F479827
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 766 | 289 | 1532 | 165 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100568855|Ga0070714_1005688552 |
| Length | 199 |
| Sequence | VAELEQLHAGHAAAVLAFELVNRAYFAASISDRGDEFFDQFPDRHSALLAEQEAGICAFYVLVADDGSVLGRFNLYDFEDGTARLGYRVAQQAAGRGVATTAVRELCRTAAARHGLRTLRAATSHDNAASQKVLTKAGFIPVGPATPADLGGKPGTWYQRDLQPETLILWADRPPGGYLCEGDAGSGPSAPAGRRRPWR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 24 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 28 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 35 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 36 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 37 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 38 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 39 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 66 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 67 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 97 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 99 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 100 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 101 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 102 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 103 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 104 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 105 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 106 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 107 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 108 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 109 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 110 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 111 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 112 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 113 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 114 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 115 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 117 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 118 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 119 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 120 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 121 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 122 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 123 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 124 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 125 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 126 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 128 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 129 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 130 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 131 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 132 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 136 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 137 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 138 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 139 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 140 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 141 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 142 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 143 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 144 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 145 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 146 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 147 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 148 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 149 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 150 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 151 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 152 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 153 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 154 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 155 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 156 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 157 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 158 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 243 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 247 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 262 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 263 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 274 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 275 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 276 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 277 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 278 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 279 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 280 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 282 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 283 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 284 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 285 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 286 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 287 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 288 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 289 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.69 |
| Metatranscriptomes | 0.26 |
| Isolates | 1.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.17 |
| Nodule | 0.13 |
| Rhizoplane | 4.44 |
| Rhizosphere | 90.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070714_100568855 | 3300005435 | Bacteria | 1086 |
| 2 | rootL2_10084405 | 3300003322 | Bacteria | 4388 |
| 3 | rootL2_10108025 | 3300003322 | Bacteria | 1586 |
| 4 | Ga0070680_100311583 | 3300005336 | Bacteria | 1335 |
| 5 | Ga0070680_100721426 | 3300005336 | Bacteria | 858 |
| 6 | Ga0070689_101416349 | 3300005340 | Bacteria | 628 |
| 7 | Ga0070691_10098059 | 3300005341 | Bacteria | 1453 |
| 8 | Ga0070671_100670934 | 3300005355 | Bacteria | 898 |
| 9 | Ga0070709_10011964 | 3300005434 | Bacteria | 4850 |
| 10 | Ga0070709_10020043 | 3300005434 | Bacteria | 3875 |
| 11 | Ga0070709_10057331 | 3300005434 | Bacteria | 2467 |
| 12 | Ga0070709_10084947 | 3300005434 | Bacteria | 2074 |
| 13 | Ga0070709_10222140 | 3300005434 | Bacteria | 1348 |
| 14 | Ga0070709_10322338 | 3300005434 | Bacteria | 1134 |
| 15 | Ga0070709_10524790 | 3300005434 | Bacteria | 903 |
| 16 | Ga0070709_10900077 | 3300005434 | Bacteria | 700 |
| 17 | Ga0070714_100000002 | 3300005435 | Bacteria | 386673 |
| 18 | Ga0070714_100004894 | 3300005435 | Bacteria | 10168 |
| 19 | Ga0070714_100024164 | 3300005435 | Bacteria | 4999 |
| 20 | Ga0070714_100113590 | 3300005435 | Bacteria | 2401 |
| 21 | Ga0070714_100249267 | 3300005435 | Bacteria | 1641 |
| 22 | Ga0070714_100254912 | 3300005435 | Bacteria | 1623 |
| 23 | Ga0070714_100275520 | 3300005435 | Bacteria | 1561 |
| 24 | Ga0070714_100285746 | 3300005435 | Bacteria | 1534 |
| 25 | Ga0070714_100466889 | 3300005435 | Bacteria | 1200 |
| 26 | Ga0070714_100772611 | 3300005435 | Bacteria | 929 |
| 27 | Ga0070714_100823619 | 3300005435 | Bacteria | 899 |
| 28 | Ga0070713_100014868 | 3300005436 | Bacteria | 5793 |
| 29 | Ga0070713_100027148 | 3300005436 | Bacteria | 4504 |
| 30 | Ga0070713_100053572 | 3300005436 | Bacteria | 3343 |
| 31 | Ga0070713_100055713 | 3300005436 | Bacteria | 3287 |
| 32 | Ga0070713_100094423 | 3300005436 | Bacteria | 2579 |
| 33 | Ga0070713_100101028 | 3300005436 | Bacteria | 2498 |
| 34 | Ga0070713_100181144 | 3300005436 | Bacteria | 1893 |
| 35 | Ga0070713_100186808 | 3300005436 | Bacteria | 1865 |
| 36 | Ga0070713_100260586 | 3300005436 | Bacteria | 1584 |
| 37 | Ga0070713_100445495 | 3300005436 | Bacteria | 1215 |
| 38 | Ga0070713_100795355 | 3300005436 | Bacteria | 906 |
| 39 | Ga0070713_101159604 | 3300005436 | Bacteria | 747 |
| 40 | Ga0070710_10016510 | 3300005437 | Bacteria | 3759 |
| 41 | Ga0070710_10068810 | 3300005437 | Bacteria | 2035 |
| 42 | Ga0070710_10330472 | 3300005437 | Bacteria | 1003 |
| 43 | Ga0070710_10375208 | 3300005437 | Bacteria | 947 |
| 44 | Ga0070710_11024761 | 3300005437 | Bacteria | 602 |
| 45 | Ga0070711_100011677 | 3300005439 | Bacteria | 5460 |
| 46 | Ga0070711_100031838 | 3300005439 | Bacteria | 3504 |
| 47 | Ga0070711_100047650 | 3300005439 | Bacteria | 2927 |
| 48 | Ga0070711_100067208 | 3300005439 | Bacteria | 2514 |
| 49 | Ga0070711_100249518 | 3300005439 | Bacteria | 1391 |
| 50 | Ga0070711_100617760 | 3300005439 | Bacteria | 906 |
| 51 | Ga0070711_100703432 | 3300005439 | Bacteria | 851 |
| 52 | Ga0070694_100429695 | 3300005444 | Bacteria | 1039 |
| 53 | Ga0070663_101123361 | 3300005455 | Bacteria | 688 |
| 54 | Ga0070685_10277627 | 3300005466 | Bacteria | 1120 |
| 55 | Ga0070706_100125570 | 3300005467 | Bacteria | 2392 |
| 56 | Ga0070698_100026601 | 3300005471 | Bacteria | 6022 |
| 57 | Ga0070679_101054025 | 3300005530 | Bacteria | 757 |
| 58 | Ga0070684_101956053 | 3300005535 | Bacteria | 553 |
| 59 | Ga0068853_100007266 | 3300005539 | Bacteria | 8870 |
| 60 | Ga0070695_100250465 | 3300005545 | Bacteria | 1289 |
| 61 | Ga0070693_100185059 | 3300005547 | Bacteria | 1343 |
| 62 | Ga0070665_100403377 | 3300005548 | Unclassified | 1375 |
| 63 | Ga0070665_100528263 | 3300005548 | Bacteria | 1192 |
| 64 | Ga0070665_101167339 | 3300005548 | Bacteria | 781 |
| 65 | Ga0068855_100543389 | 3300005563 | Bacteria | 1258 |
| 66 | Ga0068855_101102296 | 3300005563 | Bacteria | 830 |
| 67 | Ga0068856_101418503 | 3300005614 | Bacteria | 709 |
| 68 | Ga0070702_100626267 | 3300005615 | Bacteria | 810 |
| 69 | Ga0068852_101041442 | 3300005616 | Bacteria | 838 |
| 70 | Ga0068863_100019662 | 3300005841 | Bacteria | 6460 |
| 71 | Ga0068863_100833262 | 3300005841 | Bacteria | 921 |
| 72 | Ga0068860_100777634 | 3300005843 | Bacteria | 970 |
| 73 | Ga0081455_10017069 | 3300005937 | Bacteria | 6977 |
| 74 | Ga0081455_10170693 | 3300005937 | Bacteria | 1657 |
| 75 | Ga0081455_10177600 | 3300005937 | Bacteria | 1615 |
| 76 | Ga0081455_10531705 | 3300005937 | Bacteria | 782 |
| 77 | Ga0070717_10012266 | 3300006028 | Bacteria | 6534 |
| 78 | Ga0070717_10025069 | 3300006028 | Bacteria | 4737 |
| 79 | Ga0070717_10102540 | 3300006028 | Bacteria | 2431 |
| 80 | Ga0070717_10111084 | 3300006028 | Bacteria | 2338 |
| 81 | Ga0070717_10153550 | 3300006028 | Bacteria | 1993 |
| 82 | Ga0070717_10156062 | 3300006028 | Bacteria | 1977 |
| 83 | Ga0070717_10169831 | 3300006028 | Bacteria | 1896 |
| 84 | Ga0070717_10187790 | 3300006028 | Bacteria | 1804 |
| 85 | Ga0070717_10267866 | 3300006028 | Bacteria | 1512 |
| 86 | Ga0070715_10062999 | 3300006163 | Bacteria | 1633 |
| 87 | Ga0070715_10077013 | 3300006163 | Bacteria | 1504 |
| 88 | Ga0070715_10245869 | 3300006163 | Bacteria | 932 |
| 89 | Ga0070715_10582930 | 3300006163 | Bacteria | 653 |
| 90 | Ga0070716_100000653 | 3300006173 | Bacteria | 14745 |
| 91 | Ga0070716_100004013 | 3300006173 | Bacteria | 6987 |
| 92 | Ga0070716_100399966 | 3300006173 | Bacteria | 987 |
| 93 | Ga0070716_100924848 | 3300006173 | Bacteria | 685 |
| 94 | Ga0070716_101173477 | 3300006173 | Bacteria | 615 |
| 95 | Ga0070712_100023404 | 3300006175 | Bacteria | 4081 |
| 96 | Ga0070712_100065592 | 3300006175 | Bacteria | 2578 |
| 97 | Ga0070712_100128244 | 3300006175 | Bacteria | 1919 |
| 98 | Ga0070712_100150513 | 3300006175 | Bacteria | 1786 |
| 99 | Ga0070712_100752905 | 3300006175 | Bacteria | 834 |
| 100 | Ga0070712_100812792 | 3300006175 | Bacteria | 802 |
| 101 | Ga0070712_101435650 | 3300006175 | Bacteria | 602 |
| 102 | Ga0097621_100028180 | 3300006237 | Bacteria | 4426 |
| 103 | Ga0068871_100558986 | 3300006358 | Bacteria | 1037 |
| 104 | Ga0068871_100705136 | 3300006358 | Bacteria | 925 |
| 105 | Ga0075428_100003781 | 3300006844 | Bacteria | 16591 |
| 106 | Ga0075430_100031446 | 3300006846 | Bacteria | 4505 |
| 107 | Ga0075431_100000561 | 3300006847 | Bacteria | 31306 |
| 108 | Ga0075434_100887238 | 3300006871 | Bacteria | 907 |
| 109 | Ga0075429_100002390 | 3300006880 | Bacteria | 15817 |
| 110 | Ga0105240_10471697 | 3300009093 | Bacteria | 1400 |
| 111 | Ga0111539_10036831 | 3300009094 | Bacteria | 5912 |
| 112 | Ga0105245_10043179 | 3300009098 | Bacteria | 4022 |
| 113 | Ga0105245_11453844 | 3300009098 | Bacteria | 736 |
| 114 | Ga0114129_10022262 | 3300009147 | Bacteria | 8997 |
| 115 | Ga0105243_10884333 | 3300009148 | Bacteria | 887 |
| 116 | Ga0105241_10318795 | 3300009174 | Bacteria | 1340 |
| 117 | Ga0105241_10737562 | 3300009174 | Bacteria | 902 |
| 118 | Ga0105241_11356922 | 3300009174 | Bacteria | 679 |
| 119 | Ga0105242_12459827 | 3300009176 | Bacteria | 569 |
| 120 | Ga0105248_10278699 | 3300009177 | Bacteria | 1882 |
| 121 | Ga0105248_10855628 | 3300009177 | Bacteria | 1026 |
| 122 | Ga0105237_10306667 | 3300009545 | Bacteria | 1590 |
| 123 | Ga0105238_10003581 | 3300009551 | Bacteria | 15488 |
| 124 | Ga0105238_10840564 | 3300009551 | Bacteria | 935 |
| 125 | Ga0105249_10237874 | 3300009553 | Bacteria | 1799 |
| 126 | Ga0105249_10337500 | 3300009553 | Bacteria | 1523 |
| 127 | Ga0105249_10893573 | 3300009553 | Bacteria | 955 |
| 128 | Ga0105239_10285112 | 3300010375 | Bacteria | 1860 |
| 129 | Ga0105239_10765623 | 3300010375 | Bacteria | 1105 |
| 130 | Ga0105246_10993075 | 3300011119 | Bacteria | 759 |
| 131 | Ga0157369_10476446 | 3300013105 | Bacteria | 1292 |
| 132 | Ga0157374_10071290 | 3300013296 | Bacteria | 3276 |
| 133 | Ga0157374_11530276 | 3300013296 | Bacteria | 691 |
| 134 | Ga0157378_10952279 | 3300013297 | Bacteria | 891 |
| 135 | Ga0163162_10011922 | 3300013306 | Bacteria | 8476 |
| 136 | Ga0163162_11190769 | 3300013306 | Bacteria | 864 |
| 137 | Ga0163162_11418037 | 3300013306 | Bacteria | 790 |
| 138 | Ga0157372_10033630 | 3300013307 | Bacteria | 5633 |
| 139 | Ga0157372_10167139 | 3300013307 | Bacteria | 2544 |
| 140 | Ga0157372_10655349 | 3300013307 | Bacteria | 1223 |
| 141 | Ga0157375_10534806 | 3300013308 | Bacteria | 1335 |
| 142 | Ga0157375_10645878 | 3300013308 | Bacteria | 1215 |
| 143 | Ga0163163_10089435 | 3300014325 | Bacteria | 3091 |
| 144 | Ga0163163_10893745 | 3300014325 | Bacteria | 952 |
| 145 | Ga0157377_10046505 | 3300014745 | Bacteria | 2427 |
| 146 | Ga0157377_10408231 | 3300014745 | Bacteria | 927 |
| 147 | Ga0157379_10079187 | 3300014968 | Bacteria | 2943 |
| 148 | Ga0157379_10973660 | 3300014968 | Bacteria | 808 |
| 149 | Ga0157376_10175626 | 3300014969 | Bacteria | 1954 |
| 150 | Ga0157376_11427687 | 3300014969 | Bacteria | 724 |
| 151 | Ga0163161_10398645 | 3300017792 | Bacteria | 1103 |
| 152 | Ga0206353_11027777 | 3300020082 | Bacteria | 1202 |
| 153 | Ga0213875_10000292 | 3300021388 | Bacteria | 48320 |
| 154 | Ga0224572_1040972 | 3300024225 | Bacteria | 872 |
| 155 | Ga0207653_10004578 | 3300025885 | Bacteria | 4335 |
| 156 | Ga0207692_10006997 | 3300025898 | Bacteria | 4604 |
| 157 | Ga0207692_10044544 | 3300025898 | Bacteria | 2214 |
| 158 | Ga0207692_10057951 | 3300025898 | Bacteria | 1994 |
| 159 | Ga0207685_10021398 | 3300025905 | Bacteria | 2167 |
| 160 | Ga0207685_10039128 | 3300025905 | Bacteria | 1758 |
| 161 | Ga0207685_10054426 | 3300025905 | Bacteria | 1558 |
| 162 | Ga0207699_10005414 | 3300025906 | Bacteria | 6112 |
| 163 | Ga0207699_10006116 | 3300025906 | Bacteria | 5804 |
| 164 | Ga0207699_10023525 | 3300025906 | Bacteria | 3354 |
| 165 | Ga0207699_10050788 | 3300025906 | Bacteria | 2447 |
| 166 | Ga0207699_10545471 | 3300025906 | Bacteria | 841 |
| 167 | Ga0207699_10635563 | 3300025906 | Unclassified | 779 |
| 168 | Ga0207699_10737235 | 3300025906 | Bacteria | 722 |
| 169 | Ga0207684_10088849 | 3300025910 | Bacteria | 2633 |
| 170 | Ga0207707_10197709 | 3300025912 | Bacteria | 1753 |
| 171 | Ga0207695_10644889 | 3300025913 | Bacteria | 940 |
| 172 | Ga0207671_10188920 | 3300025914 | Bacteria | 1606 |
| 173 | Ga0207671_10523291 | 3300025914 | Bacteria | 946 |
| 174 | Ga0207671_11199295 | 3300025914 | Bacteria | 594 |
| 175 | Ga0207693_10019173 | 3300025915 | Bacteria | 5444 |
| 176 | Ga0207693_10146190 | 3300025915 | Bacteria | 1859 |
| 177 | Ga0207693_10155476 | 3300025915 | Bacteria | 1798 |
| 178 | Ga0207693_10235258 | 3300025915 | Bacteria | 1438 |
| 179 | Ga0207693_10355867 | 3300025915 | Bacteria | 1145 |
| 180 | Ga0207693_10375847 | 3300025915 | Bacteria | 1112 |
| 181 | Ga0207693_10495372 | 3300025915 | Bacteria | 954 |
| 182 | Ga0207693_10710639 | 3300025915 | Bacteria | 778 |
| 183 | Ga0207693_10717636 | 3300025915 | Bacteria | 774 |
| 184 | Ga0207663_10004437 | 3300025916 | Bacteria | 6977 |
| 185 | Ga0207663_10053080 | 3300025916 | Bacteria | 2531 |
| 186 | Ga0207663_10054828 | 3300025916 | Bacteria | 2498 |
| 187 | Ga0207663_10484557 | 3300025916 | Bacteria | 959 |
| 188 | Ga0207663_10710265 | 3300025916 | Bacteria | 796 |
| 189 | Ga0207663_10776195 | 3300025916 | Bacteria | 762 |
| 190 | Ga0207652_10321987 | 3300025921 | Bacteria | 1396 |
| 191 | Ga0207646_11486481 | 3300025922 | Bacteria | 587 |
| 192 | Ga0207681_10994242 | 3300025923 | Bacteria | 704 |
| 193 | Ga0207687_10303501 | 3300025927 | Bacteria | 1287 |
| 194 | Ga0207700_10002223 | 3300025928 | Bacteria | 11144 |
| 195 | Ga0207700_10023087 | 3300025928 | Bacteria | 4282 |
| 196 | Ga0207700_10025092 | 3300025928 | Bacteria | 4134 |
| 197 | Ga0207700_10058674 | 3300025928 | Bacteria | 2908 |
| 198 | Ga0207700_10107824 | 3300025928 | Bacteria | 2235 |
| 199 | Ga0207700_10185802 | 3300025928 | Bacteria | 1743 |
| 200 | Ga0207700_10258461 | 3300025928 | Bacteria | 1490 |
| 201 | Ga0207700_10285579 | 3300025928 | Bacteria | 1421 |
| 202 | Ga0207700_10528357 | 3300025928 | Bacteria | 1046 |
| 203 | Ga0207700_10595375 | 3300025928 | Bacteria | 984 |
| 204 | Ga0207700_10732744 | 3300025928 | Bacteria | 883 |
| 205 | Ga0207664_10000038 | 3300025929 | Bacteria | 166264 |
| 206 | Ga0207664_10001019 | 3300025929 | Bacteria | 18787 |
| 207 | Ga0207664_10004501 | 3300025929 | Bacteria | 9442 |
| 208 | Ga0207664_10014738 | 3300025929 | Bacteria | 5656 |
| 209 | Ga0207664_10021083 | 3300025929 | Bacteria | 4838 |
| 210 | Ga0207664_10064185 | 3300025929 | Bacteria | 2936 |
| 211 | Ga0207664_10092851 | 3300025929 | Bacteria | 2478 |
| 212 | Ga0207664_10194102 | 3300025929 | Bacteria | 1749 |
| 213 | Ga0207664_10209156 | 3300025929 | Bacteria | 1687 |
| 214 | Ga0207664_10282085 | 3300025929 | Bacteria | 1458 |
| 215 | Ga0207664_10368206 | 3300025929 | Bacteria | 1274 |
| 216 | Ga0207704_10170999 | 3300025938 | Bacteria | 1558 |
| 217 | Ga0207665_10003632 | 3300025939 | Bacteria | 10308 |
| 218 | Ga0207665_10019308 | 3300025939 | Bacteria | 4480 |
| 219 | Ga0207667_10414169 | 3300025949 | Bacteria | 1371 |
| 220 | Ga0207712_10968063 | 3300025961 | Bacteria | 754 |
| 221 | Ga0207712_10974813 | 3300025961 | Bacteria | 751 |
| 222 | Ga0207677_10285109 | 3300026023 | Bacteria | 1357 |
| 223 | Ga0207639_10668126 | 3300026041 | Bacteria | 962 |
| 224 | Ga0207702_10145653 | 3300026078 | Bacteria | 2149 |
| 225 | Ga0207702_10497247 | 3300026078 | Bacteria | 1188 |
| 226 | Ga0207641_10302866 | 3300026088 | Bacteria | 1510 |
| 227 | Ga0207641_10614045 | 3300026088 | Bacteria | 1066 |
| 228 | Ga0207641_10886387 | 3300026088 | Bacteria | 885 |
| 229 | Ga0207675_100060371 | 3300026118 | Bacteria | 3540 |
| 230 | Ga0207428_10001600 | 3300027907 | Bacteria | 23543 |
| 231 | Ga0268266_10090313 | 3300028379 | Bacteria | 2685 |
| 232 | Ga0268264_10821194 | 3300028381 | Bacteria | 930 |
| 233 | Ga0265336_10018452 | 3300028666 | Bacteria | 2261 |
| 234 | Ga0307515_10073249 | 3300028794 | Bacteria | 4607 |
| 235 | Ga0265338_10056948 | 3300028800 | Bacteria | 3461 |
| 236 | Ga0307511_10027833 | 3300030521 | Bacteria | 5152 |
| 237 | Ga0307512_10031684 | 3300030522 | Bacteria | 4573 |
| 238 | Ga0307512_10054038 | 3300030522 | Bacteria | 3185 |
| 239 | Ga0265760_10002529 | 3300031090 | Bacteria | 5336 |
| 240 | Ga0265327_10001233 | 3300031251 | Bacteria | 34340 |
| 241 | Ga0307513_10492236 | 3300031456 | Bacteria | 944 |
| 242 | Ga0307509_10010033 | 3300031507 | Bacteria | 11688 |
| 243 | Ga0307509_10031483 | 3300031507 | Bacteria | 5857 |
| 244 | Ga0307508_10003230 | 3300031616 | Bacteria | 16661 |
| 245 | Ga0307508_10006304 | 3300031616 | Bacteria | 11169 |
| 246 | Ga0307508_10008673 | 3300031616 | Bacteria | 9383 |
| 247 | Ga0307508_10121572 | 3300031616 | Bacteria | 2214 |
| 248 | Ga0307508_10710677 | 3300031616 | Unclassified | 615 |
| 249 | Ga0307514_10001453 | 3300031649 | Bacteria | 28897 |
| 250 | Ga0307514_10176687 | 3300031649 | Bacteria | 1384 |
| 251 | Ga0307516_10401771 | 3300031730 | Bacteria | 1029 |
| 252 | Ga0307507_10013841 | 3300033179 | Bacteria | 9720 |
| 253 | Ga0307507_10027613 | 3300033179 | Bacteria | 6078 |
| 254 | Ga0307510_10051842 | 3300033180 | Bacteria | 4334 |
| 255 | Ga0307510_10302859 | 3300033180 | Bacteria | 1060 |
| 256 | Ga0316214_1002889 | 3300033545 | Bacteria | 2135 |
| 257 | Ga0373926_0002104 | 3300035083 | Bacteria | 6262 |
| 258 | Ga0373926_0071310 | 3300035083 | Bacteria | 1277 |
| 259 | Ga0373926_0150766 | 3300035083 | Bacteria | 885 |
| 260 | Ga0373928_0021387 | 3300035084 | Bacteria | 1364 |
| 261 | Ga0373934_0027760 | 3300035086 | Bacteria | 2201 |
| 262 | Ga0373952_0035506 | 3300035092 | Bacteria | 1129 |
| 263 | Ga0373923_0006446 | 3300035111 | Bacteria | 4059 |
| 264 | Ga0373923_0010421 | 3300035111 | Bacteria | 3379 |
| 265 | Ga0373923_0013947 | 3300035111 | Bacteria | 3008 |
| 266 | Ga0373923_0014732 | 3300035111 | Bacteria | 2942 |
| 267 | Ga0373923_0081937 | 3300035111 | Bacteria | 1401 |
| 268 | Ga0373923_0317066 | 3300035111 | Bacteria | 740 |
| 269 | Ga0373932_0105138 | 3300035112 | Bacteria | 924 |
| 270 | Ga0373936_0003325 | 3300035113 | Bacteria | 6029 |
| 271 | Ga0373936_0016328 | 3300035113 | Bacteria | 2855 |
| 272 | Ga0373936_0035107 | 3300035113 | Bacteria | 1995 |
| 273 | Ga0373936_0048386 | 3300035113 | Bacteria | 1716 |
| 274 | Ga0373936_0207638 | 3300035113 | Bacteria | 866 |
| 275 | Ga0373939_0189086 | 3300035114 | Bacteria | 772 |
| 276 | Ga0373945_0001913 | 3300035116 | Bacteria | 6459 |
| 277 | Ga0373945_0107401 | 3300035116 | Bacteria | 1098 |
| 278 | Ga0373945_0122932 | 3300035116 | Bacteria | 1033 |
| 279 | Ga0373953_0031037 | 3300035117 | Bacteria | 2076 |
| 280 | Ga0373953_0069094 | 3300035117 | Bacteria | 1455 |
| 281 | Ga0373954_0021962 | 3300035118 | Bacteria | 2892 |
| 282 | Ga0373954_0094532 | 3300035118 | Bacteria | 1438 |
| 283 | Ga0373956_0005350 | 3300035119 | Bacteria | 5137 |
| 284 | Ga0373956_0036943 | 3300035119 | Bacteria | 2157 |
| 285 | Ga0373956_0187241 | 3300035119 | Bacteria | 979 |
| 286 | Ga0373957_0004620 | 3300035120 | Bacteria | 4203 |
| 287 | Ga0373957_0005985 | 3300035120 | Bacteria | 3806 |
| 288 | Ga0373943_0001615 | 3300035170 | Bacteria | 10227 |
| 289 | Ga0373943_0016115 | 3300035170 | Bacteria | 3404 |
| 290 | Ga0373943_0063589 | 3300035170 | Bacteria | 1850 |
| 291 | Ga0373943_0358659 | 3300035170 | Bacteria | 836 |
| 292 | Ga0373943_0599148 | 3300035170 | Bacteria | 649 |
| 293 | Ga0373946_0011715 | 3300035171 | Bacteria | 3278 |
| 294 | Ga0373946_0068066 | 3300035171 | Bacteria | 1530 |
| 295 | Ga0373946_0279713 | 3300035171 | Bacteria | 820 |
| 296 | Ga0373946_0663630 | 3300035171 | Bacteria | 544 |
| 297 | Ga0373955_0001158 | 3300035172 | Bacteria | 11196 |
| 298 | Ga0373955_0005591 | 3300035172 | Bacteria | 5652 |
| 299 | Ga0373955_0026119 | 3300035172 | Bacteria | 3004 |
| 300 | Ga0373942_0000592 | 3300035207 | Bacteria | 10200 |
| 301 | Ga0373924_0002060 | 3300035410 | Bacteria | 6711 |
| 302 | Ga0373924_0004820 | 3300035410 | Bacteria | 4742 |
| 303 | Ga0373924_0017223 | 3300035410 | Bacteria | 2768 |
| 304 | Ga0373924_0277874 | 3300035410 | Bacteria | 743 |
| 305 | Ga0373935_0006326 | 3300035692 | Bacteria | 7058 |
| 306 | Ga0373935_0012391 | 3300035692 | Bacteria | 5130 |
| 307 | Ga0373935_0029065 | 3300035692 | Bacteria | 3419 |
| 308 | Ga0373935_0084253 | 3300035692 | Bacteria | 2070 |
| 309 | Ga0373935_0140497 | 3300035692 | Bacteria | 1631 |
| 310 | Ga0373935_0280325 | 3300035692 | Bacteria | 1173 |
| 311 | Ga0373927_0061764 | 3300035695 | Bacteria | 2423 |
| 312 | Ga0373927_0247725 | 3300035695 | Bacteria | 1171 |
| 313 | Ga0373927_0337928 | 3300035695 | Bacteria | 992 |
| 314 | Ga0373933_0001299 | 3300035724 | Bacteria | 14700 |
| 315 | Ga0373933_0159974 | 3300035724 | Bacteria | 1429 |
| 316 | Ga0373933_0222747 | 3300035724 | Bacteria | 1210 |
| 317 | Ga0373947_0038465 | 3300035725 | Bacteria | 2842 |
| 318 | Ga0373947_0058674 | 3300035725 | Bacteria | 2332 |
| 319 | Ga0373947_0089509 | 3300035725 | Bacteria | 1917 |
| 320 | Ga0373947_0174016 | 3300035725 | Bacteria | 1398 |
| 321 | Ga0373937_0024671 | 3300036401 | Bacteria | 5425 |
| 322 | Ga0373937_0049692 | 3300036401 | Bacteria | 3840 |
| 323 | Ga0373937_0085106 | 3300036401 | Bacteria | 2926 |
| 324 | Ga0373937_0445520 | 3300036401 | Bacteria | 1229 |
| 325 | Ga0373937_0597650 | 3300036401 | Bacteria | 1047 |
| 326 | Ga0373937_0790170 | 3300036401 | Bacteria | 897 |
| 327 | Ga0373925_0006890 | 3300037068 | Bacteria | 8319 |
| 328 | Ga0373925_0014271 | 3300037068 | Bacteria | 5747 |
| 329 | Ga0373925_0025650 | 3300037068 | Bacteria | 4309 |
| 330 | Ga0373925_0031631 | 3300037068 | Bacteria | 3889 |
| 331 | Ga0373925_0151505 | 3300037068 | Bacteria | 1821 |
| 332 | Ga0373925_0152860 | 3300037068 | Bacteria | 1813 |
| 333 | Ga0373925_0813129 | 3300037068 | Bacteria | 770 |
| 334 | Ga0395900_0366696 | 3300037418 | Bacteria | 1411 |
| 335 | Ga0395898_0013982 | 3300037466 | Bacteria | 8247 |
| 336 | Ga0395898_0036257 | 3300037466 | Bacteria | 4897 |
| 337 | Ga0395898_0955292 | 3300037466 | Bacteria | 794 |
| 338 | Ga0436364_0734194 | 3300037853 | Bacteria | 2718 |
| 339 | Ga0436364_1135881 | 3300037853 | Bacteria | 1331 |
| 340 | Ga0436364_1492889 | 3300037853 | Bacteria | 100509 |
| 341 | Ga0395901_1511939 | 3300038443 | Bacteria | 627 |
| 342 | Ga0451853_1612332 | 3300041512 | Bacteria | 1702 |
| 343 | Ga0439448_0001710 | 3300042005 | Bacteria | 5786 |
| 344 | Ga0439449_0003066 | 3300042007 | Bacteria | 6512 |
| 345 | Ga0439455_0001546 | 3300042012 | Bacteria | 3893 |
| 346 | Ga0450903_000007 | 3300042138 | Bacteria | 38287 |
| 347 | Ga0450901_006245 | 3300042533 | Bacteria | 1224 |
| 348 | Ga0466969_0254225 | 3300044656 | Bacteria | 796 |
| 349 | Ga0466972_0196171 | 3300044658 | Bacteria | 946 |
| 350 | Ga0466965_0002942 | 3300044683 | Bacteria | 7371 |
| 351 | Ga0466966_0001649 | 3300044684 | Bacteria | 14388 |
| 352 | Ga0466966_0008575 | 3300044684 | Bacteria | 6766 |
| 353 | Ga0466961_0003202 | 3300044693 | Bacteria | 10187 |
| 354 | Ga0466961_0114108 | 3300044693 | Bacteria | 1698 |
| 355 | Ga0466963_0000620 | 3300044694 | Bacteria | 17022 |
| 356 | Ga0466964_0005892 | 3300044706 | Bacteria | 4564 |
| 357 | Ga0466964_0301387 | 3300044706 | Bacteria | 808 |
| 358 | Ga0466964_0360884 | 3300044706 | Bacteria | 749 |
| 359 | Ga0466971_0001206 | 3300044719 | Bacteria | 10748 |
| 360 | Ga0466971_0080919 | 3300044719 | Bacteria | 1481 |
| 361 | Ga0466971_0262549 | 3300044719 | Bacteria | 824 |
| 362 | Ga0466968_0102463 | 3300044735 | Bacteria | 1279 |
| 363 | Ga0466970_0004261 | 3300044765 | Bacteria | 7043 |
| 364 | Ga0466970_0057650 | 3300044765 | Bacteria | 2077 |
| 365 | Ga0466970_0272537 | 3300044765 | Bacteria | 951 |
| 366 | Ga0466957_0000473 | 3300044842 | Bacteria | 19961 |
| 367 | Ga0466959_0000889 | 3300045049 | Bacteria | 17595 |
| 368 | Ga0466959_0534903 | 3300045049 | Bacteria | 791 |
| 369 | Ga0466958_0008253 | 3300045836 | Bacteria | 5767 |
| 370 | Ga0466967_0024595 | 3300045976 | Bacteria | 4954 |
| 371 | Ga0466967_0999620 | 3300045976 | Bacteria | 833 |
| 372 | Ga0495592_0000533 | 3300046454 | Bacteria | 27280 |
| 373 | Ga0495592_0016679 | 3300046454 | Bacteria | 5574 |
| 374 | Ga0495592_0022893 | 3300046454 | Bacteria | 4754 |
| 375 | Ga0495592_0053249 | 3300046454 | Bacteria | 3002 |
| 376 | Ga0495592_0067145 | 3300046454 | Bacteria | 2622 |
| 377 | Ga0495592_0137888 | 3300046454 | Bacteria | 1699 |
| 378 | Ga0495603_0001324 | 3300046455 | Bacteria | 14366 |
| 379 | Ga0495603_0013490 | 3300046455 | Bacteria | 4944 |
| 380 | Ga0495603_0077956 | 3300046455 | Bacteria | 1943 |
| 381 | Ga0495603_0261569 | 3300046455 | Bacteria | 996 |
| 382 | Ga0495590_0039283 | 3300046457 | Bacteria | 1651 |
| 383 | Ga0495629_0006195 | 3300046459 | Bacteria | 8879 |
| 384 | Ga0495629_0013660 | 3300046459 | Bacteria | 5859 |
| 385 | Ga0495629_0041457 | 3300046459 | Bacteria | 3239 |
| 386 | Ga0495629_0058261 | 3300046459 | Bacteria | 2700 |
| 387 | Ga0495629_0102115 | 3300046459 | Bacteria | 2001 |
| 388 | Ga0495629_0183874 | 3300046459 | Bacteria | 1448 |
| 389 | Ga0495629_0222137 | 3300046459 | Bacteria | 1303 |
| 390 | Ga0495629_0305386 | 3300046459 | Bacteria | 1089 |
| 391 | Ga0495629_0713476 | 3300046459 | Bacteria | 665 |
| 392 | Ga0495638_0506044 | 3300046460 | Bacteria | 607 |
| 393 | Ga0495641_0009673 | 3300046461 | Bacteria | 5700 |
| 394 | Ga0495641_0011378 | 3300046461 | Bacteria | 5074 |
| 395 | Ga0495641_0068268 | 3300046461 | Bacteria | 1598 |
| 396 | Ga0495641_0077741 | 3300046461 | Bacteria | 1487 |
| 397 | Ga0495641_0193824 | 3300046461 | Bacteria | 911 |
| 398 | Ga0495641_0473838 | 3300046461 | Bacteria | 570 |
| 399 | Ga0495651_0014285 | 3300046462 | Bacteria | 6137 |
| 400 | Ga0495651_0029913 | 3300046462 | Bacteria | 4246 |
| 401 | Ga0495651_0043753 | 3300046462 | Bacteria | 3473 |
| 402 | Ga0495651_0070812 | 3300046462 | Bacteria | 2652 |
| 403 | Ga0495651_0084811 | 3300046462 | Bacteria | 2386 |
| 404 | Ga0495653_0027494 | 3300046463 | Bacteria | 4551 |
| 405 | Ga0495653_0121661 | 3300046463 | Bacteria | 1859 |
| 406 | Ga0495653_0447315 | 3300046463 | Bacteria | 813 |
| 407 | Ga0495650_0030732 | 3300046471 | Bacteria | 2428 |
| 408 | Ga0495580_0008335 | 3300046472 | Bacteria | 8243 |
| 409 | Ga0495580_0365737 | 3300046472 | Bacteria | 976 |
| 410 | Ga0495582_0001439 | 3300046473 | Bacteria | 13430 |
| 411 | Ga0495582_0034703 | 3300046473 | Bacteria | 2772 |
| 412 | Ga0495582_0057206 | 3300046473 | Bacteria | 2150 |
| 413 | Ga0495582_0221088 | 3300046473 | Bacteria | 1083 |
| 414 | Ga0495605_0001547 | 3300046474 | Bacteria | 14941 |
| 415 | Ga0495605_0041493 | 3300046474 | Bacteria | 2292 |
| 416 | Ga0495639_0004306 | 3300046475 | Bacteria | 6105 |
| 417 | Ga0495639_0011573 | 3300046475 | Bacteria | 3806 |
| 418 | Ga0495639_0055730 | 3300046475 | Bacteria | 1803 |
| 419 | Ga0495662_0000937 | 3300046476 | Bacteria | 14286 |
| 420 | Ga0495662_0010527 | 3300046476 | Bacteria | 4525 |
| 421 | Ga0495662_0071327 | 3300046476 | Bacteria | 1683 |
| 422 | Ga0495662_0089858 | 3300046476 | Bacteria | 1497 |
| 423 | Ga0495662_0115775 | 3300046476 | Bacteria | 1314 |
| 424 | Ga0495662_0137773 | 3300046476 | Bacteria | 1201 |
| 425 | Ga0495662_0221101 | 3300046476 | Bacteria | 933 |
| 426 | Ga0495662_0243110 | 3300046476 | Bacteria | 887 |
| 427 | Ga0495664_0001190 | 3300046477 | Bacteria | 13575 |
| 428 | Ga0495664_0029289 | 3300046477 | Bacteria | 3219 |
| 429 | Ga0495664_0107735 | 3300046477 | Bacteria | 1681 |
| 430 | Ga0495664_0195971 | 3300046477 | Bacteria | 1224 |
| 431 | Ga0495664_0269328 | 3300046477 | Bacteria | 1029 |
| 432 | Ga0495664_0318321 | 3300046477 | Bacteria | 938 |
| 433 | Ga0495584_0055583 | 3300046491 | Bacteria | 1992 |
| 434 | Ga0495584_0266431 | 3300046491 | Bacteria | 871 |
| 435 | Ga0495585_0064676 | 3300046492 | Bacteria | 2005 |
| 436 | Ga0495594_0061925 | 3300046499 | Bacteria | 2071 |
| 437 | Ga0495594_0104436 | 3300046499 | Bacteria | 1595 |
| 438 | Ga0495583_0035445 | 3300046506 | Bacteria | 2381 |
| 439 | Ga0495606_0012897 | 3300046507 | Bacteria | 6651 |
| 440 | Ga0495606_0268620 | 3300046507 | Bacteria | 938 |
| 441 | Ga0495608_0011405 | 3300046511 | Bacteria | 6184 |
| 442 | Ga0495608_0072053 | 3300046511 | Bacteria | 2254 |
| 443 | Ga0495610_0221946 | 3300046512 | Bacteria | 763 |
| 444 | Ga0495618_0013181 | 3300046514 | Bacteria | 5030 |
| 445 | Ga0495618_0044213 | 3300046514 | Bacteria | 2809 |
| 446 | Ga0495618_0088468 | 3300046514 | Bacteria | 1981 |
| 447 | Ga0495618_0128018 | 3300046514 | Bacteria | 1625 |
| 448 | Ga0495618_0246948 | 3300046514 | Bacteria | 1120 |
| 449 | Ga0495618_0334798 | 3300046514 | Bacteria | 935 |
| 450 | Ga0495620_0003274 | 3300046515 | Bacteria | 9285 |
| 451 | Ga0495620_0143312 | 3300046515 | Bacteria | 933 |
| 452 | Ga0495628_0029616 | 3300046516 | Bacteria | 4436 |
| 453 | Ga0495628_0040030 | 3300046516 | Bacteria | 3747 |
| 454 | Ga0495628_0142315 | 3300046516 | Bacteria | 1830 |
| 455 | Ga0495628_0156061 | 3300046516 | Bacteria | 1736 |
| 456 | Ga0495628_0243619 | 3300046516 | Bacteria | 1344 |
| 457 | Ga0495628_0420853 | 3300046516 | Bacteria | 974 |
| 458 | Ga0495630_0026182 | 3300046517 | Bacteria | 4317 |
| 459 | Ga0495630_0058558 | 3300046517 | Bacteria | 2888 |
| 460 | Ga0495630_0139751 | 3300046517 | Bacteria | 1841 |
| 461 | Ga0495630_0225046 | 3300046517 | Bacteria | 1432 |
| 462 | Ga0495630_0242821 | 3300046517 | Bacteria | 1376 |
| 463 | Ga0495643_0002317 | 3300046522 | Bacteria | 15353 |
| 464 | Ga0495643_0011043 | 3300046522 | Bacteria | 5522 |
| 465 | Ga0495644_0013948 | 3300046523 | Bacteria | 3081 |
| 466 | Ga0495648_0016834 | 3300046524 | Bacteria | 5254 |
| 467 | Ga0495648_0220593 | 3300046524 | Bacteria | 935 |
| 468 | Ga0495666_0005521 | 3300046526 | Bacteria | 6368 |
| 469 | Ga0495666_0079047 | 3300046526 | Bacteria | 1557 |
| 470 | Ga0495666_0192996 | 3300046526 | Bacteria | 938 |
| 471 | Ga0495642_0081960 | 3300046528 | Bacteria | 1360 |
| 472 | Ga0495652_0000731 | 3300046529 | Bacteria | 38018 |
| 473 | Ga0495652_0014378 | 3300046529 | Bacteria | 7105 |
| 474 | Ga0495652_0055391 | 3300046529 | Bacteria | 3372 |
| 475 | Ga0495652_0093259 | 3300046529 | Bacteria | 2458 |
| 476 | Ga0495652_0120359 | 3300046529 | Bacteria | 2095 |
| 477 | Ga0495652_0126860 | 3300046529 | Bacteria | 2026 |
| 478 | Ga0495652_0498733 | 3300046529 | Bacteria | 844 |
| 479 | Ga0495652_0811023 | 3300046529 | Bacteria | 622 |
| 480 | Ga0495665_0002348 | 3300046531 | Bacteria | 10222 |
| 481 | Ga0495665_0007767 | 3300046531 | Bacteria | 5804 |
| 482 | Ga0495665_0010861 | 3300046531 | Bacteria | 4925 |
| 483 | Ga0495665_0011827 | 3300046531 | Bacteria | 4727 |
| 484 | Ga0495665_0039988 | 3300046531 | Bacteria | 2497 |
| 485 | Ga0495665_0149861 | 3300046531 | Bacteria | 1218 |
| 486 | Ga0495665_0218889 | 3300046531 | Unclassified | 984 |
| 487 | Ga0495640_0041139 | 3300046533 | Bacteria | 3231 |
| 488 | Ga0495640_0051824 | 3300046533 | Bacteria | 2819 |
| 489 | Ga0495640_0059553 | 3300046533 | Bacteria | 2600 |
| 490 | Ga0495640_0086954 | 3300046533 | Bacteria | 2068 |
| 491 | Ga0495640_0450208 | 3300046533 | Bacteria | 786 |
| 492 | Ga0495586_0025368 | 3300046535 | Bacteria | 3172 |
| 493 | Ga0495586_0038621 | 3300046535 | Bacteria | 2565 |
| 494 | Ga0495586_0050344 | 3300046535 | Bacteria | 2254 |
| 495 | Ga0495586_0300648 | 3300046535 | Bacteria | 919 |
| 496 | Ga0495587_0002717 | 3300046536 | Bacteria | 11801 |
| 497 | Ga0495587_0003610 | 3300046536 | Bacteria | 10295 |
| 498 | Ga0495587_0005655 | 3300046536 | Bacteria | 8149 |
| 499 | Ga0495587_0019081 | 3300046536 | Bacteria | 4247 |
| 500 | Ga0495587_0161804 | 3300046536 | Bacteria | 1273 |
| 501 | Ga0495597_0208176 | 3300046542 | Bacteria | 781 |
| 502 | Ga0495645_0006572 | 3300046543 | Bacteria | 8080 |
| 503 | Ga0495645_0025115 | 3300046543 | Bacteria | 4323 |
| 504 | Ga0495645_0043329 | 3300046543 | Bacteria | 3283 |
| 505 | Ga0495645_0071310 | 3300046543 | Bacteria | 2505 |
| 506 | Ga0495645_0080121 | 3300046543 | Bacteria | 2344 |
| 507 | Ga0495645_0080211 | 3300046543 | Bacteria | 2343 |
| 508 | Ga0495645_0134378 | 3300046543 | Bacteria | 1731 |
| 509 | Ga0495645_0338457 | 3300046543 | Bacteria | 972 |
| 510 | Ga0495622_0069359 | 3300046557 | Bacteria | 1628 |
| 511 | Ga0495667_0014966 | 3300046559 | Bacteria | 5241 |
| 512 | Ga0495667_0022967 | 3300046559 | Bacteria | 4202 |
| 513 | Ga0495667_0062793 | 3300046559 | Bacteria | 2433 |
| 514 | Ga0495667_0092703 | 3300046559 | Bacteria | 1955 |
| 515 | Ga0495667_0168757 | 3300046559 | Bacteria | 1406 |
| 516 | Ga0495667_0332895 | 3300046559 | Bacteria | 960 |
| 517 | Ga0495667_0508456 | 3300046559 | Bacteria | 754 |
| 518 | Ga0495668_0011363 | 3300046616 | Bacteria | 5335 |
| 519 | Ga0495668_0180789 | 3300046616 | Bacteria | 1155 |
| 520 | Ga0495634_0001842 | 3300046642 | Bacteria | 18267 |
| 521 | Ga0495634_0006619 | 3300046642 | Bacteria | 8788 |
| 522 | Ga0495634_0015575 | 3300046642 | Bacteria | 5457 |
| 523 | Ga0495634_0022206 | 3300046642 | Bacteria | 4473 |
| 524 | Ga0495634_0030742 | 3300046642 | Bacteria | 3705 |
| 525 | Ga0495634_0091807 | 3300046642 | Bacteria | 1970 |
| 526 | Ga0495634_0171832 | 3300046642 | Bacteria | 1361 |
| 527 | Ga0495634_0660839 | 3300046642 | Bacteria | 603 |
| 528 | Ga0495611_0020514 | 3300046648 | Bacteria | 2845 |
| 529 | Ga0495625_0441559 | 3300046660 | Bacteria | 805 |
| 530 | Ga0495635_0009265 | 3300046663 | Bacteria | 6876 |
| 531 | Ga0495635_0033666 | 3300046663 | Bacteria | 3554 |
| 532 | Ga0495635_0035697 | 3300046663 | Bacteria | 3446 |
| 533 | Ga0495635_0036617 | 3300046663 | Bacteria | 3400 |
| 534 | Ga0495635_0065637 | 3300046663 | Bacteria | 2490 |
| 535 | Ga0495635_0072291 | 3300046663 | Bacteria | 2363 |
| 536 | Ga0495635_0118719 | 3300046663 | Bacteria | 1804 |
| 537 | Ga0495635_0133882 | 3300046663 | Bacteria | 1689 |
| 538 | Ga0495635_0253660 | 3300046663 | Bacteria | 1185 |
| 539 | Ga0495635_0464252 | 3300046663 | Bacteria | 836 |
| 540 | Ga0495588_0099672 | 3300046674 | Bacteria | 1526 |
| 541 | Ga0495657_0001951 | 3300046675 | Bacteria | 17588 |
| 542 | Ga0495657_0007880 | 3300046675 | Bacteria | 8173 |
| 543 | Ga0495657_0010131 | 3300046675 | Bacteria | 7100 |
| 544 | Ga0495657_0023926 | 3300046675 | Bacteria | 4358 |
| 545 | Ga0495657_0036154 | 3300046675 | Bacteria | 3416 |
| 546 | Ga0495657_0106359 | 3300046675 | Bacteria | 1781 |
| 547 | Ga0495599_0034176 | 3300046678 | Bacteria | 3194 |
| 548 | Ga0495599_0100141 | 3300046678 | Bacteria | 1806 |
| 549 | Ga0495599_0251017 | 3300046678 | Bacteria | 1076 |
| 550 | Ga0495599_0252074 | 3300046678 | Bacteria | 1074 |
| 551 | Ga0495599_0328185 | 3300046678 | Bacteria | 920 |
| 552 | Ga0495623_0004911 | 3300046679 | Bacteria | 8763 |
| 553 | Ga0495623_0016907 | 3300046679 | Bacteria | 4711 |
| 554 | Ga0495623_0038511 | 3300046679 | Bacteria | 3057 |
| 555 | Ga0495623_0100646 | 3300046679 | Bacteria | 1761 |
| 556 | Ga0495623_0141211 | 3300046679 | Bacteria | 1432 |
| 557 | Ga0495646_0001163 | 3300046680 | Bacteria | 15366 |
| 558 | Ga0495646_0001297 | 3300046680 | Bacteria | 14748 |
| 559 | Ga0495646_0005089 | 3300046680 | Bacteria | 8284 |
| 560 | Ga0495646_0006708 | 3300046680 | Bacteria | 7301 |
| 561 | Ga0495646_0051478 | 3300046680 | Bacteria | 2492 |
| 562 | Ga0495646_0112384 | 3300046680 | Bacteria | 1550 |
| 563 | Ga0495646_0168922 | 3300046680 | Bacteria | 1206 |
| 564 | Ga0495646_0305732 | 3300046680 | Bacteria | 840 |
| 565 | Ga0495647_0012470 | 3300046681 | Bacteria | 2928 |
| 566 | Ga0495647_0088441 | 3300046681 | Bacteria | 1266 |
| 567 | Ga0495658_0012202 | 3300046683 | Bacteria | 4343 |
| 568 | Ga0495658_0221438 | 3300046683 | Bacteria | 1184 |
| 569 | Ga0495613_0000579 | 3300046689 | Bacteria | 29609 |
| 570 | Ga0495613_0003570 | 3300046689 | Bacteria | 11656 |
| 571 | Ga0495613_0004560 | 3300046689 | Bacteria | 10392 |
| 572 | Ga0495613_0034291 | 3300046689 | Bacteria | 3770 |
| 573 | Ga0495613_0037980 | 3300046689 | Bacteria | 3569 |
| 574 | Ga0495613_0041547 | 3300046689 | Bacteria | 3405 |
| 575 | Ga0495613_0051096 | 3300046689 | Bacteria | 3048 |
| 576 | Ga0495613_0072923 | 3300046689 | Bacteria | 2502 |
| 577 | Ga0495613_0242600 | 3300046689 | Bacteria | 1259 |
| 578 | Ga0495624_0014782 | 3300046690 | Bacteria | 5286 |
| 579 | Ga0495624_0026585 | 3300046690 | Bacteria | 3791 |
| 580 | Ga0495624_0051779 | 3300046690 | Bacteria | 2596 |
| 581 | Ga0495624_0137418 | 3300046690 | Bacteria | 1498 |
| 582 | Ga0495624_0166115 | 3300046690 | Bacteria | 1347 |
| 583 | Ga0495624_0191355 | 3300046690 | Bacteria | 1244 |
| 584 | Ga0495624_0303637 | 3300046690 | Bacteria | 962 |
| 585 | Ga0495624_0347297 | 3300046690 | Bacteria | 892 |
| 586 | Ga0495649_0052614 | 3300046694 | Bacteria | 2206 |
| 587 | Ga0495589_0008211 | 3300046794 | Bacteria | 5459 |
| 588 | Ga0495600_0000897 | 3300046809 | Bacteria | 15933 |
| 589 | Ga0495600_0011883 | 3300046809 | Bacteria | 5437 |
| 590 | Ga0495600_0037522 | 3300046809 | Bacteria | 3150 |
| 591 | Ga0495600_0042432 | 3300046809 | Bacteria | 2965 |
| 592 | Ga0495600_0093236 | 3300046809 | Bacteria | 1964 |
| 593 | Ga0495600_0098077 | 3300046809 | Bacteria | 1910 |
| 594 | Ga0495600_0104650 | 3300046809 | Bacteria | 1844 |
| 595 | Ga0495660_0015042 | 3300046810 | Bacteria | 4473 |
| 596 | Ga0495581_0029101 | 3300047315 | Bacteria | 3202 |
| 597 | Ga0495581_0044606 | 3300047315 | Bacteria | 2564 |
| 598 | Ga0495581_0045749 | 3300047315 | Bacteria | 2529 |
| 599 | Ga0495581_0046539 | 3300047315 | Bacteria | 2507 |
| 600 | Ga0495581_0055069 | 3300047315 | Bacteria | 2296 |
| 601 | Ga0495581_0061645 | 3300047315 | Bacteria | 2167 |
| 602 | Ga0495581_0161283 | 3300047315 | Bacteria | 1311 |
| 603 | Ga0495604_0000213 | 3300047317 | Bacteria | 53409 |
| 604 | Ga0495604_0007672 | 3300047317 | Bacteria | 8545 |
| 605 | Ga0495604_0016298 | 3300047317 | Bacteria | 5938 |
| 606 | Ga0495604_0033683 | 3300047317 | Bacteria | 4054 |
| 607 | Ga0495604_0036763 | 3300047317 | Bacteria | 3859 |
| 608 | Ga0495604_0068526 | 3300047317 | Bacteria | 2692 |
| 609 | Ga0495604_0349035 | 3300047317 | Bacteria | 983 |
| 610 | Ga0495604_0662148 | 3300047317 | Bacteria | 665 |
| 611 | Ga0495604_0760738 | 3300047317 | Bacteria | 612 |
| 612 | Ga0495636_0017923 | 3300047318 | Bacteria | 2838 |
| 613 | Ga0495674_0027131 | 3300047319 | Bacteria | 5238 |
| 614 | Ga0495674_0126704 | 3300047319 | Bacteria | 2153 |
| 615 | Ga0495674_0133838 | 3300047319 | Bacteria | 2087 |
| 616 | Ga0495674_0186388 | 3300047319 | Bacteria | 1726 |
| 617 | Ga0495674_0277232 | 3300047319 | Bacteria | 1374 |
| 618 | Ga0495674_0621635 | 3300047319 | Bacteria | 854 |
| 619 | Ga0495676_0000413 | 3300047321 | Bacteria | 34737 |
| 620 | Ga0495676_0007049 | 3300047321 | Bacteria | 10312 |
| 621 | Ga0495676_0007443 | 3300047321 | Bacteria | 10045 |
| 622 | Ga0495676_0012405 | 3300047321 | Bacteria | 7676 |
| 623 | Ga0495676_0019011 | 3300047321 | Bacteria | 6051 |
| 624 | Ga0495676_0046396 | 3300047321 | Bacteria | 3526 |
| 625 | Ga0495676_0179302 | 3300047321 | Bacteria | 1486 |
| 626 | Ga0495676_0216303 | 3300047321 | Bacteria | 1323 |
| 627 | Ga0495676_0303311 | 3300047321 | Bacteria | 1076 |
| 628 | Ga0495676_0443858 | 3300047321 | Bacteria | 856 |
| 629 | Ga0495680_0011221 | 3300047322 | Bacteria | 7956 |
| 630 | Ga0495680_0017182 | 3300047322 | Bacteria | 6188 |
| 631 | Ga0495680_0032105 | 3300047322 | Bacteria | 4266 |
| 632 | Ga0495680_0449225 | 3300047322 | Bacteria | 882 |
| 633 | Ga0495680_0525840 | 3300047322 | Bacteria | 800 |
| 634 | Ga0495683_0007937 | 3300047323 | Bacteria | 5695 |
| 635 | Ga0495683_0202620 | 3300047323 | Bacteria | 894 |
| 636 | Ga0495687_005538 | 3300047443 | Bacteria | 8011 |
| 637 | Ga0495687_048770 | 3300047443 | Bacteria | 1814 |
| 638 | Ga0495675_0008798 | 3300047444 | Bacteria | 6268 |
| 639 | Ga0495675_0016045 | 3300047444 | Bacteria | 4736 |
| 640 | Ga0495675_0016810 | 3300047444 | Bacteria | 4627 |
| 641 | Ga0495675_0048644 | 3300047444 | Bacteria | 2697 |
| 642 | Ga0495675_0085803 | 3300047444 | Bacteria | 1979 |
| 643 | Ga0495675_0121374 | 3300047444 | Bacteria | 1627 |
| 644 | Ga0495675_0200808 | 3300047444 | Bacteria | 1214 |
| 645 | Ga0495675_0592878 | 3300047444 | Bacteria | 629 |
| 646 | Ga0495685_009439 | 3300047447 | Bacteria | 3258 |
| 647 | Ga0495684_0006269 | 3300047471 | Bacteria | 9242 |
| 648 | Ga0495684_0009269 | 3300047471 | Bacteria | 7598 |
| 649 | Ga0495684_0024539 | 3300047471 | Bacteria | 4641 |
| 650 | Ga0495684_0046334 | 3300047471 | Bacteria | 3326 |
| 651 | Ga0495684_0149424 | 3300047471 | Bacteria | 1747 |
| 652 | Ga0495684_0288668 | 3300047471 | Bacteria | 1181 |
| 653 | Ga0495684_0388289 | 3300047471 | Bacteria | 983 |
| 654 | Ga0495686_0407058 | 3300047472 | Bacteria | 729 |
| 655 | Ga0495593_0001410 | 3300047673 | Bacteria | 14074 |
| 656 | Ga0495593_0001417 | 3300047673 | Bacteria | 14054 |
| 657 | Ga0495593_0005086 | 3300047673 | Bacteria | 7779 |
| 658 | Ga0495593_0017932 | 3300047673 | Bacteria | 3984 |
| 659 | Ga0495593_0018942 | 3300047673 | Bacteria | 3862 |
| 660 | Ga0495593_0040977 | 3300047673 | Bacteria | 2492 |
| 661 | Ga0495593_0064816 | 3300047673 | Bacteria | 1906 |
| 662 | Ga0495593_0398174 | 3300047673 | Bacteria | 688 |
| 663 | Ga0495602_0034728 | 3300048088 | Bacteria | 4711 |
| 664 | Ga0495602_0036385 | 3300048088 | Bacteria | 4582 |
| 665 | Ga0495602_0041109 | 3300048088 | Bacteria | 4227 |
| 666 | Ga0495602_0043114 | 3300048088 | Bacteria | 4105 |
| 667 | Ga0495602_0292612 | 3300048088 | Bacteria | 1195 |
| 668 | Ga0495614_0001226 | 3300048089 | Bacteria | 11036 |
| 669 | Ga0495614_0002852 | 3300048089 | Bacteria | 7690 |
| 670 | Ga0495614_0006927 | 3300048089 | Bacteria | 5066 |
| 671 | Ga0495614_0009781 | 3300048089 | Bacteria | 4237 |
| 672 | Ga0495614_0039539 | 3300048089 | Bacteria | 2024 |
| 673 | Ga0495614_0049247 | 3300048089 | Bacteria | 1806 |
| 674 | Ga0495614_0063615 | 3300048089 | Bacteria | 1586 |
| 675 | Ga0495614_0455935 | 3300048089 | Bacteria | 605 |
| 676 | Ga0496100_0073431 | 3300048903 | Bacteria | 2289 |
| 677 | Ga0496100_0396489 | 3300048903 | Bacteria | 1050 |
| 678 | Ga0496101_0229244 | 3300048904 | Bacteria | 1443 |
| 679 | Ga0496102_0065207 | 3300048905 | Bacteria | 3337 |
| 680 | Ga0496102_0068020 | 3300048905 | Bacteria | 3268 |
| 681 | Ga0496102_0100265 | 3300048905 | Bacteria | 2689 |
| 682 | Ga0496102_0144939 | 3300048905 | Bacteria | 2228 |
| 683 | Ga0496102_0353113 | 3300048905 | Bacteria | 1384 |
| 684 | Ga0496103_0042588 | 3300048906 | Bacteria | 2795 |
| 685 | Ga0496103_0079491 | 3300048906 | Bacteria | 2061 |
| 686 | Ga0496103_0452359 | 3300048906 | Bacteria | 824 |
| 687 | Ga0496104_0173390 | 3300048907 | Bacteria | 2067 |
| 688 | Ga0496104_1192309 | 3300048907 | Bacteria | 665 |
| 689 | Ga0496105_0040655 | 3300048908 | Bacteria | 3834 |
| 690 | Ga0496105_1174447 | 3300048908 | Bacteria | 566 |
| 691 | Ga0496106_0041445 | 3300048909 | Bacteria | 3450 |
| 692 | Ga0496106_0132087 | 3300048909 | Bacteria | 1959 |
| 693 | Ga0496107_0167108 | 3300048910 | Bacteria | 1631 |
| 694 | Ga0496108_0000008 | 3300048911 | Bacteria | 294619 |
| 695 | Ga0496108_0027651 | 3300048911 | Bacteria | 4688 |
| 696 | Ga0496108_0079020 | 3300048911 | Bacteria | 2785 |
| 697 | Ga0496109_0031871 | 3300048912 | Bacteria | 4735 |
| 698 | Ga0496109_0115047 | 3300048912 | Bacteria | 2503 |
| 699 | Ga0496109_0327745 | 3300048912 | Bacteria | 1445 |
| 700 | Ga0496109_0587067 | 3300048912 | Bacteria | 1050 |
| 701 | Ga0496109_0836099 | 3300048912 | Bacteria | 859 |
| 702 | Ga0496110_1208806 | 3300048913 | Bacteria | 665 |
| 703 | Ga0496112_0028581 | 3300048915 | Bacteria | 5384 |
| 704 | Ga0496112_0092793 | 3300048915 | Bacteria | 2989 |
| 705 | Ga0496112_0306377 | 3300048915 | Bacteria | 1533 |
| 706 | Ga0496113_0194423 | 3300048916 | Bacteria | 1611 |
| 707 | Ga0496113_0268856 | 3300048916 | Bacteria | 1362 |
| 708 | Ga0496114_0028721 | 3300048917 | Bacteria | 4566 |
| 709 | Ga0496115_0644765 | 3300048918 | Bacteria | 838 |
| 710 | Ga0496126_0438489 | 3300048929 | Bacteria | 1053 |
| 711 | Ga0501031_0269643 | 3300049568 | Bacteria | 1105 |
| 712 | Ga0501033_0111251 | 3300049570 | Bacteria | 1993 |
| 713 | Ga0501034_0010899 | 3300049571 | Bacteria | 9442 |
| 714 | Ga0501036_0004622 | 3300049572 | Bacteria | 11125 |
| 715 | Ga0501037_0245255 | 3300049573 | Bacteria | 1255 |
| 716 | Ga0501043_0782860 | 3300049579 | Bacteria | 691 |
| 717 | Ga0501046_0179361 | 3300049580 | Bacteria | 1585 |
| 718 | Ga0501047_0066033 | 3300049581 | Bacteria | 3487 |
| 719 | Ga0501047_0144943 | 3300049581 | Bacteria | 2252 |
| 720 | Ga0501048_1249945 | 3300049582 | Bacteria | 534 |
| 721 | Ga0501070_0050320 | 3300049586 | Bacteria | 3459 |
| 722 | Ga0501070_0052949 | 3300049586 | Bacteria | 3368 |
| 723 | Ga0501074_0041454 | 3300049590 | Bacteria | 3333 |
| 724 | Ga0501074_1152675 | 3300049590 | Bacteria | 544 |
| 725 | Ga0501080_0019705 | 3300049742 | Bacteria | 6247 |
| 726 | Ga0501035_0167830 | 3300049822 | Bacteria | 1897 |
| 727 | Ga0501035_0252789 | 3300049822 | Bacteria | 1496 |
| 728 | Ga0501044_0035637 | 3300049823 | Bacteria | 5210 |
| 729 | nmdc:mga0yw44_54757_c1 | 3300050492 | Bacteria | 2426 |
| 730 | nmdc:mga06z11_287133_c1 | 3300050494 | Bacteria | 975 |
| 731 | nmdc:mga05p37_1318_c1 | 3300050507 | Bacteria | 28884 |
| 732 | nmdc:mga09592_83_c1 | 3300050508 | Bacteria | 55635 |
| 733 | nmdc:mga0qj67_28459_c1 | 3300050509 | Bacteria | 4337 |
| 734 | nmdc:mga06r32_3179_c1 | 3300050510 | Bacteria | 14713 |
| 735 | nmdc:mga08y16_3119_c1 | 3300050511 | Bacteria | 17158 |
| 736 | nmdc:mga0n895_461534_c1 | 3300050512 | Bacteria | 1282 |
| 737 | Ga0495601_0013938 | 3300053077 | Bacteria | 4841 |
| 738 | Ga0495601_0138117 | 3300053077 | Bacteria | 1589 |
| 739 | Ga0495601_0275765 | 3300053077 | Bacteria | 1096 |
| 740 | Ga0495612_0000785 | 3300053078 | Bacteria | 12917 |
| 741 | Ga0495612_0028516 | 3300053078 | Bacteria | 2248 |
| 742 | Ga0495612_0292437 | 3300053078 | Bacteria | 730 |
| 743 | Ga0495595_0015282 | 3300053084 | Bacteria | 3272 |
| 744 | Ga0495595_0065707 | 3300053084 | Bacteria | 1706 |
| 745 | Ga0495595_0066854 | 3300053084 | Bacteria | 1693 |
| 746 | Ga0495595_0192510 | 3300053084 | Bacteria | 1014 |
| 747 | Ga0495595_0400141 | 3300053084 | Bacteria | 696 |
| 748 | Ga0495619_0010893 | 3300053085 | Bacteria | 5722 |
| 749 | Ga0495619_0213321 | 3300053085 | Bacteria | 1337 |
| 750 | Ga0500646_0000221 | 3300053090 | Bacteria | 17160 |
| 751 | Ga0500640_001018 | 3300053095 | Bacteria | 7972 |
| 752 | Ga0500553_102948 | 3300053101 | Bacteria | 1223 |
| 753 | Ga0500560_005640 | 3300053107 | Bacteria | 2789 |
| 754 | Ga0500573_0013160 | 3300053140 | Bacteria | 4657 |
| 755 | Ga0500624_004099 | 3300053157 | Bacteria | 1910 |
| 756 | Ga0500639_288596 | 3300053163 | Bacteria | 626 |
| 757 | Ga0501084_0354131 | 3300054114 | Bacteria | 1240 |
| 758 | Ga0466962_0000573 | 3300061719 | Bacteria | 16169 |
| 759 | 2559432350 | 2558860280 | Bacteria | 11429938 |
| 760 | 2808848908 | 2808606359 | Bacteria | 9866990 |
| 761 | 2809229045 | 2808606448 | Bacteria | 8656184 |
| 762 | 2862581031 | 2862574272 | Bacteria | 10567477 |
| 763 | 2912728470 | 2912723979 | Bacteria | 8557534 |
| 764 | 2954005569 | 2954002825 | Bacteria | 9173742 |
| 765 | 2995468230 | 2995463766 | Bacteria | 8577691 |
| 766 | 8008580956 | 8008574985 | Bacteria | 7815457 |
| 767 | Ga0070714_100568855 | |||
| 768 | rootL2_10084405 | |||
| 769 | rootL2_10108025 | |||
| 770 | Ga0070680_100311583 | |||
| 771 | Ga0070680_100721426 | |||
| 772 | Ga0070689_101416349 | |||
| 773 | Ga0070691_10098059 | |||
| 774 | Ga0070671_100670934 | |||
| 775 | Ga0070709_10011964 | |||
| 776 | Ga0070709_10020043 | |||
| 777 | Ga0070709_10057331 | |||
| 778 | Ga0070709_10084947 | |||
| 779 | Ga0070709_10222140 | |||
| 780 | Ga0070709_10322338 | |||
| 781 | Ga0070709_10524790 | |||
| 782 | Ga0070709_10900077 | |||
| 783 | Ga0070714_100000002 | |||
| 784 | Ga0070714_100004894 | |||
| 785 | Ga0070714_100024164 | |||
| 786 | Ga0070714_100113590 | |||
| 787 | Ga0070714_100249267 | |||
| 788 | Ga0070714_100254912 | |||
| 789 | Ga0070714_100275520 | |||
| 790 | Ga0070714_100285746 | |||
| 791 | Ga0070714_100466889 | |||
| 792 | Ga0070714_100772611 | |||
| 793 | Ga0070714_100823619 | |||
| 794 | Ga0070713_100014868 | |||
| 795 | Ga0070713_100027148 | |||
| 796 | Ga0070713_100053572 | |||
| 797 | Ga0070713_100055713 | |||
| 798 | Ga0070713_100094423 | |||
| 799 | Ga0070713_100101028 | |||
| 800 | Ga0070713_100181144 | |||
| 801 | Ga0070713_100186808 | |||
| 802 | Ga0070713_100260586 | |||
| 803 | Ga0070713_100445495 | |||
| 804 | Ga0070713_100795355 | |||
| 805 | Ga0070713_101159604 | |||
| 806 | Ga0070710_10016510 | |||
| 807 | Ga0070710_10068810 | |||
| 808 | Ga0070710_10330472 | |||
| 809 | Ga0070710_10375208 | |||
| 810 | Ga0070710_11024761 | |||
| 811 | Ga0070711_100011677 | |||
| 812 | Ga0070711_100031838 | |||
| 813 | Ga0070711_100047650 | |||
| 814 | Ga0070711_100067208 | |||
| 815 | Ga0070711_100249518 | |||
| 816 | Ga0070711_100617760 | |||
| 817 | Ga0070711_100703432 | |||
| 818 | Ga0070694_100429695 | |||
| 819 | Ga0070663_101123361 | |||
| 820 | Ga0070685_10277627 | |||
| 821 | Ga0070706_100125570 | |||
| 822 | Ga0070698_100026601 | |||
| 823 | Ga0070679_101054025 | |||
| 824 | Ga0070684_101956053 | |||
| 825 | Ga0068853_100007266 | |||
| 826 | Ga0070695_100250465 | |||
| 827 | Ga0070693_100185059 | |||
| 828 | Ga0070665_100403377 | |||
| 829 | Ga0070665_100528263 | |||
| 830 | Ga0070665_101167339 | |||
| 831 | Ga0068855_100543389 | |||
| 832 | Ga0068855_101102296 | |||
| 833 | Ga0068856_101418503 | |||
| 834 | Ga0070702_100626267 | |||
| 835 | Ga0068852_101041442 | |||
| 836 | Ga0068863_100019662 | |||
| 837 | Ga0068863_100833262 | |||
| 838 | Ga0068860_100777634 | |||
| 839 | Ga0081455_10017069 | |||
| 840 | Ga0081455_10170693 | |||
| 841 | Ga0081455_10177600 | |||
| 842 | Ga0081455_10531705 | |||
| 843 | Ga0070717_10012266 | |||
| 844 | Ga0070717_10025069 | |||
| 845 | Ga0070717_10102540 | |||
| 846 | Ga0070717_10111084 | |||
| 847 | Ga0070717_10153550 | |||
| 848 | Ga0070717_10156062 | |||
| 849 | Ga0070717_10169831 | |||
| 850 | Ga0070717_10187790 | |||
| 851 | Ga0070717_10267866 | |||
| 852 | Ga0070715_10062999 | |||
| 853 | Ga0070715_10077013 | |||
| 854 | Ga0070715_10245869 | |||
| 855 | Ga0070715_10582930 | |||
| 856 | Ga0070716_100000653 | |||
| 857 | Ga0070716_100004013 | |||
| 858 | Ga0070716_100399966 | |||
| 859 | Ga0070716_100924848 | |||
| 860 | Ga0070716_101173477 | |||
| 861 | Ga0070712_100023404 | |||
| 862 | Ga0070712_100065592 | |||
| 863 | Ga0070712_100128244 | |||
| 864 | Ga0070712_100150513 | |||
| 865 | Ga0070712_100752905 | |||
| 866 | Ga0070712_100812792 | |||
| 867 | Ga0070712_101435650 | |||
| 868 | Ga0097621_100028180 | |||
| 869 | Ga0068871_100558986 | |||
| 870 | Ga0068871_100705136 | |||
| 871 | Ga0075428_100003781 | |||
| 872 | Ga0075430_100031446 | |||
| 873 | Ga0075431_100000561 | |||
| 874 | Ga0075434_100887238 | |||
| 875 | Ga0075429_100002390 | |||
| 876 | Ga0105240_10471697 | |||
| 877 | Ga0111539_10036831 | |||
| 878 | Ga0105245_10043179 | |||
| 879 | Ga0105245_11453844 | |||
| 880 | Ga0114129_10022262 | |||
| 881 | Ga0105243_10884333 | |||
| 882 | Ga0105241_10318795 | |||
| 883 | Ga0105241_10737562 | |||
| 884 | Ga0105241_11356922 | |||
| 885 | Ga0105242_12459827 | |||
| 886 | Ga0105248_10278699 | |||
| 887 | Ga0105248_10855628 | |||
| 888 | Ga0105237_10306667 | |||
| 889 | Ga0105238_10003581 | |||
| 890 | Ga0105238_10840564 | |||
| 891 | Ga0105249_10237874 | |||
| 892 | Ga0105249_10337500 | |||
| 893 | Ga0105249_10893573 | |||
| 894 | Ga0105239_10285112 | |||
| 895 | Ga0105239_10765623 | |||
| 896 | Ga0105246_10993075 | |||
| 897 | Ga0157369_10476446 | |||
| 898 | Ga0157374_10071290 | |||
| 899 | Ga0157374_11530276 | |||
| 900 | Ga0157378_10952279 | |||
| 901 | Ga0163162_10011922 | |||
| 902 | Ga0163162_11190769 | |||
| 903 | Ga0163162_11418037 | |||
| 904 | Ga0157372_10033630 | |||
| 905 | Ga0157372_10167139 | |||
| 906 | Ga0157372_10655349 | |||
| 907 | Ga0157375_10534806 | |||
| 908 | Ga0157375_10645878 | |||
| 909 | Ga0163163_10089435 | |||
| 910 | Ga0163163_10893745 | |||
| 911 | Ga0157377_10046505 | |||
| 912 | Ga0157377_10408231 | |||
| 913 | Ga0157379_10079187 | |||
| 914 | Ga0157379_10973660 | |||
| 915 | Ga0157376_10175626 | |||
| 916 | Ga0157376_11427687 | |||
| 917 | Ga0163161_10398645 | |||
| 918 | Ga0206353_11027777 | |||
| 919 | Ga0213875_10000292 | |||
| 920 | Ga0224572_1040972 | |||
| 921 | Ga0207653_10004578 | |||
| 922 | Ga0207692_10006997 | |||
| 923 | Ga0207692_10044544 | |||
| 924 | Ga0207692_10057951 | |||
| 925 | Ga0207685_10021398 | |||
| 926 | Ga0207685_10039128 | |||
| 927 | Ga0207685_10054426 | |||
| 928 | Ga0207699_10005414 | |||
| 929 | Ga0207699_10006116 | |||
| 930 | Ga0207699_10023525 | |||
| 931 | Ga0207699_10050788 | |||
| 932 | Ga0207699_10545471 | |||
| 933 | Ga0207699_10635563 | |||
| 934 | Ga0207699_10737235 | |||
| 935 | Ga0207684_10088849 | |||
| 936 | Ga0207707_10197709 | |||
| 937 | Ga0207695_10644889 | |||
| 938 | Ga0207671_10188920 | |||
| 939 | Ga0207671_10523291 | |||
| 940 | Ga0207671_11199295 | |||
| 941 | Ga0207693_10019173 | |||
| 942 | Ga0207693_10146190 | |||
| 943 | Ga0207693_10155476 | |||
| 944 | Ga0207693_10235258 | |||
| 945 | Ga0207693_10355867 | |||
| 946 | Ga0207693_10375847 | |||
| 947 | Ga0207693_10495372 | |||
| 948 | Ga0207693_10710639 | |||
| 949 | Ga0207693_10717636 | |||
| 950 | Ga0207663_10004437 | |||
| 951 | Ga0207663_10053080 | |||
| 952 | Ga0207663_10054828 | |||
| 953 | Ga0207663_10484557 | |||
| 954 | Ga0207663_10710265 | |||
| 955 | Ga0207663_10776195 | |||
| 956 | Ga0207652_10321987 | |||
| 957 | Ga0207646_11486481 | |||
| 958 | Ga0207681_10994242 | |||
| 959 | Ga0207687_10303501 | |||
| 960 | Ga0207700_10002223 | |||
| 961 | Ga0207700_10023087 | |||
| 962 | Ga0207700_10025092 | |||
| 963 | Ga0207700_10058674 | |||
| 964 | Ga0207700_10107824 | |||
| 965 | Ga0207700_10185802 | |||
| 966 | Ga0207700_10258461 | |||
| 967 | Ga0207700_10285579 | |||
| 968 | Ga0207700_10528357 | |||
| 969 | Ga0207700_10595375 | |||
| 970 | Ga0207700_10732744 | |||
| 971 | Ga0207664_10000038 | |||
| 972 | Ga0207664_10001019 | |||
| 973 | Ga0207664_10004501 | |||
| 974 | Ga0207664_10014738 | |||
| 975 | Ga0207664_10021083 | |||
| 976 | Ga0207664_10064185 | |||
| 977 | Ga0207664_10092851 | |||
| 978 | Ga0207664_10194102 | |||
| 979 | Ga0207664_10209156 | |||
| 980 | Ga0207664_10282085 | |||
| 981 | Ga0207664_10368206 | |||
| 982 | Ga0207704_10170999 | |||
| 983 | Ga0207665_10003632 | |||
| 984 | Ga0207665_10019308 | |||
| 985 | Ga0207667_10414169 | |||
| 986 | Ga0207712_10968063 | |||
| 987 | Ga0207712_10974813 | |||
| 988 | Ga0207677_10285109 | |||
| 989 | Ga0207639_10668126 | |||
| 990 | Ga0207702_10145653 | |||
| 991 | Ga0207702_10497247 | |||
| 992 | Ga0207641_10302866 | |||
| 993 | Ga0207641_10614045 | |||
| 994 | Ga0207641_10886387 | |||
| 995 | Ga0207675_100060371 | |||
| 996 | Ga0207428_10001600 | |||
| 997 | Ga0268266_10090313 | |||
| 998 | Ga0268264_10821194 | |||
| 999 | Ga0265336_10018452 | |||
| 1000 | Ga0307515_10073249 | |||
| 1001 | Ga0265338_10056948 | |||
| 1002 | Ga0307511_10027833 | |||
| 1003 | Ga0307512_10031684 | |||
| 1004 | Ga0307512_10054038 | |||
| 1005 | Ga0265760_10002529 | |||
| 1006 | Ga0265327_10001233 | |||
| 1007 | Ga0307513_10492236 | |||
| 1008 | Ga0307509_10010033 | |||
| 1009 | Ga0307509_10031483 | |||
| 1010 | Ga0307508_10003230 | |||
| 1011 | Ga0307508_10006304 | |||
| 1012 | Ga0307508_10008673 | |||
| 1013 | Ga0307508_10121572 | |||
| 1014 | Ga0307508_10710677 | |||
| 1015 | Ga0307514_10001453 | |||
| 1016 | Ga0307514_10176687 | |||
| 1017 | Ga0307516_10401771 | |||
| 1018 | Ga0307507_10013841 | |||
| 1019 | Ga0307507_10027613 | |||
| 1020 | Ga0307510_10051842 | |||
| 1021 | Ga0307510_10302859 | |||
| 1022 | Ga0316214_1002889 | |||
| 1023 | Ga0373926_0002104 | |||
| 1024 | Ga0373926_0071310 | |||
| 1025 | Ga0373926_0150766 | |||
| 1026 | Ga0373928_0021387 | |||
| 1027 | Ga0373934_0027760 | |||
| 1028 | Ga0373952_0035506 | |||
| 1029 | Ga0373923_0006446 | |||
| 1030 | Ga0373923_0010421 | |||
| 1031 | Ga0373923_0013947 | |||
| 1032 | Ga0373923_0014732 | |||
| 1033 | Ga0373923_0081937 | |||
| 1034 | Ga0373923_0317066 | |||
| 1035 | Ga0373932_0105138 | |||
| 1036 | Ga0373936_0003325 | |||
| 1037 | Ga0373936_0016328 | |||
| 1038 | Ga0373936_0035107 | |||
| 1039 | Ga0373936_0048386 | |||
| 1040 | Ga0373936_0207638 | |||
| 1041 | Ga0373939_0189086 | |||
| 1042 | Ga0373945_0001913 | |||
| 1043 | Ga0373945_0107401 | |||
| 1044 | Ga0373945_0122932 | |||
| 1045 | Ga0373953_0031037 | |||
| 1046 | Ga0373953_0069094 | |||
| 1047 | Ga0373954_0021962 | |||
| 1048 | Ga0373954_0094532 | |||
| 1049 | Ga0373956_0005350 | |||
| 1050 | Ga0373956_0036943 | |||
| 1051 | Ga0373956_0187241 | |||
| 1052 | Ga0373957_0004620 | |||
| 1053 | Ga0373957_0005985 | |||
| 1054 | Ga0373943_0001615 | |||
| 1055 | Ga0373943_0016115 | |||
| 1056 | Ga0373943_0063589 | |||
| 1057 | Ga0373943_0358659 | |||
| 1058 | Ga0373943_0599148 | |||
| 1059 | Ga0373946_0011715 | |||
| 1060 | Ga0373946_0068066 | |||
| 1061 | Ga0373946_0279713 | |||
| 1062 | Ga0373946_0663630 | |||
| 1063 | Ga0373955_0001158 | |||
| 1064 | Ga0373955_0005591 | |||
| 1065 | Ga0373955_0026119 | |||
| 1066 | Ga0373942_0000592 | |||
| 1067 | Ga0373924_0002060 | |||
| 1068 | Ga0373924_0004820 | |||
| 1069 | Ga0373924_0017223 | |||
| 1070 | Ga0373924_0277874 | |||
| 1071 | Ga0373935_0006326 | |||
| 1072 | Ga0373935_0012391 | |||
| 1073 | Ga0373935_0029065 | |||
| 1074 | Ga0373935_0084253 | |||
| 1075 | Ga0373935_0140497 | |||
| 1076 | Ga0373935_0280325 | |||
| 1077 | Ga0373927_0061764 | |||
| 1078 | Ga0373927_0247725 | |||
| 1079 | Ga0373927_0337928 | |||
| 1080 | Ga0373933_0001299 | |||
| 1081 | Ga0373933_0159974 | |||
| 1082 | Ga0373933_0222747 | |||
| 1083 | Ga0373947_0038465 | |||
| 1084 | Ga0373947_0058674 | |||
| 1085 | Ga0373947_0089509 | |||
| 1086 | Ga0373947_0174016 | |||
| 1087 | Ga0373937_0024671 | |||
| 1088 | Ga0373937_0049692 | |||
| 1089 | Ga0373937_0085106 | |||
| 1090 | Ga0373937_0445520 | |||
| 1091 | Ga0373937_0597650 | |||
| 1092 | Ga0373937_0790170 | |||
| 1093 | Ga0373925_0006890 | |||
| 1094 | Ga0373925_0014271 | |||
| 1095 | Ga0373925_0025650 | |||
| 1096 | Ga0373925_0031631 | |||
| 1097 | Ga0373925_0151505 | |||
| 1098 | Ga0373925_0152860 | |||
| 1099 | Ga0373925_0813129 | |||
| 1100 | Ga0395900_0366696 | |||
| 1101 | Ga0395898_0013982 | |||
| 1102 | Ga0395898_0036257 | |||
| 1103 | Ga0395898_0955292 | |||
| 1104 | Ga0436364_0734194 | |||
| 1105 | Ga0436364_1135881 | |||
| 1106 | Ga0436364_1492889 | |||
| 1107 | Ga0395901_1511939 | |||
| 1108 | Ga0451853_1612332 | |||
| 1109 | Ga0439448_0001710 | |||
| 1110 | Ga0439449_0003066 | |||
| 1111 | Ga0439455_0001546 | |||
| 1112 | Ga0450903_000007 | |||
| 1113 | Ga0450901_006245 | |||
| 1114 | Ga0466969_0254225 | |||
| 1115 | Ga0466972_0196171 | |||
| 1116 | Ga0466965_0002942 | |||
| 1117 | Ga0466966_0001649 | |||
| 1118 | Ga0466966_0008575 | |||
| 1119 | Ga0466961_0003202 | |||
| 1120 | Ga0466961_0114108 | |||
| 1121 | Ga0466963_0000620 | |||
| 1122 | Ga0466964_0005892 | |||
| 1123 | Ga0466964_0301387 | |||
| 1124 | Ga0466964_0360884 | |||
| 1125 | Ga0466971_0001206 | |||
| 1126 | Ga0466971_0080919 | |||
| 1127 | Ga0466971_0262549 | |||
| 1128 | Ga0466968_0102463 | |||
| 1129 | Ga0466970_0004261 | |||
| 1130 | Ga0466970_0057650 | |||
| 1131 | Ga0466970_0272537 | |||
| 1132 | Ga0466957_0000473 | |||
| 1133 | Ga0466959_0000889 | |||
| 1134 | Ga0466959_0534903 | |||
| 1135 | Ga0466958_0008253 | |||
| 1136 | Ga0466967_0024595 | |||
| 1137 | Ga0466967_0999620 | |||
| 1138 | Ga0495592_0000533 | |||
| 1139 | Ga0495592_0016679 | |||
| 1140 | Ga0495592_0022893 | |||
| 1141 | Ga0495592_0053249 | |||
| 1142 | Ga0495592_0067145 | |||
| 1143 | Ga0495592_0137888 | |||
| 1144 | Ga0495603_0001324 | |||
| 1145 | Ga0495603_0013490 | |||
| 1146 | Ga0495603_0077956 | |||
| 1147 | Ga0495603_0261569 | |||
| 1148 | Ga0495590_0039283 | |||
| 1149 | Ga0495629_0006195 | |||
| 1150 | Ga0495629_0013660 | |||
| 1151 | Ga0495629_0041457 | |||
| 1152 | Ga0495629_0058261 | |||
| 1153 | Ga0495629_0102115 | |||
| 1154 | Ga0495629_0183874 | |||
| 1155 | Ga0495629_0222137 | |||
| 1156 | Ga0495629_0305386 | |||
| 1157 | Ga0495629_0713476 | |||
| 1158 | Ga0495638_0506044 | |||
| 1159 | Ga0495641_0009673 | |||
| 1160 | Ga0495641_0011378 | |||
| 1161 | Ga0495641_0068268 | |||
| 1162 | Ga0495641_0077741 | |||
| 1163 | Ga0495641_0193824 | |||
| 1164 | Ga0495641_0473838 | |||
| 1165 | Ga0495651_0014285 | |||
| 1166 | Ga0495651_0029913 | |||
| 1167 | Ga0495651_0043753 | |||
| 1168 | Ga0495651_0070812 | |||
| 1169 | Ga0495651_0084811 | |||
| 1170 | Ga0495653_0027494 | |||
| 1171 | Ga0495653_0121661 | |||
| 1172 | Ga0495653_0447315 | |||
| 1173 | Ga0495650_0030732 | |||
| 1174 | Ga0495580_0008335 | |||
| 1175 | Ga0495580_0365737 | |||
| 1176 | Ga0495582_0001439 | |||
| 1177 | Ga0495582_0034703 | |||
| 1178 | Ga0495582_0057206 | |||
| 1179 | Ga0495582_0221088 | |||
| 1180 | Ga0495605_0001547 | |||
| 1181 | Ga0495605_0041493 | |||
| 1182 | Ga0495639_0004306 | |||
| 1183 | Ga0495639_0011573 | |||
| 1184 | Ga0495639_0055730 | |||
| 1185 | Ga0495662_0000937 | |||
| 1186 | Ga0495662_0010527 | |||
| 1187 | Ga0495662_0071327 | |||
| 1188 | Ga0495662_0089858 | |||
| 1189 | Ga0495662_0115775 | |||
| 1190 | Ga0495662_0137773 | |||
| 1191 | Ga0495662_0221101 | |||
| 1192 | Ga0495662_0243110 | |||
| 1193 | Ga0495664_0001190 | |||
| 1194 | Ga0495664_0029289 | |||
| 1195 | Ga0495664_0107735 | |||
| 1196 | Ga0495664_0195971 | |||
| 1197 | Ga0495664_0269328 | |||
| 1198 | Ga0495664_0318321 | |||
| 1199 | Ga0495584_0055583 | |||
| 1200 | Ga0495584_0266431 | |||
| 1201 | Ga0495585_0064676 | |||
| 1202 | Ga0495594_0061925 | |||
| 1203 | Ga0495594_0104436 | |||
| 1204 | Ga0495583_0035445 | |||
| 1205 | Ga0495606_0012897 | |||
| 1206 | Ga0495606_0268620 | |||
| 1207 | Ga0495608_0011405 | |||
| 1208 | Ga0495608_0072053 | |||
| 1209 | Ga0495610_0221946 | |||
| 1210 | Ga0495618_0013181 | |||
| 1211 | Ga0495618_0044213 | |||
| 1212 | Ga0495618_0088468 | |||
| 1213 | Ga0495618_0128018 | |||
| 1214 | Ga0495618_0246948 | |||
| 1215 | Ga0495618_0334798 | |||
| 1216 | Ga0495620_0003274 | |||
| 1217 | Ga0495620_0143312 | |||
| 1218 | Ga0495628_0029616 | |||
| 1219 | Ga0495628_0040030 | |||
| 1220 | Ga0495628_0142315 | |||
| 1221 | Ga0495628_0156061 | |||
| 1222 | Ga0495628_0243619 | |||
| 1223 | Ga0495628_0420853 | |||
| 1224 | Ga0495630_0026182 | |||
| 1225 | Ga0495630_0058558 | |||
| 1226 | Ga0495630_0139751 | |||
| 1227 | Ga0495630_0225046 | |||
| 1228 | Ga0495630_0242821 | |||
| 1229 | Ga0495643_0002317 | |||
| 1230 | Ga0495643_0011043 | |||
| 1231 | Ga0495644_0013948 | |||
| 1232 | Ga0495648_0016834 | |||
| 1233 | Ga0495648_0220593 | |||
| 1234 | Ga0495666_0005521 | |||
| 1235 | Ga0495666_0079047 | |||
| 1236 | Ga0495666_0192996 | |||
| 1237 | Ga0495642_0081960 | |||
| 1238 | Ga0495652_0000731 | |||
| 1239 | Ga0495652_0014378 | |||
| 1240 | Ga0495652_0055391 | |||
| 1241 | Ga0495652_0093259 | |||
| 1242 | Ga0495652_0120359 | |||
| 1243 | Ga0495652_0126860 | |||
| 1244 | Ga0495652_0498733 | |||
| 1245 | Ga0495652_0811023 | |||
| 1246 | Ga0495665_0002348 | |||
| 1247 | Ga0495665_0007767 | |||
| 1248 | Ga0495665_0010861 | |||
| 1249 | Ga0495665_0011827 | |||
| 1250 | Ga0495665_0039988 | |||
| 1251 | Ga0495665_0149861 | |||
| 1252 | Ga0495665_0218889 | |||
| 1253 | Ga0495640_0041139 | |||
| 1254 | Ga0495640_0051824 | |||
| 1255 | Ga0495640_0059553 | |||
| 1256 | Ga0495640_0086954 | |||
| 1257 | Ga0495640_0450208 | |||
| 1258 | Ga0495586_0025368 | |||
| 1259 | Ga0495586_0038621 | |||
| 1260 | Ga0495586_0050344 | |||
| 1261 | Ga0495586_0300648 | |||
| 1262 | Ga0495587_0002717 | |||
| 1263 | Ga0495587_0003610 | |||
| 1264 | Ga0495587_0005655 | |||
| 1265 | Ga0495587_0019081 | |||
| 1266 | Ga0495587_0161804 | |||
| 1267 | Ga0495597_0208176 | |||
| 1268 | Ga0495645_0006572 | |||
| 1269 | Ga0495645_0025115 | |||
| 1270 | Ga0495645_0043329 | |||
| 1271 | Ga0495645_0071310 | |||
| 1272 | Ga0495645_0080121 | |||
| 1273 | Ga0495645_0080211 | |||
| 1274 | Ga0495645_0134378 | |||
| 1275 | Ga0495645_0338457 | |||
| 1276 | Ga0495622_0069359 | |||
| 1277 | Ga0495667_0014966 | |||
| 1278 | Ga0495667_0022967 | |||
| 1279 | Ga0495667_0062793 | |||
| 1280 | Ga0495667_0092703 | |||
| 1281 | Ga0495667_0168757 | |||
| 1282 | Ga0495667_0332895 | |||
| 1283 | Ga0495667_0508456 | |||
| 1284 | Ga0495668_0011363 | |||
| 1285 | Ga0495668_0180789 | |||
| 1286 | Ga0495634_0001842 | |||
| 1287 | Ga0495634_0006619 | |||
| 1288 | Ga0495634_0015575 | |||
| 1289 | Ga0495634_0022206 | |||
| 1290 | Ga0495634_0030742 | |||
| 1291 | Ga0495634_0091807 | |||
| 1292 | Ga0495634_0171832 | |||
| 1293 | Ga0495634_0660839 | |||
| 1294 | Ga0495611_0020514 | |||
| 1295 | Ga0495625_0441559 | |||
| 1296 | Ga0495635_0009265 | |||
| 1297 | Ga0495635_0033666 | |||
| 1298 | Ga0495635_0035697 | |||
| 1299 | Ga0495635_0036617 | |||
| 1300 | Ga0495635_0065637 | |||
| 1301 | Ga0495635_0072291 | |||
| 1302 | Ga0495635_0118719 | |||
| 1303 | Ga0495635_0133882 | |||
| 1304 | Ga0495635_0253660 | |||
| 1305 | Ga0495635_0464252 | |||
| 1306 | Ga0495588_0099672 | |||
| 1307 | Ga0495657_0001951 | |||
| 1308 | Ga0495657_0007880 | |||
| 1309 | Ga0495657_0010131 | |||
| 1310 | Ga0495657_0023926 | |||
| 1311 | Ga0495657_0036154 | |||
| 1312 | Ga0495657_0106359 | |||
| 1313 | Ga0495599_0034176 | |||
| 1314 | Ga0495599_0100141 | |||
| 1315 | Ga0495599_0251017 | |||
| 1316 | Ga0495599_0252074 | |||
| 1317 | Ga0495599_0328185 | |||
| 1318 | Ga0495623_0004911 | |||
| 1319 | Ga0495623_0016907 | |||
| 1320 | Ga0495623_0038511 | |||
| 1321 | Ga0495623_0100646 | |||
| 1322 | Ga0495623_0141211 | |||
| 1323 | Ga0495646_0001163 | |||
| 1324 | Ga0495646_0001297 | |||
| 1325 | Ga0495646_0005089 | |||
| 1326 | Ga0495646_0006708 | |||
| 1327 | Ga0495646_0051478 | |||
| 1328 | Ga0495646_0112384 | |||
| 1329 | Ga0495646_0168922 | |||
| 1330 | Ga0495646_0305732 | |||
| 1331 | Ga0495647_0012470 | |||
| 1332 | Ga0495647_0088441 | |||
| 1333 | Ga0495658_0012202 | |||
| 1334 | Ga0495658_0221438 | |||
| 1335 | Ga0495613_0000579 | |||
| 1336 | Ga0495613_0003570 | |||
| 1337 | Ga0495613_0004560 | |||
| 1338 | Ga0495613_0034291 | |||
| 1339 | Ga0495613_0037980 | |||
| 1340 | Ga0495613_0041547 | |||
| 1341 | Ga0495613_0051096 | |||
| 1342 | Ga0495613_0072923 | |||
| 1343 | Ga0495613_0242600 | |||
| 1344 | Ga0495624_0014782 | |||
| 1345 | Ga0495624_0026585 | |||
| 1346 | Ga0495624_0051779 | |||
| 1347 | Ga0495624_0137418 | |||
| 1348 | Ga0495624_0166115 | |||
| 1349 | Ga0495624_0191355 | |||
| 1350 | Ga0495624_0303637 | |||
| 1351 | Ga0495624_0347297 | |||
| 1352 | Ga0495649_0052614 | |||
| 1353 | Ga0495589_0008211 | |||
| 1354 | Ga0495600_0000897 | |||
| 1355 | Ga0495600_0011883 | |||
| 1356 | Ga0495600_0037522 | |||
| 1357 | Ga0495600_0042432 | |||
| 1358 | Ga0495600_0093236 | |||
| 1359 | Ga0495600_0098077 | |||
| 1360 | Ga0495600_0104650 | |||
| 1361 | Ga0495660_0015042 | |||
| 1362 | Ga0495581_0029101 | |||
| 1363 | Ga0495581_0044606 | |||
| 1364 | Ga0495581_0045749 | |||
| 1365 | Ga0495581_0046539 | |||
| 1366 | Ga0495581_0055069 | |||
| 1367 | Ga0495581_0061645 | |||
| 1368 | Ga0495581_0161283 | |||
| 1369 | Ga0495604_0000213 | |||
| 1370 | Ga0495604_0007672 | |||
| 1371 | Ga0495604_0016298 | |||
| 1372 | Ga0495604_0033683 | |||
| 1373 | Ga0495604_0036763 | |||
| 1374 | Ga0495604_0068526 | |||
| 1375 | Ga0495604_0349035 | |||
| 1376 | Ga0495604_0662148 | |||
| 1377 | Ga0495604_0760738 | |||
| 1378 | Ga0495636_0017923 | |||
| 1379 | Ga0495674_0027131 | |||
| 1380 | Ga0495674_0126704 | |||
| 1381 | Ga0495674_0133838 | |||
| 1382 | Ga0495674_0186388 | |||
| 1383 | Ga0495674_0277232 | |||
| 1384 | Ga0495674_0621635 | |||
| 1385 | Ga0495676_0000413 | |||
| 1386 | Ga0495676_0007049 | |||
| 1387 | Ga0495676_0007443 | |||
| 1388 | Ga0495676_0012405 | |||
| 1389 | Ga0495676_0019011 | |||
| 1390 | Ga0495676_0046396 | |||
| 1391 | Ga0495676_0179302 | |||
| 1392 | Ga0495676_0216303 | |||
| 1393 | Ga0495676_0303311 | |||
| 1394 | Ga0495676_0443858 | |||
| 1395 | Ga0495680_0011221 | |||
| 1396 | Ga0495680_0017182 | |||
| 1397 | Ga0495680_0032105 | |||
| 1398 | Ga0495680_0449225 | |||
| 1399 | Ga0495680_0525840 | |||
| 1400 | Ga0495683_0007937 | |||
| 1401 | Ga0495683_0202620 | |||
| 1402 | Ga0495687_005538 | |||
| 1403 | Ga0495687_048770 | |||
| 1404 | Ga0495675_0008798 | |||
| 1405 | Ga0495675_0016045 | |||
| 1406 | Ga0495675_0016810 | |||
| 1407 | Ga0495675_0048644 | |||
| 1408 | Ga0495675_0085803 | |||
| 1409 | Ga0495675_0121374 | |||
| 1410 | Ga0495675_0200808 | |||
| 1411 | Ga0495675_0592878 | |||
| 1412 | Ga0495685_009439 | |||
| 1413 | Ga0495684_0006269 | |||
| 1414 | Ga0495684_0009269 | |||
| 1415 | Ga0495684_0024539 | |||
| 1416 | Ga0495684_0046334 | |||
| 1417 | Ga0495684_0149424 | |||
| 1418 | Ga0495684_0288668 | |||
| 1419 | Ga0495684_0388289 | |||
| 1420 | Ga0495686_0407058 | |||
| 1421 | Ga0495593_0001410 | |||
| 1422 | Ga0495593_0001417 | |||
| 1423 | Ga0495593_0005086 | |||
| 1424 | Ga0495593_0017932 | |||
| 1425 | Ga0495593_0018942 | |||
| 1426 | Ga0495593_0040977 | |||
| 1427 | Ga0495593_0064816 | |||
| 1428 | Ga0495593_0398174 | |||
| 1429 | Ga0495602_0034728 | |||
| 1430 | Ga0495602_0036385 | |||
| 1431 | Ga0495602_0041109 | |||
| 1432 | Ga0495602_0043114 | |||
| 1433 | Ga0495602_0292612 | |||
| 1434 | Ga0495614_0001226 | |||
| 1435 | Ga0495614_0002852 | |||
| 1436 | Ga0495614_0006927 | |||
| 1437 | Ga0495614_0009781 | |||
| 1438 | Ga0495614_0039539 | |||
| 1439 | Ga0495614_0049247 | |||
| 1440 | Ga0495614_0063615 | |||
| 1441 | Ga0495614_0455935 | |||
| 1442 | Ga0496100_0073431 | |||
| 1443 | Ga0496100_0396489 | |||
| 1444 | Ga0496101_0229244 | |||
| 1445 | Ga0496102_0065207 | |||
| 1446 | Ga0496102_0068020 | |||
| 1447 | Ga0496102_0100265 | |||
| 1448 | Ga0496102_0144939 | |||
| 1449 | Ga0496102_0353113 | |||
| 1450 | Ga0496103_0042588 | |||
| 1451 | Ga0496103_0079491 | |||
| 1452 | Ga0496103_0452359 | |||
| 1453 | Ga0496104_0173390 | |||
| 1454 | Ga0496104_1192309 | |||
| 1455 | Ga0496105_0040655 | |||
| 1456 | Ga0496105_1174447 | |||
| 1457 | Ga0496106_0041445 | |||
| 1458 | Ga0496106_0132087 | |||
| 1459 | Ga0496107_0167108 | |||
| 1460 | Ga0496108_0000008 | |||
| 1461 | Ga0496108_0027651 | |||
| 1462 | Ga0496108_0079020 | |||
| 1463 | Ga0496109_0031871 | |||
| 1464 | Ga0496109_0115047 | |||
| 1465 | Ga0496109_0327745 | |||
| 1466 | Ga0496109_0587067 | |||
| 1467 | Ga0496109_0836099 | |||
| 1468 | Ga0496110_1208806 | |||
| 1469 | Ga0496112_0028581 | |||
| 1470 | Ga0496112_0092793 | |||
| 1471 | Ga0496112_0306377 | |||
| 1472 | Ga0496113_0194423 | |||
| 1473 | Ga0496113_0268856 | |||
| 1474 | Ga0496114_0028721 | |||
| 1475 | Ga0496115_0644765 | |||
| 1476 | Ga0496126_0438489 | |||
| 1477 | Ga0501031_0269643 | |||
| 1478 | Ga0501033_0111251 | |||
| 1479 | Ga0501034_0010899 | |||
| 1480 | Ga0501036_0004622 | |||
| 1481 | Ga0501037_0245255 | |||
| 1482 | Ga0501043_0782860 | |||
| 1483 | Ga0501046_0179361 | |||
| 1484 | Ga0501047_0066033 | |||
| 1485 | Ga0501047_0144943 | |||
| 1486 | Ga0501048_1249945 | |||
| 1487 | Ga0501070_0050320 | |||
| 1488 | Ga0501070_0052949 | |||
| 1489 | Ga0501074_0041454 | |||
| 1490 | Ga0501074_1152675 | |||
| 1491 | Ga0501080_0019705 | |||
| 1492 | Ga0501035_0167830 | |||
| 1493 | Ga0501035_0252789 | |||
| 1494 | Ga0501044_0035637 | |||
| 1495 | nmdc:mga0yw44_54757_c1 | |||
| 1496 | nmdc:mga06z11_287133_c1 | |||
| 1497 | nmdc:mga05p37_1318_c1 | |||
| 1498 | nmdc:mga09592_83_c1 | |||
| 1499 | nmdc:mga0qj67_28459_c1 | |||
| 1500 | nmdc:mga06r32_3179_c1 | |||
| 1501 | nmdc:mga08y16_3119_c1 | |||
| 1502 | nmdc:mga0n895_461534_c1 | |||
| 1503 | Ga0495601_0013938 | |||
| 1504 | Ga0495601_0138117 | |||
| 1505 | Ga0495601_0275765 | |||
| 1506 | Ga0495612_0000785 | |||
| 1507 | Ga0495612_0028516 | |||
| 1508 | Ga0495612_0292437 | |||
| 1509 | Ga0495595_0015282 | |||
| 1510 | Ga0495595_0065707 | |||
| 1511 | Ga0495595_0066854 | |||
| 1512 | Ga0495595_0192510 | |||
| 1513 | Ga0495595_0400141 | |||
| 1514 | Ga0495619_0010893 | |||
| 1515 | Ga0495619_0213321 | |||
| 1516 | Ga0500646_0000221 | |||
| 1517 | Ga0500640_001018 | |||
| 1518 | Ga0500553_102948 | |||
| 1519 | Ga0500560_005640 | |||
| 1520 | Ga0500573_0013160 | |||
| 1521 | Ga0500624_004099 | |||
| 1522 | Ga0500639_288596 | |||
| 1523 | Ga0501084_0354131 | |||
| 1524 | Ga0466962_0000573 | |||
| 1525 | 2559432350 | |||
| 1526 | 2808848908 | |||
| 1527 | 2809229045 | |||
| 1528 | 2862581031 | |||
| 1529 | 2912728470 | |||
| 1530 | 2954005569 | |||
| 1531 | 2995468230 | |||
| 1532 | 8008580956 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3igr-assembly1.cif.gz_A | the crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a | 0.8986 | 16 | 169 |
| 4u5y-assembly1.cif.gz_A | crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica | 0.8922 | 63 | 169 |
| 7kx3-assembly1.cif.gz_B | speg spermidine n-acetyltransferase f149g mutant from vibrio cholerae | 0.872 | 48 | 168 |
| 1s7n-assembly1.cif.gz_B | ribosomal l7/l12 alpha-n-protein acetyltransferase in complex with coenzyme a (coa free sulfhydryl) | 0.8692 | 17 | 169 |
| 1s7f-assembly1.cif.gz_A-2 | riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo) | 0.869 | 17 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4u5yA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8922 | 63 | 169 | 3.40.630.30 |
| af_P0A948_10_192_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8754 | 15 | 173 | 3.40.630.30 |
| 1z9uA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.866 | 17 | 170 | 3.40.630.30 |
| 3r9eB00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8583 | 17 | 169 | 3.40.630.30 |
| af_Q2FWL1_1_136_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.858 | 53 | 170 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K2VER8-F1-model_v4 | GNAT family N-acetyltransferase | 0.9745 | 1 | 169 |
GO:0016747
|
| AF-D6TUA6-F1-model_v4 | [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) | 0.9505 | 6 | 170 |
GO:0005737
GO:0008999 |
| AF-D6TUA6-F1-model_v4 | [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) | 0.939 | 6 | 170 |
GO:0005737
GO:0008999 |
| AF-A0A7X8K874-F1-model_v4 | [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) | 0.9259 | 17 | 170 |
GO:0005737
GO:0008999 |
| AF-A0A1G9V929-F1-model_v4 | [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) | 0.9252 | 16 | 182 |
GO:0005737
GO:0008999 |