F479827

General Info

Members Datasets Scaffolds Average Seq Length
766 289 1532 165

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100568855|Ga0070714_1005688552
Length 199
Sequence VAELEQLHAGHAAAVLAFELVNRAYFAASISDRGDEFFDQFPDRHSALLAEQEAGICAFYVLVADDGSVLGRFNLYDFEDGTARLGYRVAQQAAGRGVATTAVRELCRTAAARHGLRTLRAATSHDNAASQKVLTKAGFIPVGPATPADLGGKPGTWYQRDLQPETLILWADRPPGGYLCEGDAGSGPSAPAGRRRPWR

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
100 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
108 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
109 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
110 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
111 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
127 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
141 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
142 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
143 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
223 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
274 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
275 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
276 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
277 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
278 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
279 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
282 2558860280 Kutzneria sp. 744 Isolate Unclassified
283 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
284 2808606448 Streptomyces sp. 193411 Isolate Unclassified
285 2862574272 Streptomyces sp. AcE210 Isolate Nodule
286 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
287 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
288 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
289 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0.26
Isolates 1.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0.13
Rhizoplane 4.44
Rhizosphere 90.08
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100568855 3300005435 Bacteria 1086
2 rootL2_10084405 3300003322 Bacteria 4388
3 rootL2_10108025 3300003322 Bacteria 1586
4 Ga0070680_100311583 3300005336 Bacteria 1335
5 Ga0070680_100721426 3300005336 Bacteria 858
6 Ga0070689_101416349 3300005340 Bacteria 628
7 Ga0070691_10098059 3300005341 Bacteria 1453
8 Ga0070671_100670934 3300005355 Bacteria 898
9 Ga0070709_10011964 3300005434 Bacteria 4850
10 Ga0070709_10020043 3300005434 Bacteria 3875
11 Ga0070709_10057331 3300005434 Bacteria 2467
12 Ga0070709_10084947 3300005434 Bacteria 2074
13 Ga0070709_10222140 3300005434 Bacteria 1348
14 Ga0070709_10322338 3300005434 Bacteria 1134
15 Ga0070709_10524790 3300005434 Bacteria 903
16 Ga0070709_10900077 3300005434 Bacteria 700
17 Ga0070714_100000002 3300005435 Bacteria 386673
18 Ga0070714_100004894 3300005435 Bacteria 10168
19 Ga0070714_100024164 3300005435 Bacteria 4999
20 Ga0070714_100113590 3300005435 Bacteria 2401
21 Ga0070714_100249267 3300005435 Bacteria 1641
22 Ga0070714_100254912 3300005435 Bacteria 1623
23 Ga0070714_100275520 3300005435 Bacteria 1561
24 Ga0070714_100285746 3300005435 Bacteria 1534
25 Ga0070714_100466889 3300005435 Bacteria 1200
26 Ga0070714_100772611 3300005435 Bacteria 929
27 Ga0070714_100823619 3300005435 Bacteria 899
28 Ga0070713_100014868 3300005436 Bacteria 5793
29 Ga0070713_100027148 3300005436 Bacteria 4504
30 Ga0070713_100053572 3300005436 Bacteria 3343
31 Ga0070713_100055713 3300005436 Bacteria 3287
32 Ga0070713_100094423 3300005436 Bacteria 2579
33 Ga0070713_100101028 3300005436 Bacteria 2498
34 Ga0070713_100181144 3300005436 Bacteria 1893
35 Ga0070713_100186808 3300005436 Bacteria 1865
36 Ga0070713_100260586 3300005436 Bacteria 1584
37 Ga0070713_100445495 3300005436 Bacteria 1215
38 Ga0070713_100795355 3300005436 Bacteria 906
39 Ga0070713_101159604 3300005436 Bacteria 747
40 Ga0070710_10016510 3300005437 Bacteria 3759
41 Ga0070710_10068810 3300005437 Bacteria 2035
42 Ga0070710_10330472 3300005437 Bacteria 1003
43 Ga0070710_10375208 3300005437 Bacteria 947
44 Ga0070710_11024761 3300005437 Bacteria 602
45 Ga0070711_100011677 3300005439 Bacteria 5460
46 Ga0070711_100031838 3300005439 Bacteria 3504
47 Ga0070711_100047650 3300005439 Bacteria 2927
48 Ga0070711_100067208 3300005439 Bacteria 2514
49 Ga0070711_100249518 3300005439 Bacteria 1391
50 Ga0070711_100617760 3300005439 Bacteria 906
51 Ga0070711_100703432 3300005439 Bacteria 851
52 Ga0070694_100429695 3300005444 Bacteria 1039
53 Ga0070663_101123361 3300005455 Bacteria 688
54 Ga0070685_10277627 3300005466 Bacteria 1120
55 Ga0070706_100125570 3300005467 Bacteria 2392
56 Ga0070698_100026601 3300005471 Bacteria 6022
57 Ga0070679_101054025 3300005530 Bacteria 757
58 Ga0070684_101956053 3300005535 Bacteria 553
59 Ga0068853_100007266 3300005539 Bacteria 8870
60 Ga0070695_100250465 3300005545 Bacteria 1289
61 Ga0070693_100185059 3300005547 Bacteria 1343
62 Ga0070665_100403377 3300005548 Unclassified 1375
63 Ga0070665_100528263 3300005548 Bacteria 1192
64 Ga0070665_101167339 3300005548 Bacteria 781
65 Ga0068855_100543389 3300005563 Bacteria 1258
66 Ga0068855_101102296 3300005563 Bacteria 830
67 Ga0068856_101418503 3300005614 Bacteria 709
68 Ga0070702_100626267 3300005615 Bacteria 810
69 Ga0068852_101041442 3300005616 Bacteria 838
70 Ga0068863_100019662 3300005841 Bacteria 6460
71 Ga0068863_100833262 3300005841 Bacteria 921
72 Ga0068860_100777634 3300005843 Bacteria 970
73 Ga0081455_10017069 3300005937 Bacteria 6977
74 Ga0081455_10170693 3300005937 Bacteria 1657
75 Ga0081455_10177600 3300005937 Bacteria 1615
76 Ga0081455_10531705 3300005937 Bacteria 782
77 Ga0070717_10012266 3300006028 Bacteria 6534
78 Ga0070717_10025069 3300006028 Bacteria 4737
79 Ga0070717_10102540 3300006028 Bacteria 2431
80 Ga0070717_10111084 3300006028 Bacteria 2338
81 Ga0070717_10153550 3300006028 Bacteria 1993
82 Ga0070717_10156062 3300006028 Bacteria 1977
83 Ga0070717_10169831 3300006028 Bacteria 1896
84 Ga0070717_10187790 3300006028 Bacteria 1804
85 Ga0070717_10267866 3300006028 Bacteria 1512
86 Ga0070715_10062999 3300006163 Bacteria 1633
87 Ga0070715_10077013 3300006163 Bacteria 1504
88 Ga0070715_10245869 3300006163 Bacteria 932
89 Ga0070715_10582930 3300006163 Bacteria 653
90 Ga0070716_100000653 3300006173 Bacteria 14745
91 Ga0070716_100004013 3300006173 Bacteria 6987
92 Ga0070716_100399966 3300006173 Bacteria 987
93 Ga0070716_100924848 3300006173 Bacteria 685
94 Ga0070716_101173477 3300006173 Bacteria 615
95 Ga0070712_100023404 3300006175 Bacteria 4081
96 Ga0070712_100065592 3300006175 Bacteria 2578
97 Ga0070712_100128244 3300006175 Bacteria 1919
98 Ga0070712_100150513 3300006175 Bacteria 1786
99 Ga0070712_100752905 3300006175 Bacteria 834
100 Ga0070712_100812792 3300006175 Bacteria 802
101 Ga0070712_101435650 3300006175 Bacteria 602
102 Ga0097621_100028180 3300006237 Bacteria 4426
103 Ga0068871_100558986 3300006358 Bacteria 1037
104 Ga0068871_100705136 3300006358 Bacteria 925
105 Ga0075428_100003781 3300006844 Bacteria 16591
106 Ga0075430_100031446 3300006846 Bacteria 4505
107 Ga0075431_100000561 3300006847 Bacteria 31306
108 Ga0075434_100887238 3300006871 Bacteria 907
109 Ga0075429_100002390 3300006880 Bacteria 15817
110 Ga0105240_10471697 3300009093 Bacteria 1400
111 Ga0111539_10036831 3300009094 Bacteria 5912
112 Ga0105245_10043179 3300009098 Bacteria 4022
113 Ga0105245_11453844 3300009098 Bacteria 736
114 Ga0114129_10022262 3300009147 Bacteria 8997
115 Ga0105243_10884333 3300009148 Bacteria 887
116 Ga0105241_10318795 3300009174 Bacteria 1340
117 Ga0105241_10737562 3300009174 Bacteria 902
118 Ga0105241_11356922 3300009174 Bacteria 679
119 Ga0105242_12459827 3300009176 Bacteria 569
120 Ga0105248_10278699 3300009177 Bacteria 1882
121 Ga0105248_10855628 3300009177 Bacteria 1026
122 Ga0105237_10306667 3300009545 Bacteria 1590
123 Ga0105238_10003581 3300009551 Bacteria 15488
124 Ga0105238_10840564 3300009551 Bacteria 935
125 Ga0105249_10237874 3300009553 Bacteria 1799
126 Ga0105249_10337500 3300009553 Bacteria 1523
127 Ga0105249_10893573 3300009553 Bacteria 955
128 Ga0105239_10285112 3300010375 Bacteria 1860
129 Ga0105239_10765623 3300010375 Bacteria 1105
130 Ga0105246_10993075 3300011119 Bacteria 759
131 Ga0157369_10476446 3300013105 Bacteria 1292
132 Ga0157374_10071290 3300013296 Bacteria 3276
133 Ga0157374_11530276 3300013296 Bacteria 691
134 Ga0157378_10952279 3300013297 Bacteria 891
135 Ga0163162_10011922 3300013306 Bacteria 8476
136 Ga0163162_11190769 3300013306 Bacteria 864
137 Ga0163162_11418037 3300013306 Bacteria 790
138 Ga0157372_10033630 3300013307 Bacteria 5633
139 Ga0157372_10167139 3300013307 Bacteria 2544
140 Ga0157372_10655349 3300013307 Bacteria 1223
141 Ga0157375_10534806 3300013308 Bacteria 1335
142 Ga0157375_10645878 3300013308 Bacteria 1215
143 Ga0163163_10089435 3300014325 Bacteria 3091
144 Ga0163163_10893745 3300014325 Bacteria 952
145 Ga0157377_10046505 3300014745 Bacteria 2427
146 Ga0157377_10408231 3300014745 Bacteria 927
147 Ga0157379_10079187 3300014968 Bacteria 2943
148 Ga0157379_10973660 3300014968 Bacteria 808
149 Ga0157376_10175626 3300014969 Bacteria 1954
150 Ga0157376_11427687 3300014969 Bacteria 724
151 Ga0163161_10398645 3300017792 Bacteria 1103
152 Ga0206353_11027777 3300020082 Bacteria 1202
153 Ga0213875_10000292 3300021388 Bacteria 48320
154 Ga0224572_1040972 3300024225 Bacteria 872
155 Ga0207653_10004578 3300025885 Bacteria 4335
156 Ga0207692_10006997 3300025898 Bacteria 4604
157 Ga0207692_10044544 3300025898 Bacteria 2214
158 Ga0207692_10057951 3300025898 Bacteria 1994
159 Ga0207685_10021398 3300025905 Bacteria 2167
160 Ga0207685_10039128 3300025905 Bacteria 1758
161 Ga0207685_10054426 3300025905 Bacteria 1558
162 Ga0207699_10005414 3300025906 Bacteria 6112
163 Ga0207699_10006116 3300025906 Bacteria 5804
164 Ga0207699_10023525 3300025906 Bacteria 3354
165 Ga0207699_10050788 3300025906 Bacteria 2447
166 Ga0207699_10545471 3300025906 Bacteria 841
167 Ga0207699_10635563 3300025906 Unclassified 779
168 Ga0207699_10737235 3300025906 Bacteria 722
169 Ga0207684_10088849 3300025910 Bacteria 2633
170 Ga0207707_10197709 3300025912 Bacteria 1753
171 Ga0207695_10644889 3300025913 Bacteria 940
172 Ga0207671_10188920 3300025914 Bacteria 1606
173 Ga0207671_10523291 3300025914 Bacteria 946
174 Ga0207671_11199295 3300025914 Bacteria 594
175 Ga0207693_10019173 3300025915 Bacteria 5444
176 Ga0207693_10146190 3300025915 Bacteria 1859
177 Ga0207693_10155476 3300025915 Bacteria 1798
178 Ga0207693_10235258 3300025915 Bacteria 1438
179 Ga0207693_10355867 3300025915 Bacteria 1145
180 Ga0207693_10375847 3300025915 Bacteria 1112
181 Ga0207693_10495372 3300025915 Bacteria 954
182 Ga0207693_10710639 3300025915 Bacteria 778
183 Ga0207693_10717636 3300025915 Bacteria 774
184 Ga0207663_10004437 3300025916 Bacteria 6977
185 Ga0207663_10053080 3300025916 Bacteria 2531
186 Ga0207663_10054828 3300025916 Bacteria 2498
187 Ga0207663_10484557 3300025916 Bacteria 959
188 Ga0207663_10710265 3300025916 Bacteria 796
189 Ga0207663_10776195 3300025916 Bacteria 762
190 Ga0207652_10321987 3300025921 Bacteria 1396
191 Ga0207646_11486481 3300025922 Bacteria 587
192 Ga0207681_10994242 3300025923 Bacteria 704
193 Ga0207687_10303501 3300025927 Bacteria 1287
194 Ga0207700_10002223 3300025928 Bacteria 11144
195 Ga0207700_10023087 3300025928 Bacteria 4282
196 Ga0207700_10025092 3300025928 Bacteria 4134
197 Ga0207700_10058674 3300025928 Bacteria 2908
198 Ga0207700_10107824 3300025928 Bacteria 2235
199 Ga0207700_10185802 3300025928 Bacteria 1743
200 Ga0207700_10258461 3300025928 Bacteria 1490
201 Ga0207700_10285579 3300025928 Bacteria 1421
202 Ga0207700_10528357 3300025928 Bacteria 1046
203 Ga0207700_10595375 3300025928 Bacteria 984
204 Ga0207700_10732744 3300025928 Bacteria 883
205 Ga0207664_10000038 3300025929 Bacteria 166264
206 Ga0207664_10001019 3300025929 Bacteria 18787
207 Ga0207664_10004501 3300025929 Bacteria 9442
208 Ga0207664_10014738 3300025929 Bacteria 5656
209 Ga0207664_10021083 3300025929 Bacteria 4838
210 Ga0207664_10064185 3300025929 Bacteria 2936
211 Ga0207664_10092851 3300025929 Bacteria 2478
212 Ga0207664_10194102 3300025929 Bacteria 1749
213 Ga0207664_10209156 3300025929 Bacteria 1687
214 Ga0207664_10282085 3300025929 Bacteria 1458
215 Ga0207664_10368206 3300025929 Bacteria 1274
216 Ga0207704_10170999 3300025938 Bacteria 1558
217 Ga0207665_10003632 3300025939 Bacteria 10308
218 Ga0207665_10019308 3300025939 Bacteria 4480
219 Ga0207667_10414169 3300025949 Bacteria 1371
220 Ga0207712_10968063 3300025961 Bacteria 754
221 Ga0207712_10974813 3300025961 Bacteria 751
222 Ga0207677_10285109 3300026023 Bacteria 1357
223 Ga0207639_10668126 3300026041 Bacteria 962
224 Ga0207702_10145653 3300026078 Bacteria 2149
225 Ga0207702_10497247 3300026078 Bacteria 1188
226 Ga0207641_10302866 3300026088 Bacteria 1510
227 Ga0207641_10614045 3300026088 Bacteria 1066
228 Ga0207641_10886387 3300026088 Bacteria 885
229 Ga0207675_100060371 3300026118 Bacteria 3540
230 Ga0207428_10001600 3300027907 Bacteria 23543
231 Ga0268266_10090313 3300028379 Bacteria 2685
232 Ga0268264_10821194 3300028381 Bacteria 930
233 Ga0265336_10018452 3300028666 Bacteria 2261
234 Ga0307515_10073249 3300028794 Bacteria 4607
235 Ga0265338_10056948 3300028800 Bacteria 3461
236 Ga0307511_10027833 3300030521 Bacteria 5152
237 Ga0307512_10031684 3300030522 Bacteria 4573
238 Ga0307512_10054038 3300030522 Bacteria 3185
239 Ga0265760_10002529 3300031090 Bacteria 5336
240 Ga0265327_10001233 3300031251 Bacteria 34340
241 Ga0307513_10492236 3300031456 Bacteria 944
242 Ga0307509_10010033 3300031507 Bacteria 11688
243 Ga0307509_10031483 3300031507 Bacteria 5857
244 Ga0307508_10003230 3300031616 Bacteria 16661
245 Ga0307508_10006304 3300031616 Bacteria 11169
246 Ga0307508_10008673 3300031616 Bacteria 9383
247 Ga0307508_10121572 3300031616 Bacteria 2214
248 Ga0307508_10710677 3300031616 Unclassified 615
249 Ga0307514_10001453 3300031649 Bacteria 28897
250 Ga0307514_10176687 3300031649 Bacteria 1384
251 Ga0307516_10401771 3300031730 Bacteria 1029
252 Ga0307507_10013841 3300033179 Bacteria 9720
253 Ga0307507_10027613 3300033179 Bacteria 6078
254 Ga0307510_10051842 3300033180 Bacteria 4334
255 Ga0307510_10302859 3300033180 Bacteria 1060
256 Ga0316214_1002889 3300033545 Bacteria 2135
257 Ga0373926_0002104 3300035083 Bacteria 6262
258 Ga0373926_0071310 3300035083 Bacteria 1277
259 Ga0373926_0150766 3300035083 Bacteria 885
260 Ga0373928_0021387 3300035084 Bacteria 1364
261 Ga0373934_0027760 3300035086 Bacteria 2201
262 Ga0373952_0035506 3300035092 Bacteria 1129
263 Ga0373923_0006446 3300035111 Bacteria 4059
264 Ga0373923_0010421 3300035111 Bacteria 3379
265 Ga0373923_0013947 3300035111 Bacteria 3008
266 Ga0373923_0014732 3300035111 Bacteria 2942
267 Ga0373923_0081937 3300035111 Bacteria 1401
268 Ga0373923_0317066 3300035111 Bacteria 740
269 Ga0373932_0105138 3300035112 Bacteria 924
270 Ga0373936_0003325 3300035113 Bacteria 6029
271 Ga0373936_0016328 3300035113 Bacteria 2855
272 Ga0373936_0035107 3300035113 Bacteria 1995
273 Ga0373936_0048386 3300035113 Bacteria 1716
274 Ga0373936_0207638 3300035113 Bacteria 866
275 Ga0373939_0189086 3300035114 Bacteria 772
276 Ga0373945_0001913 3300035116 Bacteria 6459
277 Ga0373945_0107401 3300035116 Bacteria 1098
278 Ga0373945_0122932 3300035116 Bacteria 1033
279 Ga0373953_0031037 3300035117 Bacteria 2076
280 Ga0373953_0069094 3300035117 Bacteria 1455
281 Ga0373954_0021962 3300035118 Bacteria 2892
282 Ga0373954_0094532 3300035118 Bacteria 1438
283 Ga0373956_0005350 3300035119 Bacteria 5137
284 Ga0373956_0036943 3300035119 Bacteria 2157
285 Ga0373956_0187241 3300035119 Bacteria 979
286 Ga0373957_0004620 3300035120 Bacteria 4203
287 Ga0373957_0005985 3300035120 Bacteria 3806
288 Ga0373943_0001615 3300035170 Bacteria 10227
289 Ga0373943_0016115 3300035170 Bacteria 3404
290 Ga0373943_0063589 3300035170 Bacteria 1850
291 Ga0373943_0358659 3300035170 Bacteria 836
292 Ga0373943_0599148 3300035170 Bacteria 649
293 Ga0373946_0011715 3300035171 Bacteria 3278
294 Ga0373946_0068066 3300035171 Bacteria 1530
295 Ga0373946_0279713 3300035171 Bacteria 820
296 Ga0373946_0663630 3300035171 Bacteria 544
297 Ga0373955_0001158 3300035172 Bacteria 11196
298 Ga0373955_0005591 3300035172 Bacteria 5652
299 Ga0373955_0026119 3300035172 Bacteria 3004
300 Ga0373942_0000592 3300035207 Bacteria 10200
301 Ga0373924_0002060 3300035410 Bacteria 6711
302 Ga0373924_0004820 3300035410 Bacteria 4742
303 Ga0373924_0017223 3300035410 Bacteria 2768
304 Ga0373924_0277874 3300035410 Bacteria 743
305 Ga0373935_0006326 3300035692 Bacteria 7058
306 Ga0373935_0012391 3300035692 Bacteria 5130
307 Ga0373935_0029065 3300035692 Bacteria 3419
308 Ga0373935_0084253 3300035692 Bacteria 2070
309 Ga0373935_0140497 3300035692 Bacteria 1631
310 Ga0373935_0280325 3300035692 Bacteria 1173
311 Ga0373927_0061764 3300035695 Bacteria 2423
312 Ga0373927_0247725 3300035695 Bacteria 1171
313 Ga0373927_0337928 3300035695 Bacteria 992
314 Ga0373933_0001299 3300035724 Bacteria 14700
315 Ga0373933_0159974 3300035724 Bacteria 1429
316 Ga0373933_0222747 3300035724 Bacteria 1210
317 Ga0373947_0038465 3300035725 Bacteria 2842
318 Ga0373947_0058674 3300035725 Bacteria 2332
319 Ga0373947_0089509 3300035725 Bacteria 1917
320 Ga0373947_0174016 3300035725 Bacteria 1398
321 Ga0373937_0024671 3300036401 Bacteria 5425
322 Ga0373937_0049692 3300036401 Bacteria 3840
323 Ga0373937_0085106 3300036401 Bacteria 2926
324 Ga0373937_0445520 3300036401 Bacteria 1229
325 Ga0373937_0597650 3300036401 Bacteria 1047
326 Ga0373937_0790170 3300036401 Bacteria 897
327 Ga0373925_0006890 3300037068 Bacteria 8319
328 Ga0373925_0014271 3300037068 Bacteria 5747
329 Ga0373925_0025650 3300037068 Bacteria 4309
330 Ga0373925_0031631 3300037068 Bacteria 3889
331 Ga0373925_0151505 3300037068 Bacteria 1821
332 Ga0373925_0152860 3300037068 Bacteria 1813
333 Ga0373925_0813129 3300037068 Bacteria 770
334 Ga0395900_0366696 3300037418 Bacteria 1411
335 Ga0395898_0013982 3300037466 Bacteria 8247
336 Ga0395898_0036257 3300037466 Bacteria 4897
337 Ga0395898_0955292 3300037466 Bacteria 794
338 Ga0436364_0734194 3300037853 Bacteria 2718
339 Ga0436364_1135881 3300037853 Bacteria 1331
340 Ga0436364_1492889 3300037853 Bacteria 100509
341 Ga0395901_1511939 3300038443 Bacteria 627
342 Ga0451853_1612332 3300041512 Bacteria 1702
343 Ga0439448_0001710 3300042005 Bacteria 5786
344 Ga0439449_0003066 3300042007 Bacteria 6512
345 Ga0439455_0001546 3300042012 Bacteria 3893
346 Ga0450903_000007 3300042138 Bacteria 38287
347 Ga0450901_006245 3300042533 Bacteria 1224
348 Ga0466969_0254225 3300044656 Bacteria 796
349 Ga0466972_0196171 3300044658 Bacteria 946
350 Ga0466965_0002942 3300044683 Bacteria 7371
351 Ga0466966_0001649 3300044684 Bacteria 14388
352 Ga0466966_0008575 3300044684 Bacteria 6766
353 Ga0466961_0003202 3300044693 Bacteria 10187
354 Ga0466961_0114108 3300044693 Bacteria 1698
355 Ga0466963_0000620 3300044694 Bacteria 17022
356 Ga0466964_0005892 3300044706 Bacteria 4564
357 Ga0466964_0301387 3300044706 Bacteria 808
358 Ga0466964_0360884 3300044706 Bacteria 749
359 Ga0466971_0001206 3300044719 Bacteria 10748
360 Ga0466971_0080919 3300044719 Bacteria 1481
361 Ga0466971_0262549 3300044719 Bacteria 824
362 Ga0466968_0102463 3300044735 Bacteria 1279
363 Ga0466970_0004261 3300044765 Bacteria 7043
364 Ga0466970_0057650 3300044765 Bacteria 2077
365 Ga0466970_0272537 3300044765 Bacteria 951
366 Ga0466957_0000473 3300044842 Bacteria 19961
367 Ga0466959_0000889 3300045049 Bacteria 17595
368 Ga0466959_0534903 3300045049 Bacteria 791
369 Ga0466958_0008253 3300045836 Bacteria 5767
370 Ga0466967_0024595 3300045976 Bacteria 4954
371 Ga0466967_0999620 3300045976 Bacteria 833
372 Ga0495592_0000533 3300046454 Bacteria 27280
373 Ga0495592_0016679 3300046454 Bacteria 5574
374 Ga0495592_0022893 3300046454 Bacteria 4754
375 Ga0495592_0053249 3300046454 Bacteria 3002
376 Ga0495592_0067145 3300046454 Bacteria 2622
377 Ga0495592_0137888 3300046454 Bacteria 1699
378 Ga0495603_0001324 3300046455 Bacteria 14366
379 Ga0495603_0013490 3300046455 Bacteria 4944
380 Ga0495603_0077956 3300046455 Bacteria 1943
381 Ga0495603_0261569 3300046455 Bacteria 996
382 Ga0495590_0039283 3300046457 Bacteria 1651
383 Ga0495629_0006195 3300046459 Bacteria 8879
384 Ga0495629_0013660 3300046459 Bacteria 5859
385 Ga0495629_0041457 3300046459 Bacteria 3239
386 Ga0495629_0058261 3300046459 Bacteria 2700
387 Ga0495629_0102115 3300046459 Bacteria 2001
388 Ga0495629_0183874 3300046459 Bacteria 1448
389 Ga0495629_0222137 3300046459 Bacteria 1303
390 Ga0495629_0305386 3300046459 Bacteria 1089
391 Ga0495629_0713476 3300046459 Bacteria 665
392 Ga0495638_0506044 3300046460 Bacteria 607
393 Ga0495641_0009673 3300046461 Bacteria 5700
394 Ga0495641_0011378 3300046461 Bacteria 5074
395 Ga0495641_0068268 3300046461 Bacteria 1598
396 Ga0495641_0077741 3300046461 Bacteria 1487
397 Ga0495641_0193824 3300046461 Bacteria 911
398 Ga0495641_0473838 3300046461 Bacteria 570
399 Ga0495651_0014285 3300046462 Bacteria 6137
400 Ga0495651_0029913 3300046462 Bacteria 4246
401 Ga0495651_0043753 3300046462 Bacteria 3473
402 Ga0495651_0070812 3300046462 Bacteria 2652
403 Ga0495651_0084811 3300046462 Bacteria 2386
404 Ga0495653_0027494 3300046463 Bacteria 4551
405 Ga0495653_0121661 3300046463 Bacteria 1859
406 Ga0495653_0447315 3300046463 Bacteria 813
407 Ga0495650_0030732 3300046471 Bacteria 2428
408 Ga0495580_0008335 3300046472 Bacteria 8243
409 Ga0495580_0365737 3300046472 Bacteria 976
410 Ga0495582_0001439 3300046473 Bacteria 13430
411 Ga0495582_0034703 3300046473 Bacteria 2772
412 Ga0495582_0057206 3300046473 Bacteria 2150
413 Ga0495582_0221088 3300046473 Bacteria 1083
414 Ga0495605_0001547 3300046474 Bacteria 14941
415 Ga0495605_0041493 3300046474 Bacteria 2292
416 Ga0495639_0004306 3300046475 Bacteria 6105
417 Ga0495639_0011573 3300046475 Bacteria 3806
418 Ga0495639_0055730 3300046475 Bacteria 1803
419 Ga0495662_0000937 3300046476 Bacteria 14286
420 Ga0495662_0010527 3300046476 Bacteria 4525
421 Ga0495662_0071327 3300046476 Bacteria 1683
422 Ga0495662_0089858 3300046476 Bacteria 1497
423 Ga0495662_0115775 3300046476 Bacteria 1314
424 Ga0495662_0137773 3300046476 Bacteria 1201
425 Ga0495662_0221101 3300046476 Bacteria 933
426 Ga0495662_0243110 3300046476 Bacteria 887
427 Ga0495664_0001190 3300046477 Bacteria 13575
428 Ga0495664_0029289 3300046477 Bacteria 3219
429 Ga0495664_0107735 3300046477 Bacteria 1681
430 Ga0495664_0195971 3300046477 Bacteria 1224
431 Ga0495664_0269328 3300046477 Bacteria 1029
432 Ga0495664_0318321 3300046477 Bacteria 938
433 Ga0495584_0055583 3300046491 Bacteria 1992
434 Ga0495584_0266431 3300046491 Bacteria 871
435 Ga0495585_0064676 3300046492 Bacteria 2005
436 Ga0495594_0061925 3300046499 Bacteria 2071
437 Ga0495594_0104436 3300046499 Bacteria 1595
438 Ga0495583_0035445 3300046506 Bacteria 2381
439 Ga0495606_0012897 3300046507 Bacteria 6651
440 Ga0495606_0268620 3300046507 Bacteria 938
441 Ga0495608_0011405 3300046511 Bacteria 6184
442 Ga0495608_0072053 3300046511 Bacteria 2254
443 Ga0495610_0221946 3300046512 Bacteria 763
444 Ga0495618_0013181 3300046514 Bacteria 5030
445 Ga0495618_0044213 3300046514 Bacteria 2809
446 Ga0495618_0088468 3300046514 Bacteria 1981
447 Ga0495618_0128018 3300046514 Bacteria 1625
448 Ga0495618_0246948 3300046514 Bacteria 1120
449 Ga0495618_0334798 3300046514 Bacteria 935
450 Ga0495620_0003274 3300046515 Bacteria 9285
451 Ga0495620_0143312 3300046515 Bacteria 933
452 Ga0495628_0029616 3300046516 Bacteria 4436
453 Ga0495628_0040030 3300046516 Bacteria 3747
454 Ga0495628_0142315 3300046516 Bacteria 1830
455 Ga0495628_0156061 3300046516 Bacteria 1736
456 Ga0495628_0243619 3300046516 Bacteria 1344
457 Ga0495628_0420853 3300046516 Bacteria 974
458 Ga0495630_0026182 3300046517 Bacteria 4317
459 Ga0495630_0058558 3300046517 Bacteria 2888
460 Ga0495630_0139751 3300046517 Bacteria 1841
461 Ga0495630_0225046 3300046517 Bacteria 1432
462 Ga0495630_0242821 3300046517 Bacteria 1376
463 Ga0495643_0002317 3300046522 Bacteria 15353
464 Ga0495643_0011043 3300046522 Bacteria 5522
465 Ga0495644_0013948 3300046523 Bacteria 3081
466 Ga0495648_0016834 3300046524 Bacteria 5254
467 Ga0495648_0220593 3300046524 Bacteria 935
468 Ga0495666_0005521 3300046526 Bacteria 6368
469 Ga0495666_0079047 3300046526 Bacteria 1557
470 Ga0495666_0192996 3300046526 Bacteria 938
471 Ga0495642_0081960 3300046528 Bacteria 1360
472 Ga0495652_0000731 3300046529 Bacteria 38018
473 Ga0495652_0014378 3300046529 Bacteria 7105
474 Ga0495652_0055391 3300046529 Bacteria 3372
475 Ga0495652_0093259 3300046529 Bacteria 2458
476 Ga0495652_0120359 3300046529 Bacteria 2095
477 Ga0495652_0126860 3300046529 Bacteria 2026
478 Ga0495652_0498733 3300046529 Bacteria 844
479 Ga0495652_0811023 3300046529 Bacteria 622
480 Ga0495665_0002348 3300046531 Bacteria 10222
481 Ga0495665_0007767 3300046531 Bacteria 5804
482 Ga0495665_0010861 3300046531 Bacteria 4925
483 Ga0495665_0011827 3300046531 Bacteria 4727
484 Ga0495665_0039988 3300046531 Bacteria 2497
485 Ga0495665_0149861 3300046531 Bacteria 1218
486 Ga0495665_0218889 3300046531 Unclassified 984
487 Ga0495640_0041139 3300046533 Bacteria 3231
488 Ga0495640_0051824 3300046533 Bacteria 2819
489 Ga0495640_0059553 3300046533 Bacteria 2600
490 Ga0495640_0086954 3300046533 Bacteria 2068
491 Ga0495640_0450208 3300046533 Bacteria 786
492 Ga0495586_0025368 3300046535 Bacteria 3172
493 Ga0495586_0038621 3300046535 Bacteria 2565
494 Ga0495586_0050344 3300046535 Bacteria 2254
495 Ga0495586_0300648 3300046535 Bacteria 919
496 Ga0495587_0002717 3300046536 Bacteria 11801
497 Ga0495587_0003610 3300046536 Bacteria 10295
498 Ga0495587_0005655 3300046536 Bacteria 8149
499 Ga0495587_0019081 3300046536 Bacteria 4247
500 Ga0495587_0161804 3300046536 Bacteria 1273
501 Ga0495597_0208176 3300046542 Bacteria 781
502 Ga0495645_0006572 3300046543 Bacteria 8080
503 Ga0495645_0025115 3300046543 Bacteria 4323
504 Ga0495645_0043329 3300046543 Bacteria 3283
505 Ga0495645_0071310 3300046543 Bacteria 2505
506 Ga0495645_0080121 3300046543 Bacteria 2344
507 Ga0495645_0080211 3300046543 Bacteria 2343
508 Ga0495645_0134378 3300046543 Bacteria 1731
509 Ga0495645_0338457 3300046543 Bacteria 972
510 Ga0495622_0069359 3300046557 Bacteria 1628
511 Ga0495667_0014966 3300046559 Bacteria 5241
512 Ga0495667_0022967 3300046559 Bacteria 4202
513 Ga0495667_0062793 3300046559 Bacteria 2433
514 Ga0495667_0092703 3300046559 Bacteria 1955
515 Ga0495667_0168757 3300046559 Bacteria 1406
516 Ga0495667_0332895 3300046559 Bacteria 960
517 Ga0495667_0508456 3300046559 Bacteria 754
518 Ga0495668_0011363 3300046616 Bacteria 5335
519 Ga0495668_0180789 3300046616 Bacteria 1155
520 Ga0495634_0001842 3300046642 Bacteria 18267
521 Ga0495634_0006619 3300046642 Bacteria 8788
522 Ga0495634_0015575 3300046642 Bacteria 5457
523 Ga0495634_0022206 3300046642 Bacteria 4473
524 Ga0495634_0030742 3300046642 Bacteria 3705
525 Ga0495634_0091807 3300046642 Bacteria 1970
526 Ga0495634_0171832 3300046642 Bacteria 1361
527 Ga0495634_0660839 3300046642 Bacteria 603
528 Ga0495611_0020514 3300046648 Bacteria 2845
529 Ga0495625_0441559 3300046660 Bacteria 805
530 Ga0495635_0009265 3300046663 Bacteria 6876
531 Ga0495635_0033666 3300046663 Bacteria 3554
532 Ga0495635_0035697 3300046663 Bacteria 3446
533 Ga0495635_0036617 3300046663 Bacteria 3400
534 Ga0495635_0065637 3300046663 Bacteria 2490
535 Ga0495635_0072291 3300046663 Bacteria 2363
536 Ga0495635_0118719 3300046663 Bacteria 1804
537 Ga0495635_0133882 3300046663 Bacteria 1689
538 Ga0495635_0253660 3300046663 Bacteria 1185
539 Ga0495635_0464252 3300046663 Bacteria 836
540 Ga0495588_0099672 3300046674 Bacteria 1526
541 Ga0495657_0001951 3300046675 Bacteria 17588
542 Ga0495657_0007880 3300046675 Bacteria 8173
543 Ga0495657_0010131 3300046675 Bacteria 7100
544 Ga0495657_0023926 3300046675 Bacteria 4358
545 Ga0495657_0036154 3300046675 Bacteria 3416
546 Ga0495657_0106359 3300046675 Bacteria 1781
547 Ga0495599_0034176 3300046678 Bacteria 3194
548 Ga0495599_0100141 3300046678 Bacteria 1806
549 Ga0495599_0251017 3300046678 Bacteria 1076
550 Ga0495599_0252074 3300046678 Bacteria 1074
551 Ga0495599_0328185 3300046678 Bacteria 920
552 Ga0495623_0004911 3300046679 Bacteria 8763
553 Ga0495623_0016907 3300046679 Bacteria 4711
554 Ga0495623_0038511 3300046679 Bacteria 3057
555 Ga0495623_0100646 3300046679 Bacteria 1761
556 Ga0495623_0141211 3300046679 Bacteria 1432
557 Ga0495646_0001163 3300046680 Bacteria 15366
558 Ga0495646_0001297 3300046680 Bacteria 14748
559 Ga0495646_0005089 3300046680 Bacteria 8284
560 Ga0495646_0006708 3300046680 Bacteria 7301
561 Ga0495646_0051478 3300046680 Bacteria 2492
562 Ga0495646_0112384 3300046680 Bacteria 1550
563 Ga0495646_0168922 3300046680 Bacteria 1206
564 Ga0495646_0305732 3300046680 Bacteria 840
565 Ga0495647_0012470 3300046681 Bacteria 2928
566 Ga0495647_0088441 3300046681 Bacteria 1266
567 Ga0495658_0012202 3300046683 Bacteria 4343
568 Ga0495658_0221438 3300046683 Bacteria 1184
569 Ga0495613_0000579 3300046689 Bacteria 29609
570 Ga0495613_0003570 3300046689 Bacteria 11656
571 Ga0495613_0004560 3300046689 Bacteria 10392
572 Ga0495613_0034291 3300046689 Bacteria 3770
573 Ga0495613_0037980 3300046689 Bacteria 3569
574 Ga0495613_0041547 3300046689 Bacteria 3405
575 Ga0495613_0051096 3300046689 Bacteria 3048
576 Ga0495613_0072923 3300046689 Bacteria 2502
577 Ga0495613_0242600 3300046689 Bacteria 1259
578 Ga0495624_0014782 3300046690 Bacteria 5286
579 Ga0495624_0026585 3300046690 Bacteria 3791
580 Ga0495624_0051779 3300046690 Bacteria 2596
581 Ga0495624_0137418 3300046690 Bacteria 1498
582 Ga0495624_0166115 3300046690 Bacteria 1347
583 Ga0495624_0191355 3300046690 Bacteria 1244
584 Ga0495624_0303637 3300046690 Bacteria 962
585 Ga0495624_0347297 3300046690 Bacteria 892
586 Ga0495649_0052614 3300046694 Bacteria 2206
587 Ga0495589_0008211 3300046794 Bacteria 5459
588 Ga0495600_0000897 3300046809 Bacteria 15933
589 Ga0495600_0011883 3300046809 Bacteria 5437
590 Ga0495600_0037522 3300046809 Bacteria 3150
591 Ga0495600_0042432 3300046809 Bacteria 2965
592 Ga0495600_0093236 3300046809 Bacteria 1964
593 Ga0495600_0098077 3300046809 Bacteria 1910
594 Ga0495600_0104650 3300046809 Bacteria 1844
595 Ga0495660_0015042 3300046810 Bacteria 4473
596 Ga0495581_0029101 3300047315 Bacteria 3202
597 Ga0495581_0044606 3300047315 Bacteria 2564
598 Ga0495581_0045749 3300047315 Bacteria 2529
599 Ga0495581_0046539 3300047315 Bacteria 2507
600 Ga0495581_0055069 3300047315 Bacteria 2296
601 Ga0495581_0061645 3300047315 Bacteria 2167
602 Ga0495581_0161283 3300047315 Bacteria 1311
603 Ga0495604_0000213 3300047317 Bacteria 53409
604 Ga0495604_0007672 3300047317 Bacteria 8545
605 Ga0495604_0016298 3300047317 Bacteria 5938
606 Ga0495604_0033683 3300047317 Bacteria 4054
607 Ga0495604_0036763 3300047317 Bacteria 3859
608 Ga0495604_0068526 3300047317 Bacteria 2692
609 Ga0495604_0349035 3300047317 Bacteria 983
610 Ga0495604_0662148 3300047317 Bacteria 665
611 Ga0495604_0760738 3300047317 Bacteria 612
612 Ga0495636_0017923 3300047318 Bacteria 2838
613 Ga0495674_0027131 3300047319 Bacteria 5238
614 Ga0495674_0126704 3300047319 Bacteria 2153
615 Ga0495674_0133838 3300047319 Bacteria 2087
616 Ga0495674_0186388 3300047319 Bacteria 1726
617 Ga0495674_0277232 3300047319 Bacteria 1374
618 Ga0495674_0621635 3300047319 Bacteria 854
619 Ga0495676_0000413 3300047321 Bacteria 34737
620 Ga0495676_0007049 3300047321 Bacteria 10312
621 Ga0495676_0007443 3300047321 Bacteria 10045
622 Ga0495676_0012405 3300047321 Bacteria 7676
623 Ga0495676_0019011 3300047321 Bacteria 6051
624 Ga0495676_0046396 3300047321 Bacteria 3526
625 Ga0495676_0179302 3300047321 Bacteria 1486
626 Ga0495676_0216303 3300047321 Bacteria 1323
627 Ga0495676_0303311 3300047321 Bacteria 1076
628 Ga0495676_0443858 3300047321 Bacteria 856
629 Ga0495680_0011221 3300047322 Bacteria 7956
630 Ga0495680_0017182 3300047322 Bacteria 6188
631 Ga0495680_0032105 3300047322 Bacteria 4266
632 Ga0495680_0449225 3300047322 Bacteria 882
633 Ga0495680_0525840 3300047322 Bacteria 800
634 Ga0495683_0007937 3300047323 Bacteria 5695
635 Ga0495683_0202620 3300047323 Bacteria 894
636 Ga0495687_005538 3300047443 Bacteria 8011
637 Ga0495687_048770 3300047443 Bacteria 1814
638 Ga0495675_0008798 3300047444 Bacteria 6268
639 Ga0495675_0016045 3300047444 Bacteria 4736
640 Ga0495675_0016810 3300047444 Bacteria 4627
641 Ga0495675_0048644 3300047444 Bacteria 2697
642 Ga0495675_0085803 3300047444 Bacteria 1979
643 Ga0495675_0121374 3300047444 Bacteria 1627
644 Ga0495675_0200808 3300047444 Bacteria 1214
645 Ga0495675_0592878 3300047444 Bacteria 629
646 Ga0495685_009439 3300047447 Bacteria 3258
647 Ga0495684_0006269 3300047471 Bacteria 9242
648 Ga0495684_0009269 3300047471 Bacteria 7598
649 Ga0495684_0024539 3300047471 Bacteria 4641
650 Ga0495684_0046334 3300047471 Bacteria 3326
651 Ga0495684_0149424 3300047471 Bacteria 1747
652 Ga0495684_0288668 3300047471 Bacteria 1181
653 Ga0495684_0388289 3300047471 Bacteria 983
654 Ga0495686_0407058 3300047472 Bacteria 729
655 Ga0495593_0001410 3300047673 Bacteria 14074
656 Ga0495593_0001417 3300047673 Bacteria 14054
657 Ga0495593_0005086 3300047673 Bacteria 7779
658 Ga0495593_0017932 3300047673 Bacteria 3984
659 Ga0495593_0018942 3300047673 Bacteria 3862
660 Ga0495593_0040977 3300047673 Bacteria 2492
661 Ga0495593_0064816 3300047673 Bacteria 1906
662 Ga0495593_0398174 3300047673 Bacteria 688
663 Ga0495602_0034728 3300048088 Bacteria 4711
664 Ga0495602_0036385 3300048088 Bacteria 4582
665 Ga0495602_0041109 3300048088 Bacteria 4227
666 Ga0495602_0043114 3300048088 Bacteria 4105
667 Ga0495602_0292612 3300048088 Bacteria 1195
668 Ga0495614_0001226 3300048089 Bacteria 11036
669 Ga0495614_0002852 3300048089 Bacteria 7690
670 Ga0495614_0006927 3300048089 Bacteria 5066
671 Ga0495614_0009781 3300048089 Bacteria 4237
672 Ga0495614_0039539 3300048089 Bacteria 2024
673 Ga0495614_0049247 3300048089 Bacteria 1806
674 Ga0495614_0063615 3300048089 Bacteria 1586
675 Ga0495614_0455935 3300048089 Bacteria 605
676 Ga0496100_0073431 3300048903 Bacteria 2289
677 Ga0496100_0396489 3300048903 Bacteria 1050
678 Ga0496101_0229244 3300048904 Bacteria 1443
679 Ga0496102_0065207 3300048905 Bacteria 3337
680 Ga0496102_0068020 3300048905 Bacteria 3268
681 Ga0496102_0100265 3300048905 Bacteria 2689
682 Ga0496102_0144939 3300048905 Bacteria 2228
683 Ga0496102_0353113 3300048905 Bacteria 1384
684 Ga0496103_0042588 3300048906 Bacteria 2795
685 Ga0496103_0079491 3300048906 Bacteria 2061
686 Ga0496103_0452359 3300048906 Bacteria 824
687 Ga0496104_0173390 3300048907 Bacteria 2067
688 Ga0496104_1192309 3300048907 Bacteria 665
689 Ga0496105_0040655 3300048908 Bacteria 3834
690 Ga0496105_1174447 3300048908 Bacteria 566
691 Ga0496106_0041445 3300048909 Bacteria 3450
692 Ga0496106_0132087 3300048909 Bacteria 1959
693 Ga0496107_0167108 3300048910 Bacteria 1631
694 Ga0496108_0000008 3300048911 Bacteria 294619
695 Ga0496108_0027651 3300048911 Bacteria 4688
696 Ga0496108_0079020 3300048911 Bacteria 2785
697 Ga0496109_0031871 3300048912 Bacteria 4735
698 Ga0496109_0115047 3300048912 Bacteria 2503
699 Ga0496109_0327745 3300048912 Bacteria 1445
700 Ga0496109_0587067 3300048912 Bacteria 1050
701 Ga0496109_0836099 3300048912 Bacteria 859
702 Ga0496110_1208806 3300048913 Bacteria 665
703 Ga0496112_0028581 3300048915 Bacteria 5384
704 Ga0496112_0092793 3300048915 Bacteria 2989
705 Ga0496112_0306377 3300048915 Bacteria 1533
706 Ga0496113_0194423 3300048916 Bacteria 1611
707 Ga0496113_0268856 3300048916 Bacteria 1362
708 Ga0496114_0028721 3300048917 Bacteria 4566
709 Ga0496115_0644765 3300048918 Bacteria 838
710 Ga0496126_0438489 3300048929 Bacteria 1053
711 Ga0501031_0269643 3300049568 Bacteria 1105
712 Ga0501033_0111251 3300049570 Bacteria 1993
713 Ga0501034_0010899 3300049571 Bacteria 9442
714 Ga0501036_0004622 3300049572 Bacteria 11125
715 Ga0501037_0245255 3300049573 Bacteria 1255
716 Ga0501043_0782860 3300049579 Bacteria 691
717 Ga0501046_0179361 3300049580 Bacteria 1585
718 Ga0501047_0066033 3300049581 Bacteria 3487
719 Ga0501047_0144943 3300049581 Bacteria 2252
720 Ga0501048_1249945 3300049582 Bacteria 534
721 Ga0501070_0050320 3300049586 Bacteria 3459
722 Ga0501070_0052949 3300049586 Bacteria 3368
723 Ga0501074_0041454 3300049590 Bacteria 3333
724 Ga0501074_1152675 3300049590 Bacteria 544
725 Ga0501080_0019705 3300049742 Bacteria 6247
726 Ga0501035_0167830 3300049822 Bacteria 1897
727 Ga0501035_0252789 3300049822 Bacteria 1496
728 Ga0501044_0035637 3300049823 Bacteria 5210
729 nmdc:mga0yw44_54757_c1 3300050492 Bacteria 2426
730 nmdc:mga06z11_287133_c1 3300050494 Bacteria 975
731 nmdc:mga05p37_1318_c1 3300050507 Bacteria 28884
732 nmdc:mga09592_83_c1 3300050508 Bacteria 55635
733 nmdc:mga0qj67_28459_c1 3300050509 Bacteria 4337
734 nmdc:mga06r32_3179_c1 3300050510 Bacteria 14713
735 nmdc:mga08y16_3119_c1 3300050511 Bacteria 17158
736 nmdc:mga0n895_461534_c1 3300050512 Bacteria 1282
737 Ga0495601_0013938 3300053077 Bacteria 4841
738 Ga0495601_0138117 3300053077 Bacteria 1589
739 Ga0495601_0275765 3300053077 Bacteria 1096
740 Ga0495612_0000785 3300053078 Bacteria 12917
741 Ga0495612_0028516 3300053078 Bacteria 2248
742 Ga0495612_0292437 3300053078 Bacteria 730
743 Ga0495595_0015282 3300053084 Bacteria 3272
744 Ga0495595_0065707 3300053084 Bacteria 1706
745 Ga0495595_0066854 3300053084 Bacteria 1693
746 Ga0495595_0192510 3300053084 Bacteria 1014
747 Ga0495595_0400141 3300053084 Bacteria 696
748 Ga0495619_0010893 3300053085 Bacteria 5722
749 Ga0495619_0213321 3300053085 Bacteria 1337
750 Ga0500646_0000221 3300053090 Bacteria 17160
751 Ga0500640_001018 3300053095 Bacteria 7972
752 Ga0500553_102948 3300053101 Bacteria 1223
753 Ga0500560_005640 3300053107 Bacteria 2789
754 Ga0500573_0013160 3300053140 Bacteria 4657
755 Ga0500624_004099 3300053157 Bacteria 1910
756 Ga0500639_288596 3300053163 Bacteria 626
757 Ga0501084_0354131 3300054114 Bacteria 1240
758 Ga0466962_0000573 3300061719 Bacteria 16169
759 2559432350 2558860280 Bacteria 11429938
760 2808848908 2808606359 Bacteria 9866990
761 2809229045 2808606448 Bacteria 8656184
762 2862581031 2862574272 Bacteria 10567477
763 2912728470 2912723979 Bacteria 8557534
764 2954005569 2954002825 Bacteria 9173742
765 2995468230 2995463766 Bacteria 8577691
766 8008580956 8008574985 Bacteria 7815457
767 Ga0070714_100568855
768 rootL2_10084405
769 rootL2_10108025
770 Ga0070680_100311583
771 Ga0070680_100721426
772 Ga0070689_101416349
773 Ga0070691_10098059
774 Ga0070671_100670934
775 Ga0070709_10011964
776 Ga0070709_10020043
777 Ga0070709_10057331
778 Ga0070709_10084947
779 Ga0070709_10222140
780 Ga0070709_10322338
781 Ga0070709_10524790
782 Ga0070709_10900077
783 Ga0070714_100000002
784 Ga0070714_100004894
785 Ga0070714_100024164
786 Ga0070714_100113590
787 Ga0070714_100249267
788 Ga0070714_100254912
789 Ga0070714_100275520
790 Ga0070714_100285746
791 Ga0070714_100466889
792 Ga0070714_100772611
793 Ga0070714_100823619
794 Ga0070713_100014868
795 Ga0070713_100027148
796 Ga0070713_100053572
797 Ga0070713_100055713
798 Ga0070713_100094423
799 Ga0070713_100101028
800 Ga0070713_100181144
801 Ga0070713_100186808
802 Ga0070713_100260586
803 Ga0070713_100445495
804 Ga0070713_100795355
805 Ga0070713_101159604
806 Ga0070710_10016510
807 Ga0070710_10068810
808 Ga0070710_10330472
809 Ga0070710_10375208
810 Ga0070710_11024761
811 Ga0070711_100011677
812 Ga0070711_100031838
813 Ga0070711_100047650
814 Ga0070711_100067208
815 Ga0070711_100249518
816 Ga0070711_100617760
817 Ga0070711_100703432
818 Ga0070694_100429695
819 Ga0070663_101123361
820 Ga0070685_10277627
821 Ga0070706_100125570
822 Ga0070698_100026601
823 Ga0070679_101054025
824 Ga0070684_101956053
825 Ga0068853_100007266
826 Ga0070695_100250465
827 Ga0070693_100185059
828 Ga0070665_100403377
829 Ga0070665_100528263
830 Ga0070665_101167339
831 Ga0068855_100543389
832 Ga0068855_101102296
833 Ga0068856_101418503
834 Ga0070702_100626267
835 Ga0068852_101041442
836 Ga0068863_100019662
837 Ga0068863_100833262
838 Ga0068860_100777634
839 Ga0081455_10017069
840 Ga0081455_10170693
841 Ga0081455_10177600
842 Ga0081455_10531705
843 Ga0070717_10012266
844 Ga0070717_10025069
845 Ga0070717_10102540
846 Ga0070717_10111084
847 Ga0070717_10153550
848 Ga0070717_10156062
849 Ga0070717_10169831
850 Ga0070717_10187790
851 Ga0070717_10267866
852 Ga0070715_10062999
853 Ga0070715_10077013
854 Ga0070715_10245869
855 Ga0070715_10582930
856 Ga0070716_100000653
857 Ga0070716_100004013
858 Ga0070716_100399966
859 Ga0070716_100924848
860 Ga0070716_101173477
861 Ga0070712_100023404
862 Ga0070712_100065592
863 Ga0070712_100128244
864 Ga0070712_100150513
865 Ga0070712_100752905
866 Ga0070712_100812792
867 Ga0070712_101435650
868 Ga0097621_100028180
869 Ga0068871_100558986
870 Ga0068871_100705136
871 Ga0075428_100003781
872 Ga0075430_100031446
873 Ga0075431_100000561
874 Ga0075434_100887238
875 Ga0075429_100002390
876 Ga0105240_10471697
877 Ga0111539_10036831
878 Ga0105245_10043179
879 Ga0105245_11453844
880 Ga0114129_10022262
881 Ga0105243_10884333
882 Ga0105241_10318795
883 Ga0105241_10737562
884 Ga0105241_11356922
885 Ga0105242_12459827
886 Ga0105248_10278699
887 Ga0105248_10855628
888 Ga0105237_10306667
889 Ga0105238_10003581
890 Ga0105238_10840564
891 Ga0105249_10237874
892 Ga0105249_10337500
893 Ga0105249_10893573
894 Ga0105239_10285112
895 Ga0105239_10765623
896 Ga0105246_10993075
897 Ga0157369_10476446
898 Ga0157374_10071290
899 Ga0157374_11530276
900 Ga0157378_10952279
901 Ga0163162_10011922
902 Ga0163162_11190769
903 Ga0163162_11418037
904 Ga0157372_10033630
905 Ga0157372_10167139
906 Ga0157372_10655349
907 Ga0157375_10534806
908 Ga0157375_10645878
909 Ga0163163_10089435
910 Ga0163163_10893745
911 Ga0157377_10046505
912 Ga0157377_10408231
913 Ga0157379_10079187
914 Ga0157379_10973660
915 Ga0157376_10175626
916 Ga0157376_11427687
917 Ga0163161_10398645
918 Ga0206353_11027777
919 Ga0213875_10000292
920 Ga0224572_1040972
921 Ga0207653_10004578
922 Ga0207692_10006997
923 Ga0207692_10044544
924 Ga0207692_10057951
925 Ga0207685_10021398
926 Ga0207685_10039128
927 Ga0207685_10054426
928 Ga0207699_10005414
929 Ga0207699_10006116
930 Ga0207699_10023525
931 Ga0207699_10050788
932 Ga0207699_10545471
933 Ga0207699_10635563
934 Ga0207699_10737235
935 Ga0207684_10088849
936 Ga0207707_10197709
937 Ga0207695_10644889
938 Ga0207671_10188920
939 Ga0207671_10523291
940 Ga0207671_11199295
941 Ga0207693_10019173
942 Ga0207693_10146190
943 Ga0207693_10155476
944 Ga0207693_10235258
945 Ga0207693_10355867
946 Ga0207693_10375847
947 Ga0207693_10495372
948 Ga0207693_10710639
949 Ga0207693_10717636
950 Ga0207663_10004437
951 Ga0207663_10053080
952 Ga0207663_10054828
953 Ga0207663_10484557
954 Ga0207663_10710265
955 Ga0207663_10776195
956 Ga0207652_10321987
957 Ga0207646_11486481
958 Ga0207681_10994242
959 Ga0207687_10303501
960 Ga0207700_10002223
961 Ga0207700_10023087
962 Ga0207700_10025092
963 Ga0207700_10058674
964 Ga0207700_10107824
965 Ga0207700_10185802
966 Ga0207700_10258461
967 Ga0207700_10285579
968 Ga0207700_10528357
969 Ga0207700_10595375
970 Ga0207700_10732744
971 Ga0207664_10000038
972 Ga0207664_10001019
973 Ga0207664_10004501
974 Ga0207664_10014738
975 Ga0207664_10021083
976 Ga0207664_10064185
977 Ga0207664_10092851
978 Ga0207664_10194102
979 Ga0207664_10209156
980 Ga0207664_10282085
981 Ga0207664_10368206
982 Ga0207704_10170999
983 Ga0207665_10003632
984 Ga0207665_10019308
985 Ga0207667_10414169
986 Ga0207712_10968063
987 Ga0207712_10974813
988 Ga0207677_10285109
989 Ga0207639_10668126
990 Ga0207702_10145653
991 Ga0207702_10497247
992 Ga0207641_10302866
993 Ga0207641_10614045
994 Ga0207641_10886387
995 Ga0207675_100060371
996 Ga0207428_10001600
997 Ga0268266_10090313
998 Ga0268264_10821194
999 Ga0265336_10018452
1000 Ga0307515_10073249
1001 Ga0265338_10056948
1002 Ga0307511_10027833
1003 Ga0307512_10031684
1004 Ga0307512_10054038
1005 Ga0265760_10002529
1006 Ga0265327_10001233
1007 Ga0307513_10492236
1008 Ga0307509_10010033
1009 Ga0307509_10031483
1010 Ga0307508_10003230
1011 Ga0307508_10006304
1012 Ga0307508_10008673
1013 Ga0307508_10121572
1014 Ga0307508_10710677
1015 Ga0307514_10001453
1016 Ga0307514_10176687
1017 Ga0307516_10401771
1018 Ga0307507_10013841
1019 Ga0307507_10027613
1020 Ga0307510_10051842
1021 Ga0307510_10302859
1022 Ga0316214_1002889
1023 Ga0373926_0002104
1024 Ga0373926_0071310
1025 Ga0373926_0150766
1026 Ga0373928_0021387
1027 Ga0373934_0027760
1028 Ga0373952_0035506
1029 Ga0373923_0006446
1030 Ga0373923_0010421
1031 Ga0373923_0013947
1032 Ga0373923_0014732
1033 Ga0373923_0081937
1034 Ga0373923_0317066
1035 Ga0373932_0105138
1036 Ga0373936_0003325
1037 Ga0373936_0016328
1038 Ga0373936_0035107
1039 Ga0373936_0048386
1040 Ga0373936_0207638
1041 Ga0373939_0189086
1042 Ga0373945_0001913
1043 Ga0373945_0107401
1044 Ga0373945_0122932
1045 Ga0373953_0031037
1046 Ga0373953_0069094
1047 Ga0373954_0021962
1048 Ga0373954_0094532
1049 Ga0373956_0005350
1050 Ga0373956_0036943
1051 Ga0373956_0187241
1052 Ga0373957_0004620
1053 Ga0373957_0005985
1054 Ga0373943_0001615
1055 Ga0373943_0016115
1056 Ga0373943_0063589
1057 Ga0373943_0358659
1058 Ga0373943_0599148
1059 Ga0373946_0011715
1060 Ga0373946_0068066
1061 Ga0373946_0279713
1062 Ga0373946_0663630
1063 Ga0373955_0001158
1064 Ga0373955_0005591
1065 Ga0373955_0026119
1066 Ga0373942_0000592
1067 Ga0373924_0002060
1068 Ga0373924_0004820
1069 Ga0373924_0017223
1070 Ga0373924_0277874
1071 Ga0373935_0006326
1072 Ga0373935_0012391
1073 Ga0373935_0029065
1074 Ga0373935_0084253
1075 Ga0373935_0140497
1076 Ga0373935_0280325
1077 Ga0373927_0061764
1078 Ga0373927_0247725
1079 Ga0373927_0337928
1080 Ga0373933_0001299
1081 Ga0373933_0159974
1082 Ga0373933_0222747
1083 Ga0373947_0038465
1084 Ga0373947_0058674
1085 Ga0373947_0089509
1086 Ga0373947_0174016
1087 Ga0373937_0024671
1088 Ga0373937_0049692
1089 Ga0373937_0085106
1090 Ga0373937_0445520
1091 Ga0373937_0597650
1092 Ga0373937_0790170
1093 Ga0373925_0006890
1094 Ga0373925_0014271
1095 Ga0373925_0025650
1096 Ga0373925_0031631
1097 Ga0373925_0151505
1098 Ga0373925_0152860
1099 Ga0373925_0813129
1100 Ga0395900_0366696
1101 Ga0395898_0013982
1102 Ga0395898_0036257
1103 Ga0395898_0955292
1104 Ga0436364_0734194
1105 Ga0436364_1135881
1106 Ga0436364_1492889
1107 Ga0395901_1511939
1108 Ga0451853_1612332
1109 Ga0439448_0001710
1110 Ga0439449_0003066
1111 Ga0439455_0001546
1112 Ga0450903_000007
1113 Ga0450901_006245
1114 Ga0466969_0254225
1115 Ga0466972_0196171
1116 Ga0466965_0002942
1117 Ga0466966_0001649
1118 Ga0466966_0008575
1119 Ga0466961_0003202
1120 Ga0466961_0114108
1121 Ga0466963_0000620
1122 Ga0466964_0005892
1123 Ga0466964_0301387
1124 Ga0466964_0360884
1125 Ga0466971_0001206
1126 Ga0466971_0080919
1127 Ga0466971_0262549
1128 Ga0466968_0102463
1129 Ga0466970_0004261
1130 Ga0466970_0057650
1131 Ga0466970_0272537
1132 Ga0466957_0000473
1133 Ga0466959_0000889
1134 Ga0466959_0534903
1135 Ga0466958_0008253
1136 Ga0466967_0024595
1137 Ga0466967_0999620
1138 Ga0495592_0000533
1139 Ga0495592_0016679
1140 Ga0495592_0022893
1141 Ga0495592_0053249
1142 Ga0495592_0067145
1143 Ga0495592_0137888
1144 Ga0495603_0001324
1145 Ga0495603_0013490
1146 Ga0495603_0077956
1147 Ga0495603_0261569
1148 Ga0495590_0039283
1149 Ga0495629_0006195
1150 Ga0495629_0013660
1151 Ga0495629_0041457
1152 Ga0495629_0058261
1153 Ga0495629_0102115
1154 Ga0495629_0183874
1155 Ga0495629_0222137
1156 Ga0495629_0305386
1157 Ga0495629_0713476
1158 Ga0495638_0506044
1159 Ga0495641_0009673
1160 Ga0495641_0011378
1161 Ga0495641_0068268
1162 Ga0495641_0077741
1163 Ga0495641_0193824
1164 Ga0495641_0473838
1165 Ga0495651_0014285
1166 Ga0495651_0029913
1167 Ga0495651_0043753
1168 Ga0495651_0070812
1169 Ga0495651_0084811
1170 Ga0495653_0027494
1171 Ga0495653_0121661
1172 Ga0495653_0447315
1173 Ga0495650_0030732
1174 Ga0495580_0008335
1175 Ga0495580_0365737
1176 Ga0495582_0001439
1177 Ga0495582_0034703
1178 Ga0495582_0057206
1179 Ga0495582_0221088
1180 Ga0495605_0001547
1181 Ga0495605_0041493
1182 Ga0495639_0004306
1183 Ga0495639_0011573
1184 Ga0495639_0055730
1185 Ga0495662_0000937
1186 Ga0495662_0010527
1187 Ga0495662_0071327
1188 Ga0495662_0089858
1189 Ga0495662_0115775
1190 Ga0495662_0137773
1191 Ga0495662_0221101
1192 Ga0495662_0243110
1193 Ga0495664_0001190
1194 Ga0495664_0029289
1195 Ga0495664_0107735
1196 Ga0495664_0195971
1197 Ga0495664_0269328
1198 Ga0495664_0318321
1199 Ga0495584_0055583
1200 Ga0495584_0266431
1201 Ga0495585_0064676
1202 Ga0495594_0061925
1203 Ga0495594_0104436
1204 Ga0495583_0035445
1205 Ga0495606_0012897
1206 Ga0495606_0268620
1207 Ga0495608_0011405
1208 Ga0495608_0072053
1209 Ga0495610_0221946
1210 Ga0495618_0013181
1211 Ga0495618_0044213
1212 Ga0495618_0088468
1213 Ga0495618_0128018
1214 Ga0495618_0246948
1215 Ga0495618_0334798
1216 Ga0495620_0003274
1217 Ga0495620_0143312
1218 Ga0495628_0029616
1219 Ga0495628_0040030
1220 Ga0495628_0142315
1221 Ga0495628_0156061
1222 Ga0495628_0243619
1223 Ga0495628_0420853
1224 Ga0495630_0026182
1225 Ga0495630_0058558
1226 Ga0495630_0139751
1227 Ga0495630_0225046
1228 Ga0495630_0242821
1229 Ga0495643_0002317
1230 Ga0495643_0011043
1231 Ga0495644_0013948
1232 Ga0495648_0016834
1233 Ga0495648_0220593
1234 Ga0495666_0005521
1235 Ga0495666_0079047
1236 Ga0495666_0192996
1237 Ga0495642_0081960
1238 Ga0495652_0000731
1239 Ga0495652_0014378
1240 Ga0495652_0055391
1241 Ga0495652_0093259
1242 Ga0495652_0120359
1243 Ga0495652_0126860
1244 Ga0495652_0498733
1245 Ga0495652_0811023
1246 Ga0495665_0002348
1247 Ga0495665_0007767
1248 Ga0495665_0010861
1249 Ga0495665_0011827
1250 Ga0495665_0039988
1251 Ga0495665_0149861
1252 Ga0495665_0218889
1253 Ga0495640_0041139
1254 Ga0495640_0051824
1255 Ga0495640_0059553
1256 Ga0495640_0086954
1257 Ga0495640_0450208
1258 Ga0495586_0025368
1259 Ga0495586_0038621
1260 Ga0495586_0050344
1261 Ga0495586_0300648
1262 Ga0495587_0002717
1263 Ga0495587_0003610
1264 Ga0495587_0005655
1265 Ga0495587_0019081
1266 Ga0495587_0161804
1267 Ga0495597_0208176
1268 Ga0495645_0006572
1269 Ga0495645_0025115
1270 Ga0495645_0043329
1271 Ga0495645_0071310
1272 Ga0495645_0080121
1273 Ga0495645_0080211
1274 Ga0495645_0134378
1275 Ga0495645_0338457
1276 Ga0495622_0069359
1277 Ga0495667_0014966
1278 Ga0495667_0022967
1279 Ga0495667_0062793
1280 Ga0495667_0092703
1281 Ga0495667_0168757
1282 Ga0495667_0332895
1283 Ga0495667_0508456
1284 Ga0495668_0011363
1285 Ga0495668_0180789
1286 Ga0495634_0001842
1287 Ga0495634_0006619
1288 Ga0495634_0015575
1289 Ga0495634_0022206
1290 Ga0495634_0030742
1291 Ga0495634_0091807
1292 Ga0495634_0171832
1293 Ga0495634_0660839
1294 Ga0495611_0020514
1295 Ga0495625_0441559
1296 Ga0495635_0009265
1297 Ga0495635_0033666
1298 Ga0495635_0035697
1299 Ga0495635_0036617
1300 Ga0495635_0065637
1301 Ga0495635_0072291
1302 Ga0495635_0118719
1303 Ga0495635_0133882
1304 Ga0495635_0253660
1305 Ga0495635_0464252
1306 Ga0495588_0099672
1307 Ga0495657_0001951
1308 Ga0495657_0007880
1309 Ga0495657_0010131
1310 Ga0495657_0023926
1311 Ga0495657_0036154
1312 Ga0495657_0106359
1313 Ga0495599_0034176
1314 Ga0495599_0100141
1315 Ga0495599_0251017
1316 Ga0495599_0252074
1317 Ga0495599_0328185
1318 Ga0495623_0004911
1319 Ga0495623_0016907
1320 Ga0495623_0038511
1321 Ga0495623_0100646
1322 Ga0495623_0141211
1323 Ga0495646_0001163
1324 Ga0495646_0001297
1325 Ga0495646_0005089
1326 Ga0495646_0006708
1327 Ga0495646_0051478
1328 Ga0495646_0112384
1329 Ga0495646_0168922
1330 Ga0495646_0305732
1331 Ga0495647_0012470
1332 Ga0495647_0088441
1333 Ga0495658_0012202
1334 Ga0495658_0221438
1335 Ga0495613_0000579
1336 Ga0495613_0003570
1337 Ga0495613_0004560
1338 Ga0495613_0034291
1339 Ga0495613_0037980
1340 Ga0495613_0041547
1341 Ga0495613_0051096
1342 Ga0495613_0072923
1343 Ga0495613_0242600
1344 Ga0495624_0014782
1345 Ga0495624_0026585
1346 Ga0495624_0051779
1347 Ga0495624_0137418
1348 Ga0495624_0166115
1349 Ga0495624_0191355
1350 Ga0495624_0303637
1351 Ga0495624_0347297
1352 Ga0495649_0052614
1353 Ga0495589_0008211
1354 Ga0495600_0000897
1355 Ga0495600_0011883
1356 Ga0495600_0037522
1357 Ga0495600_0042432
1358 Ga0495600_0093236
1359 Ga0495600_0098077
1360 Ga0495600_0104650
1361 Ga0495660_0015042
1362 Ga0495581_0029101
1363 Ga0495581_0044606
1364 Ga0495581_0045749
1365 Ga0495581_0046539
1366 Ga0495581_0055069
1367 Ga0495581_0061645
1368 Ga0495581_0161283
1369 Ga0495604_0000213
1370 Ga0495604_0007672
1371 Ga0495604_0016298
1372 Ga0495604_0033683
1373 Ga0495604_0036763
1374 Ga0495604_0068526
1375 Ga0495604_0349035
1376 Ga0495604_0662148
1377 Ga0495604_0760738
1378 Ga0495636_0017923
1379 Ga0495674_0027131
1380 Ga0495674_0126704
1381 Ga0495674_0133838
1382 Ga0495674_0186388
1383 Ga0495674_0277232
1384 Ga0495674_0621635
1385 Ga0495676_0000413
1386 Ga0495676_0007049
1387 Ga0495676_0007443
1388 Ga0495676_0012405
1389 Ga0495676_0019011
1390 Ga0495676_0046396
1391 Ga0495676_0179302
1392 Ga0495676_0216303
1393 Ga0495676_0303311
1394 Ga0495676_0443858
1395 Ga0495680_0011221
1396 Ga0495680_0017182
1397 Ga0495680_0032105
1398 Ga0495680_0449225
1399 Ga0495680_0525840
1400 Ga0495683_0007937
1401 Ga0495683_0202620
1402 Ga0495687_005538
1403 Ga0495687_048770
1404 Ga0495675_0008798
1405 Ga0495675_0016045
1406 Ga0495675_0016810
1407 Ga0495675_0048644
1408 Ga0495675_0085803
1409 Ga0495675_0121374
1410 Ga0495675_0200808
1411 Ga0495675_0592878
1412 Ga0495685_009439
1413 Ga0495684_0006269
1414 Ga0495684_0009269
1415 Ga0495684_0024539
1416 Ga0495684_0046334
1417 Ga0495684_0149424
1418 Ga0495684_0288668
1419 Ga0495684_0388289
1420 Ga0495686_0407058
1421 Ga0495593_0001410
1422 Ga0495593_0001417
1423 Ga0495593_0005086
1424 Ga0495593_0017932
1425 Ga0495593_0018942
1426 Ga0495593_0040977
1427 Ga0495593_0064816
1428 Ga0495593_0398174
1429 Ga0495602_0034728
1430 Ga0495602_0036385
1431 Ga0495602_0041109
1432 Ga0495602_0043114
1433 Ga0495602_0292612
1434 Ga0495614_0001226
1435 Ga0495614_0002852
1436 Ga0495614_0006927
1437 Ga0495614_0009781
1438 Ga0495614_0039539
1439 Ga0495614_0049247
1440 Ga0495614_0063615
1441 Ga0495614_0455935
1442 Ga0496100_0073431
1443 Ga0496100_0396489
1444 Ga0496101_0229244
1445 Ga0496102_0065207
1446 Ga0496102_0068020
1447 Ga0496102_0100265
1448 Ga0496102_0144939
1449 Ga0496102_0353113
1450 Ga0496103_0042588
1451 Ga0496103_0079491
1452 Ga0496103_0452359
1453 Ga0496104_0173390
1454 Ga0496104_1192309
1455 Ga0496105_0040655
1456 Ga0496105_1174447
1457 Ga0496106_0041445
1458 Ga0496106_0132087
1459 Ga0496107_0167108
1460 Ga0496108_0000008
1461 Ga0496108_0027651
1462 Ga0496108_0079020
1463 Ga0496109_0031871
1464 Ga0496109_0115047
1465 Ga0496109_0327745
1466 Ga0496109_0587067
1467 Ga0496109_0836099
1468 Ga0496110_1208806
1469 Ga0496112_0028581
1470 Ga0496112_0092793
1471 Ga0496112_0306377
1472 Ga0496113_0194423
1473 Ga0496113_0268856
1474 Ga0496114_0028721
1475 Ga0496115_0644765
1476 Ga0496126_0438489
1477 Ga0501031_0269643
1478 Ga0501033_0111251
1479 Ga0501034_0010899
1480 Ga0501036_0004622
1481 Ga0501037_0245255
1482 Ga0501043_0782860
1483 Ga0501046_0179361
1484 Ga0501047_0066033
1485 Ga0501047_0144943
1486 Ga0501048_1249945
1487 Ga0501070_0050320
1488 Ga0501070_0052949
1489 Ga0501074_0041454
1490 Ga0501074_1152675
1491 Ga0501080_0019705
1492 Ga0501035_0167830
1493 Ga0501035_0252789
1494 Ga0501044_0035637
1495 nmdc:mga0yw44_54757_c1
1496 nmdc:mga06z11_287133_c1
1497 nmdc:mga05p37_1318_c1
1498 nmdc:mga09592_83_c1
1499 nmdc:mga0qj67_28459_c1
1500 nmdc:mga06r32_3179_c1
1501 nmdc:mga08y16_3119_c1
1502 nmdc:mga0n895_461534_c1
1503 Ga0495601_0013938
1504 Ga0495601_0138117
1505 Ga0495601_0275765
1506 Ga0495612_0000785
1507 Ga0495612_0028516
1508 Ga0495612_0292437
1509 Ga0495595_0015282
1510 Ga0495595_0065707
1511 Ga0495595_0066854
1512 Ga0495595_0192510
1513 Ga0495595_0400141
1514 Ga0495619_0010893
1515 Ga0495619_0213321
1516 Ga0500646_0000221
1517 Ga0500640_001018
1518 Ga0500553_102948
1519 Ga0500560_005640
1520 Ga0500573_0013160
1521 Ga0500624_004099
1522 Ga0500639_288596
1523 Ga0501084_0354131
1524 Ga0466962_0000573
1525 2559432350
1526 2808848908
1527 2809229045
1528 2862581031
1529 2912728470
1530 2954005569
1531 2995468230
1532 8008580956

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

18

139

0.86

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

3

140

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3igr-assembly1.cif.gz_A the crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a 0.8986 16 169
4u5y-assembly1.cif.gz_A crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica 0.8922 63 169
7kx3-assembly1.cif.gz_B speg spermidine n-acetyltransferase f149g mutant from vibrio cholerae 0.872 48 168
1s7n-assembly1.cif.gz_B ribosomal l7/l12 alpha-n-protein acetyltransferase in complex with coenzyme a (coa free sulfhydryl) 0.8692 17 169
1s7f-assembly1.cif.gz_A-2 riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo) 0.869 17 169
ID Description Score Start End Superfamily
4u5yA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8922 63 169 3.40.630.30
af_P0A948_10_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8754 15 173 3.40.630.30
1z9uA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.866 17 170 3.40.630.30
3r9eB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8583 17 169 3.40.630.30
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.858 53 170 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7K2VER8-F1-model_v4 GNAT family N-acetyltransferase 0.9745 1 169 GO:0016747
AF-D6TUA6-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9505 6 170 GO:0005737
GO:0008999
AF-D6TUA6-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.939 6 170 GO:0005737
GO:0008999
AF-A0A7X8K874-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9259 17 170 GO:0005737
GO:0008999
AF-A0A1G9V929-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9252 16 182 GO:0005737
GO:0008999

Map