695 Ga0495684_0254208 3300047471 Bacteria 1277
696 Ga0495684_0409406 3300047471 Bacteria 950
697 Ga0495684_0468512 3300047471 Unclassified 872
698 Ga0495602_0340473 3300048088 Bacteria 1085
699 Ga0496100_0200559 3300048903 Bacteria 1454
700 Ga0496100_0370951 3300048903 Unclassified 1085
701 Ga0496101_0543670 3300048904 Bacteria 918
702 Ga0496101_1115419 3300048904 Bacteria 619
703 Ga0496101_1136884 3300048904 Unclassified 613
704 Ga0496102_0000730 3300048905 Bacteria 32303
705 Ga0496102_0219202 3300048905 Bacteria 1793
706 Ga0496102_0520438 3300048905 Bacteria 1112
707 Ga0496102_0875147 3300048905 Unclassified 820
708 Ga0496102_1164390 3300048905 Unclassified 690
709 Ga0496102_1380758 3300048905 Unclassified 623
710 Ga0496102_1507227 3300048905 Unclassified 591
711 Ga0496103_0003239 3300048906 Bacteria 9985
712 Ga0496103_0102813 3300048906 Bacteria 1809
713 Ga0496103_0328011 3300048906 Bacteria 984
714 Ga0496104_0100570 3300048907 Bacteria 2768
715 Ga0496104_0179569 3300048907 Unclassified 2027
716 Ga0496104_0968883 3300048907 Unclassified 755
717 Ga0496105_0395219 3300048908 Bacteria 1098
718 Ga0496105_0434234 3300048908 Unclassified 1038
719 Ga0496106_0024052 3300048909 Bacteria 4528
720 Ga0496106_0354737 3300048909 Bacteria 1178
721 Ga0496106_0490117 3300048909 Bacteria 987
722 Ga0496106_1313026 3300048909 Unclassified 561
723 Ga0496107_0174101 3300048910 Bacteria 1597
724 Ga0496107_0518921 3300048910 Bacteria 883
725 Ga0496107_0560905 3300048910 Bacteria 845
726 Ga0496108_0000535 3300048911 Bacteria 29618
727 Ga0496109_0000323 3300048912 Bacteria 44606
728 Ga0496109_0525315 3300048912 Unclassified 1117
729 Ga0496110_0000505 3300048913 Bacteria 26465
730 Ga0496110_0180279 3300048913 Bacteria 1918
731 Ga0496111_0270943 3300048914 Unclassified 1259
732 Ga0496111_0447546 3300048914 Bacteria 953
733 Ga0496112_0013887 3300048915 Bacteria 7450
734 Ga0496112_0028806 3300048915 Bacteria 5364
735 Ga0496112_0066669 3300048915 Bacteria 3552
736 Ga0496112_0153503 3300048915 Bacteria 2270
737 Ga0496112_0237257 3300048915 Bacteria 1777
738 Ga0496112_0621899 3300048915 Bacteria 1011
739 Ga0496112_1031683 3300048915 Bacteria 742
740 Ga0496113_0007627 3300048916 Bacteria 6980
741 Ga0496113_0089709 3300048916 Unclassified 2367
742 Ga0496113_0484113 3300048916 Bacteria 994
743 Ga0496113_0501657 3300048916 Bacteria 974
744 Ga0496114_1259891 3300048917 Bacteria 626
745 Ga0496115_0045617 3300048918 Bacteria 3500
746 Ga0496115_0401926 3300048918 Bacteria 1111
747 Ga0496115_0991718 3300048918 Unclassified 642
748 Ga0495682_0066902 3300049460 Bacteria 1295
749 Ga0501067_0147087 3300049583 Bacteria 1313
750 nmdc:mga08y16_1640348_c1 3300050511 Unclassified 600
751 nmdc:mga0n895_3077_c1 3300050512 Bacteria 13275
752 nmdc:mga0rr50_143419_c1 3300050513 Bacteria 1923
753 nmdc:mga0rr50_244551_c1 3300050513 Bacteria 1488
754 nmdc:mga08x19_410_c1 3300050514 Bacteria 30075
755 nmdc:mga0a205_17360_c1 3300050515 Bacteria 2948
756 Ga0587093_055070 3300059478 Unclassified 637
757 Ga0587073_0072429 3300059492 Bacteria 835
758 Ga0587073_0164074 3300059492 Unclassified 639
759 Ga0587082_102117 3300059504 Unclassified 626
760 Ga0587083_0108716 3300059505 Bacteria 701
761 Ga0587088_102604 3300059508 Unclassified 641
762 Ga0587131_007016 3300059609 Bacteria 742
763 Ga0587128_079909 3300059630 Bacteria 653
764 Ga0587128_156164 3300059630 Unclassified 523
765 Ga0587079_127560 3300059647 Unclassified 636
766 Ga0587114_066070 3300059655 Unclassified 645

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100000963 Ga0070713_1000009635 139
2 3300005439 Ga0070711_100021540 Ga0070711_1000215404 139
3 3300006028 Ga0070717_10013824 Ga0070717_100138244 139
4 3300006028 Ga0070717_11178970 Ga0070717_111789701 139
5 3300006173 Ga0070716_100006011 Ga0070716_1000060115 139
6 3300030879 Ga0265765_1017299 Ga0265765_10172991 139
7 3300005445 Ga0070708_100148576 Ga0070708_1001485763 142
8 3300044706 Ga0466964_0065841 Ga0466964_0065841_870_1337 142
9 3300006028 Ga0070717_10034959 Ga0070717_100349592 143
10 3300025916 Ga0207663_10439460 Ga0207663_104394601 143
11 3300025928 Ga0207700_11816814 Ga0207700_118168141 143
12 3300035116 Ga0373945_0147347 Ga0373945_0147347_387_839 143
13 3300035170 Ga0373943_0203336 Ga0373943_0203336_139_591 143
14 3300037068 Ga0373925_0034326 Ga0373925_0034326_869_1321 143
15 3300005445 Ga0070708_100105612 Ga0070708_1001056122 144
16 3300005468 Ga0070707_100000190 Ga0070707_10000019034 144
17 3300025922 Ga0207646_10000054 Ga0207646_1000005429 144
18 3300042876 Ga0451577_0120857 Ga0451577_0120857_116_553 144
19 3300044673 Ga0453683_0001795 Ga0453683_0001795_16480_16917 144
20 3300044712 Ga0453684_0474829 Ga0453684_0474829_604_1041 144
21 3300045051 Ga0451576_0336904 Ga0451576_0336904_1088_1525 144
22 3300033545 Ga0316214_1007707 Ga0316214_10077072 145
23 3300005718 Ga0068866_10218030 Ga0068866_102180302 146
24 3300014325 Ga0163163_10060479 Ga0163163_100604795 146
25 3300025899 Ga0207642_10065874 Ga0207642_100658743 146
26 3300025922 Ga0207646_10299492 Ga0207646_102994922 146
27 3300028379 Ga0268266_10049803 Ga0268266_100498031 146
28 3300046474 Ga0495605_0258391 Ga0495605_0258391_237_683 146
29 3300046531 Ga0495665_0193666 Ga0495665_0193666_591_1037 146
30 3300046616 Ga0495668_0305192 Ga0495668_0305192_333_779 146
31 3300046674 Ga0495588_0094928 Ga0495588_0094928_439_885 146
32 3300046684 Ga0495669_0084006 Ga0495669_0084006_954_1400 146
33 3300047445 Ga0495677_0085100 Ga0495677_0085100_572_1018 146
34 3300048915 Ga0496112_1031683 Ga0496112_1031683_106_552 146
35 3300049583 Ga0501067_0147087 Ga0501067_0147087_744_1211 146
36 3300001991 JGI24743J22301_10005212 JGI24743J22301_100052122 147
37 3300005290 Ga0065712_10331065 Ga0065712_103310652 147
38 3300005327 Ga0070658_10016195 Ga0070658_100161952 147
39 3300005329 Ga0070683_100000196 Ga0070683_10000019631 147
40 3300005329 Ga0070683_100466363 Ga0070683_1004663631 147
41 3300005331 Ga0070670_100003321 Ga0070670_1000033216 147
42 3300005334 Ga0068869_100001678 Ga0068869_1000016788 147
43 3300005334 Ga0068869_100211941 Ga0068869_1002119412 147
44 3300005335 Ga0070666_10023121 Ga0070666_100231216 147
45 3300005335 Ga0070666_10359023 Ga0070666_103590232 147
46 3300005337 Ga0070682_100007543 Ga0070682_1000075432 147
47 3300005338 Ga0068868_100005839 Ga0068868_1000058393 147
48 3300005338 Ga0068868_100027007 Ga0068868_1000270073 147
49 3300005339 Ga0070660_100068735 Ga0070660_1000687354 147
50 3300005340 Ga0070689_100059915 Ga0070689_1000599152 147
51 3300005341 Ga0070691_10043894 Ga0070691_100438942 147
52 3300005344 Ga0070661_100031791 Ga0070661_1000317912 147
53 3300005344 Ga0070661_100065456 Ga0070661_1000654562 147
54 3300005347 Ga0070668_100161328 Ga0070668_1001613282 147
55 3300005353 Ga0070669_100138701 Ga0070669_1001387012 147
56 3300005354 Ga0070675_100379893 Ga0070675_1003798933 147
57 3300005355 Ga0070671_100057077 Ga0070671_1000570772 147
58 3300005366 Ga0070659_100078269 Ga0070659_1000782694 147
59 3300005367 Ga0070667_100008526 Ga0070667_1000085269 147
60 3300005440 Ga0070705_101002504 Ga0070705_1010025041 147
61 3300005445 Ga0070708_100110753 Ga0070708_1001107533 147
62 3300005455 Ga0070663_100031137 Ga0070663_1000311374 147
63 3300005455 Ga0070663_100279421 Ga0070663_1002794212 147
64 3300005456 Ga0070678_100169228 Ga0070678_1001692282 147
65 3300005457 Ga0070662_100006064 Ga0070662_1000060643 147
66 3300005467 Ga0070706_100001749 Ga0070706_10000174911 147
67 3300005468 Ga0070707_100811028 Ga0070707_1008110281 147
68 3300005471 Ga0070698_101021644 Ga0070698_1010216441 147
69 3300005535 Ga0070684_100000283 Ga0070684_10000028330 147
70 3300005535 Ga0070684_100205317 Ga0070684_1002053172 147
71 3300005535 Ga0070684_100344579 Ga0070684_1003445792 147
72 3300005539 Ga0068853_100000114 Ga0068853_10000011452 147
73 3300005539 Ga0068853_100443228 Ga0068853_1004432281 147
74 3300005545 Ga0070695_100236343 Ga0070695_1002363432 147
75 3300005546 Ga0070696_100303480 Ga0070696_1003034802 147
76 3300005547 Ga0070693_100044548 Ga0070693_1000445482 147
77 3300005548 Ga0070665_100016715 Ga0070665_1000167153 147
78 3300005548 Ga0070665_100119794 Ga0070665_1001197945 147
79 3300005563 Ga0068855_100009737 Ga0068855_10000973711 147
80 3300005563 Ga0068855_100227498 Ga0068855_1002274981 147
81 3300005564 Ga0070664_100124450 Ga0070664_1001244502 147
82 3300005577 Ga0068857_100000606 Ga0068857_10000060610 147
83 3300005577 Ga0068857_100101920 Ga0068857_1001019202 147
84 3300005578 Ga0068854_100166302 Ga0068854_1001663022 147
85 3300005578 Ga0068854_100945747 Ga0068854_1009457471 147
86 3300005614 Ga0068856_100015081 Ga0068856_1000150814 147
87 3300005614 Ga0068856_100018182 Ga0068856_1000181825 147
88 3300005614 Ga0068856_100022679 Ga0068856_1000226796 147
89 3300005616 Ga0068852_100000033 Ga0068852_10000003385 147
90 3300005616 Ga0068852_100441353 Ga0068852_1004413532 147
91 3300005617 Ga0068859_100008570 Ga0068859_10000857011 147
92 3300005617 Ga0068859_100111266 Ga0068859_1001112665 147
93 3300005618 Ga0068864_100000314 Ga0068864_10000031424 147
94 3300005618 Ga0068864_100083299 Ga0068864_1000832992 147
95 3300005719 Ga0068861_101398763 Ga0068861_1013987632 147
96 3300005834 Ga0068851_10001735 Ga0068851_100017354 147
97 3300005834 Ga0068851_10002075 Ga0068851_100020754 147
98 3300005834 Ga0068851_10180128 Ga0068851_101801282 147
99 3300005840 Ga0068870_10029294 Ga0068870_100292944 147
100 3300005841 Ga0068863_100002166 Ga0068863_1000021664 147
101 3300005842 Ga0068858_100001497 Ga0068858_1000014973 147
102 3300005842 Ga0068858_100068682 Ga0068858_1000686822 147
103 3300005843 Ga0068860_100000188 Ga0068860_1000001886 147
104 3300005843 Ga0068860_100080206 Ga0068860_1000802062 147
105 3300005844 Ga0068862_100053000 Ga0068862_1000530002 147
106 3300005844 Ga0068862_100332903 Ga0068862_1003329034 147
107 3300006028 Ga0070717_10065200 Ga0070717_100652002 147
108 3300006237 Ga0097621_100007205 Ga0097621_1000072058 147
109 3300006358 Ga0068871_100004472 Ga0068871_1000044726 147
110 3300006358 Ga0068871_100031432 Ga0068871_1000314321 147
111 3300006881 Ga0068865_100042964 Ga0068865_1000429644 147
112 3300006931 Ga0097620_100008571 Ga0097620_1000085715 147
113 3300006931 Ga0097620_100111255 Ga0097620_1001112555 147
114 3300009093 Ga0105240_10000125 Ga0105240_1000012524 147
115 3300009093 Ga0105240_10015304 Ga0105240_100153047 147
116 3300009093 Ga0105240_10090699 Ga0105240_100906993 147
117 3300009093 Ga0105240_10418606 Ga0105240_104186063 147
118 3300009098 Ga0105245_10009201 Ga0105245_100092013 147
119 3300009098 Ga0105245_11508452 Ga0105245_115084521 147
120 3300009101 Ga0105247_10006936 Ga0105247_100069364 147
121 3300009101 Ga0105247_10044374 Ga0105247_100443743 147
122 3300009174 Ga0105241_10000092 Ga0105241_1000009256 147
123 3300009174 Ga0105241_10003508 Ga0105241_1000350810 147
124 3300009177 Ga0105248_10019275 Ga0105248_100192756 147
125 3300009177 Ga0105248_10024463 Ga0105248_100244638 147
126 3300009545 Ga0105237_10000686 Ga0105237_1000068634 147
127 3300009545 Ga0105237_10015090 Ga0105237_100150909 147
128 3300009545 Ga0105237_10333781 Ga0105237_103337812 147
129 3300009551 Ga0105238_10000083 Ga0105238_1000008314 147
130 3300009551 Ga0105238_10000122 Ga0105238_1000012274 147
131 3300009551 Ga0105238_10185801 Ga0105238_101858012 147
132 3300009553 Ga0105249_10017849 Ga0105249_100178494 147
133 3300009553 Ga0105249_10068506 Ga0105249_100685064 147
134 3300010159 Ga0099796_10384050 Ga0099796_103840501 147
135 3300010375 Ga0105239_10010996 Ga0105239_100109967 147
136 3300010375 Ga0105239_10052045 Ga0105239_100520455 147
137 3300011119 Ga0105246_10003685 Ga0105246_100036859 147
138 3300011119 Ga0105246_10037058 Ga0105246_100370582 147
139 3300013100 Ga0157373_10060655 Ga0157373_100606554 147
140 3300013102 Ga0157371_10038088 Ga0157371_100380884 147
141 3300013105 Ga0157369_10001545 Ga0157369_1000154528 147
142 3300013105 Ga0157369_10031250 Ga0157369_100312503 147
143 3300013105 Ga0157369_10896285 Ga0157369_108962851 147
144 3300013296 Ga0157374_10011719 Ga0157374_100117198 147
145 3300013296 Ga0157374_10034477 Ga0157374_100344775 147
146 3300013296 Ga0157374_10035275 Ga0157374_100352753 147
147 3300013297 Ga0157378_10008928 Ga0157378_1000892810 147
148 3300013306 Ga0163162_10006846 Ga0163162_100068466 147
149 3300013306 Ga0163162_10060056 Ga0163162_100600562 147
150 3300013307 Ga0157372_10114312 Ga0157372_101143124 147
151 3300013307 Ga0157372_10146518 Ga0157372_101465181 147
152 3300013308 Ga0157375_10027050 Ga0157375_100270506 147
153 3300014325 Ga0163163_10000561 Ga0163163_1000056128 147
154 3300014325 Ga0163163_10036133 Ga0163163_100361336 147
155 3300014968 Ga0157379_10001207 Ga0157379_100012076 147
156 3300014968 Ga0157379_10254833 Ga0157379_102548333 147
157 3300014969 Ga0157376_10001660 Ga0157376_100016604 147
158 3300014969 Ga0157376_10516468 Ga0157376_105164682 147
159 3300025321 Ga0207656_10005061 Ga0207656_100050616 147
160 3300025321 Ga0207656_10162827 Ga0207656_101628272 147
161 3300025900 Ga0207710_10001709 Ga0207710_1000170910 147
162 3300025903 Ga0207680_10060671 Ga0207680_100606714 147
163 3300025903 Ga0207680_10088737 Ga0207680_100887371 147
164 3300025904 Ga0207647_10205354 Ga0207647_102053542 147
165 3300025904 Ga0207647_10219273 Ga0207647_102192732 147
166 3300025907 Ga0207645_10027230 Ga0207645_100272305 147
167 3300025909 Ga0207705_10103419 Ga0207705_101034192 147
168 3300025910 Ga0207684_10009632 Ga0207684_1000963211 147
169 3300025910 Ga0207684_10126635 Ga0207684_101266352 147
170 3300025911 Ga0207654_10000858 Ga0207654_1000085814 147
171 3300025911 Ga0207654_10001656 Ga0207654_100016569 147
172 3300025911 Ga0207654_10010963 Ga0207654_100109636 147
173 3300025913 Ga0207695_10000210 Ga0207695_10000210125 147
174 3300025913 Ga0207695_10000338 Ga0207695_1000033814 147
175 3300025913 Ga0207695_10050253 Ga0207695_100502534 147
176 3300025914 Ga0207671_10000068 Ga0207671_1000006825 147
177 3300025914 Ga0207671_10000145 Ga0207671_1000014515 147
178 3300025914 Ga0207671_10045869 Ga0207671_100458692 147
179 3300025915 Ga0207693_10262606 Ga0207693_102626062 147
180 3300025916 Ga0207663_10364544 Ga0207663_103645441 147
181 3300025919 Ga0207657_10000626 Ga0207657_1000062617 147
182 3300025920 Ga0207649_10007611 Ga0207649_100076117 147
183 3300025920 Ga0207649_10026936 Ga0207649_100269364 147
184 3300025923 Ga0207681_10012929 Ga0207681_100129296 147
185 3300025924 Ga0207694_10000043 Ga0207694_1000004328 147
186 3300025924 Ga0207694_10000085 Ga0207694_1000008585 147
187 3300025924 Ga0207694_10050114 Ga0207694_100501143 147
188 3300025925 Ga0207650_10028268 Ga0207650_100282686 147
189 3300025927 Ga0207687_10004706 Ga0207687_100047066 147
190 3300025927 Ga0207687_10006238 Ga0207687_100062385 147
191 3300025931 Ga0207644_10020673 Ga0207644_100206733 147
192 3300025933 Ga0207706_10015203 Ga0207706_100152033 147
193 3300025934 Ga0207686_10019537 Ga0207686_100195371 147
194 3300025935 Ga0207709_10231845 Ga0207709_102318451 147
195 3300025936 Ga0207670_10027036 Ga0207670_100270362 147
196 3300025938 Ga0207704_10116602 Ga0207704_101166022 147
197 3300025941 Ga0207711_10005920 Ga0207711_100059204 147
198 3300025941 Ga0207711_10019631 Ga0207711_100196313 147
199 3300025942 Ga0207689_10001635 Ga0207689_100016354 147
200 3300025944 Ga0207661_10000402 Ga0207661_1000040224 147
201 3300025945 Ga0207679_10037566 Ga0207679_100375662 147
202 3300025949 Ga0207667_10105131 Ga0207667_101051314 147
203 3300025961 Ga0207712_10045296 Ga0207712_100452963 147
204 3300025961 Ga0207712_10076361 Ga0207712_100763613 147
205 3300025981 Ga0207640_10012277 Ga0207640_100122776 147
206 3300025981 Ga0207640_10042944 Ga0207640_100429442 147
207 3300025986 Ga0207658_10002106 Ga0207658_1000210613 147
208 3300025986 Ga0207658_10025548 Ga0207658_100255483 147
209 3300026023 Ga0207677_10000841 Ga0207677_100008419 147
210 3300026023 Ga0207677_10010795 Ga0207677_100107955 147
211 3300026035 Ga0207703_10003037 Ga0207703_100030375 147
212 3300026035 Ga0207703_10760994 Ga0207703_107609941 147
213 3300026041 Ga0207639_10000072 Ga0207639_1000007214 147
214 3300026067 Ga0207678_10008082 Ga0207678_100080822 147
215 3300026067 Ga0207678_10529187 Ga0207678_105291871 147
216 3300026078 Ga0207702_10000205 Ga0207702_1000020563 147
217 3300026078 Ga0207702_10021287 Ga0207702_100212873 147
218 3300026078 Ga0207702_10177590 Ga0207702_101775901 147
219 3300026078 Ga0207702_10437554 Ga0207702_104375543 147
220 3300026088 Ga0207641_10006446 Ga0207641_100064464 147
221 3300026088 Ga0207641_10453364 Ga0207641_104533642 147
222 3300026095 Ga0207676_10005980 Ga0207676_100059805 147
223 3300026095 Ga0207676_10122425 Ga0207676_101224253 147
224 3300026116 Ga0207674_10000239 Ga0207674_1000023921 147
225 3300026116 Ga0207674_10026228 Ga0207674_100262284 147
226 3300026116 Ga0207674_10119579 Ga0207674_101195792 147
227 3300026118 Ga0207675_100106606 Ga0207675_1001066064 147
228 3300026121 Ga0207683_10188949 Ga0207683_101889492 147
229 3300026142 Ga0207698_10000040 Ga0207698_1000004090 147
230 3300026142 Ga0207698_10293941 Ga0207698_102939414 147
231 3300028379 Ga0268266_10066550 Ga0268266_100665503 147
232 3300028380 Ga0268265_10033781 Ga0268265_100337812 147
233 3300028381 Ga0268264_10004509 Ga0268264_1000450910 147
234 3300028381 Ga0268264_10131628 Ga0268264_101316283 147
235 3300034818 Ga0373950_0026472 Ga0373950_0026472_141_629 147
236 3300035084 Ga0373928_0146853 Ga0373928_0146853_13_501 147
237 3300035088 Ga0373940_0034564 Ga0373940_0034564_244_732 147
238 3300035092 Ga0373952_0046901 Ga0373952_0046901_324_812 147
239 3300035111 Ga0373923_0170232 Ga0373923_0170232_23_484 147
240 3300035115 Ga0373941_0140399 Ga0373941_0140399_254_742 147
241 3300035691 Ga0373931_0080475 Ga0373931_0080475_1029_1517 147
242 3300035695 Ga0373927_0040349 Ga0373927_0040349_780_1241 147
243 3300046472 Ga0495580_0000831 Ga0495580_0000831_22636_23097 147
244 3300046473 Ga0495582_0579905 Ga0495582_0579905_167_628 147
245 3300046531 Ga0495665_0047528 Ga0495665_0047528_998_1459 147
246 3300046536 Ga0495587_0369925 Ga0495587_0369925_326_775 147
247 3300047471 Ga0495684_0468512 Ga0495684_0468512_35_496 147
248 3300048904 Ga0496101_0543670 Ga0496101_0543670_55_543 147
249 3300048905 Ga0496102_0219202 Ga0496102_0219202_270_758 147
250 3300048905 Ga0496102_0520438 Ga0496102_0520438_498_944 147
251 3300048906 Ga0496103_0328011 Ga0496103_0328011_25_513 147
252 3300048907 Ga0496104_0100570 Ga0496104_0100570_1026_1484 147
253 3300048915 Ga0496112_0066669 Ga0496112_0066669_823_1311 147
254 3300048916 Ga0496113_0089709 Ga0496113_0089709_1717_2205 147
255 3300049460 Ga0495682_0066902 Ga0495682_0066902_816_1265 147
256 3300059609 Ga0587131_007016 Ga0587131_007016_175_624 147
257 3300005329 Ga0070683_100466601 Ga0070683_1004666012 148
258 3300005445 Ga0070708_100004714 Ga0070708_1000047143 148
259 3300005467 Ga0070706_100003331 Ga0070706_1000033313 148
260 3300005468 Ga0070707_100001198 Ga0070707_10000119810 148
261 3300005468 Ga0070707_100097105 Ga0070707_1000971051 148
262 3300005518 Ga0070699_100002192 Ga0070699_1000021923 148
263 3300005535 Ga0070684_100009031 Ga0070684_1000090316 148
264 3300005536 Ga0070697_100000788 Ga0070697_10000078818 148
265 3300005563 Ga0068855_100263463 Ga0068855_1002634632 148
266 3300006028 Ga0070717_10055315 Ga0070717_100553153 148
267 3300013105 Ga0157369_10138797 Ga0157369_101387972 148
268 3300013307 Ga0157372_10373396 Ga0157372_103733962 148
269 3300020069 Ga0197907_11139742 Ga0197907_111397421 148
270 3300020070 Ga0206356_11441786 Ga0206356_114417862 148
271 3300020075 Ga0206349_1377318 Ga0206349_13773181 148
272 3300020078 Ga0206352_10685474 Ga0206352_106854741 148
273 3300020081 Ga0206354_11661069 Ga0206354_116610691 148
274 3300022467 Ga0224712_10009934 Ga0224712_100099341 148
275 3300025910 Ga0207684_10000921 Ga0207684_1000092120 148
276 3300025922 Ga0207646_10001731 Ga0207646_1000173119 148
277 3300025922 Ga0207646_10054314 Ga0207646_100543145 148
278 3300025944 Ga0207661_10054639 Ga0207661_100546394 148
279 3300025949 Ga0207667_10593589 Ga0207667_105935892 148
280 3300026142 Ga0207698_10693122 Ga0207698_106931221 148
281 3300005329 Ga0070683_100116685 Ga0070683_1001166852 149
282 3300005336 Ga0070680_100029534 Ga0070680_1000295345 149
283 3300005338 Ga0068868_100015053 Ga0068868_1000150532 149
284 3300005343 Ga0070687_100107280 Ga0070687_1001072802 149
285 3300005436 Ga0070713_100117567 Ga0070713_1001175671 149
286 3300005439 Ga0070711_100113607 Ga0070711_1001136074 149
287 3300005441 Ga0070700_100431182 Ga0070700_1004311822 149
288 3300005457 Ga0070662_100496795 Ga0070662_1004967952 149
289 3300005458 Ga0070681_10029426 Ga0070681_100294262 149
290 3300005530 Ga0070679_100163782 Ga0070679_1001637825 149
291 3300005546 Ga0070696_100018327 Ga0070696_1000183273 149
292 3300005563 Ga0068855_100720602 Ga0068855_1007206022 149
293 3300005617 Ga0068859_100003073 Ga0068859_10000307310 149
294 3300005719 Ga0068861_100034276 Ga0068861_1000342765 149
295 3300006931 Ga0097620_100003073 Ga0097620_10000307310 149
296 3300009093 Ga0105240_10001204 Ga0105240_1000120421 149
297 3300009093 Ga0105240_10150805 Ga0105240_101508054 149
298 3300009174 Ga0105241_10000043 Ga0105241_1000004343 149
299 3300009174 Ga0105241_10847957 Ga0105241_108479571 149
300 3300009174 Ga0105241_10960837 Ga0105241_109608372 149
301 3300009174 Ga0105241_10989076 Ga0105241_109890761 149
302 3300009176 Ga0105242_10383727 Ga0105242_103837272 149
303 3300009545 Ga0105237_10016050 Ga0105237_100160506 149
304 3300013100 Ga0157373_10225185 Ga0157373_102251852 149
305 3300013105 Ga0157369_10003066 Ga0157369_1000306617 149
306 3300013296 Ga0157374_10033040 Ga0157374_100330405 149
307 3300013306 Ga0163162_10113732 Ga0163162_101137324 149
308 3300013307 Ga0157372_11006271 Ga0157372_110062711 149
309 3300013308 Ga0157375_11350087 Ga0157375_113500872 149
310 3300014968 Ga0157379_10112678 Ga0157379_101126782 149
311 3300014968 Ga0157379_10275784 Ga0157379_102757842 149
312 3300019190 Ga0184600_131136 Ga0184600_1311364 149
313 3300019192 Ga0184603_152930 Ga0184603_1529301 149
314 3300020069 Ga0197907_10226117 Ga0197907_102261173 149
315 3300020077 Ga0206351_10177850 Ga0206351_101778502 149
316 3300020081 Ga0206354_10122061 Ga0206354_101220613 149
317 3300020610 Ga0154015_1019090 Ga0154015_10190902 149
318 3300022467 Ga0224712_10107193 Ga0224712_101071931 149
319 3300023672 Ga0247553_102601 Ga0247553_1026012 149
320 3300025904 Ga0207647_10003391 Ga0207647_100033917 149
321 3300025911 Ga0207654_10000019 Ga0207654_1000001962 149
322 3300025912 Ga0207707_10320182 Ga0207707_103201822 149
323 3300025913 Ga0207695_10070920 Ga0207695_100709204 149
324 3300025913 Ga0207695_10358830 Ga0207695_103588301 149
325 3300025917 Ga0207660_10129081 Ga0207660_101290812 149
326 3300025918 Ga0207662_10708799 Ga0207662_107087992 149
327 3300025921 Ga0207652_10150233 Ga0207652_101502334 149
328 3300025928 Ga0207700_10083686 Ga0207700_100836861 149
329 3300025942 Ga0207689_10000875 Ga0207689_100008759 149
330 3300025949 Ga0207667_10755070 Ga0207667_107550702 149
331 3300026035 Ga0207703_10006325 Ga0207703_100063259 149
332 3300026078 Ga0207702_10307358 Ga0207702_103073581 149
333 3300026142 Ga0207698_10924680 Ga0207698_109246802 149
334 3300032120 Ga0316053_100579 Ga0316053_1005791 149
335 3300032120 Ga0316053_110970 Ga0316053_1109702 149
336 3300042005 Ga0439448_0036989 Ga0439448_0036989_526_981 149
337 3300042876 Ga0451577_0000885 Ga0451577_0000885_21396_21869 149
338 3300044673 Ga0453683_0028183 Ga0453683_0028183_2495_2968 149
339 3300044712 Ga0453684_0007009 Ga0453684_0007009_9334_9807 149
340 3300045051 Ga0451576_0490606 Ga0451576_0490606_64_537 149
341 3300046472 Ga0495580_0386901 Ga0495580_0386901_152_613 149
342 3300046691 Ga0495670_0151067 Ga0495670_0151067_347_802 149
343 3300048905 Ga0496102_1164390 Ga0496102_1164390_71_526 149
344 3300048913 Ga0496110_0180279 Ga0496110_0180279_1312_1767 149
345 3300048914 Ga0496111_0447546 Ga0496111_0447546_483_938 149
346 3300048915 Ga0496112_0013887 Ga0496112_0013887_5867_6322 149
347 3300048916 Ga0496113_0484113 Ga0496113_0484113_364_819 149
348 3300048917 Ga0496114_1259891 Ga0496114_1259891_116_571 149
349 3300059492 Ga0587073_0072429 Ga0587073_0072429_186_641 149
350 3300059630 Ga0587128_079909 Ga0587128_079909_174_629 149
351 3300059630 Ga0587128_156164 Ga0587128_156164_26_481 149
352 3300005434 Ga0070709_10707984 Ga0070709_107079842 150
353 3300005436 Ga0070713_101975275 Ga0070713_1019752751 150
354 3300005439 Ga0070711_100218828 Ga0070711_1002188282 150
355 3300005445 Ga0070708_100062325 Ga0070708_1000623251 150
356 3300005468 Ga0070707_100557603 Ga0070707_1005576032 150
357 3300005518 Ga0070699_100209499 Ga0070699_1002094992 150
358 3300005536 Ga0070697_100745019 Ga0070697_1007450191 150
359 3300006173 Ga0070716_100080931 Ga0070716_1000809311 150
360 3300006175 Ga0070712_100085022 Ga0070712_1000850221 150
361 3300006914 Ga0075436_100321304 Ga0075436_1003213042 150
362 3300007076 Ga0075435_100488547 Ga0075435_1004885472 150
363 3300010159 Ga0099796_10236698 Ga0099796_102366982 150
364 3300014325 Ga0163163_10507836 Ga0163163_105078362 150
365 3300025906 Ga0207699_10251978 Ga0207699_102519782 150
366 3300025922 Ga0207646_10573364 Ga0207646_105733642 150
367 3300028800 Ga0265338_10158716 Ga0265338_101587162 150
368 3300031249 Ga0265339_10136882 Ga0265339_101368821 150
369 3300046457 Ga0495590_0092051 Ga0495590_0092051_90_542 150
370 3300046499 Ga0495594_0285301 Ga0495594_0285301_308_781 150
371 3300048908 Ga0496105_0395219 Ga0496105_0395219_479_934 150
372 3300048918 Ga0496115_0401926 Ga0496115_0401926_477_932 150
373 3300050513 nmdc:mga0rr50_244551_c1 nmdc:mga0rr50_244551_c1_727_1182 150
374 3300005334 Ga0068869_101907783 Ga0068869_1019077831 151
375 3300005336 Ga0070680_100164168 Ga0070680_1001641682 151
376 3300005338 Ga0068868_100727948 Ga0068868_1007279481 151
377 3300005435 Ga0070714_100046420 Ga0070714_1000464203 151
378 3300005435 Ga0070714_100176057 Ga0070714_1001760573 151
379 3300005436 Ga0070713_100795000 Ga0070713_1007950002 151
380 3300005437 Ga0070710_10038230 Ga0070710_100382302 151
381 3300005445 Ga0070708_100194568 Ga0070708_1001945684 151
382 3300005445 Ga0070708_100216366 Ga0070708_1002163663 151
383 3300005445 Ga0070708_101517715 Ga0070708_1015177151 151
384 3300005458 Ga0070681_10009378 Ga0070681_100093789 151
385 3300005458 Ga0070681_10154389 Ga0070681_101543893 151
386 3300005467 Ga0070706_100022304 Ga0070706_1000223047 151
387 3300005467 Ga0070706_100276189 Ga0070706_1002761892 151
388 3300005468 Ga0070707_100017806 Ga0070707_1000178062 151
389 3300005468 Ga0070707_100420646 Ga0070707_1004206462 151
390 3300005468 Ga0070707_100505114 Ga0070707_1005051141 151
391 3300005468 Ga0070707_101074296 Ga0070707_1010742961 151
392 3300005518 Ga0070699_100018990 Ga0070699_1000189902 151
393 3300005518 Ga0070699_100066639 Ga0070699_1000666394 151
394 3300005518 Ga0070699_101344499 Ga0070699_1013444991 151
395 3300005536 Ga0070697_100253439 Ga0070697_1002534392 151
396 3300005545 Ga0070695_100125117 Ga0070695_1001251172 151
397 3300005841 Ga0068863_101265543 Ga0068863_1012655431 151
398 3300006028 Ga0070717_10015404 Ga0070717_100154043 151
399 3300006028 Ga0070717_10585773 Ga0070717_105857732 151
400 3300006163 Ga0070715_10039516 Ga0070715_100395165 151
401 3300006173 Ga0070716_100177412 Ga0070716_1001774122 151
402 3300006173 Ga0070716_100265942 Ga0070716_1002659422 151
403 3300006173 Ga0070716_101147424 Ga0070716_1011474241 151
404 3300006175 Ga0070712_100007747 Ga0070712_1000077476 151
405 3300006914 Ga0075436_100035905 Ga0075436_1000359052 151
406 3300009177 Ga0105248_10537835 Ga0105248_105378352 151
407 3300009551 Ga0105238_10878342 Ga0105238_108783422 151
408 3300012502 Ga0157347_1047219 Ga0157347_10472192 151
409 3300013296 Ga0157374_10492431 Ga0157374_104924312 151
410 3300013297 Ga0157378_10568063 Ga0157378_105680631 151
411 3300014969 Ga0157376_10353171 Ga0157376_103531712 151
412 3300025898 Ga0207692_10251918 Ga0207692_102519182 151
413 3300025905 Ga0207685_10030785 Ga0207685_100307852 151
414 3300025906 Ga0207699_10217291 Ga0207699_102172912 151
415 3300025906 Ga0207699_10512924 Ga0207699_105129241 151
416 3300025910 Ga0207684_10116062 Ga0207684_101160622 151
417 3300025910 Ga0207684_10773107 Ga0207684_107731071 151
418 3300025912 Ga0207707_10115018 Ga0207707_101150182 151
419 3300025915 Ga0207693_10001531 Ga0207693_1000153117 151
420 3300025917 Ga0207660_10222738 Ga0207660_102227382 151
421 3300025922 Ga0207646_10091800 Ga0207646_100918002 151
422 3300025922 Ga0207646_11786158 Ga0207646_117861581 151
423 3300025928 Ga0207700_10122573 Ga0207700_101225732 151
424 3300025928 Ga0207700_10846102 Ga0207700_108461021 151
425 3300025929 Ga0207664_10030871 Ga0207664_100308713 151
426 3300025929 Ga0207664_10239080 Ga0207664_102390802 151
427 3300025939 Ga0207665_10102811 Ga0207665_101028113 151
428 3300025939 Ga0207665_10602848 Ga0207665_106028481 151
429 3300026088 Ga0207641_10809933 Ga0207641_108099332 151
430 3300028666 Ga0265336_10086843 Ga0265336_100868432 151
431 3300028800 Ga0265338_10036712 Ga0265338_100367124 151
432 3300028800 Ga0265338_10064140 Ga0265338_100641403 151
433 3300028800 Ga0265338_10435094 Ga0265338_104350942 151
434 3300030760 Ga0265762_1115415 Ga0265762_11154151 151
435 3300030762 Ga0265775_103204 Ga0265775_1032042 151
436 3300030879 Ga0265765_1029077 Ga0265765_10290771 151
437 3300031090 Ga0265760_10006194 Ga0265760_100061944 151
438 3300031247 Ga0265340_10088073 Ga0265340_100880731 151
439 3300031249 Ga0265339_10230716 Ga0265339_102307161 151
440 3300031249 Ga0265339_10346169 Ga0265339_103461691 151
441 3300031344 Ga0265316_10010452 Ga0265316_100104521 151
442 3300031344 Ga0265316_10041556 Ga0265316_100415563 151
443 3300031711 Ga0265314_10017548 Ga0265314_100175481 151
444 3300033547 Ga0316212_1020040 Ga0316212_10200402 151
445 3300035113 Ga0373936_0036192 Ga0373936_0036192_616_1101 151
446 3300035118 Ga0373954_0183246 Ga0373954_0183246_447_926 151
447 3300035119 Ga0373956_0115153 Ga0373956_0115153_342_800 151
448 3300035120 Ga0373957_0139218 Ga0373957_0139218_19_477 151
449 3300035170 Ga0373943_0008381 Ga0373943_0008381_110_568 151
450 3300035171 Ga0373946_0218275 Ga0373946_0218275_162_647 151
451 3300035172 Ga0373955_0061711 Ga0373955_0061711_323_781 151
452 3300035410 Ga0373924_0223758 Ga0373924_0223758_228_713 151
453 3300035692 Ga0373935_0004159 Ga0373935_0004159_6667_7152 151
454 3300035695 Ga0373927_0208838 Ga0373927_0208838_794_1270 151
455 3300035724 Ga0373933_0037915 Ga0373933_0037915_1259_1717 151
456 3300035725 Ga0373947_0065887 Ga0373947_0065887_835_1293 151
457 3300035725 Ga0373947_0319790 Ga0373947_0319790_485_970 151
458 3300035725 Ga0373947_1080707 Ga0373947_1080707_32_511 151
459 3300036401 Ga0373937_0367435 Ga0373937_0367435_228_707 151
460 3300036401 Ga0373937_0404424 Ga0373937_0404424_606_1064 151
461 3300036401 Ga0373937_1216376 Ga0373937_1216376_168_689 151
462 3300037068 Ga0373925_0018201 Ga0373925_0018201_4494_4979 151
463 3300037068 Ga0373925_0104477 Ga0373925_0104477_905_1363 151
464 3300037068 Ga0373925_0873336 Ga0373925_0873336_167_649 151
465 3300039438 Ga0436360_0305246 Ga0436360_0305246_173_631 151
466 3300045051 Ga0451576_0047334 Ga0451576_0047334_562_1041 151
467 3300046459 Ga0495629_0013831 Ga0495629_0013831_80_538 151
468 3300046472 Ga0495580_0000007 Ga0495580_0000007_11778_12236 151
469 3300046472 Ga0495580_0040984 Ga0495580_0040984_2309_2785 151
470 3300046472 Ga0495580_0134143 Ga0495580_0134143_1119_1577 151
471 3300046472 Ga0495580_0172639 Ga0495580_0172639_421_897 151
472 3300046473 Ga0495582_0014527 Ga0495582_0014527_2480_2938 151
473 3300046475 Ga0495639_0290405 Ga0495639_0290405_133_591 151
474 3300046475 Ga0495639_0333402 Ga0495639_0333402_164_643 151
475 3300046477 Ga0495664_0278693 Ga0495664_0278693_364_849 151
476 3300046499 Ga0495594_0417039 Ga0495594_0417039_126_584 151
477 3300046517 Ga0495630_0275939 Ga0495630_0275939_762_1259 151
478 3300046531 Ga0495665_0163994 Ga0495665_0163994_485_943 151
479 3300046531 Ga0495665_0319563 Ga0495665_0319563_83_562 151
480 3300046675 Ga0495657_0257271 Ga0495657_0257271_210_677 151
481 3300046675 Ga0495657_0528497 Ga0495657_0528497_183_668 151
482 3300046683 Ga0495658_0016509 Ga0495658_0016509_1616_2074 151
483 3300046690 Ga0495624_0098992 Ga0495624_0098992_421_906 151
484 3300047319 Ga0495674_0014419 Ga0495674_0014419_1412_1897 151
485 3300047319 Ga0495674_1469901 Ga0495674_1469901_15_473 151
486 3300047321 Ga0495676_0157979 Ga0495676_0157979_790_1248 151
487 3300047471 Ga0495684_0254208 Ga0495684_0254208_662_1138 151
488 3300047471 Ga0495684_0409406 Ga0495684_0409406_175_672 151
489 3300048904 Ga0496101_1115419 Ga0496101_1115419_28_495 151
490 3300048904 Ga0496101_1136884 Ga0496101_1136884_103_561 151
491 3300048905 Ga0496102_0875147 Ga0496102_0875147_160_618 151
492 3300048909 Ga0496106_1313026 Ga0496106_1313026_66_533 151
493 3300048915 Ga0496112_0153503 Ga0496112_0153503_209_676 151
494 3300048915 Ga0496112_0237257 Ga0496112_0237257_467_925 151
495 3300048916 Ga0496113_0501657 Ga0496113_0501657_114_581 151
496 3300048918 Ga0496115_0991718 Ga0496115_0991718_158_616 151
497 3300050514 nmdc:mga08x19_410_c1 nmdc:mga08x19_410_c1_14327_14803 151
498 3300059478 Ga0587093_055070 Ga0587093_055070_136_594 151
499 3300059492 Ga0587073_0164074 Ga0587073_0164074_139_597 151
500 3300059504 Ga0587082_102117 Ga0587082_102117_35_493 151
501 3300059505 Ga0587083_0108716 Ga0587083_0108716_35_493 151
502 3300059508 Ga0587088_102604 Ga0587088_102604_45_503 151
503 3300059647 Ga0587079_127560 Ga0587079_127560_45_503 151
504 3300059655 Ga0587114_066070 Ga0587114_066070_43_501 151
505 2162886011 MRS1b_contig_9210921 MRS1b_0584.00002870 152
506 2162886012 MBSR1b_contig_694782 MBSR1b_0859.00000310 152
507 3300001978 JGI24747J21853_1014241 JGI24747J21853_10142412 152
508 3300001990 JGI24737J22298_10012413 JGI24737J22298_100124132 152
509 3300001991 JGI24743J22301_10010652 JGI24743J22301_100106524 152
510 3300002074 JGI24748J21848_1022567 JGI24748J21848_10225671 152
511 3300002075 JGI24738J21930_10114464 JGI24738J21930_101144641 152
512 3300002239 JGI24034J26672_10001329 JGI24034J26672_100013292 152
513 3300002459 JGI24751J29686_10004437 JGI24751J29686_100044371 152
514 3300004798 Ga0058859_10968610 Ga0058859_109686101 152
515 3300004801 Ga0058860_12078993 Ga0058860_120789931 152
516 3300005293 Ga0065715_10092929 Ga0065715_100929293 152
517 3300005295 Ga0065707_10415556 Ga0065707_104155561 152
518 3300005327 Ga0070658_10071817 Ga0070658_100718174 152
519 3300005328 Ga0070676_10001847 Ga0070676_1000184710 152
520 3300005329 Ga0070683_100024245 Ga0070683_1000242453 152
521 3300005330 Ga0070690_100038269 Ga0070690_1000382691 152
522 3300005331 Ga0070670_100049803 Ga0070670_1000498031 152
523 3300005331 Ga0070670_100120291 Ga0070670_1001202913 152
524 3300005333 Ga0070677_10008557 Ga0070677_100085575 152
525 3300005334 Ga0068869_100010000 Ga0068869_1000100004 152
526 3300005334 Ga0068869_100101958 Ga0068869_1001019585 152
527 3300005337 Ga0070682_100005289 Ga0070682_1000052895 152
528 3300005338 Ga0068868_100014727 Ga0068868_1000147276 152
529 3300005338 Ga0068868_100023318 Ga0068868_1000233185 152
530 3300005339 Ga0070660_100175999 Ga0070660_1001759992 152
531 3300005340 Ga0070689_100001280 Ga0070689_1000012801 152
532 3300005343 Ga0070687_100010778 Ga0070687_1000107785 152
533 3300005347 Ga0070668_100005427 Ga0070668_1000054276 152
534 3300005353 Ga0070669_100021333 Ga0070669_1000213334 152
535 3300005354 Ga0070675_100024552 Ga0070675_1000245525 152
536 3300005356 Ga0070674_100046828 Ga0070674_1000468281 152
537 3300005365 Ga0070688_100006261 Ga0070688_1000062616 152
538 3300005366 Ga0070659_100031541 Ga0070659_1000315415 152
539 3300005434 Ga0070709_10450371 Ga0070709_104503711 152
540 3300005435 Ga0070714_100069238 Ga0070714_1000692382 152
541 3300005436 Ga0070713_100052988 Ga0070713_1000529884 152
542 3300005436 Ga0070713_100239766 Ga0070713_1002397661 152
543 3300005436 Ga0070713_100332520 Ga0070713_1003325202 152
544 3300005437 Ga0070710_10143056 Ga0070710_101430562 152
545 3300005439 Ga0070711_100001492 Ga0070711_1000014929 152
546 3300005440 Ga0070705_100489575 Ga0070705_1004895752 152
547 3300005440 Ga0070705_100992322 Ga0070705_1009923221 152
548 3300005441 Ga0070700_100036844 Ga0070700_1000368443 152
549 3300005445 Ga0070708_100000677 Ga0070708_10000067712 152
550 3300005445 Ga0070708_100015510 Ga0070708_1000155105 152
551 3300005445 Ga0070708_100336434 Ga0070708_1003364342 152
552 3300005445 Ga0070708_100347487 Ga0070708_1003474872 152
553 3300005455 Ga0070663_100016752 Ga0070663_1000167523 152
554 3300005455 Ga0070663_100124491 Ga0070663_1001244911 152
555 3300005457 Ga0070662_100025048 Ga0070662_1000250485 152
556 3300005459 Ga0068867_100006756 Ga0068867_1000067566 152
557 3300005466 Ga0070685_10006837 Ga0070685_100068376 152
558 3300005467 Ga0070706_100000734 Ga0070706_10000073415 152
559 3300005467 Ga0070706_100020469 Ga0070706_1000204699 152
560 3300005467 Ga0070706_100513905 Ga0070706_1005139052 152
561 3300005468 Ga0070707_100000413 Ga0070707_10000041329 152
562 3300005468 Ga0070707_100636979 Ga0070707_1006369792 152
563 3300005471 Ga0070698_100000248 Ga0070698_10000024835 152
564 3300005518 Ga0070699_100007279 Ga0070699_1000072797 152
565 3300005518 Ga0070699_100052286 Ga0070699_1000522862 152
566 3300005530 Ga0070679_100261993 Ga0070679_1002619932 152
567 3300005535 Ga0070684_100008624 Ga0070684_1000086245 152
568 3300005536 Ga0070697_100002694 Ga0070697_1000026942 152
569 3300005536 Ga0070697_100009349 Ga0070697_1000093495 152
570 3300005536 Ga0070697_100010875 Ga0070697_1000108753 152
571 3300005536 Ga0070697_100162364 Ga0070697_1001623643 152
572 3300005536 Ga0070697_100452400 Ga0070697_1004524001 152
573 3300005536 Ga0070697_100659715 Ga0070697_1006597151 152
574 3300005536 Ga0070697_101043174 Ga0070697_1010431741 152
575 3300005539 Ga0068853_100041831 Ga0068853_1000418315 152
576 3300005544 Ga0070686_100003572 Ga0070686_1000035723 152
577 3300005545 Ga0070695_100026303 Ga0070695_1000263033 152
578 3300005547 Ga0070693_100105636 Ga0070693_1001056361 152
579 3300005549 Ga0070704_101055272 Ga0070704_1010552721 152
580 3300005563 Ga0068855_100065756 Ga0068855_1000657564 152
581 3300005577 Ga0068857_100021825 Ga0068857_1000218256 152
582 3300005578 Ga0068854_100008827 Ga0068854_1000088276 152
583 3300005578 Ga0068854_100010438 Ga0068854_1000104385 152
584 3300005615 Ga0070702_100006489 Ga0070702_1000064892 152
585 3300005616 Ga0068852_100185987 Ga0068852_1001859875 152
586 3300005618 Ga0068864_100080131 Ga0068864_1000801314 152
587 3300005618 Ga0068864_100105923 Ga0068864_1001059232 152
588 3300005719 Ga0068861_100013927 Ga0068861_1000139274 152
589 3300005834 Ga0068851_10200490 Ga0068851_102004902 152
590 3300005840 Ga0068870_10493820 Ga0068870_104938201 152
591 3300005841 Ga0068863_100643646 Ga0068863_1006436462 152
592 3300005841 Ga0068863_100709064 Ga0068863_1007090642 152
593 3300005841 Ga0068863_101335669 Ga0068863_1013356691 152
594 3300005844 Ga0068862_100029083 Ga0068862_1000290836 152
595 3300006028 Ga0070717_10001554 Ga0070717_1000155412 152
596 3300006028 Ga0070717_10319744 Ga0070717_103197441 152
597 3300006028 Ga0070717_10486749 Ga0070717_104867492 152
598 3300006173 Ga0070716_100000362 Ga0070716_1000003623 152
599 3300006173 Ga0070716_100607214 Ga0070716_1006072142 152
600 3300006175 Ga0070712_100004680 Ga0070712_10000468010 152
601 3300006175 Ga0070712_100012554 Ga0070712_1000125546 152
602 3300006175 Ga0070712_100024155 Ga0070712_1000241555 152
603 3300006175 Ga0070712_101010320 Ga0070712_1010103202 152
604 3300006175 Ga0070712_101358284 Ga0070712_1013582841 152
605 3300006237 Ga0097621_100607160 Ga0097621_1006071602 152
606 3300006358 Ga0068871_100211589 Ga0068871_1002115894 152
607 3300006852 Ga0075433_10079886 Ga0075433_100798863 152
608 3300006852 Ga0075433_10608442 Ga0075433_106084422 152
609 3300006871 Ga0075434_100001530 Ga0075434_10000153020 152
610 3300006871 Ga0075434_100814031 Ga0075434_1008140312 152
611 3300006881 Ga0068865_100591690 Ga0068865_1005916902 152
612 3300007076 Ga0075435_100015879 Ga0075435_1000158799 152
613 3300009092 Ga0105250_10022999 Ga0105250_100229992 152
614 3300009092 Ga0105250_10185610 Ga0105250_101856101 152
615 3300009094 Ga0111539_12493572 Ga0111539_124935722 152
616 3300009098 Ga0105245_10008707 Ga0105245_100087078 152
617 3300009098 Ga0105245_10171158 Ga0105245_101711582 152
618 3300009101 Ga0105247_10014624 Ga0105247_100146245 152
619 3300009101 Ga0105247_10159623 Ga0105247_101596232 152
620 3300009148 Ga0105243_10183153 Ga0105243_101831532 152
621 3300009174 Ga0105241_10003987 Ga0105241_1000398711 152
622 3300009174 Ga0105241_10021431 Ga0105241_100214315 152
623 3300009176 Ga0105242_10074687 Ga0105242_100746874 152
624 3300009176 Ga0105242_10417110 Ga0105242_104171102 152
625 3300009177 Ga0105248_10159820 Ga0105248_101598201 152
626 3300009177 Ga0105248_10350970 Ga0105248_103509702 152
627 3300009545 Ga0105237_10095169 Ga0105237_100951692 152
628 3300009545 Ga0105237_10488230 Ga0105237_104882302 152
629 3300009551 Ga0105238_10824498 Ga0105238_108244982 152
630 3300009553 Ga0105249_10016825 Ga0105249_100168255 152
631 3300009553 Ga0105249_10288689 Ga0105249_102886893 152
632 3300010375 Ga0105239_10051532 Ga0105239_100515322 152
633 3300010375 Ga0105239_11718490 Ga0105239_117184901 152
634 3300011119 Ga0105246_10000284 Ga0105246_1000028423 152
635 3300013100 Ga0157373_10004151 Ga0157373_100041516 152
636 3300013102 Ga0157371_10005578 Ga0157371_100055786 152
637 3300013105 Ga0157369_10019098 Ga0157369_100190985 152
638 3300013297 Ga0157378_10044780 Ga0157378_100447801 152
639 3300013297 Ga0157378_10056338 Ga0157378_100563384 152
640 3300013297 Ga0157378_10487820 Ga0157378_104878202 152
641 3300013306 Ga0163162_10015578 Ga0163162_100155786 152
642 3300013306 Ga0163162_11269317 Ga0163162_112693171 152
643 3300013307 Ga0157372_10018391 Ga0157372_100183914 152
644 3300013308 Ga0157375_10051079 Ga0157375_100510794 152
645 3300014325 Ga0163163_10002188 Ga0163163_1000218816 152
646 3300014325 Ga0163163_10355254 Ga0163163_103552542 152
647 3300014326 Ga0157380_11337243 Ga0157380_113372432 152
648 3300014497 Ga0182008_10009202 Ga0182008_100092023 152
649 3300014745 Ga0157377_10003729 Ga0157377_100037295 152
650 3300014968 Ga0157379_10019539 Ga0157379_100195398 152
651 3300014968 Ga0157379_10074088 Ga0157379_100740883 152
652 3300014969 Ga0157376_10009673 Ga0157376_100096735 152
653 3300017792 Ga0163161_10010741 Ga0163161_100107416 152
654 3300025315 Ga0207697_10005610 Ga0207697_100056105 152
655 3300025321 Ga0207656_10021437 Ga0207656_100214372 152
656 3300025893 Ga0207682_10035732 Ga0207682_100357321 152
657 3300025898 Ga0207692_10113367 Ga0207692_101133672 152
658 3300025899 Ga0207642_10026795 Ga0207642_100267951 152
659 3300025900 Ga0207710_10007231 Ga0207710_100072314 152
660 3300025900 Ga0207710_10101856 Ga0207710_101018561 152
661 3300025901 Ga0207688_10003510 Ga0207688_100035104 152
662 3300025903 Ga0207680_10015013 Ga0207680_100150136 152
663 3300025905 Ga0207685_10041938 Ga0207685_100419382 152
664 3300025910 Ga0207684_10000389 Ga0207684_1000038934 152
665 3300025910 Ga0207684_10007163 Ga0207684_100071632 152
666 3300025910 Ga0207684_10421396 Ga0207684_104213962 152
667 3300025911 Ga0207654_10039744 Ga0207654_100397444 152
668 3300025911 Ga0207654_10130487 Ga0207654_101304872 152
669 3300025913 Ga0207695_10491572 Ga0207695_104915721 152
670 3300025915 Ga0207693_10003230 Ga0207693_100032307 152
671 3300025915 Ga0207693_10008387 Ga0207693_100083879 152
672 3300025915 Ga0207693_10033483 Ga0207693_100334835 152
673 3300025915 Ga0207693_10154904 Ga0207693_101549042 152
674 3300025917 Ga0207660_10904507 Ga0207660_109045071 152
675 3300025919 Ga0207657_10085411 Ga0207657_100854114 152
676 3300025922 Ga0207646_10001021 Ga0207646_1000102120 152
677 3300025923 Ga0207681_10154011 Ga0207681_101540112 152
678 3300025924 Ga0207694_10658516 Ga0207694_106585162 152
679 3300025925 Ga0207650_10209867 Ga0207650_102098672 152
680 3300025926 Ga0207659_10014351 Ga0207659_100143514 152
681 3300025929 Ga0207664_10373287 Ga0207664_103732871 152
682 3300025929 Ga0207664_10538248 Ga0207664_105382481 152
683 3300025931 Ga0207644_10009734 Ga0207644_100097345 152
684 3300025932 Ga0207690_10025891 Ga0207690_100258914 152
685 3300025934 Ga0207686_10265160 Ga0207686_102651602 152
686 3300025936 Ga0207670_10013296 Ga0207670_100132965 152
687 3300025937 Ga0207669_10030663 Ga0207669_100306635 152
688 3300025938 Ga0207704_10045185 Ga0207704_100451851 152
689 3300025939 Ga0207665_10000680 Ga0207665_1000068012 152
690 3300025939 Ga0207665_10601784 Ga0207665_106017841 152
691 3300025941 Ga0207711_10027489 Ga0207711_100274891 152
692 3300025941 Ga0207711_10624748 Ga0207711_106247482 152
693 3300025942 Ga0207689_10192475 Ga0207689_101924751 152
694 3300025944 Ga0207661_10202856 Ga0207661_102028563 152
695 3300025949 Ga0207667_10091353 Ga0207667_100913531 152
696 3300025960 Ga0207651_10023909 Ga0207651_100239095 152
697 3300025961 Ga0207712_10188727 Ga0207712_101887273 152
698 3300025961 Ga0207712_10196340 Ga0207712_101963403 152
699 3300025972 Ga0207668_10011636 Ga0207668_100116365 152
700 3300025981 Ga0207640_10012979 Ga0207640_100129794 152
701 3300025986 Ga0207658_10006917 Ga0207658_100069175 152
702 3300026023 Ga0207677_10007711 Ga0207677_100077116 152
703 3300026023 Ga0207677_10064922 Ga0207677_100649223 152
704 3300026035 Ga0207703_10063265 Ga0207703_100632651 152
705 3300026035 Ga0207703_10239389 Ga0207703_102393892 152
706 3300026041 Ga0207639_10016958 Ga0207639_100169584 152
707 3300026067 Ga0207678_10697689 Ga0207678_106976892 152
708 3300026075 Ga0207708_10040151 Ga0207708_100401513 152
709 3300026088 Ga0207641_10937218 Ga0207641_109372181 152
710 3300026095 Ga0207676_10736563 Ga0207676_107365631 152
711 3300026118 Ga0207675_100028244 Ga0207675_1000282446 152
712 3300026142 Ga0207698_11309497 Ga0207698_113094971 152
713 3300028016 Ga0265354_1009546 Ga0265354_10095462 152
714 3300031090 Ga0265760_10000187 Ga0265760_1000018712 152
715 3300031090 Ga0265760_10061558 Ga0265760_100615582 152
716 3300031344 Ga0265316_10083170 Ga0265316_100831702 152
717 3300035085 Ga0373929_0080689 Ga0373929_0080689_174_662 152
718 3300035088 Ga0373940_0051096 Ga0373940_0051096_323_796 152
719 3300035089 Ga0373944_0283063 Ga0373944_0283063_123_584 152
720 3300035241 Ga0373961_0075587 Ga0373961_0075587_138_626 152
721 3300035691 Ga0373931_0238116 Ga0373931_0238116_487_948 152
722 3300035691 Ga0373931_0598682 Ga0373931_0598682_64_525 152
723 3300035695 Ga0373927_0485890 Ga0373927_0485890_246_707 152
724 3300039450 Ga0436363_0901030 Ga0436363_0901030_603_1064 152
725 3300039453 Ga0436362_1210155 Ga0436362_1210155_197_658 152
726 3300045051 Ga0451576_0806605 Ga0451576_0806605_332_790 152
727 3300045051 Ga0451576_1158824 Ga0451576_1158824_164_652 152
728 3300046455 Ga0495603_0382887 Ga0495603_0382887_276_737 152
729 3300046457 Ga0495590_0112587 Ga0495590_0112587_37_498 152
730 3300046472 Ga0495580_0000600 Ga0495580_0000600_1730_2191 152
731 3300046472 Ga0495580_0001059 Ga0495580_0001059_16835_17296 152
732 3300046472 Ga0495580_0103100 Ga0495580_0103100_612_1073 152
733 3300046472 Ga0495580_0106965 Ga0495580_0106965_377_838 152
734 3300046499 Ga0495594_0118305 Ga0495594_0118305_653_1114 152
735 3300046664 Ga0495659_0010209 Ga0495659_0010209_1452_1913 152
736 3300046675 Ga0495657_0349084 Ga0495657_0349084_57_518 152
737 3300048088 Ga0495602_0340473 Ga0495602_0340473_231_692 152
738 3300048903 Ga0496100_0200559 Ga0496100_0200559_546_1019 152
739 3300048903 Ga0496100_0370951 Ga0496100_0370951_276_734 152
740 3300048905 Ga0496102_0000730 Ga0496102_0000730_14476_14949 152
741 3300048905 Ga0496102_1380758 Ga0496102_1380758_127_585 152
742 3300048905 Ga0496102_1507227 Ga0496102_1507227_80_538 152
743 3300048906 Ga0496103_0003239 Ga0496103_0003239_1109_1582 152
744 3300048906 Ga0496103_0102813 Ga0496103_0102813_1053_1511 152
745 3300048907 Ga0496104_0179569 Ga0496104_0179569_1330_1788 152
746 3300048907 Ga0496104_0968883 Ga0496104_0968883_93_581 152
747 3300048908 Ga0496105_0434234 Ga0496105_0434234_111_569 152
748 3300048909 Ga0496106_0024052 Ga0496106_0024052_3338_3811 152
749 3300048909 Ga0496106_0354737 Ga0496106_0354737_327_815 152
750 3300048909 Ga0496106_0490117 Ga0496106_0490117_398_856 152
751 3300048910 Ga0496107_0174101 Ga0496107_0174101_884_1342 152
752 3300048910 Ga0496107_0518921 Ga0496107_0518921_218_706 152
753 3300048910 Ga0496107_0560905 Ga0496107_0560905_85_558 152
754 3300048911 Ga0496108_0000535 Ga0496108_0000535_27348_27806 152
755 3300048912 Ga0496109_0000323 Ga0496109_0000323_29639_30097 152
756 3300048912 Ga0496109_0525315 Ga0496109_0525315_22_510 152
757 3300048913 Ga0496110_0000505 Ga0496110_0000505_1258_1716 152
758 3300048914 Ga0496111_0270943 Ga0496111_0270943_686_1144 152
759 3300048915 Ga0496112_0028806 Ga0496112_0028806_2442_2900 152
760 3300048915 Ga0496112_0621899 Ga0496112_0621899_444_902 152
761 3300048916 Ga0496113_0007627 Ga0496113_0007627_1850_2308 152
762 3300048918 Ga0496115_0045617 Ga0496115_0045617_1929_2387 152
763 3300050511 nmdc:mga08y16_1640348_c1 nmdc:mga08y16_1640348_c1_100_558 152
764 3300050512 nmdc:mga0n895_3077_c1 nmdc:mga0n895_3077_c1_6347_6808 152
765 3300050513 nmdc:mga0rr50_143419_c1 nmdc:mga0rr50_143419_c1_1357_1818 152
766 3300050515 nmdc:mga0a205_17360_c1 nmdc:mga0a205_17360_c1_893_1354 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

38

170

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f22-assembly1.cif.gz_B crystal structure of zalpha in complex with d(cgtacg) 0.9417 9 69
3f23-assembly1.cif.gz_A crystal structure of zalpha in complex with d(cggccg) 0.938 5 69
2acj-assembly1.cif.gz_D crystal structure of the b/z junction containing dna bound to z-dna binding proteins 0.9376 14 70
3irq-assembly1.cif.gz_A crystal structure of a z-z junction 0.9329 9 68
4hf2-assembly1.cif.gz_A crystal structure of e43a iscr mutant bound to its promoter 0.9326 3 130
ID Description Score Start End Superfamily
3f22A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9375 5 69 1.10.10.10
4hf2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9326 3 130 1.10.10.10
2gxbB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9287 14 70 1.10.10.10
af_P55265_129_209_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9283 7 70 1.10.10.10
3nrvB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9247 10 68 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2Z5G9Y9-F1-model_v4 Iron-sulfur cluster regulator IscR 0.9149 1 129 GO:0003700
GO:0005829
AF-A0A1V5YW79-F1-model_v4 HTH-type transcriptional regulator CymR 0.9102 3 130 GO:0003700
GO:0005829
AF-A0A2N9L592-F1-model_v4 Rrf2 family protein 0.908 1 130 GO:0003700
GO:0005829
AF-A0A5M8SX12-F1-model_v4 Rrf2 family transcriptional regulator 0.902 1 135 GO:0003700
GO:0005829
AF-A0A7C2WKU9-F1-model_v4 Rrf2 family transcriptional regulator 0.9017 3 130 GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
79.5 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map