F479804

General Info

Members Datasets Scaffolds Average Seq Length
765 338 737 563

Family's Representative Sequence

Representative Sequence 3300049459|Ga0495678_000316|Ga0495678_000316_26157_28010
Length 617
Sequence MFINAKAEWELRGTMIEQKLGRTGLQSQDHNHSIRDTMKTLLLPLALAVLGAIAPAAQALDTAAHAAGPATVAELNAMAKRFAPVDLTADTGKLSKGDRVAIAKLIEAAKIVDTLQLRQRWSGNEALWAALQKDTTPLGKARRDYFWINKGPWSVLDGNRSFMPASFGGLAIPAEKPLGANFYPEGAIKQELETWMNSLSAKDKEQAQWFFTVIKRTKDGKGAQQFTSVNYSDEYAAELQQLSKLLKEAANATDNASLKKFLNLRADAFLSNDYLASDFAWMDLDSPVDVTIGPYETYNDELFGYKAAFEAYVNVRDAKETEKLNFFGKHMQELENNLPIDPKYRNPKVGAIAPMVVVNQVYGAGDGNMGVQTAAYNLPNDERIISKRGSKRVMLKNVQEAKFAATLQPITKLVLRPADQKDLDFDSFFTHILAHEIMHGLGPHATTQNGKPSTPRQDLKDAYSTIEEAKADVTGLWALGYMMDKGQLKSSLGQGVEAERKLYNTFLASAFRTLHFGLTDSHARGMAIQVNYLLDKGGFVSHGDGTFSVDFKKIKAAVADLDREFLTIEATGDYARAQALMKQYVVIRPDVQKALDKMKAVPNDIRPAFVTAAKLTK

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2643221645 Massilia sp. Root351 Isolate Unclassified
6 2643221684 Massilia sp. Root133 Isolate Unclassified
7 2738541280 Massilia sp. GV090 Isolate Unclassified
8 2738541297 Duganella sp. GV083 Isolate Unclassified
9 2738541300 Massilia sp. GV016 Isolate Unclassified
10 2738541357 Duganella sp. GV053 Isolate Unclassified
11 2738543003 Duganella sp. GV066 Isolate Unclassified
12 2738543018 Massilia sp. GV045 Isolate Unclassified
13 2738543026 Duganella sp. GV089 Isolate Unclassified
14 2738543029 Duganella sp. GV039 Isolate Unclassified
15 2738543030 Massilia sp. GV097 Isolate Unclassified
16 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
17 2821131069 Duganella sp. 1224 Isolate Unclassified
18 2842711865 Duganella sp. R-73148 Isolate Unclassified
19 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
20 2857553236 Duganella sp. R-74557 Isolate Unclassified
21 2857558681 Duganella sp. R-74565 Isolate Unclassified
22 2857564685 Duganella sp. R-74599 Isolate Unclassified
23 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
24 2904424332 Duganella sp. 1411 Isolate Rhizosphere
25 2919476304 Duganella sp. 3397 Isolate Unclassified
26 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
27 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
28 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
29 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
30 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
31 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
32 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
33 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
34 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
37 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
38 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
40 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
41 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
42 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
43 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
44 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
48 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
50 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
73 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
74 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
75 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
134 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
137 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
140 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
212 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
213 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
221 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
222 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
223 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
235 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
236 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
247 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
248 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
251 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
252 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
265 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
266 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
267 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
272 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
276 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
277 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
278 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
279 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
280 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
281 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
282 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
287 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
304 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
308 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
314 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
315 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
316 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
317 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
318 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
319 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
320 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
321 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
334 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
335 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
338 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.21
Metatranscriptomes 0.13
Isolates 3.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.63
Nodule 0.26
Rhizoplane 2.22
Rhizosphere 83.14
Stem 0
Stem Tuber 0
Unclassified 5.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000265 3300000532 Bacteria 5011
2 JGI24751J29686_10000044 3300002459 Bacteria 77576
3 JGI25154J39366_1002264 3300002738 Bacteria 5236
4 JGI25152J39213_1000217 3300002773 Bacteria 39039
5 JGI25150J39212_1001645 3300002774 Bacteria 6071
6 JGI25159J45721_1004474 3300002987 Bacteria 4630
7 JGI25406J46586_10001956 3300003203 Bacteria 9737
8 JGI25153J46596_10003209 3300003215 Bacteria 9189
9 JGI25160J50197_1005010 3300003354 Bacteria 5606
10 JGI25161J50226_1006659 3300003374 Bacteria 2058
11 Ga0032354_1086905 3300003693 Bacteria 2781
12 Ga0055525_1000009 3300003759 Bacteria 596899
13 Ga0055526_1000161 3300003771 Bacteria 59705
14 Ga0055526_1000309 3300003771 Bacteria 40758
15 Ga0055526_1001981 3300003771 Bacteria 14122
16 Ga0055526_1007917 3300003771 Bacteria 5409
17 Ga0055526_1008551 3300003771 Bacteria 5080
18 Ga0055537_1000035 3300003773 Bacteria 96274
19 Ga0055537_1003987 3300003773 Bacteria 4357
20 Ga0055524_1000015 3300003775 Bacteria 246493
21 Ga0055524_1000615 3300003775 Bacteria 25550
22 Ga0055524_1001052 3300003775 Bacteria 17032
23 Ga0055524_1001567 3300003775 Bacteria 12852
24 Ga0055524_1002035 3300003775 Bacteria 10762
25 Ga0055534_1000843 3300003784 Bacteria 14132
26 Ga0055534_1002519 3300003784 Bacteria 6290
27 Ga0055528_1000058 3300003790 Bacteria 88086
28 Ga0055530_10001617 3300003791 Bacteria 16165
29 Ga0055530_10004677 3300003791 Bacteria 6944
30 Ga0055530_10005605 3300003791 Bacteria 5895
31 Ga0055531_10003927 3300003794 Bacteria 9251
32 Ga0065165_1000224 3300005262 Bacteria 99359
33 Ga0065165_1000286 3300005262 Bacteria 85993
34 Ga0065714_10064531 3300005288 Bacteria 40961
35 Ga0065712_10000123 3300005290 Bacteria 89338
36 Ga0065715_10013050 3300005293 Bacteria 2217
37 Ga0070658_10097302 3300005327 Bacteria 2430
38 Ga0070690_100001410 3300005330 Bacteria 12551
39 Ga0070690_100002314 3300005330 Bacteria 10225
40 Ga0070670_100000144 3300005331 Bacteria 66583
41 Ga0068869_100034319 3300005334 Bacteria 3588
42 Ga0068869_100034758 3300005334 Bacteria 3568
43 Ga0068869_100038074 3300005334 Bacteria 3424
44 Ga0070682_100001655 3300005337 Bacteria 12393
45 Ga0070682_100020846 3300005337 Bacteria 3862
46 Ga0068868_100089034 3300005338 Bacteria 2485
47 Ga0070689_100012356 3300005340 Bacteria 6150
48 Ga0070689_100092455 3300005340 Bacteria 2386
49 Ga0070687_100061094 3300005343 Bacteria 1991
50 Ga0070692_10023322 3300005345 Bacteria 3032
51 Ga0070669_100000609 3300005353 Bacteria 26606
52 Ga0070669_100068143 3300005353 Unclassified 2626
53 Ga0070669_100093359 3300005353 Bacteria 2259
54 Ga0070675_100016465 3300005354 Bacteria 5870
55 Ga0070675_100071206 3300005354 Bacteria 2884
56 Ga0070671_100082869 3300005355 Bacteria 2682
57 Ga0070659_100012300 3300005366 Bacteria 6345
58 Ga0070659_100038344 3300005366 Bacteria 3737
59 Ga0070703_10000254 3300005406 Bacteria 25848
60 Ga0070701_10039354 3300005438 Bacteria 2398
61 Ga0070701_10039425 3300005438 Unclassified 2396
62 Ga0070711_100000055 3300005439 Bacteria 68448
63 Ga0070705_100000012 3300005440 Bacteria 101160
64 Ga0070700_100000062 3300005441 Bacteria 79866
65 Ga0070694_100028495 3300005444 Bacteria 3635
66 Ga0070694_100080250 3300005444 Bacteria 2267
67 Ga0070694_100089146 3300005444 Bacteria 2161
68 Ga0070662_100037956 3300005457 Bacteria 3419
69 Ga0070681_10000078 3300005458 Bacteria 71959
70 Ga0070681_10007691 3300005458 Bacteria 10538
71 Ga0070681_10014121 3300005458 Bacteria 7949
72 Ga0070706_100000137 3300005467 Bacteria 91778
73 Ga0070706_100001373 3300005467 Bacteria 25852
74 Ga0070707_100054170 3300005468 Bacteria 3845
75 Ga0070698_100013194 3300005471 Bacteria 8744
76 Ga0070698_100025017 3300005471 Bacteria 6223
77 Ga0070698_100104020 3300005471 Bacteria 2809
78 Ga0070699_100000013 3300005518 Bacteria 241303
79 Ga0070699_100002577 3300005518 Bacteria 16250
80 Ga0070699_100005594 3300005518 Bacteria 11024
81 Ga0070699_100078904 3300005518 Bacteria 2867
82 Ga0070679_100000047 3300005530 Bacteria 90654
83 Ga0070697_100088995 3300005536 Bacteria 2550
84 Ga0070686_100099080 3300005544 Bacteria 1966
85 Ga0070695_100010081 3300005545 Bacteria 5635
86 Ga0070693_100000269 3300005547 Bacteria 24472
87 Ga0070704_100021829 3300005549 Bacteria 4157
88 Ga0068855_100003154 3300005563 Bacteria 20174
89 Ga0070664_100152457 3300005564 Bacteria 2041
90 Ga0068857_100035718 3300005577 Bacteria 4402
91 Ga0068857_100088981 3300005577 Bacteria 2762
92 Ga0068859_100000001 3300005617 Bacteria 545224
93 Ga0068859_100006736 3300005617 Bacteria 11672
94 Ga0068859_100094120 3300005617 Bacteria 3048
95 Ga0068859_100146528 3300005617 Bacteria 2436
96 Ga0068859_100154893 3300005617 Bacteria 2368
97 Ga0068864_100025978 3300005618 Bacteria 4936
98 Ga0068864_100032457 3300005618 Unclassified 4437
99 Ga0068864_100106835 3300005618 Bacteria 2489
100 Ga0068863_100052347 3300005841 Unclassified 3870
101 Ga0068858_100025848 3300005842 Bacteria 5460
102 Ga0068860_100035238 3300005843 Bacteria 4801
103 Ga0068860_100044352 3300005843 Bacteria 4238
104 Ga0068862_100016781 3300005844 Bacteria 6097
105 Ga0068862_100050130 3300005844 Bacteria 3567
106 Ga0081539_10000422 3300005985 Bacteria 90043
107 Ga0081539_10004930 3300005985 Bacteria 14213
108 Ga0081539_10029181 3300005985 Bacteria 3453
109 Ga0075362_10015886 3300006177 Bacteria 3071
110 Ga0097621_100028387 3300006237 Unclassified 4410
111 Ga0097621_100057637 3300006237 Bacteria 3177
112 Ga0097621_100060162 3300006237 Bacteria 3113
113 Ga0097621_100180895 3300006237 Bacteria 1822
114 Ga0068871_100008018 3300006358 Bacteria 7583
115 Ga0068871_100054453 3300006358 Bacteria 3246
116 Ga0075430_100043903 3300006846 Bacteria 3780
117 Ga0075430_100052667 3300006846 Bacteria 3428
118 Ga0075430_100056655 3300006846 Bacteria 3296
119 Ga0075430_100084797 3300006846 Bacteria 2653
120 Ga0075431_100056603 3300006847 Bacteria 4043
121 Ga0075433_10047913 3300006852 Bacteria 3717
122 Ga0075433_10121865 3300006852 Bacteria 2316
123 Ga0075434_100020847 3300006871 Bacteria 6364
124 Ga0075429_100040587 3300006880 Bacteria 4053
125 Ga0075429_100084433 3300006880 Unclassified 2767
126 Ga0075436_100003828 3300006914 Bacteria 10318
127 Ga0097620_100000001 3300006931 Bacteria 545224
128 Ga0097620_100006736 3300006931 Bacteria 11672
129 Ga0097620_100094117 3300006931 Bacteria 3048
130 Ga0097620_100146524 3300006931 Bacteria 2436
131 Ga0097620_100154888 3300006931 Bacteria 2368
132 Ga0099826_10000003 3300006948 Bacteria 1067817
133 Ga0075435_100019697 3300007076 Bacteria 5158
134 Ga0105244_10001968 3300009036 Bacteria 15915
135 Ga0105244_10022293 3300009036 Bacteria 3487
136 Ga0111539_10123413 3300009094 Bacteria 3035
137 Ga0105245_10037375 3300009098 Bacteria 4316
138 Ga0114129_10013656 3300009147 Bacteria 11571
139 Ga0114129_10023985 3300009147 Bacteria 8645
140 Ga0114129_10038360 3300009147 Bacteria 6759
141 Ga0114129_10048897 3300009147 Bacteria 5944
142 Ga0114129_10111378 3300009147 Bacteria 3777
143 Ga0105243_10008155 3300009148 Bacteria 8043
144 Ga0105243_10080565 3300009148 Bacteria 2656
145 Ga0105243_10110704 3300009148 Bacteria 2297
146 Ga0105241_10065793 3300009174 Bacteria 2802
147 Ga0105241_10111337 3300009174 Bacteria 2192
148 Ga0105242_10028444 3300009176 Bacteria 4451
149 Ga0105248_10000861 3300009177 Bacteria 34162
150 Ga0105248_10051156 3300009177 Bacteria 4636
151 Ga0105237_10000903 3300009545 Bacteria 39910
152 Ga0105238_10001253 3300009551 Bacteria 25546
153 Ga0105238_10003887 3300009551 Bacteria 14828
154 Ga0105249_10016430 3300009553 Bacteria 6567
155 Ga0105239_10030456 3300010375 Bacteria 5933
156 Ga0105239_10191758 3300010375 Bacteria 2287
157 Ga0105239_10209090 3300010375 Bacteria 2187
158 Ga0105246_10125201 3300011119 Bacteria 1911
159 Ga0157373_10045612 3300013100 Unclassified 3128
160 Ga0157374_10112293 3300013296 Bacteria 2622
161 Ga0157374_10224282 3300013296 Bacteria 1845
162 Ga0157378_10008171 3300013297 Bacteria 9131
163 Ga0157378_10042915 3300013297 Unclassified 4015
164 Ga0157378_10185587 3300013297 Bacteria 1959
165 Ga0163162_10006291 3300013306 Bacteria 11500
166 Ga0163162_10033540 3300013306 Bacteria 5102
167 Ga0163162_10070910 3300013306 Bacteria 3537
168 Ga0157372_10002676 3300013307 Bacteria 19281
169 Ga0157372_10233711 3300013307 Bacteria 2132
170 Ga0163163_10001085 3300014325 Bacteria 23094
171 Ga0163163_10001208 3300014325 Bacteria 21839
172 Ga0163163_10006946 3300014325 Bacteria 9946
173 Ga0163163_10007804 3300014325 Bacteria 9460
174 Ga0163163_10024980 3300014325 Bacteria 5691
175 Ga0163163_10037271 3300014325 Unclassified 4729
176 Ga0163163_10198180 3300014325 Bacteria 2056
177 Ga0157380_10069130 3300014326 Bacteria 2849
178 Ga0157380_10106074 3300014326 Bacteria 2350
179 Ga0157380_10147727 3300014326 Bacteria 2028
180 Ga0182008_10001646 3300014497 Bacteria 14758
181 Ga0157379_10137220 3300014968 Unclassified 2204
182 Ga0157376_10077076 3300014969 Bacteria 2851
183 Ga0182006_1000014 3300015261 Bacteria 340159
184 Ga0182006_1000268 3300015261 Bacteria 47147
185 Ga0182007_10000096 3300015262 Bacteria 62363
186 Ga0182005_1000014 3300015265 Bacteria 389763
187 Ga0182005_1000018 3300015265 Bacteria 324307
188 Ga0163161_10035876 3300017792 Unclassified 3550
189 Ga0213872_10000002 3300021361 Bacteria 554092
190 Ga0213872_10001473 3300021361 Bacteria 15262
191 Ga0213876_10031836 3300021384 Bacteria 2782
192 Ga0209436_100292 3300025208 Bacteria 23109
193 Ga0209563_100015 3300025230 Bacteria 879901
194 Ga0209437_106718 3300025233 Bacteria 1903
195 Ga0207425_1000001 3300025245 Bacteria 2525432
196 Ga0207425_1000428 3300025245 Bacteria 27931
197 Ga0207425_1000474 3300025245 Bacteria 25484
198 Ga0207425_1008411 3300025245 Bacteria 2644
199 Ga0209646_1000028 3300025246 Bacteria 387986
200 Ga0209148_1000741 3300025254 Bacteria 25277
201 Ga0209129_1000093 3300025258 Bacteria 173163
202 Ga0209565_1000009 3300025263 Bacteria 751701
203 Ga0209565_1001220 3300025263 Bacteria 12133
204 Ga0209455_1000049 3300025272 Bacteria 374414
205 Ga0209673_1000036 3300025273 Bacteria 323162
206 Ga0209130_1000044 3300025284 Bacteria 241110
207 Ga0209130_1000853 3300025284 Bacteria 25229
208 Ga0209130_1006522 3300025284 Bacteria 3773
209 Ga0209675_1000013 3300025291 Bacteria 448220
210 Ga0209025_1014127 3300025294 Bacteria 4950
211 Ga0209564_1000006 3300025295 Bacteria 1100927
212 Ga0209564_1000038 3300025295 Bacteria 414357
213 Ga0209564_1000122 3300025295 Bacteria 203709
214 Ga0209564_1000751 3300025295 Bacteria 45957
215 Ga0209564_1007615 3300025295 Bacteria 5548
216 Ga0209758_1000055 3300025297 Bacteria 336183
217 Ga0209758_1000149 3300025297 Bacteria 163504
218 Ga0209050_1000092 3300025298 Bacteria 252702
219 Ga0209050_1001070 3300025298 Bacteria 33611
220 Ga0209050_1002850 3300025298 Bacteria 13715
221 Ga0209256_1000005 3300025299 Bacteria 1315082
222 Ga0209256_1000106 3300025299 Bacteria 187258
223 Ga0209256_1000586 3300025299 Bacteria 50850
224 Ga0209256_1000879 3300025299 Bacteria 37144
225 Ga0207426_1002992 3300025302 Bacteria 9840
226 Ga0209257_1000010 3300025304 Bacteria 1158682
227 Ga0207655_1021874 3300025728 Bacteria 3227
228 Ga0207653_10000481 3300025885 Bacteria 15776
229 Ga0207653_10003134 3300025885 Bacteria 5231
230 Ga0207647_10003657 3300025904 Bacteria 11503
231 Ga0207645_10055294 3300025907 Bacteria 2534
232 Ga0207643_10003613 3300025908 Bacteria 8339
233 Ga0207705_10051373 3300025909 Bacteria 2967
234 Ga0207684_10000314 3300025910 Bacteria 68706
235 Ga0207684_10001424 3300025910 Bacteria 25878
236 Ga0207684_10014100 3300025910 Bacteria 6902
237 Ga0207654_10011450 3300025911 Bacteria 4526
238 Ga0207707_10000006 3300025912 Bacteria 374131
239 Ga0207707_10006367 3300025912 Bacteria 10304
240 Ga0207707_10024302 3300025912 Bacteria 5304
241 Ga0207695_10008579 3300025913 Bacteria 12771
242 Ga0207671_10004805 3300025914 Bacteria 12724
243 Ga0207663_10000003 3300025916 Bacteria 458807
244 Ga0207662_10046356 3300025918 Unclassified 2571
245 Ga0207657_10004692 3300025919 Bacteria 14422
246 Ga0207652_10001029 3300025921 Bacteria 25565
247 Ga0207681_10001077 3300025923 Bacteria 17703
248 Ga0207681_10010892 3300025923 Bacteria 5585
249 Ga0207681_10054985 3300025923 Unclassified 2709
250 Ga0207694_10000938 3300025924 Bacteria 25703
251 Ga0207650_10000047 3300025925 Bacteria 175675
252 Ga0207650_10000542 3300025925 Bacteria 30843
253 Ga0207659_10009883 3300025926 Bacteria 5971
254 Ga0207644_10014449 3300025931 Bacteria 5281
255 Ga0207706_10042700 3300025933 Bacteria 4019
256 Ga0207686_10005640 3300025934 Bacteria 6708
257 Ga0207709_10006794 3300025935 Bacteria 6400
258 Ga0207709_10008485 3300025935 Bacteria 5685
259 Ga0207670_10007735 3300025936 Bacteria 6026
260 Ga0207691_10004303 3300025940 Bacteria 13825
261 Ga0207691_10044274 3300025940 Bacteria 4097
262 Ga0207711_10036305 3300025941 Bacteria 4182
263 Ga0207711_10042429 3300025941 Bacteria 3876
264 Ga0207711_10055952 3300025941 Unclassified 3388
265 Ga0207689_10012384 3300025942 Bacteria 7296
266 Ga0207689_10020503 3300025942 Bacteria 5563
267 Ga0207689_10147406 3300025942 Bacteria 1939
268 Ga0207651_10067531 3300025960 Bacteria 2517
269 Ga0207712_10003390 3300025961 Bacteria 10076
270 Ga0207703_10043102 3300026035 Bacteria 3620
271 Ga0207703_10062490 3300026035 Bacteria 3050
272 Ga0207703_10081974 3300026035 Bacteria 2691
273 Ga0207639_10033421 3300026041 Bacteria 3795
274 Ga0207708_10000246 3300026075 Bacteria 42577
275 Ga0207708_10036784 3300026075 Bacteria 3728
276 Ga0207708_10059437 3300026075 Bacteria 2918
277 Ga0207702_10015334 3300026078 Bacteria 6351
278 Ga0207641_10060297 3300026088 Unclassified 3234
279 Ga0207648_10009860 3300026089 Bacteria 9108
280 Ga0207648_10081979 3300026089 Bacteria 2813
281 Ga0207676_10030712 3300026095 Unclassified 4035
282 Ga0207676_10091378 3300026095 Bacteria 2500
283 Ga0207676_10141139 3300026095 Bacteria 2062
284 Ga0207676_10183941 3300026095 Bacteria 1832
285 Ga0207674_10001412 3300026116 Bacteria 31013
286 Ga0207674_10012633 3300026116 Bacteria 9439
287 Ga0207674_10118129 3300026116 Bacteria 2622
288 Ga0207675_100004692 3300026118 Bacteria 13158
289 Ga0207675_100006123 3300026118 Bacteria 11435
290 Ga0207675_100007738 3300026118 Bacteria 10138
291 Ga0207683_10092724 3300026121 Bacteria 2691
292 Ga0207698_10154543 3300026142 Bacteria 1996
293 Ga0209282_1000002 3300027666 Bacteria 1067825
294 Ga0207428_10105532 3300027907 Bacteria 2173
295 Ga0268265_10133339 3300028380 Bacteria 2068
296 Ga0268264_10079077 3300028381 Bacteria 2805
297 Ga0307515_10099407 3300028794 Bacteria 3533
298 Ga0307408_100000498 3300031548 Bacteria 34159
299 Ga0307408_100000774 3300031548 Bacteria 25726
300 Ga0307518_10026887 3300031838 Bacteria 4149
301 Ga0307410_10002233 3300031852 Bacteria 9247
302 Ga0307410_10063431 3300031852 Unclassified 2535
303 Ga0307409_100203894 3300031995 Bacteria 1772
304 Ga0307416_100003518 3300032002 Bacteria 9221
305 Ga0307411_10062329 3300032005 Bacteria 2487
306 Ga0373951_0002546 3300035091 Unclassified 4583
307 Ga0395899_0000330 3300037312 Bacteria 60063
308 Ga0395899_0000715 3300037312 Bacteria 33273
309 Ga0395900_0000372 3300037418 Bacteria 64606
310 Ga0395900_0049778 3300037418 Bacteria 4317
311 Ga0395900_0086306 3300037418 Bacteria 3225
312 Ga0395905_0009240 3300037471 Bacteria 9651
313 Ga0395905_0018620 3300037471 Bacteria 6586
314 Ga0395905_0031408 3300037471 Bacteria 5000
315 Ga0395905_0049000 3300037471 Bacteria 3958
316 Ga0395905_0102623 3300037471 Bacteria 2685
317 Ga0395901_0001123 3300038443 Bacteria 28428
318 Ga0395901_0004045 3300038443 Bacteria 14768
319 Ga0395901_0094591 3300038443 Bacteria 3131
320 Ga0436365_1170609 3300039437 Bacteria 2918
321 Ga0436361_0111397 3300039447 Bacteria 9308
322 Ga0436361_0667736 3300039447 Bacteria 15392
323 Ga0436361_0872359 3300039447 Bacteria 6580
324 Ga0436361_0977466 3300039447 Bacteria 31080
325 Ga0439448_0001145 3300042005 Bacteria 6710
326 Ga0439450_002379 3300042008 Bacteria 2949
327 Ga0450904_000130 3300042139 Bacteria 16713
328 Ga0439458_0001237 3300042157 Bacteria 6453
329 Ga0466972_0001600 3300044658 Bacteria 11067
330 Ga0453683_0011548 3300044673 Bacteria 5818
331 Ga0466966_0001121 3300044684 Bacteria 17200
332 Ga0466957_0000545 3300044842 Bacteria 19030
333 Ga0466959_0027945 3300045049 Bacteria 4183
334 Ga0466967_0004194 3300045976 Bacteria 9658
335 Ga0466967_0045615 3300045976 Bacteria 3809
336 Ga0495617_000002 3300046452 Bacteria 710121
337 Ga0495617_000147 3300046452 Bacteria 45169
338 Ga0495617_000539 3300046452 Bacteria 19621
339 Ga0495617_012984 3300046452 Bacteria 2839
340 Ga0495627_000006 3300046453 Bacteria 581750
341 Ga0495627_000207 3300046453 Bacteria 63763
342 Ga0495590_0000004 3300046457 Bacteria 402091
343 Ga0495590_0000025 3300046457 Bacteria 165221
344 Ga0495590_0002187 3300046457 Bacteria 8178
345 Ga0495591_000246 3300046458 Bacteria 52198
346 Ga0495629_0024427 3300046459 Bacteria 4304
347 Ga0495638_0000066 3300046460 Bacteria 168673
348 Ga0495638_0001537 3300046460 Bacteria 20765
349 Ga0495638_0003279 3300046460 Bacteria 12760
350 Ga0495638_0025016 3300046460 Bacteria 3885
351 Ga0495653_0000037 3300046463 Bacteria 120575
352 Ga0495653_0007115 3300046463 Bacteria 9172
353 Ga0495653_0010485 3300046463 Bacteria 7582
354 Ga0495650_0000695 3300046471 Bacteria 43367
355 Ga0495650_0000871 3300046471 Bacteria 35889
356 Ga0495650_0000930 3300046471 Bacteria 34077
357 Ga0495650_0001046 3300046471 Bacteria 30824
358 Ga0495650_0001111 3300046471 Bacteria 29425
359 Ga0495582_0036807 3300046473 Bacteria 2692
360 Ga0495582_0038166 3300046473 Bacteria 2642
361 Ga0495605_0000003 3300046474 Bacteria 491502
362 Ga0495605_0000034 3300046474 Bacteria 208277
363 Ga0495605_0000293 3300046474 Bacteria 55067
364 Ga0495605_0003564 3300046474 Bacteria 9226
365 Ga0495605_0020413 3300046474 Bacteria 3521
366 Ga0495605_0022360 3300046474 Bacteria 3340
367 Ga0495605_0025115 3300046474 Bacteria 3106
368 Ga0495605_0028603 3300046474 Bacteria 2876
369 Ga0495605_0034862 3300046474 Bacteria 2545
370 Ga0495605_0036014 3300046474 Bacteria 2498
371 Ga0495639_0014226 3300046475 Bacteria 3443
372 Ga0495584_0000017 3300046491 Bacteria 149686
373 Ga0495584_0000070 3300046491 Bacteria 73237
374 Ga0495584_0000345 3300046491 Bacteria 32162
375 Ga0495584_0000401 3300046491 Bacteria 29931
376 Ga0495584_0001098 3300046491 Bacteria 16805
377 Ga0495584_0002836 3300046491 Bacteria 9675
378 Ga0495584_0002986 3300046491 Bacteria 9388
379 Ga0495584_0005999 3300046491 Bacteria 6400
380 Ga0495584_0009791 3300046491 Bacteria 4930
381 Ga0495584_0017380 3300046491 Bacteria 3662
382 Ga0495585_0000006 3300046492 Bacteria 320556
383 Ga0495585_0000064 3300046492 Bacteria 109302
384 Ga0495585_0000254 3300046492 Bacteria 54984
385 Ga0495585_0000941 3300046492 Bacteria 24552
386 Ga0495585_0001061 3300046492 Bacteria 22624
387 Ga0495585_0002026 3300046492 Bacteria 15005
388 Ga0495585_0003330 3300046492 Bacteria 10902
389 Ga0495585_0009300 3300046492 Bacteria 5902
390 Ga0495585_0026537 3300046492 Bacteria 3309
391 Ga0495585_0058990 3300046492 Bacteria 2116
392 Ga0495594_0029580 3300046499 Bacteria 2961
393 Ga0495596_0000224 3300046500 Bacteria 38703
394 Ga0495596_0000838 3300046500 Bacteria 18592
395 Ga0495596_0001873 3300046500 Bacteria 11670
396 Ga0495596_0002814 3300046500 Bacteria 9109
397 Ga0495596_0003137 3300046500 Bacteria 8520
398 Ga0495596_0006614 3300046500 Bacteria 5317
399 Ga0495596_0010139 3300046500 Bacteria 4117
400 Ga0495607_0000398 3300046501 Bacteria 44114
401 Ga0495607_0002518 3300046501 Bacteria 14850
402 Ga0495607_0004773 3300046501 Bacteria 9907
403 Ga0495607_0005452 3300046501 Bacteria 9102
404 Ga0495607_0005454 3300046501 Bacteria 9100
405 Ga0495607_0016521 3300046501 Bacteria 4761
406 Ga0495583_0000195 3300046506 Bacteria 101598
407 Ga0495583_0000372 3300046506 Bacteria 69750
408 Ga0495583_0000382 3300046506 Bacteria 68388
409 Ga0495583_0000600 3300046506 Bacteria 48984
410 Ga0495583_0000808 3300046506 Bacteria 38650
411 Ga0495583_0003755 3300046506 Bacteria 11296
412 Ga0495583_0005962 3300046506 Bacteria 8086
413 Ga0495583_0007066 3300046506 Bacteria 7175
414 Ga0495583_0040612 3300046506 Bacteria 2184
415 Ga0495583_0043941 3300046506 Bacteria 2077
416 Ga0495606_0000024 3300046507 Bacteria 262080
417 Ga0495606_0000268 3300046507 Bacteria 91857
418 Ga0495606_0001211 3300046507 Bacteria 36201
419 Ga0495606_0001586 3300046507 Bacteria 29713
420 Ga0495606_0004274 3300046507 Bacteria 14413
421 Ga0495606_0004483 3300046507 Bacteria 13920
422 Ga0495606_0011433 3300046507 Bacteria 7239
423 Ga0495606_0025925 3300046507 Bacteria 4187
424 Ga0495606_0027466 3300046507 Bacteria 4035
425 Ga0495606_0036142 3300046507 Bacteria 3368
426 Ga0495606_0037147 3300046507 Bacteria 3309
427 Ga0495610_0000004 3300046512 Bacteria 1006135
428 Ga0495610_0000229 3300046512 Bacteria 59730
429 Ga0495610_0001082 3300046512 Bacteria 24922
430 Ga0495610_0010579 3300046512 Bacteria 5720
431 Ga0495616_0000057 3300046513 Bacteria 100806
432 Ga0495616_0000207 3300046513 Bacteria 48768
433 Ga0495616_0000378 3300046513 Bacteria 34726
434 Ga0495616_0000996 3300046513 Bacteria 20276
435 Ga0495616_0003899 3300046513 Bacteria 9504
436 Ga0495616_0007442 3300046513 Bacteria 6554
437 Ga0495616_0009424 3300046513 Bacteria 5711
438 Ga0495631_0001464 3300046518 Bacteria 14314
439 Ga0495631_0003789 3300046518 Bacteria 8228
440 Ga0495631_0009360 3300046518 Bacteria 4895
441 Ga0495631_0012909 3300046518 Bacteria 4067
442 Ga0495631_0047878 3300046518 Bacteria 1875
443 Ga0495632_0000077 3300046519 Bacteria 100834
444 Ga0495632_0000129 3300046519 Bacteria 77134
445 Ga0495632_0000296 3300046519 Bacteria 48157
446 Ga0495632_0000375 3300046519 Bacteria 42575
447 Ga0495632_0004693 3300046519 Bacteria 9233
448 Ga0495637_0000019 3300046520 Bacteria 185953
449 Ga0495637_0000914 3300046520 Bacteria 18934
450 Ga0495637_0000991 3300046520 Bacteria 17941
451 Ga0495637_0003088 3300046520 Bacteria 8884
452 Ga0495637_0006965 3300046520 Bacteria 5634
453 Ga0495643_0000415 3300046522 Bacteria 55824
454 Ga0495643_0000453 3300046522 Bacteria 52189
455 Ga0495643_0000567 3300046522 Bacteria 45722
456 Ga0495643_0000626 3300046522 Bacteria 42009
457 Ga0495643_0000661 3300046522 Bacteria 40615
458 Ga0495644_0020657 3300046523 Bacteria 2512
459 Ga0495648_0000007 3300046524 Bacteria 347305
460 Ga0495648_0000045 3300046524 Bacteria 172587
461 Ga0495648_0001105 3300046524 Bacteria 27423
462 Ga0495648_0004308 3300046524 Bacteria 12194
463 Ga0495648_0004611 3300046524 Bacteria 11729
464 Ga0495648_0009124 3300046524 Bacteria 7735
465 Ga0495648_0018963 3300046524 Bacteria 4853
466 Ga0495648_0032006 3300046524 Bacteria 3457
467 Ga0495648_0045976 3300046524 Bacteria 2710
468 Ga0495648_0076214 3300046524 Bacteria 1926
469 Ga0495648_0080197 3300046524 Bacteria 1860
470 Ga0495663_0013019 3300046525 Bacteria 2323
471 Ga0495642_0000085 3300046528 Bacteria 54372
472 Ga0495642_0000285 3300046528 Bacteria 28471
473 Ga0495642_0000485 3300046528 Bacteria 20381
474 Ga0495642_0005862 3300046528 Bacteria 4713
475 Ga0495642_0006531 3300046528 Bacteria 4473
476 Ga0495642_0009424 3300046528 Bacteria 3738
477 Ga0495654_0000004 3300046530 Bacteria 515304
478 Ga0495654_0009140 3300046530 Bacteria 5435
479 Ga0495654_0038101 3300046530 Bacteria 2406
480 Ga0495665_0004421 3300046531 Bacteria 7590
481 Ga0495665_0026182 3300046531 Bacteria 3133
482 Ga0495665_0047463 3300046531 Bacteria 2278
483 Ga0495586_0012766 3300046535 Bacteria 4452
484 Ga0495586_0026284 3300046535 Bacteria 3114
485 Ga0495609_0000002 3300046538 Bacteria 739816
486 Ga0495609_0000910 3300046538 Bacteria 21411
487 Ga0495609_0001921 3300046538 Bacteria 13230
488 Ga0495609_0001963 3300046538 Bacteria 13048
489 Ga0495609_0005513 3300046538 Bacteria 6618
490 Ga0495609_0010671 3300046538 Bacteria 4397
491 Ga0495609_0017017 3300046538 Bacteria 3382
492 Ga0495597_0000226 3300046542 Bacteria 51108
493 Ga0495597_0000409 3300046542 Bacteria 37065
494 Ga0495597_0000812 3300046542 Bacteria 24678
495 Ga0495597_0000957 3300046542 Bacteria 22305
496 Ga0495597_0000958 3300046542 Bacteria 22301
497 Ga0495597_0001519 3300046542 Bacteria 16517
498 Ga0495597_0005958 3300046542 Bacteria 6360
499 Ga0495597_0009351 3300046542 Bacteria 4847
500 Ga0495597_0010112 3300046542 Bacteria 4624
501 Ga0495597_0017371 3300046542 Bacteria 3387
502 Ga0495597_0050618 3300046542 Bacteria 1833
503 Ga0495622_0000064 3300046557 Bacteria 93789
504 Ga0495633_0000401 3300046558 Bacteria 45374
505 Ga0495633_0000527 3300046558 Bacteria 38323
506 Ga0495633_0000815 3300046558 Bacteria 27611
507 Ga0495633_0001332 3300046558 Bacteria 19368
508 Ga0495633_0002100 3300046558 Bacteria 14322
509 Ga0495633_0002968 3300046558 Bacteria 11604
510 Ga0495633_0012539 3300046558 Bacteria 4502
511 Ga0495633_0016211 3300046558 Bacteria 3849
512 Ga0495633_0016762 3300046558 Bacteria 3767
513 Ga0495668_0000025 3300046616 Bacteria 304546
514 Ga0495668_0000126 3300046616 Bacteria 114185
515 Ga0495668_0000274 3300046616 Bacteria 72330
516 Ga0495668_0000544 3300046616 Bacteria 46835
517 Ga0495668_0000941 3300046616 Bacteria 32463
518 Ga0495668_0001238 3300046616 Bacteria 25633
519 Ga0495668_0001842 3300046616 Bacteria 19110
520 Ga0495668_0002219 3300046616 Bacteria 16499
521 Ga0495668_0020953 3300046616 Bacteria 3755
522 Ga0495634_0027471 3300046642 Bacteria 3958
523 Ga0495611_0000195 3300046648 Bacteria 42925
524 Ga0495611_0000773 3300046648 Bacteria 17861
525 Ga0495611_0001877 3300046648 Bacteria 10006
526 Ga0495611_0002974 3300046648 Bacteria 7559
527 Ga0495611_0007350 3300046648 Bacteria 4676
528 Ga0495611_0020067 3300046648 Bacteria 2874
529 Ga0495625_0000850 3300046660 Bacteria 41673
530 Ga0495625_0002274 3300046660 Bacteria 21098
531 Ga0495625_0006331 3300046660 Bacteria 10577
532 Ga0495625_0013621 3300046660 Bacteria 6525
533 Ga0495625_0018164 3300046660 Bacteria 5497
534 Ga0495625_0022531 3300046660 Bacteria 4829
535 Ga0495625_0044881 3300046660 Bacteria 3198
536 Ga0495625_0078564 3300046660 Bacteria 2303
537 Ga0495635_0002840 3300046663 Bacteria 11897
538 Ga0495659_0000124 3300046664 Bacteria 33876
539 Ga0495659_0012157 3300046664 Bacteria 2783
540 Ga0495661_0000281 3300046665 Bacteria 57922
541 Ga0495661_0000980 3300046665 Bacteria 25764
542 Ga0495661_0001170 3300046665 Bacteria 22890
543 Ga0495661_0002244 3300046665 Bacteria 14973
544 Ga0495661_0002737 3300046665 Bacteria 13416
545 Ga0495661_0011882 3300046665 Bacteria 5897
546 Ga0495661_0033230 3300046665 Bacteria 3255
547 Ga0495661_0037848 3300046665 Bacteria 3009
548 Ga0495588_0000177 3300046674 Bacteria 78598
549 Ga0495588_0019032 3300046674 Bacteria 3358
550 Ga0495588_0035646 3300046674 Bacteria 2522
551 Ga0495669_0000092 3300046684 Bacteria 59765
552 Ga0495669_0000502 3300046684 Bacteria 17877
553 Ga0495669_0001901 3300046684 Bacteria 8561
554 Ga0495669_0002014 3300046684 Bacteria 8331
555 Ga0495669_0004319 3300046684 Bacteria 5865
556 Ga0495670_0000157 3300046691 Bacteria 29533
557 Ga0495670_0000312 3300046691 Bacteria 23108
558 Ga0495670_0001319 3300046691 Bacteria 12093
559 Ga0495670_0001945 3300046691 Bacteria 10176
560 Ga0495670_0018547 3300046691 Bacteria 3425
561 Ga0495670_0037095 3300046691 Bacteria 2429
562 Ga0495670_0061925 3300046691 Bacteria 1881
563 Ga0495671_0000001 3300046692 Bacteria 1169494
564 Ga0495671_0000575 3300046692 Bacteria 27425
565 Ga0495671_0000965 3300046692 Bacteria 20129
566 Ga0495671_0003679 3300046692 Bacteria 9336
567 Ga0495671_0025379 3300046692 Bacteria 3081
568 Ga0495671_0044534 3300046692 Bacteria 2224
569 Ga0495671_0055826 3300046692 Bacteria 1956
570 Ga0495649_0000277 3300046694 Bacteria 45216
571 Ga0495649_0007938 3300046694 Bacteria 6419
572 Ga0495649_0015329 3300046694 Bacteria 4364
573 Ga0495649_0049528 3300046694 Bacteria 2282
574 Ga0495589_0000230 3300046794 Bacteria 47199
575 Ga0495589_0000535 3300046794 Bacteria 26576
576 Ga0495589_0001364 3300046794 Bacteria 14251
577 Ga0495589_0022217 3300046794 Bacteria 3239
578 Ga0495589_0035253 3300046794 Bacteria 2509
579 Ga0495589_0035755 3300046794 Bacteria 2490
580 Ga0495589_0044531 3300046794 Bacteria 2207
581 Ga0495660_0000026 3300046810 Bacteria 256223
582 Ga0495660_0002729 3300046810 Bacteria 11142
583 Ga0495660_0002963 3300046810 Bacteria 10613
584 Ga0495660_0004933 3300046810 Bacteria 8039
585 Ga0495660_0011889 3300046810 Bacteria 5050
586 Ga0495660_0016405 3300046810 Bacteria 4271
587 Ga0495581_0007297 3300047315 Bacteria 6396
588 Ga0495604_0029462 3300047317 Bacteria 4367
589 Ga0495604_0058512 3300047317 Bacteria 2959
590 Ga0495636_0005231 3300047318 Bacteria 5092
591 Ga0495636_0005273 3300047318 Bacteria 5074
592 Ga0495636_0012438 3300047318 Bacteria 3369
593 Ga0495672_0000041 3300047320 Bacteria 267545
594 Ga0495672_0000045 3300047320 Bacteria 255145
595 Ga0495672_0000505 3300047320 Bacteria 45047
596 Ga0495672_0000748 3300047320 Bacteria 35552
597 Ga0495672_0001178 3300047320 Bacteria 26523
598 Ga0495672_0003428 3300047320 Bacteria 13591
599 Ga0495672_0013058 3300047320 Bacteria 5748
600 Ga0495672_0017777 3300047320 Bacteria 4745
601 Ga0495676_0000309 3300047321 Bacteria 39532
602 Ga0495676_0002463 3300047321 Bacteria 16453
603 Ga0495676_0042180 3300047321 Bacteria 3748
604 Ga0495680_0054663 3300047322 Bacteria 3099
605 Ga0495683_0000179 3300047323 Bacteria 62241
606 Ga0495683_0000763 3300047323 Bacteria 23208
607 Ga0495683_0006600 3300047323 Bacteria 6327
608 Ga0495683_0009925 3300047323 Bacteria 5056
609 Ga0495687_000013 3300047443 Bacteria 371058
610 Ga0495687_000127 3300047443 Bacteria 117520
611 Ga0495687_000143 3300047443 Bacteria 108306
612 Ga0495687_000280 3300047443 Bacteria 67023
613 Ga0495687_001126 3300047443 Bacteria 25966
614 Ga0495687_001213 3300047443 Bacteria 24676
615 Ga0495687_001550 3300047443 Bacteria 20895
616 Ga0495675_0038544 3300047444 Bacteria 3043
617 Ga0495677_0000041 3300047445 Bacteria 75366
618 Ga0495677_0000104 3300047445 Bacteria 41829
619 Ga0495677_0000210 3300047445 Bacteria 26828
620 Ga0495677_0001887 3300047445 Bacteria 8373
621 Ga0495677_0005929 3300047445 Bacteria 4628
622 Ga0495679_001712 3300047446 Bacteria 12130
623 Ga0495679_002516 3300047446 Bacteria 9255
624 Ga0495685_001298 3300047447 Bacteria 7619
625 Ga0495685_030530 3300047447 Bacteria 1853
626 Ga0495673_0000006 3300047469 Bacteria 908691
627 Ga0495673_0000014 3300047469 Bacteria 599202
628 Ga0495673_0000017 3300047469 Bacteria 574970
629 Ga0495673_0017040 3300047469 Bacteria 3699
630 Ga0495681_0000667 3300047470 Bacteria 26095
631 Ga0495681_0000815 3300047470 Bacteria 23974
632 Ga0495681_0010372 3300047470 Bacteria 5640
633 Ga0495681_0017512 3300047470 Bacteria 3974
634 Ga0495681_0022331 3300047470 Bacteria 3389
635 Ga0495686_0000656 3300047472 Bacteria 47216
636 Ga0495686_0000732 3300047472 Bacteria 43872
637 Ga0495686_0022414 3300047472 Bacteria 4180
638 Ga0495593_0023123 3300047673 Bacteria 3457
639 Ga0495602_0005903 3300048088 Bacteria 12859
640 Ga0495614_0005144 3300048089 Bacteria 5903
641 Ga0495626_0000383 3300048091 Bacteria 45903
642 Ga0495626_0001009 3300048091 Bacteria 24183
643 Ga0495626_0001865 3300048091 Bacteria 15814
644 Ga0495626_0002453 3300048091 Bacteria 12850
645 Ga0495626_0006233 3300048091 Bacteria 6812
646 Ga0495626_0008221 3300048091 Bacteria 5745
647 Ga0495626_0009080 3300048091 Bacteria 5393
648 Ga0495626_0013526 3300048091 Bacteria 4238
649 Ga0495626_0042634 3300048091 Bacteria 2131
650 Ga0495626_0043083 3300048091 Bacteria 2118
651 Ga0495626_0049584 3300048091 Bacteria 1943
652 Ga0495626_0052809 3300048091 Bacteria 1872
653 Ga0496100_0082565 3300048903 Bacteria 2173
654 Ga0496102_0000454 3300048905 Bacteria 46487
655 Ga0496102_0000931 3300048905 Bacteria 27579
656 Ga0496102_0022302 3300048905 Bacteria 5610
657 Ga0496103_0007341 3300048906 Bacteria 6569
658 Ga0496103_0026176 3300048906 Bacteria 3531
659 Ga0496104_0075039 3300048907 Bacteria 3220
660 Ga0496105_0168157 3300048908 Bacteria 1798
661 Ga0496106_0011144 3300048909 Bacteria 6651
662 Ga0496110_0000068 3300048913 Bacteria 51803
663 Ga0496110_0051568 3300048913 Bacteria 3615
664 Ga0496111_0025612 3300048914 Bacteria 4163
665 Ga0496112_0099876 3300048915 Bacteria 2872
666 Ga0496112_0229064 3300048915 Bacteria 1813
667 Ga0496113_0029183 3300048916 Bacteria 3979
668 Ga0496115_0015932 3300048918 Bacteria 5713
669 Ga0496116_0040323 3300048919 Bacteria 3216
670 Ga0496117_0000001 3300048920 Bacteria 2526244
671 Ga0496118_0000008 3300048921 Bacteria 644537
672 Ga0496121_0004172 3300048924 Bacteria 19754
673 Ga0496121_0005269 3300048924 Bacteria 16693
674 Ga0496121_0025979 3300048924 Bacteria 5538
675 Ga0496122_0000445 3300048925 Bacteria 86566
676 Ga0496122_0001558 3300048925 Bacteria 36307
677 Ga0496122_0002321 3300048925 Bacteria 27457
678 Ga0496122_0059997 3300048925 Bacteria 2805
679 Ga0496123_0001531 3300048926 Bacteria 31933
680 Ga0496123_0007447 3300048926 Bacteria 10303
681 Ga0496123_0031575 3300048926 Bacteria 3851
682 Ga0496124_0008544 3300048927 Bacteria 10691
683 Ga0496124_0024873 3300048927 Bacteria 5435
684 Ga0496124_0027329 3300048927 Bacteria 5123
685 Ga0496125_0002437 3300048928 Bacteria 24169
686 Ga0495678_000042 3300049459 Bacteria 174125
687 Ga0495678_000233 3300049459 Bacteria 63499
688 Ga0495678_000316 3300049459 Bacteria 51625
689 Ga0495678_001513 3300049459 Bacteria 18039
690 Ga0495678_001703 3300049459 Bacteria 16504
691 Ga0495678_001985 3300049459 Bacteria 14727
692 Ga0495678_014117 3300049459 Bacteria 3723
693 Ga0495682_0000107 3300049460 Bacteria 73486
694 Ga0495682_0001172 3300049460 Bacteria 14944
695 Ga0495682_0002913 3300049460 Bacteria 7852
696 Ga0495682_0008541 3300049460 Bacteria 4031
697 Ga0501038_0034715 3300049574 Bacteria 4433
698 Ga0501069_0019786 3300049585 Bacteria 3641
699 Ga0501070_0000019 3300049586 Bacteria 171935
700 Ga0501070_0080110 3300049586 Bacteria 2702
701 Ga0501073_0024768 3300049589 Bacteria 4308
702 Ga0501073_0036578 3300049589 Bacteria 3488
703 Ga0501198_001067 3300049649 Bacteria 3499
704 Ga0501217_007428 3300049661 Bacteria 2350
705 Ga0501223_000399 3300049663 Bacteria 10644
706 Ga0501227_000931 3300049665 Bacteria 6413
707 Ga0501238_000859 3300049671 Bacteria 3460
708 Ga0501249_001226 3300049679 Bacteria 5381
709 Ga0501257_002375 3300049686 Bacteria 3964
710 Ga0501221_003830 3300049704 Unclassified 2482
711 Ga0501225_0002188 3300049705 Bacteria 6042
712 Ga0501225_0011682 3300049705 Bacteria 2470
713 Ga0501080_0020549 3300049742 Bacteria 6115
714 Ga0501083_0016339 3300049744 Bacteria 5196
715 Ga0501269_000155 3300049766 Bacteria 21098
716 Ga0501035_0003621 3300049822 Bacteria 14734
717 Ga0501212_001911 3300049851 Bacteria 2432
718 nmdc:mga05p37_19426_c1 3300050507 Bacteria 8220
719 nmdc:mga05p37_2364_c1 3300050507 Bacteria 21951
720 nmdc:mga05p37_38576_c1 3300050507 Bacteria 5860
721 nmdc:mga05p37_60640_c1 3300050507 Bacteria 4657
722 nmdc:mga09592_150152_c1 3300050508 Bacteria 2010
723 nmdc:mga06r32_161666_c1 3300050510 Bacteria 2222
724 nmdc:mga06r32_232889_c1 3300050510 Bacteria 1830
725 nmdc:mga08y16_140020_c1 3300050511 Bacteria 2515
726 nmdc:mga08y16_140929_c1 3300050511 Bacteria 2507
727 nmdc:mga08x19_10_c1 3300050514 Bacteria 404490
728 nmdc:mga08x19_1288_c1 3300050514 Bacteria 15581
729 nmdc:mga08x19_170371_c1 3300050514 Bacteria 1483
730 nmdc:mga0a205_139277_c1 3300050515 Bacteria 2327
731 nmdc:mga0a205_200926_c1 3300050515 Bacteria 1884
732 nmdc:mga0a205_33639_c1 3300050515 Bacteria 4915
733 Ga0500594_0010803 3300053118 Bacteria 2124
734 Ga0500618_000630 3300053125 Bacteria 21289
735 Ga0500586_004143 3300053145 Bacteria 3508
736 Ga0501084_0109808 3300054114 Unclassified 2317
737 Ga0501082_0071990 3300060353 Bacteria 2977

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050514 nmdc:mga08x19_170371_c1 nmdc:mga08x19_170371_c1_23_1468 479
2 3300046524 Ga0495648_0009124 Ga0495648_0009124_5933_7687 512
3 3300046531 Ga0495665_0047463 Ga0495665_0047463_335_1888 516
4 3300049460 Ga0495682_0008541 Ga0495682_0008541_1645_3459 518
5 3300048915 Ga0496112_0229064 Ga0496112_0229064_49_1773 519
6 3300005617 Ga0068859_100154893 Ga0068859_1001548931 520
7 3300006931 Ga0097620_100154888 Ga0097620_1001548881 520
8 3300046518 Ga0495631_0047878 Ga0495631_0047878_246_1859 520
9 3300047472 Ga0495686_0022414 Ga0495686_0022414_2552_4165 520
10 3300048091 Ga0495626_0009080 Ga0495626_0009080_3768_5378 520
11 3300005354 Ga0070675_100016465 Ga0070675_1000164652 521
12 3300025926 Ga0207659_10009883 Ga0207659_100098832 521
13 3300025940 Ga0207691_10044274 Ga0207691_100442743 521
14 3300009176 Ga0105242_10028444 Ga0105242_100284443 523
15 3300038443 Ga0395901_0094591 Ga0395901_0094591_924_2765 524
16 3300046660 Ga0495625_0013621 Ga0495625_0013621_1982_3682 524
17 3300009036 Ga0105244_10001968 Ga0105244_100019688 525
18 3300046457 Ga0495590_0002187 Ga0495590_0002187_2808_4580 525
19 3300046507 Ga0495606_0036142 Ga0495606_0036142_383_2155 525
20 3300046473 Ga0495582_0036807 Ga0495582_0036807_272_1978 526
21 3300046518 Ga0495631_0012909 Ga0495631_0012909_1398_3104 527
22 3300046531 Ga0495665_0026182 Ga0495665_0026182_1039_2754 527
23 3300046616 Ga0495668_0020953 Ga0495668_0020953_873_2579 527
24 3300046692 Ga0495671_0044534 Ga0495671_0044534_322_2028 527
25 3300047445 Ga0495677_0000104 Ga0495677_0000104_2113_3855 527
26 3300049585 Ga0501069_0019786 Ga0501069_0019786_314_1972 528
27 3300049586 Ga0501070_0000019 Ga0501070_0000019_49708_51366 528
28 3300049589 Ga0501073_0036578 Ga0501073_0036578_1355_3013 528
29 3300049744 Ga0501083_0016339 Ga0501083_0016339_2685_4343 528
30 3300050511 nmdc:mga08y16_140929_c1 nmdc:mga08y16_140929_c1_875_2485 528
31 3300060353 Ga0501082_0071990 Ga0501082_0071990_1218_2876 528
32 3300014325 Ga0163163_10007804 Ga0163163_100078044 529
33 3300025885 Ga0207653_10000481 Ga0207653_1000048110 529
34 3300046524 Ga0495648_0076214 Ga0495648_0076214_156_1874 529
35 3300046557 Ga0495622_0000064 Ga0495622_0000064_24624_26330 529
36 3300037471 Ga0395905_0102623 Ga0395905_0102623_874_2619 530
37 3300048924 Ga0496121_0005269 Ga0496121_0005269_4768_6501 530
38 3300005563 Ga0068855_100003154 Ga0068855_1000031547 531
39 3300046558 Ga0495633_0000815 Ga0495633_0000815_19729_21450 531
40 3300049586 Ga0501070_0080110 Ga0501070_0080110_119_1792 531
41 3300049589 Ga0501073_0024768 Ga0501073_0024768_869_2542 531
42 3300049679 Ga0501249_001226 Ga0501249_001226_3361_5061 531
43 3300049742 Ga0501080_0020549 Ga0501080_0020549_2788_4461 531
44 3300049766 Ga0501269_000155 Ga0501269_000155_8802_10502 531
45 3300005564 Ga0070664_100152457 Ga0070664_1001524572 532
46 3300006237 Ga0097621_100057637 Ga0097621_1000576374 532
47 3300006237 Ga0097621_100180895 Ga0097621_1001808952 532
48 3300006846 Ga0075430_100084797 Ga0075430_1000847971 532
49 3300009147 Ga0114129_10023985 Ga0114129_100239855 532
50 3300046459 Ga0495629_0024427 Ga0495629_0024427_1077_2783 532
51 3300046535 Ga0495586_0012766 Ga0495586_0012766_1350_3056 532
52 3300046542 Ga0495597_0000957 Ga0495597_0000957_15185_16891 532
53 3300047443 Ga0495687_001550 Ga0495687_001550_9175_10932 532
54 3300050510 nmdc:mga06r32_161666_c1 nmdc:mga06r32_161666_c1_220_1932 532
55 3300003771 Ga0055526_1007917 Ga0055526_10079175 533
56 3300003773 Ga0055537_1003987 Ga0055537_10039874 533
57 3300003775 Ga0055524_1000615 Ga0055524_100061518 533
58 3300025295 Ga0209564_1000751 Ga0209564_100075121 533
59 3300025295 Ga0209564_1007615 Ga0209564_10076152 533
60 3300025299 Ga0209256_1000586 Ga0209256_100058619 533
61 3300046519 Ga0495632_0000375 Ga0495632_0000375_30325_32082 533
62 3300046520 Ga0495637_0000914 Ga0495637_0000914_5259_6959 533
63 3300046524 Ga0495648_0045976 Ga0495648_0045976_189_1940 533
64 3300046530 Ga0495654_0000004 Ga0495654_0000004_134226_135926 533
65 3300046542 Ga0495597_0000958 Ga0495597_0000958_14510_16222 533
66 3300046665 Ga0495661_0002737 Ga0495661_0002737_4264_6021 533
67 3300047445 Ga0495677_0001887 Ga0495677_0001887_1723_3480 533
68 3300003354 JGI25160J50197_1005010 JGI25160J50197_10050103 534
69 3300003374 JGI25161J50226_1006659 JGI25161J50226_10066592 534
70 3300003771 Ga0055526_1001981 Ga0055526_10019816 534
71 3300003771 Ga0055526_1008551 Ga0055526_10085513 534
72 3300003773 Ga0055537_1000035 Ga0055537_100003566 534
73 3300003775 Ga0055524_1001052 Ga0055524_100105213 534
74 3300003775 Ga0055524_1002035 Ga0055524_10020355 534
75 3300003784 Ga0055534_1000843 Ga0055534_10008434 534
76 3300003784 Ga0055534_1002519 Ga0055534_10025192 534
77 3300003790 Ga0055528_1000058 Ga0055528_100005819 534
78 3300003791 Ga0055530_10001617 Ga0055530_100016175 534
79 3300003791 Ga0055530_10004677 Ga0055530_100046773 534
80 3300003791 Ga0055530_10005605 Ga0055530_100056052 534
81 3300003794 Ga0055531_10003927 Ga0055531_100039275 534
82 3300025208 Ga0209436_100292 Ga0209436_1002924 534
83 3300025245 Ga0207425_1000428 Ga0207425_100042812 534
84 3300025263 Ga0209565_1000009 Ga0209565_1000009616 534
85 3300025273 Ga0209673_1000036 Ga0209673_100003667 534
86 3300025284 Ga0209130_1000853 Ga0209130_10008536 534
87 3300025284 Ga0209130_1006522 Ga0209130_10065222 534
88 3300025291 Ga0209675_1000013 Ga0209675_100001367 534
89 3300025295 Ga0209564_1000122 Ga0209564_100012267 534
90 3300025298 Ga0209050_1000092 Ga0209050_1000092185 534
91 3300025298 Ga0209050_1001070 Ga0209050_100107019 534
92 3300025298 Ga0209050_1002850 Ga0209050_10028506 534
93 3300025299 Ga0209256_1000106 Ga0209256_1000106109 534
94 3300025302 Ga0207426_1002992 Ga0207426_10029926 534
95 3300025304 Ga0209257_1000010 Ga0209257_1000010982 534
96 3300031548 Ga0307408_100000498 Ga0307408_10000049812 534
97 3300046491 Ga0495584_0001098 Ga0495584_0001098_12519_14264 534
98 3300046492 Ga0495585_0000254 Ga0495585_0000254_18336_20081 534
99 3300046500 Ga0495596_0002814 Ga0495596_0002814_1939_3684 534
100 3300046500 Ga0495596_0003137 Ga0495596_0003137_6640_8385 534
101 3300046501 Ga0495607_0005452 Ga0495607_0005452_3266_5020 534
102 3300046506 Ga0495583_0003755 Ga0495583_0003755_14_1756 534
103 3300046513 Ga0495616_0000996 Ga0495616_0000996_69_1814 534
104 3300046530 Ga0495654_0038101 Ga0495654_0038101_304_2037 534
105 3300046542 Ga0495597_0050618 Ga0495597_0050618_76_1818 534
106 3300047323 Ga0495683_0000179 Ga0495683_0000179_34884_36629 534
107 3300006177 Ga0075362_10015886 Ga0075362_100158861 535
108 3300037312 Ga0395899_0000330 Ga0395899_0000330_47612_49327 535
109 3300046463 Ga0495653_0007115 Ga0495653_0007115_4111_5880 535
110 3300046519 Ga0495632_0000129 Ga0495632_0000129_32469_34214 535
111 3300046520 Ga0495637_0006965 Ga0495637_0006965_3915_5624 535
112 3300046522 Ga0495643_0000415 Ga0495643_0000415_8436_10154 535
113 3300046528 Ga0495642_0009424 Ga0495642_0009424_1013_2758 535
114 3300046692 Ga0495671_0003679 Ga0495671_0003679_868_2613 535
115 3300047444 Ga0495675_0038544 Ga0495675_0038544_1215_2984 535
116 3300048906 Ga0496103_0007341 Ga0496103_0007341_2657_4357 535
117 3300049459 Ga0495678_001703 Ga0495678_001703_10514_12259 535
118 3300049459 Ga0495678_001985 Ga0495678_001985_12782_14527 535
119 3300049460 Ga0495682_0000107 Ga0495682_0000107_39134_40879 535
120 3300050507 nmdc:mga05p37_2364_c1 nmdc:mga05p37_2364_c1_3885_5573 535
121 3300005518 Ga0070699_100000013 Ga0070699_10000001351 536
122 3300005843 Ga0068860_100044352 Ga0068860_1000443522 536
123 3300009147 Ga0114129_10048897 Ga0114129_100488973 536
124 3300013297 Ga0157378_10008171 Ga0157378_100081715 536
125 3300025272 Ga0209455_1000049 Ga0209455_1000049222 536
126 3300046492 Ga0495585_0000006 Ga0495585_0000006_253759_255504 536
127 3300046558 Ga0495633_0016211 Ga0495633_0016211_1341_3101 536
128 3300048907 Ga0496104_0075039 Ga0496104_0075039_82_1698 536
129 3300048913 Ga0496110_0000068 Ga0496110_0000068_23102_24838 536
130 3300050507 nmdc:mga05p37_38576_c1 nmdc:mga05p37_38576_c1_3814_5436 536
131 3300053125 Ga0500618_000630 Ga0500618_000630_14102_15850 536
132 3300015261 Ga0182006_1000014 Ga0182006_1000014243 537
133 3300046471 Ga0495650_0000930 Ga0495650_0000930_17397_19157 537
134 3300046492 Ga0495585_0002026 Ga0495585_0002026_5712_7457 537
135 3300046500 Ga0495596_0010139 Ga0495596_0010139_560_2317 537
136 3300046506 Ga0495583_0000808 Ga0495583_0000808_1488_3227 537
137 3300046507 Ga0495606_0000024 Ga0495606_0000024_87857_89617 537
138 3300046512 Ga0495610_0010579 Ga0495610_0010579_2619_4379 537
139 3300046558 Ga0495633_0016762 Ga0495633_0016762_504_2249 537
140 3300046616 Ga0495668_0000126 Ga0495668_0000126_38017_39777 537
141 3300046616 Ga0495668_0001842 Ga0495668_0001842_1602_3362 537
142 3300046691 Ga0495670_0001945 Ga0495670_0001945_8382_10127 537
143 3300046694 Ga0495649_0049528 Ga0495649_0049528_496_2196 537
144 3300005549 Ga0070704_100021829 Ga0070704_1000218292 538
145 3300006914 Ga0075436_100003828 Ga0075436_1000038283 538
146 3300031838 Ga0307518_10026887 Ga0307518_100268872 538
147 3300046471 Ga0495650_0001111 Ga0495650_0001111_7396_9123 538
148 3300046500 Ga0495596_0001873 Ga0495596_0001873_2397_4115 538
149 3300046507 Ga0495606_0027466 Ga0495606_0027466_1686_3425 538
150 3300046518 Ga0495631_0009360 Ga0495631_0009360_2383_4122 538
151 3300046648 Ga0495611_0020067 Ga0495611_0020067_426_2165 538
152 3300046660 Ga0495625_0000850 Ga0495625_0000850_22271_23998 538
153 3300046665 Ga0495661_0033230 Ga0495661_0033230_352_2085 538
154 3300046684 Ga0495669_0000092 Ga0495669_0000092_39643_41361 538
155 3300046810 Ga0495660_0011889 Ga0495660_0011889_767_2506 538
156 3300047321 Ga0495676_0042180 Ga0495676_0042180_1450_3195 538
157 3300048091 Ga0495626_0008221 Ga0495626_0008221_2862_4580 538
158 3300048913 Ga0496110_0051568 Ga0496110_0051568_1789_3522 538
159 3300048914 Ga0496111_0025612 Ga0496111_0025612_2338_4071 538
160 3300050514 nmdc:mga08x19_1288_c1 nmdc:mga08x19_1288_c1_2035_3708 538
161 3300053118 Ga0500594_0010803 Ga0500594_0010803_343_2043 538
162 3300006880 Ga0075429_100040587 Ga0075429_1000405872 539
163 3300037471 Ga0395905_0009240 Ga0395905_0009240_3313_5034 539
164 3300046452 Ga0495617_000539 Ga0495617_000539_11425_13170 539
165 3300046492 Ga0495585_0000064 Ga0495585_0000064_92395_94140 539
166 3300046513 Ga0495616_0003899 Ga0495616_0003899_1770_3515 539
167 3300046524 Ga0495648_0000007 Ga0495648_0000007_238237_239982 539
168 3300046538 Ga0495609_0001963 Ga0495609_0001963_6853_8595 539
169 3300046542 Ga0495597_0000226 Ga0495597_0000226_22173_23915 539
170 3300047320 Ga0495672_0013058 Ga0495672_0013058_3186_4925 539
171 3300048927 Ga0496124_0027329 Ga0496124_0027329_1342_3042 539
172 3300049574 Ga0501038_0034715 Ga0501038_0034715_1238_2863 539
173 3300050511 nmdc:mga08y16_140020_c1 nmdc:mga08y16_140020_c1_195_1814 539
174 iso_pu_bacteria 2643221554 2643788383 539
175 iso_pu_bacteria 2643221638 2644213693 539
176 3300009147 Ga0114129_10013656 Ga0114129_100136566 540
177 3300013297 Ga0157378_10185587 Ga0157378_101855871 540
178 3300014326 Ga0157380_10147727 Ga0157380_101477271 540
179 3300046463 Ga0495653_0010485 Ga0495653_0010485_4250_5974 540
180 3300046492 Ga0495585_0001061 Ga0495585_0001061_5118_6857 540
181 3300046522 Ga0495643_0000567 Ga0495643_0000567_40345_42081 540
182 3300046535 Ga0495586_0026284 Ga0495586_0026284_803_2527 540
183 3300046663 Ga0495635_0002840 Ga0495635_0002840_855_2579 540
184 3300047317 Ga0495604_0029462 Ga0495604_0029462_673_2397 540
185 3300047322 Ga0495680_0054663 Ga0495680_0054663_919_2643 540
186 3300047673 Ga0495593_0023123 Ga0495593_0023123_1161_2885 540
187 3300048089 Ga0495614_0005144 Ga0495614_0005144_3141_4865 540
188 3300048091 Ga0495626_0043083 Ga0495626_0043083_253_1989 540
189 iso_pu_bacteria 2643221556 2643798088 540
190 iso_pu_bacteria 2643221645 2644253813 540
191 iso_pu_bacteria 2643221684 2644473266 540
192 iso_pu_bacteria 2738541280 2738738784 540
193 iso_pu_bacteria 2738541297 2738825172 540
194 iso_pu_bacteria 2738541300 2738844670 540
195 iso_pu_bacteria 2738541357 2739148969 540
196 iso_pu_bacteria 2738543003 2739190888 540
197 iso_pu_bacteria 2738543018 2739276195 540
198 iso_pu_bacteria 2738543026 2739317365 540
199 iso_pu_bacteria 2738543029 2739335606 540
200 iso_pu_bacteria 2738543030 2739345281 540
201 iso_pu_bacteria 2821131069 2821133766 540
202 iso_pu_bacteria 2842711865 2842717166 540
203 iso_pu_bacteria 2857553236 2857553875 540
204 iso_pu_bacteria 2857558681 2857560337 540
205 iso_pu_bacteria 2857564685 2857565558 540
206 iso_pu_bacteria 2904424332 2904430621 540
207 iso_pu_bacteria 2919476304 2919480490 540
208 iso_pu_bacteria 8047673197 8047678093 540
209 3300014497 Ga0182008_10001646 Ga0182008_1000164610 541
210 3300015262 Ga0182007_10000096 Ga0182007_100000969 541
211 3300015265 Ga0182005_1000014 Ga0182005_1000014249 541
212 3300032002 Ga0307416_100003518 Ga0307416_1000035185 541
213 3300046460 Ga0495638_0003279 Ga0495638_0003279_1023_2714 541
214 3300046471 Ga0495650_0001046 Ga0495650_0001046_12757_14448 541
215 3300046474 Ga0495605_0025115 Ga0495605_0025115_1018_2766 541
216 3300046474 Ga0495605_0034862 Ga0495605_0034862_85_1824 541
217 3300046491 Ga0495584_0009791 Ga0495584_0009791_1174_2865 541
218 3300046500 Ga0495596_0006614 Ga0495596_0006614_2516_4255 541
219 3300046501 Ga0495607_0016521 Ga0495607_0016521_2954_4645 541
220 3300046506 Ga0495583_0000195 Ga0495583_0000195_61315_63060 541
221 3300046506 Ga0495583_0005962 Ga0495583_0005962_2010_3749 541
222 3300046506 Ga0495583_0043941 Ga0495583_0043941_64_1755 541
223 3300046507 Ga0495606_0004483 Ga0495606_0004483_6734_8425 541
224 3300046513 Ga0495616_0007442 Ga0495616_0007442_103_1842 541
225 3300046538 Ga0495609_0000910 Ga0495609_0000910_4346_6037 541
226 3300046538 Ga0495609_0005513 Ga0495609_0005513_2540_4270 541
227 3300046660 Ga0495625_0018164 Ga0495625_0018164_2113_3804 541
228 3300046664 Ga0495659_0012157 Ga0495659_0012157_323_2014 541
229 3300046665 Ga0495661_0001170 Ga0495661_0001170_10947_12665 541
230 3300046794 Ga0495589_0035755 Ga0495589_0035755_704_2443 541
231 3300047318 Ga0495636_0005231 Ga0495636_0005231_2245_3957 541
232 3300047318 Ga0495636_0012438 Ga0495636_0012438_1053_2744 541
233 3300047447 Ga0495685_001298 Ga0495685_001298_3302_4993 541
234 3300047469 Ga0495673_0017040 Ga0495673_0017040_328_2067 541
235 3300047470 Ga0495681_0022331 Ga0495681_0022331_1520_3214 541
236 3300048091 Ga0495626_0013526 Ga0495626_0013526_1813_3543 541
237 3300048091 Ga0495626_0042634 Ga0495626_0042634_254_2002 541
238 3300048091 Ga0495626_0049584 Ga0495626_0049584_148_1842 541
239 3300048091 Ga0495626_0052809 Ga0495626_0052809_90_1829 541
240 3300048903 Ga0496100_0082565 Ga0496100_0082565_33_1751 541
241 3300048916 Ga0496113_0029183 Ga0496113_0029183_1199_2917 541
242 3300048918 Ga0496115_0015932 Ga0496115_0015932_872_2566 541
243 3300048920 Ga0496117_0000001 Ga0496117_0000001_2264147_2265880 541
244 3300048921 Ga0496118_0000008 Ga0496118_0000008_382440_384173 541
245 3300048924 Ga0496121_0004172 Ga0496121_0004172_3764_5497 541
246 3300048925 Ga0496122_0000445 Ga0496122_0000445_63316_65034 541
247 3300048925 Ga0496122_0002321 Ga0496122_0002321_14081_15814 541
248 3300048926 Ga0496123_0001531 Ga0496123_0001531_8681_10399 541
249 3300048928 Ga0496125_0002437 Ga0496125_0002437_961_2679 541
250 iso_pu_bacteria 2600255292 2601671013 541
251 iso_pu_bacteria 2808606418 2809144563 541
252 iso_pu_bacteria 2857547612 2857547785 541
253 iso_pu_bacteria 2885080285 2885086235 541
254 iso_pu_bacteria 2932410948 2932412392 541
255 iso_pu_bacteria 2932416698 2932419907 541
256 3300005345 Ga0070692_10023322 Ga0070692_100233223 542
257 3300005545 Ga0070695_100010081 Ga0070695_1000100813 542
258 3300005577 Ga0068857_100035718 Ga0068857_1000357182 542
259 3300025908 Ga0207643_10003613 Ga0207643_100036132 542
260 3300025935 Ga0207709_10008485 Ga0207709_100084852 542
261 3300026041 Ga0207639_10033421 Ga0207639_100334213 542
262 3300026095 Ga0207676_10183941 Ga0207676_101839411 542
263 3300026116 Ga0207674_10118129 Ga0207674_101181292 542
264 3300031995 Ga0307409_100203894 Ga0307409_1002038941 542
265 3300046519 Ga0495632_0000077 Ga0495632_0000077_65754_67472 542
266 3300002773 JGI25152J39213_1000217 JGI25152J39213_100021713 543
267 3300003215 JGI25153J46596_10003209 JGI25153J46596_100032098 543
268 3300003775 Ga0055524_1001567 Ga0055524_10015672 543
269 3300005468 Ga0070707_100054170 Ga0070707_1000541703 543
270 3300005471 Ga0070698_100104020 Ga0070698_1001040202 543
271 3300005577 Ga0068857_100088981 Ga0068857_1000889812 543
272 3300006852 Ga0075433_10121865 Ga0075433_101218652 543
273 3300010375 Ga0105239_10191758 Ga0105239_101917582 543
274 3300021361 Ga0213872_10000002 Ga0213872_10000002254 543
275 3300021361 Ga0213872_10001473 Ga0213872_100014735 543
276 3300025245 Ga0207425_1000001 Ga0207425_10000012225 543
277 3300025245 Ga0207425_1008411 Ga0207425_10084112 543
278 3300025258 Ga0209129_1000093 Ga0209129_1000093127 543
279 3300025263 Ga0209565_1001220 Ga0209565_100122012 543
280 3300025297 Ga0209758_1000055 Ga0209758_1000055127 543
281 3300025299 Ga0209256_1000879 Ga0209256_100087913 543
282 3300025923 Ga0207681_10010892 Ga0207681_100108923 543
283 3300025924 Ga0207694_10000938 Ga0207694_1000093823 543
284 3300025934 Ga0207686_10005640 Ga0207686_100056403 543
285 3300025941 Ga0207711_10042429 Ga0207711_100424292 543
286 3300025941 Ga0207711_10055952 Ga0207711_100559522 543
287 3300025960 Ga0207651_10067531 Ga0207651_100675312 543
288 3300025961 Ga0207712_10003390 Ga0207712_100033908 543
289 3300026035 Ga0207703_10081974 Ga0207703_100819741 543
290 3300026089 Ga0207648_10081979 Ga0207648_100819792 543
291 3300035091 Ga0373951_0002546 Ga0373951_0002546_150_1781 543
292 3300039447 Ga0436361_0111397 Ga0436361_0111397_921_2621 543
293 3300039447 Ga0436361_0667736 Ga0436361_0667736_6208_7917 543
294 3300039447 Ga0436361_0977466 Ga0436361_0977466_14154_15848 543
295 3300042139 Ga0450904_000130 Ga0450904_000130_14791_16524 543
296 3300042157 Ga0439458_0001237 Ga0439458_0001237_3059_4690 543
297 3300046460 Ga0495638_0001537 Ga0495638_0001537_2789_4525 543
298 3300046491 Ga0495584_0000017 Ga0495584_0000017_69926_71671 543
299 3300046492 Ga0495585_0058990 Ga0495585_0058990_54_1814 543
300 3300046500 Ga0495596_0000224 Ga0495596_0000224_3585_5345 543
301 3300046507 Ga0495606_0025925 Ga0495606_0025925_1920_3665 543
302 3300046513 Ga0495616_0000057 Ga0495616_0000057_86920_88650 543
303 3300046525 Ga0495663_0013019 Ga0495663_0013019_364_2088 543
304 3300046528 Ga0495642_0006531 Ga0495642_0006531_865_2601 543
305 3300046531 Ga0495665_0004421 Ga0495665_0004421_111_1877 543
306 3300046542 Ga0495597_0010112 Ga0495597_0010112_677_2401 543
307 3300046542 Ga0495597_0017371 Ga0495597_0017371_566_2302 543
308 3300046558 Ga0495633_0012539 Ga0495633_0012539_302_2062 543
309 3300046642 Ga0495634_0027471 Ga0495634_0027471_1777_3543 543
310 3300046648 Ga0495611_0007350 Ga0495611_0007350_373_2109 543
311 3300046660 Ga0495625_0044881 Ga0495625_0044881_800_2521 543
312 3300046684 Ga0495669_0000502 Ga0495669_0000502_14761_16521 543
313 3300046691 Ga0495670_0000157 Ga0495670_0000157_3029_4750 543
314 3300046691 Ga0495670_0037095 Ga0495670_0037095_531_2291 543
315 3300046691 Ga0495670_0061925 Ga0495670_0061925_141_1865 543
316 3300046692 Ga0495671_0055826 Ga0495671_0055826_221_1945 543
317 3300046794 Ga0495589_0022217 Ga0495589_0022217_1459_3183 543
318 3300047321 Ga0495676_0002463 Ga0495676_0002463_7685_9424 543
319 3300047443 Ga0495687_000143 Ga0495687_000143_98853_100568 543
320 3300047447 Ga0495685_030530 Ga0495685_030530_121_1839 543
321 3300047470 Ga0495681_0010372 Ga0495681_0010372_3520_5244 543
322 3300047472 Ga0495686_0000656 Ga0495686_0000656_10887_12593 543
323 3300048088 Ga0495602_0005903 Ga0495602_0005903_10914_12671 543
324 3300048091 Ga0495626_0001009 Ga0495626_0001009_2465_4198 543
325 3300048091 Ga0495626_0002453 Ga0495626_0002453_7500_9236 543
326 3300048915 Ga0496112_0099876 Ga0496112_0099876_383_2014 543
327 3300048927 Ga0496124_0008544 Ga0496124_0008544_3029_4780 543
328 3300049460 Ga0495682_0002913 Ga0495682_0002913_5719_7455 543
329 3300049851 Ga0501212_001911 Ga0501212_001911_533_2173 543
330 3300050515 nmdc:mga0a205_139277_c1 nmdc:mga0a205_139277_c1_245_1945 543
331 3300002738 JGI25154J39366_1002264 JGI25154J39366_10022641 544
332 3300002774 JGI25150J39212_1001645 JGI25150J39212_10016452 544
333 3300002987 JGI25159J45721_1004474 JGI25159J45721_10044742 544
334 3300003693 Ga0032354_1086905 Ga0032354_10869052 544
335 3300003771 Ga0055526_1000161 Ga0055526_100016123 544
336 3300003771 Ga0055526_1000309 Ga0055526_100030923 544
337 3300003775 Ga0055524_1000015 Ga0055524_1000015157 544
338 3300005262 Ga0065165_1000224 Ga0065165_100022430 544
339 3300005366 Ga0070659_100038344 Ga0070659_1000383442 544
340 3300006948 Ga0099826_10000003 Ga0099826_10000003265 544
341 3300009036 Ga0105244_10022293 Ga0105244_100222932 544
342 3300025233 Ga0209437_106718 Ga0209437_1067182 544
343 3300025245 Ga0207425_1000474 Ga0207425_100047422 544
344 3300025246 Ga0209646_1000028 Ga0209646_100002893 544
345 3300025284 Ga0209130_1000044 Ga0209130_1000044131 544
346 3300025294 Ga0209025_1014127 Ga0209025_10141273 544
347 3300025295 Ga0209564_1000006 Ga0209564_1000006105 544
348 3300025295 Ga0209564_1000038 Ga0209564_100003873 544
349 3300025297 Ga0209758_1000149 Ga0209758_1000149148 544
350 3300025299 Ga0209256_1000005 Ga0209256_1000005158 544
351 3300025728 Ga0207655_1021874 Ga0207655_10218742 544
352 3300025919 Ga0207657_10004692 Ga0207657_100046924 544
353 3300027666 Ga0209282_1000002 Ga0209282_1000002732 544
354 3300028794 Ga0307515_10099407 Ga0307515_100994072 544
355 3300031548 Ga0307408_100000774 Ga0307408_10000077423 544
356 3300037312 Ga0395899_0000715 Ga0395899_0000715_7054_8766 544
357 3300037418 Ga0395900_0000372 Ga0395900_0000372_3051_4772 544
358 3300037418 Ga0395900_0049778 Ga0395900_0049778_149_1861 544
359 3300037418 Ga0395900_0086306 Ga0395900_0086306_48_1757 544
360 3300037471 Ga0395905_0018620 Ga0395905_0018620_1869_3581 544
361 3300038443 Ga0395901_0001123 Ga0395901_0001123_3464_5173 544
362 3300039447 Ga0436361_0872359 Ga0436361_0872359_673_2385 544
363 3300042008 Ga0439450_002379 Ga0439450_002379_984_2696 544
364 3300044658 Ga0466972_0001600 Ga0466972_0001600_3612_5321 544
365 3300044684 Ga0466966_0001121 Ga0466966_0001121_210_1919 544
366 3300045049 Ga0466959_0027945 Ga0466959_0027945_2137_3846 544
367 3300046452 Ga0495617_000147 Ga0495617_000147_24731_26470 544
368 3300046452 Ga0495617_012984 Ga0495617_012984_976_2673 544
369 3300046453 Ga0495627_000006 Ga0495627_000006_29889_31589 544
370 3300046457 Ga0495590_0000004 Ga0495590_0000004_400248_401948 544
371 3300046460 Ga0495638_0000066 Ga0495638_0000066_21251_22951 544
372 3300046463 Ga0495653_0000037 Ga0495653_0000037_5376_7076 544
373 3300046471 Ga0495650_0000695 Ga0495650_0000695_18719_20419 544
374 3300046471 Ga0495650_0000871 Ga0495650_0000871_17626_19326 544
375 3300046474 Ga0495605_0000003 Ga0495605_0000003_384532_386244 544
376 3300046474 Ga0495605_0000034 Ga0495605_0000034_195164_196876 544
377 3300046474 Ga0495605_0003564 Ga0495605_0003564_3677_5410 544
378 3300046474 Ga0495605_0022360 Ga0495605_0022360_129_1844 544
379 3300046475 Ga0495639_0014226 Ga0495639_0014226_1247_2947 544
380 3300046491 Ga0495584_0000345 Ga0495584_0000345_28286_29995 544
381 3300046491 Ga0495584_0000401 Ga0495584_0000401_10395_12095 544
382 3300046491 Ga0495584_0002836 Ga0495584_0002836_5558_7273 544
383 3300046491 Ga0495584_0002986 Ga0495584_0002986_6037_7767 544
384 3300046491 Ga0495584_0005999 Ga0495584_0005999_300_2018 544
385 3300046491 Ga0495584_0017380 Ga0495584_0017380_312_2036 544
386 3300046492 Ga0495585_0000941 Ga0495585_0000941_10025_11755 544
387 3300046492 Ga0495585_0003330 Ga0495585_0003330_2513_4270 544
388 3300046492 Ga0495585_0009300 Ga0495585_0009300_2354_4051 544
389 3300046492 Ga0495585_0026537 Ga0495585_0026537_625_2325 544
390 3300046501 Ga0495607_0000398 Ga0495607_0000398_38232_39947 544
391 3300046501 Ga0495607_0002518 Ga0495607_0002518_10777_12489 544
392 3300046501 Ga0495607_0005454 Ga0495607_0005454_7287_9029 544
393 3300046506 Ga0495583_0000372 Ga0495583_0000372_19031_20755 544
394 3300046506 Ga0495583_0000600 Ga0495583_0000600_20590_22290 544
395 3300046506 Ga0495583_0040612 Ga0495583_0040612_345_2087 544
396 3300046507 Ga0495606_0000268 Ga0495606_0000268_21852_23552 544
397 3300046507 Ga0495606_0001211 Ga0495606_0001211_5324_7066 544
398 3300046507 Ga0495606_0001586 Ga0495606_0001586_7347_9047 544
399 3300046507 Ga0495606_0004274 Ga0495606_0004274_1697_3397 544
400 3300046507 Ga0495606_0011433 Ga0495606_0011433_174_1874 544
401 3300046507 Ga0495606_0037147 Ga0495606_0037147_540_2252 544
402 3300046512 Ga0495610_0000004 Ga0495610_0000004_402717_404417 544
403 3300046512 Ga0495610_0001082 Ga0495610_0001082_12410_14110 544
404 3300046513 Ga0495616_0000378 Ga0495616_0000378_20326_22023 544
405 3300046513 Ga0495616_0009424 Ga0495616_0009424_3299_5014 544
406 3300046519 Ga0495632_0004693 Ga0495632_0004693_2790_4514 544
407 3300046520 Ga0495637_0000991 Ga0495637_0000991_1544_3244 544
408 3300046522 Ga0495643_0000453 Ga0495643_0000453_22445_24157 544
409 3300046522 Ga0495643_0000626 Ga0495643_0000626_19206_20903 544
410 3300046522 Ga0495643_0000661 Ga0495643_0000661_15083_16783 544
411 3300046523 Ga0495644_0020657 Ga0495644_0020657_681_2405 544
412 3300046524 Ga0495648_0000045 Ga0495648_0000045_77203_78903 544
413 3300046524 Ga0495648_0004611 Ga0495648_0004611_6778_8478 544
414 3300046524 Ga0495648_0018963 Ga0495648_0018963_2955_4667 544
415 3300046524 Ga0495648_0080197 Ga0495648_0080197_146_1846 544
416 3300046528 Ga0495642_0000485 Ga0495642_0000485_9818_11530 544
417 3300046528 Ga0495642_0005862 Ga0495642_0005862_455_2173 544
418 3300046530 Ga0495654_0009140 Ga0495654_0009140_2761_4461 544
419 3300046538 Ga0495609_0000002 Ga0495609_0000002_376250_377965 544
420 3300046538 Ga0495609_0001921 Ga0495609_0001921_7130_8830 544
421 3300046538 Ga0495609_0017017 Ga0495609_0017017_1275_2975 544
422 3300046542 Ga0495597_0000409 Ga0495597_0000409_30064_31761 544
423 3300046542 Ga0495597_0009351 Ga0495597_0009351_1615_3315 544
424 3300046558 Ga0495633_0000401 Ga0495633_0000401_16635_18335 544
425 3300046558 Ga0495633_0000527 Ga0495633_0000527_14615_16324 544
426 3300046558 Ga0495633_0001332 Ga0495633_0001332_6614_8344 544
427 3300046558 Ga0495633_0002100 Ga0495633_0002100_1666_3366 544
428 3300046616 Ga0495668_0000025 Ga0495668_0000025_173393_175102 544
429 3300046616 Ga0495668_0000274 Ga0495668_0000274_35142_36866 544
430 3300046616 Ga0495668_0001238 Ga0495668_0001238_60_1760 544
431 3300046616 Ga0495668_0002219 Ga0495668_0002219_6366_8066 544
432 3300046648 Ga0495611_0001877 Ga0495611_0001877_4166_5890 544
433 3300046648 Ga0495611_0002974 Ga0495611_0002974_4011_5708 544
434 3300046660 Ga0495625_0002274 Ga0495625_0002274_2763_4463 544
435 3300046660 Ga0495625_0006331 Ga0495625_0006331_3678_5378 544
436 3300046660 Ga0495625_0022531 Ga0495625_0022531_480_2186 544
437 3300046660 Ga0495625_0078564 Ga0495625_0078564_197_1894 544
438 3300046664 Ga0495659_0000124 Ga0495659_0000124_32157_33857 544
439 3300046665 Ga0495661_0000281 Ga0495661_0000281_10519_12234 544
440 3300046665 Ga0495661_0000980 Ga0495661_0000980_11215_12945 544
441 3300046665 Ga0495661_0011882 Ga0495661_0011882_258_1967 544
442 3300046665 Ga0495661_0037848 Ga0495661_0037848_84_1796 544
443 3300046674 Ga0495588_0000177 Ga0495588_0000177_41855_43567 544
444 3300046691 Ga0495670_0000312 Ga0495670_0000312_8462_10192 544
445 3300046691 Ga0495670_0001319 Ga0495670_0001319_4733_6430 544
446 3300046691 Ga0495670_0018547 Ga0495670_0018547_150_1868 544
447 3300046692 Ga0495671_0000001 Ga0495671_0000001_1050182_1051882 544
448 3300046692 Ga0495671_0000575 Ga0495671_0000575_10393_12093 544
449 3300046692 Ga0495671_0025379 Ga0495671_0025379_785_2485 544
450 3300046694 Ga0495649_0007938 Ga0495649_0007938_1769_3493 544
451 3300046694 Ga0495649_0015329 Ga0495649_0015329_171_1871 544
452 3300046794 Ga0495589_0000230 Ga0495589_0000230_34535_36250 544
453 3300046794 Ga0495589_0001364 Ga0495589_0001364_1649_3361 544
454 3300046794 Ga0495589_0035253 Ga0495589_0035253_583_2307 544
455 3300046810 Ga0495660_0000026 Ga0495660_0000026_243344_245056 544
456 3300046810 Ga0495660_0002729 Ga0495660_0002729_284_2008 544
457 3300046810 Ga0495660_0002963 Ga0495660_0002963_5856_7556 544
458 3300046810 Ga0495660_0004933 Ga0495660_0004933_3030_4730 544
459 3300046810 Ga0495660_0016405 Ga0495660_0016405_835_2535 544
460 3300047315 Ga0495581_0007297 Ga0495581_0007297_2314_4032 544
461 3300047318 Ga0495636_0005273 Ga0495636_0005273_2808_4550 544
462 3300047320 Ga0495672_0000045 Ga0495672_0000045_198086_199786 544
463 3300047320 Ga0495672_0000505 Ga0495672_0000505_40133_41833 544
464 3300047320 Ga0495672_0001178 Ga0495672_0001178_15647_17371 544
465 3300047320 Ga0495672_0003428 Ga0495672_0003428_152_1864 544
466 3300047323 Ga0495683_0006600 Ga0495683_0006600_4571_6295 544
467 3300047323 Ga0495683_0009925 Ga0495683_0009925_2017_3717 544
468 3300047443 Ga0495687_000013 Ga0495687_000013_358891_360606 544
469 3300047443 Ga0495687_000280 Ga0495687_000280_2365_4077 544
470 3300047443 Ga0495687_001126 Ga0495687_001126_1675_3375 544
471 3300047443 Ga0495687_001213 Ga0495687_001213_21268_22968 544
472 3300047445 Ga0495677_0000041 Ga0495677_0000041_45699_47414 544
473 3300047445 Ga0495677_0005929 Ga0495677_0005929_211_1923 544
474 3300047446 Ga0495679_002516 Ga0495679_002516_5895_7619 544
475 3300047469 Ga0495673_0000006 Ga0495673_0000006_131523_133223 544
476 3300047469 Ga0495673_0000014 Ga0495673_0000014_349328_351028 544
477 3300047469 Ga0495673_0000017 Ga0495673_0000017_80467_82167 544
478 3300047470 Ga0495681_0000815 Ga0495681_0000815_12627_14357 544
479 3300047470 Ga0495681_0017512 Ga0495681_0017512_411_2135 544
480 3300048091 Ga0495626_0000383 Ga0495626_0000383_9855_11570 544
481 3300048091 Ga0495626_0001865 Ga0495626_0001865_2383_4095 544
482 3300048091 Ga0495626_0006233 Ga0495626_0006233_4938_6671 544
483 3300048905 Ga0496102_0000454 Ga0496102_0000454_43086_44822 544
484 3300048906 Ga0496103_0026176 Ga0496103_0026176_1103_2827 544
485 3300048909 Ga0496106_0011144 Ga0496106_0011144_1452_3164 544
486 3300048919 Ga0496116_0040323 Ga0496116_0040323_1121_2821 544
487 3300048924 Ga0496121_0025979 Ga0496121_0025979_3496_5196 544
488 3300048925 Ga0496122_0059997 Ga0496122_0059997_614_2326 544
489 3300048926 Ga0496123_0007447 Ga0496123_0007447_6897_8609 544
490 3300048927 Ga0496124_0024873 Ga0496124_0024873_2908_4632 544
491 3300049459 Ga0495678_000042 Ga0495678_000042_157397_159097 544
492 3300049459 Ga0495678_001513 Ga0495678_001513_3240_4940 544
493 3300049459 Ga0495678_014117 Ga0495678_014117_1700_3400 544
494 3300049671 Ga0501238_000859 Ga0501238_000859_676_2376 544
495 3300049822 Ga0501035_0003621 Ga0501035_0003621_8706_10418 544
496 3300053145 Ga0500586_004143 Ga0500586_004143_1625_3325 544
497 3300003759 Ga0055525_1000009 Ga0055525_100000921 545
498 3300005262 Ga0065165_1000286 Ga0065165_100028624 545
499 3300005327 Ga0070658_10097302 Ga0070658_100973021 545
500 3300005439 Ga0070711_100000055 Ga0070711_1000000553 545
501 3300005457 Ga0070662_100037956 Ga0070662_1000379561 545
502 3300005617 Ga0068859_100000001 Ga0068859_100000001259 545
503 3300006931 Ga0097620_100000001 Ga0097620_100000001259 545
504 3300009098 Ga0105245_10037375 Ga0105245_100373751 545
505 3300009148 Ga0105243_10008155 Ga0105243_100081556 545
506 3300009174 Ga0105241_10065793 Ga0105241_100657931 545
507 3300013296 Ga0157374_10224282 Ga0157374_102242821 545
508 3300015261 Ga0182006_1000268 Ga0182006_100026819 545
509 3300015265 Ga0182005_1000018 Ga0182005_1000018225 545
510 3300025230 Ga0209563_100015 Ga0209563_100015134 545
511 3300025254 Ga0209148_1000741 Ga0209148_100074118 545
512 3300025909 Ga0207705_10051373 Ga0207705_100513732 545
513 3300025911 Ga0207654_10011450 Ga0207654_100114505 545
514 3300025933 Ga0207706_10042700 Ga0207706_100427001 545
515 3300025935 Ga0207709_10006794 Ga0207709_100067946 545
516 3300037471 Ga0395905_0031408 Ga0395905_0031408_1470_3215 545
517 3300037471 Ga0395905_0049000 Ga0395905_0049000_1682_3409 545
518 3300038443 Ga0395901_0004045 Ga0395901_0004045_2743_4470 545
519 3300042005 Ga0439448_0001145 Ga0439448_0001145_4762_6480 545
520 3300044842 Ga0466957_0000545 Ga0466957_0000545_10028_11767 545
521 3300045976 Ga0466967_0004194 Ga0466967_0004194_318_2045 545
522 3300045976 Ga0466967_0045615 Ga0466967_0045615_662_2386 545
523 3300046457 Ga0495590_0000025 Ga0495590_0000025_103264_105015 545
524 3300046458 Ga0495591_000246 Ga0495591_000246_25425_27176 545
525 3300046460 Ga0495638_0025016 Ga0495638_0025016_1445_3187 545
526 3300046474 Ga0495605_0028603 Ga0495605_0028603_1024_2781 545
527 3300046491 Ga0495584_0000070 Ga0495584_0000070_25515_27266 545
528 3300046499 Ga0495594_0029580 Ga0495594_0029580_560_2311 545
529 3300046501 Ga0495607_0004773 Ga0495607_0004773_2327_4078 545
530 3300046506 Ga0495583_0000382 Ga0495583_0000382_24109_25860 545
531 3300046506 Ga0495583_0007066 Ga0495583_0007066_3066_4808 545
532 3300046512 Ga0495610_0000229 Ga0495610_0000229_26078_27829 545
533 3300046518 Ga0495631_0001464 Ga0495631_0001464_2552_4294 545
534 3300046520 Ga0495637_0000019 Ga0495637_0000019_16205_17956 545
535 3300046520 Ga0495637_0003088 Ga0495637_0003088_7056_8867 545
536 3300046524 Ga0495648_0004308 Ga0495648_0004308_4151_5893 545
537 3300046538 Ga0495609_0010671 Ga0495609_0010671_1429_3189 545
538 3300046542 Ga0495597_0000812 Ga0495597_0000812_14427_16169 545
539 3300046542 Ga0495597_0005958 Ga0495597_0005958_1844_3601 545
540 3300046558 Ga0495633_0002968 Ga0495633_0002968_2346_4097 545
541 3300046616 Ga0495668_0000544 Ga0495668_0000544_38958_40700 545
542 3300046648 Ga0495611_0000195 Ga0495611_0000195_25845_27596 545
543 3300046648 Ga0495611_0000773 Ga0495611_0000773_15821_17551 545
544 3300046674 Ga0495588_0035646 Ga0495588_0035646_528_2279 545
545 3300046684 Ga0495669_0004319 Ga0495669_0004319_2668_4398 545
546 3300046694 Ga0495649_0000277 Ga0495649_0000277_18074_19825 545
547 3300046794 Ga0495589_0000535 Ga0495589_0000535_7193_8935 545
548 3300046794 Ga0495589_0044531 Ga0495589_0044531_171_1928 545
549 3300047320 Ga0495672_0000041 Ga0495672_0000041_171601_173352 545
550 3300047320 Ga0495672_0017777 Ga0495672_0017777_962_2719 545
551 3300047321 Ga0495676_0000309 Ga0495676_0000309_20650_22470 545
552 3300047323 Ga0495683_0000763 Ga0495683_0000763_11136_12887 545
553 3300047443 Ga0495687_000127 Ga0495687_000127_98570_100330 545
554 3300047445 Ga0495677_0000210 Ga0495677_0000210_10689_12440 545
555 3300047446 Ga0495679_001712 Ga0495679_001712_7091_8833 545
556 3300047472 Ga0495686_0000732 Ga0495686_0000732_9452_11203 545
557 3300048905 Ga0496102_0022302 Ga0496102_0022302_916_2640 545
558 3300048908 Ga0496105_0168157 Ga0496105_0168157_20_1750 545
559 3300048925 Ga0496122_0001558 Ga0496122_0001558_3602_5326 545
560 3300048926 Ga0496123_0031575 Ga0496123_0031575_1095_2819 545
561 3300049459 Ga0495678_000233 Ga0495678_000233_34564_36294 545
562 3300049459 Ga0495678_000316 Ga0495678_000316_26157_28010 545
563 3300049460 Ga0495682_0001172 Ga0495682_0001172_10048_11799 545
564 3300006846 Ga0075430_100043903 Ga0075430_1000439032 546
565 3300044673 Ga0453683_0011548 Ga0453683_0011548_4073_5752 546
566 3300046473 Ga0495582_0038166 Ga0495582_0038166_772_2547 546
567 3300046542 Ga0495597_0001519 Ga0495597_0001519_5835_7589 546
568 3300047317 Ga0495604_0058512 Ga0495604_0058512_120_1895 546
569 3300046452 Ga0495617_000002 Ga0495617_000002_613263_615020 547
570 3300046453 Ga0495627_000207 Ga0495627_000207_39914_41671 547
571 3300046474 Ga0495605_0000293 Ga0495605_0000293_20130_21887 547
572 3300046474 Ga0495605_0036014 Ga0495605_0036014_542_2293 547
573 3300046513 Ga0495616_0000207 Ga0495616_0000207_17045_18784 547
574 3300046518 Ga0495631_0003789 Ga0495631_0003789_29_1786 547
575 3300046519 Ga0495632_0000296 Ga0495632_0000296_30689_32428 547
576 3300046524 Ga0495648_0001105 Ga0495648_0001105_17163_18920 547
577 3300046528 Ga0495642_0000085 Ga0495642_0000085_29840_31597 547
578 3300046528 Ga0495642_0000285 Ga0495642_0000285_16126_17865 547
579 3300046616 Ga0495668_0000941 Ga0495668_0000941_14323_16080 547
580 3300046665 Ga0495661_0002244 Ga0495661_0002244_5560_7317 547
581 3300046674 Ga0495588_0019032 Ga0495588_0019032_417_2156 547
582 3300046684 Ga0495669_0001901 Ga0495669_0001901_909_2666 547
583 3300046684 Ga0495669_0002014 Ga0495669_0002014_1980_3719 547
584 3300046692 Ga0495671_0000965 Ga0495671_0000965_1383_3140 547
585 3300047470 Ga0495681_0000667 Ga0495681_0000667_7477_9237 547
586 3300048905 Ga0496102_0000931 Ga0496102_0000931_4826_6583 547
587 3300005618 Ga0068864_100106835 Ga0068864_1001068352 548
588 3300046474 Ga0495605_0020413 Ga0495605_0020413_671_2443 548
589 3300046500 Ga0495596_0000838 Ga0495596_0000838_15022_16794 548
590 3300046524 Ga0495648_0032006 Ga0495648_0032006_675_2447 548
591 3300047320 Ga0495672_0000748 Ga0495672_0000748_6191_7963 548
592 3300009147 Ga0114129_10038360 Ga0114129_100383606 549
593 3300013307 Ga0157372_10002676 Ga0157372_1000267624 549
594 3300021384 Ga0213876_10031836 Ga0213876_100318362 549
595 3300025913 Ga0207695_10008579 Ga0207695_100085795 549
596 3300032005 Ga0307411_10062329 Ga0307411_100623292 549
597 3300039437 Ga0436365_1170609 Ga0436365_1170609_582_2267 549
598 3300050507 nmdc:mga05p37_60640_c1 nmdc:mga05p37_60640_c1_2437_4098 549
599 3300005438 Ga0070701_10039354 Ga0070701_100393542 550
600 3300006846 Ga0075430_100056655 Ga0075430_1000566552 550
601 3300006847 Ga0075431_100056603 Ga0075431_1000566032 550
602 3300009147 Ga0114129_10111378 Ga0114129_101113782 550
603 3300013306 Ga0163162_10070910 Ga0163162_100709101 550
604 3300025907 Ga0207645_10055294 Ga0207645_100552942 550
605 3300026075 Ga0207708_10036784 Ga0207708_100367841 550
606 3300050508 nmdc:mga09592_150152_c1 nmdc:mga09592_150152_c1_170_1834 550
607 3300050510 nmdc:mga06r32_232889_c1 nmdc:mga06r32_232889_c1_74_1738 550
608 3300005330 Ga0070690_100001410 Ga0070690_1000014102 551
609 3300005544 Ga0070686_100099080 Ga0070686_1000990801 551
610 3300005617 Ga0068859_100146528 Ga0068859_1001465282 551
611 3300006846 Ga0075430_100052667 Ga0075430_1000526673 551
612 3300006931 Ga0097620_100146524 Ga0097620_1001465242 551
613 3300013297 Ga0157378_10042915 Ga0157378_100429152 551
614 3300005334 Ga0068869_100034319 Ga0068869_1000343192 552
615 3300005337 Ga0070682_100001655 Ga0070682_1000016551 552
616 3300005337 Ga0070682_100020846 Ga0070682_1000208463 552
617 3300005340 Ga0070689_100012356 Ga0070689_1000123563 552
618 3300005366 Ga0070659_100012300 Ga0070659_1000123004 552
619 3300005444 Ga0070694_100028495 Ga0070694_1000284952 552
620 3300005444 Ga0070694_100080250 Ga0070694_1000802501 552
621 3300005444 Ga0070694_100089146 Ga0070694_1000891461 552
622 3300005458 Ga0070681_10007691 Ga0070681_100076912 552
623 3300005458 Ga0070681_10014121 Ga0070681_100141214 552
624 3300005467 Ga0070706_100000137 Ga0070706_1000001376 552
625 3300005618 Ga0068864_100025978 Ga0068864_1000259784 552
626 3300005985 Ga0081539_10029181 Ga0081539_100291812 552
627 3300006237 Ga0097621_100060162 Ga0097621_1000601622 552
628 3300006358 Ga0068871_100008018 Ga0068871_1000080187 552
629 3300006852 Ga0075433_10047913 Ga0075433_100479131 552
630 3300006880 Ga0075429_100084433 Ga0075429_1000844332 552
631 3300009094 Ga0111539_10123413 Ga0111539_101234131 552
632 3300009545 Ga0105237_10000903 Ga0105237_1000090333 552
633 3300009551 Ga0105238_10003887 Ga0105238_100038875 552
634 3300011119 Ga0105246_10125201 Ga0105246_101252011 552
635 3300013100 Ga0157373_10045612 Ga0157373_100456123 552
636 3300014325 Ga0163163_10024980 Ga0163163_100249804 552
637 3300014325 Ga0163163_10037271 Ga0163163_100372711 552
638 3300014326 Ga0157380_10069130 Ga0157380_100691302 552
639 3300014326 Ga0157380_10106074 Ga0157380_101060742 552
640 3300025885 Ga0207653_10003134 Ga0207653_100031343 552
641 3300025904 Ga0207647_10003657 Ga0207647_100036578 552
642 3300025910 Ga0207684_10000314 Ga0207684_100003145 552
643 3300025912 Ga0207707_10006367 Ga0207707_100063674 552
644 3300025912 Ga0207707_10024302 Ga0207707_100243021 552
645 3300025914 Ga0207671_10004805 Ga0207671_100048059 552
646 3300025936 Ga0207670_10007735 Ga0207670_100077353 552
647 3300025942 Ga0207689_10012384 Ga0207689_100123842 552
648 3300026035 Ga0207703_10062490 Ga0207703_100624901 552
649 3300026078 Ga0207702_10015334 Ga0207702_100153341 552
650 3300026095 Ga0207676_10091378 Ga0207676_100913782 552
651 3300026116 Ga0207674_10001412 Ga0207674_1000141230 552
652 3300026118 Ga0207675_100007738 Ga0207675_1000077382 552
653 3300027907 Ga0207428_10105532 Ga0207428_101055322 552
654 3300028381 Ga0268264_10079077 Ga0268264_100790772 552
655 3300031852 Ga0307410_10002233 Ga0307410_100022336 552
656 3300049649 Ga0501198_001067 Ga0501198_001067_1166_2833 552
657 3300049663 Ga0501223_000399 Ga0501223_000399_7437_9104 552
658 3300049665 Ga0501227_000931 Ga0501227_000931_1004_2671 552
659 3300049686 Ga0501257_002375 Ga0501257_002375_435_2102 552
660 3300049704 Ga0501221_003830 Ga0501221_003830_606_2270 552
661 3300049705 Ga0501225_0002188 Ga0501225_0002188_2549_4216 552
662 3300049705 Ga0501225_0011682 Ga0501225_0011682_290_1954 552
663 3300050507 nmdc:mga05p37_19426_c1 nmdc:mga05p37_19426_c1_2544_4202 552
664 3300054114 Ga0501084_0109808 Ga0501084_0109808_77_1753 552
665 3300000532 CNAas_1000265 CNAas_10002651 553
666 3300002459 JGI24751J29686_10000044 JGI24751J29686_1000004436 553
667 3300003203 JGI25406J46586_10001956 JGI25406J46586_100019563 553
668 3300005288 Ga0065714_10064531 Ga0065714_1006453131 553
669 3300005290 Ga0065712_10000123 Ga0065712_100001236 553
670 3300005293 Ga0065715_10013050 Ga0065715_100130502 553
671 3300005330 Ga0070690_100002314 Ga0070690_1000023147 553
672 3300005331 Ga0070670_100000144 Ga0070670_10000014430 553
673 3300005334 Ga0068869_100034758 Ga0068869_1000347582 553
674 3300005334 Ga0068869_100038074 Ga0068869_1000380741 553
675 3300005338 Ga0068868_100089034 Ga0068868_1000890343 553
676 3300005340 Ga0070689_100092455 Ga0070689_1000924552 553
677 3300005343 Ga0070687_100061094 Ga0070687_1000610941 553
678 3300005353 Ga0070669_100000609 Ga0070669_10000060928 553
679 3300005353 Ga0070669_100068143 Ga0070669_1000681431 553
680 3300005353 Ga0070669_100093359 Ga0070669_1000933592 553
681 3300005354 Ga0070675_100071206 Ga0070675_1000712062 553
682 3300005355 Ga0070671_100082869 Ga0070671_1000828692 553
683 3300005406 Ga0070703_10000254 Ga0070703_1000025415 553
684 3300005438 Ga0070701_10039425 Ga0070701_100394252 553
685 3300005440 Ga0070705_100000012 Ga0070705_10000001297 553
686 3300005441 Ga0070700_100000062 Ga0070700_1000000629 553
687 3300005458 Ga0070681_10000078 Ga0070681_1000007811 553
688 3300005467 Ga0070706_100001373 Ga0070706_10000137315 553
689 3300005471 Ga0070698_100013194 Ga0070698_1000131946 553
690 3300005471 Ga0070698_100025017 Ga0070698_1000250175 553
691 3300005518 Ga0070699_100002577 Ga0070699_10000257718 553
692 3300005518 Ga0070699_100005594 Ga0070699_1000055948 553
693 3300005518 Ga0070699_100078904 Ga0070699_1000789042 553
694 3300005530 Ga0070679_100000047 Ga0070679_10000004735 553
695 3300005536 Ga0070697_100088995 Ga0070697_1000889952 553
696 3300005547 Ga0070693_100000269 Ga0070693_1000002693 553
697 3300005617 Ga0068859_100006736 Ga0068859_1000067364 553
698 3300005617 Ga0068859_100094120 Ga0068859_1000941202 553
699 3300005618 Ga0068864_100032457 Ga0068864_1000324573 553
700 3300005841 Ga0068863_100052347 Ga0068863_1000523473 553
701 3300005842 Ga0068858_100025848 Ga0068858_1000258483 553
702 3300005843 Ga0068860_100035238 Ga0068860_1000352383 553
703 3300005844 Ga0068862_100016781 Ga0068862_1000167815 553
704 3300005844 Ga0068862_100050130 Ga0068862_1000501302 553
705 3300005985 Ga0081539_10000422 Ga0081539_1000042254 553
706 3300005985 Ga0081539_10004930 Ga0081539_1000493017 553
707 3300006237 Ga0097621_100028387 Ga0097621_1000283873 553
708 3300006358 Ga0068871_100054453 Ga0068871_1000544532 553
709 3300006871 Ga0075434_100020847 Ga0075434_1000208477 553
710 3300006931 Ga0097620_100006736 Ga0097620_1000067369 553
711 3300006931 Ga0097620_100094117 Ga0097620_1000941172 553
712 3300007076 Ga0075435_100019697 Ga0075435_1000196974 553
713 3300009148 Ga0105243_10080565 Ga0105243_100805652 553
714 3300009148 Ga0105243_10110704 Ga0105243_101107042 553
715 3300009174 Ga0105241_10111337 Ga0105241_101113371 553
716 3300009177 Ga0105248_10000861 Ga0105248_100008618 553
717 3300009177 Ga0105248_10051156 Ga0105248_100511563 553
718 3300009551 Ga0105238_10001253 Ga0105238_1000125320 553
719 3300009553 Ga0105249_10016430 Ga0105249_100164307 553
720 3300010375 Ga0105239_10030456 Ga0105239_100304563 553
721 3300010375 Ga0105239_10209090 Ga0105239_102090902 553
722 3300013296 Ga0157374_10112293 Ga0157374_101122931 553
723 3300013306 Ga0163162_10006291 Ga0163162_1000629110 553
724 3300013306 Ga0163162_10033540 Ga0163162_100335402 553
725 3300013307 Ga0157372_10233711 Ga0157372_102337112 553
726 3300014325 Ga0163163_10001085 Ga0163163_1000108519 553
727 3300014325 Ga0163163_10001208 Ga0163163_1000120814 553
728 3300014325 Ga0163163_10006946 Ga0163163_100069465 553
729 3300014325 Ga0163163_10198180 Ga0163163_101981801 553
730 3300014968 Ga0157379_10137220 Ga0157379_101372202 553
731 3300014969 Ga0157376_10077076 Ga0157376_100770763 553
732 3300017792 Ga0163161_10035876 Ga0163161_100358762 553
733 3300025910 Ga0207684_10001424 Ga0207684_1000142410 553
734 3300025910 Ga0207684_10014100 Ga0207684_100141006 553
735 3300025912 Ga0207707_10000006 Ga0207707_10000006279 553
736 3300025916 Ga0207663_10000003 Ga0207663_10000003346 553
737 3300025918 Ga0207662_10046356 Ga0207662_100463561 553
738 3300025921 Ga0207652_10001029 Ga0207652_1000102925 553
739 3300025923 Ga0207681_10001077 Ga0207681_1000107715 553
740 3300025923 Ga0207681_10054985 Ga0207681_100549852 553
741 3300025925 Ga0207650_10000047 Ga0207650_1000004780 553
742 3300025925 Ga0207650_10000542 Ga0207650_1000054210 553
743 3300025931 Ga0207644_10014449 Ga0207644_100144492 553
744 3300025940 Ga0207691_10004303 Ga0207691_1000430310 553
745 3300025941 Ga0207711_10036305 Ga0207711_100363053 553
746 3300025942 Ga0207689_10020503 Ga0207689_100205033 553
747 3300025942 Ga0207689_10147406 Ga0207689_101474061 553
748 3300026035 Ga0207703_10043102 Ga0207703_100431021 553
749 3300026075 Ga0207708_10000246 Ga0207708_100002469 553
750 3300026075 Ga0207708_10059437 Ga0207708_100594372 553
751 3300026088 Ga0207641_10060297 Ga0207641_100602972 553
752 3300026089 Ga0207648_10009860 Ga0207648_100098602 553
753 3300026095 Ga0207676_10030712 Ga0207676_100307122 553
754 3300026095 Ga0207676_10141139 Ga0207676_101411391 553
755 3300026116 Ga0207674_10012633 Ga0207674_100126332 553
756 3300026118 Ga0207675_100004692 Ga0207675_1000046929 553
757 3300026118 Ga0207675_100006123 Ga0207675_1000061232 553
758 3300026121 Ga0207683_10092724 Ga0207683_100927242 553
759 3300026142 Ga0207698_10154543 Ga0207698_101545431 553
760 3300028380 Ga0268265_10133339 Ga0268265_101333391 553
761 3300031852 Ga0307410_10063431 Ga0307410_100634312 553
762 3300049661 Ga0501217_007428 Ga0501217_007428_503_2173 553
763 3300050514 nmdc:mga08x19_10_c1 nmdc:mga08x19_10_c1_188873_190573 553
764 3300050515 nmdc:mga0a205_200926_c1 nmdc:mga0a205_200926_c1_101_1777 553
765 3300050515 nmdc:mga0a205_33639_c1 nmdc:mga0a205_33639_c1_3089_4750 553

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03571

Peptidase_M49

Peptidase family M49

189

451

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eom-assembly1.cif.gz_A structure of dpp iii from caldithrix abyssi 0.9679 31 551
6eom-assembly1.cif.gz_A structure of dpp iii from caldithrix abyssi 0.9552 31 551
5zum-assembly1.cif.gz_B structure of dipeptidyl-peptidase iii from corallococcus sp. strain egb 0.9218 28 552
5zum-assembly1.cif.gz_B structure of dipeptidyl-peptidase iii from corallococcus sp. strain egb 0.8974 28 552
5na8-assembly1.cif.gz_A structure of dpp iii from bacteroides thetaiotaomicron in closed form 0.8681 39 546
ID Description Score Start End Superfamily
af_A0A1D6QCD2_379_579_3.30.540.30 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1; 0.8382 148 349 3.30.540.30
af_A0A1D6QCD2_379_579_3.30.540.30 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1; 0.8261 148 349 3.30.540.30
af_A0A1D8PQB4_223_346_3.30.540.30 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1; 0.7451 163 269 3.30.540.30
5e2qA02 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1; 0.6934 145 348 3.30.540.30
5e2qA02 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1; 0.6777 145 348 3.30.540.30
ID Description Score Start End GO Terms
AF-A0A3D0QES0-F1-model_v4 Zn-dependent hydrolase 0.9939 164 551 GO:0005737
GO:0008239
GO:0046872
AF-A0A0L9VIV3-F1-model_v4 Fis family transcriptional regulator 0.9932 403 538 GO:0005737
GO:0008239
GO:0046872
AF-A0A2W0B6R4-F1-model_v4 Uncharacterized protein 0.9906 136 236 GO:0005737
GO:0008239
GO:0046872
AF-A0A3N5LL21-F1-model_v4 Uncharacterized protein 0.9902 442 549 GO:0005737
GO:0008239
GO:0046872
AF-A0A7C7XE90-F1-model_v4 Peptidase 0.9889 250 552 GO:0005737
GO:0008239
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.03 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map