F479804
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 765 | 338 | 737 | 563 |
Family's Representative Sequence
| Representative Sequence | 3300049459|Ga0495678_000316|Ga0495678_000316_26157_28010 |
| Length | 617 |
| Sequence | MFINAKAEWELRGTMIEQKLGRTGLQSQDHNHSIRDTMKTLLLPLALAVLGAIAPAAQALDTAAHAAGPATVAELNAMAKRFAPVDLTADTGKLSKGDRVAIAKLIEAAKIVDTLQLRQRWSGNEALWAALQKDTTPLGKARRDYFWINKGPWSVLDGNRSFMPASFGGLAIPAEKPLGANFYPEGAIKQELETWMNSLSAKDKEQAQWFFTVIKRTKDGKGAQQFTSVNYSDEYAAELQQLSKLLKEAANATDNASLKKFLNLRADAFLSNDYLASDFAWMDLDSPVDVTIGPYETYNDELFGYKAAFEAYVNVRDAKETEKLNFFGKHMQELENNLPIDPKYRNPKVGAIAPMVVVNQVYGAGDGNMGVQTAAYNLPNDERIISKRGSKRVMLKNVQEAKFAATLQPITKLVLRPADQKDLDFDSFFTHILAHEIMHGLGPHATTQNGKPSTPRQDLKDAYSTIEEAKADVTGLWALGYMMDKGQLKSSLGQGVEAERKLYNTFLASAFRTLHFGLTDSHARGMAIQVNYLLDKGGFVSHGDGTFSVDFKKIKAAVADLDREFLTIEATGDYARAQALMKQYVVIRPDVQKALDKMKAVPNDIRPAFVTAAKLTK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 2 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 3 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 4 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 5 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 6 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 7 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 8 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 9 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 10 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 11 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 12 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 13 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 14 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 15 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 16 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 17 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 18 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 19 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 20 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 21 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 22 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 23 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 24 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 25 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 26 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 27 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 28 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 29 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 30 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 31 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 32 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 33 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 34 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 35 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 36 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 37 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 38 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 39 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 48 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 50 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 55 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 210 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 211 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 212 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 213 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 214 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 215 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 216 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 296 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 297 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 300 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 301 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 302 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 303 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 304 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 305 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 306 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 307 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 314 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 315 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 318 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 319 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 320 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 321 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 327 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 334 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 336 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.21 |
| Metatranscriptomes | 0.13 |
| Isolates | 3.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.63 |
| Nodule | 0.26 |
| Rhizoplane | 2.22 |
| Rhizosphere | 83.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1000265 | 3300000532 | Bacteria | 5011 |
| 2 | JGI24751J29686_10000044 | 3300002459 | Bacteria | 77576 |
| 3 | JGI25154J39366_1002264 | 3300002738 | Bacteria | 5236 |
| 4 | JGI25152J39213_1000217 | 3300002773 | Bacteria | 39039 |
| 5 | JGI25150J39212_1001645 | 3300002774 | Bacteria | 6071 |
| 6 | JGI25159J45721_1004474 | 3300002987 | Bacteria | 4630 |
| 7 | JGI25406J46586_10001956 | 3300003203 | Bacteria | 9737 |
| 8 | JGI25153J46596_10003209 | 3300003215 | Bacteria | 9189 |
| 9 | JGI25160J50197_1005010 | 3300003354 | Bacteria | 5606 |
| 10 | JGI25161J50226_1006659 | 3300003374 | Bacteria | 2058 |
| 11 | Ga0032354_1086905 | 3300003693 | Bacteria | 2781 |
| 12 | Ga0055525_1000009 | 3300003759 | Bacteria | 596899 |
| 13 | Ga0055526_1000161 | 3300003771 | Bacteria | 59705 |
| 14 | Ga0055526_1000309 | 3300003771 | Bacteria | 40758 |
| 15 | Ga0055526_1001981 | 3300003771 | Bacteria | 14122 |
| 16 | Ga0055526_1007917 | 3300003771 | Bacteria | 5409 |
| 17 | Ga0055526_1008551 | 3300003771 | Bacteria | 5080 |
| 18 | Ga0055537_1000035 | 3300003773 | Bacteria | 96274 |
| 19 | Ga0055537_1003987 | 3300003773 | Bacteria | 4357 |
| 20 | Ga0055524_1000015 | 3300003775 | Bacteria | 246493 |
| 21 | Ga0055524_1000615 | 3300003775 | Bacteria | 25550 |
| 22 | Ga0055524_1001052 | 3300003775 | Bacteria | 17032 |
| 23 | Ga0055524_1001567 | 3300003775 | Bacteria | 12852 |
| 24 | Ga0055524_1002035 | 3300003775 | Bacteria | 10762 |
| 25 | Ga0055534_1000843 | 3300003784 | Bacteria | 14132 |
| 26 | Ga0055534_1002519 | 3300003784 | Bacteria | 6290 |
| 27 | Ga0055528_1000058 | 3300003790 | Bacteria | 88086 |
| 28 | Ga0055530_10001617 | 3300003791 | Bacteria | 16165 |
| 29 | Ga0055530_10004677 | 3300003791 | Bacteria | 6944 |
| 30 | Ga0055530_10005605 | 3300003791 | Bacteria | 5895 |
| 31 | Ga0055531_10003927 | 3300003794 | Bacteria | 9251 |
| 32 | Ga0065165_1000224 | 3300005262 | Bacteria | 99359 |
| 33 | Ga0065165_1000286 | 3300005262 | Bacteria | 85993 |
| 34 | Ga0065714_10064531 | 3300005288 | Bacteria | 40961 |
| 35 | Ga0065712_10000123 | 3300005290 | Bacteria | 89338 |
| 36 | Ga0065715_10013050 | 3300005293 | Bacteria | 2217 |
| 37 | Ga0070658_10097302 | 3300005327 | Bacteria | 2430 |
| 38 | Ga0070690_100001410 | 3300005330 | Bacteria | 12551 |
| 39 | Ga0070690_100002314 | 3300005330 | Bacteria | 10225 |
| 40 | Ga0070670_100000144 | 3300005331 | Bacteria | 66583 |
| 41 | Ga0068869_100034319 | 3300005334 | Bacteria | 3588 |
| 42 | Ga0068869_100034758 | 3300005334 | Bacteria | 3568 |
| 43 | Ga0068869_100038074 | 3300005334 | Bacteria | 3424 |
| 44 | Ga0070682_100001655 | 3300005337 | Bacteria | 12393 |
| 45 | Ga0070682_100020846 | 3300005337 | Bacteria | 3862 |
| 46 | Ga0068868_100089034 | 3300005338 | Bacteria | 2485 |
| 47 | Ga0070689_100012356 | 3300005340 | Bacteria | 6150 |
| 48 | Ga0070689_100092455 | 3300005340 | Bacteria | 2386 |
| 49 | Ga0070687_100061094 | 3300005343 | Bacteria | 1991 |
| 50 | Ga0070692_10023322 | 3300005345 | Bacteria | 3032 |
| 51 | Ga0070669_100000609 | 3300005353 | Bacteria | 26606 |
| 52 | Ga0070669_100068143 | 3300005353 | Unclassified | 2626 |
| 53 | Ga0070669_100093359 | 3300005353 | Bacteria | 2259 |
| 54 | Ga0070675_100016465 | 3300005354 | Bacteria | 5870 |
| 55 | Ga0070675_100071206 | 3300005354 | Bacteria | 2884 |
| 56 | Ga0070671_100082869 | 3300005355 | Bacteria | 2682 |
| 57 | Ga0070659_100012300 | 3300005366 | Bacteria | 6345 |
| 58 | Ga0070659_100038344 | 3300005366 | Bacteria | 3737 |
| 59 | Ga0070703_10000254 | 3300005406 | Bacteria | 25848 |
| 60 | Ga0070701_10039354 | 3300005438 | Bacteria | 2398 |
| 61 | Ga0070701_10039425 | 3300005438 | Unclassified | 2396 |
| 62 | Ga0070711_100000055 | 3300005439 | Bacteria | 68448 |
| 63 | Ga0070705_100000012 | 3300005440 | Bacteria | 101160 |
| 64 | Ga0070700_100000062 | 3300005441 | Bacteria | 79866 |
| 65 | Ga0070694_100028495 | 3300005444 | Bacteria | 3635 |
| 66 | Ga0070694_100080250 | 3300005444 | Bacteria | 2267 |
| 67 | Ga0070694_100089146 | 3300005444 | Bacteria | 2161 |
| 68 | Ga0070662_100037956 | 3300005457 | Bacteria | 3419 |
| 69 | Ga0070681_10000078 | 3300005458 | Bacteria | 71959 |
| 70 | Ga0070681_10007691 | 3300005458 | Bacteria | 10538 |
| 71 | Ga0070681_10014121 | 3300005458 | Bacteria | 7949 |
| 72 | Ga0070706_100000137 | 3300005467 | Bacteria | 91778 |
| 73 | Ga0070706_100001373 | 3300005467 | Bacteria | 25852 |
| 74 | Ga0070707_100054170 | 3300005468 | Bacteria | 3845 |
| 75 | Ga0070698_100013194 | 3300005471 | Bacteria | 8744 |
| 76 | Ga0070698_100025017 | 3300005471 | Bacteria | 6223 |
| 77 | Ga0070698_100104020 | 3300005471 | Bacteria | 2809 |
| 78 | Ga0070699_100000013 | 3300005518 | Bacteria | 241303 |
| 79 | Ga0070699_100002577 | 3300005518 | Bacteria | 16250 |
| 80 | Ga0070699_100005594 | 3300005518 | Bacteria | 11024 |
| 81 | Ga0070699_100078904 | 3300005518 | Bacteria | 2867 |
| 82 | Ga0070679_100000047 | 3300005530 | Bacteria | 90654 |
| 83 | Ga0070697_100088995 | 3300005536 | Bacteria | 2550 |
| 84 | Ga0070686_100099080 | 3300005544 | Bacteria | 1966 |
| 85 | Ga0070695_100010081 | 3300005545 | Bacteria | 5635 |
| 86 | Ga0070693_100000269 | 3300005547 | Bacteria | 24472 |
| 87 | Ga0070704_100021829 | 3300005549 | Bacteria | 4157 |
| 88 | Ga0068855_100003154 | 3300005563 | Bacteria | 20174 |
| 89 | Ga0070664_100152457 | 3300005564 | Bacteria | 2041 |
| 90 | Ga0068857_100035718 | 3300005577 | Bacteria | 4402 |
| 91 | Ga0068857_100088981 | 3300005577 | Bacteria | 2762 |
| 92 | Ga0068859_100000001 | 3300005617 | Bacteria | 545224 |
| 93 | Ga0068859_100006736 | 3300005617 | Bacteria | 11672 |
| 94 | Ga0068859_100094120 | 3300005617 | Bacteria | 3048 |
| 95 | Ga0068859_100146528 | 3300005617 | Bacteria | 2436 |
| 96 | Ga0068859_100154893 | 3300005617 | Bacteria | 2368 |
| 97 | Ga0068864_100025978 | 3300005618 | Bacteria | 4936 |
| 98 | Ga0068864_100032457 | 3300005618 | Unclassified | 4437 |
| 99 | Ga0068864_100106835 | 3300005618 | Bacteria | 2489 |
| 100 | Ga0068863_100052347 | 3300005841 | Unclassified | 3870 |
| 101 | Ga0068858_100025848 | 3300005842 | Bacteria | 5460 |
| 102 | Ga0068860_100035238 | 3300005843 | Bacteria | 4801 |
| 103 | Ga0068860_100044352 | 3300005843 | Bacteria | 4238 |
| 104 | Ga0068862_100016781 | 3300005844 | Bacteria | 6097 |
| 105 | Ga0068862_100050130 | 3300005844 | Bacteria | 3567 |
| 106 | Ga0081539_10000422 | 3300005985 | Bacteria | 90043 |
| 107 | Ga0081539_10004930 | 3300005985 | Bacteria | 14213 |
| 108 | Ga0081539_10029181 | 3300005985 | Bacteria | 3453 |
| 109 | Ga0075362_10015886 | 3300006177 | Bacteria | 3071 |
| 110 | Ga0097621_100028387 | 3300006237 | Unclassified | 4410 |
| 111 | Ga0097621_100057637 | 3300006237 | Bacteria | 3177 |
| 112 | Ga0097621_100060162 | 3300006237 | Bacteria | 3113 |
| 113 | Ga0097621_100180895 | 3300006237 | Bacteria | 1822 |
| 114 | Ga0068871_100008018 | 3300006358 | Bacteria | 7583 |
| 115 | Ga0068871_100054453 | 3300006358 | Bacteria | 3246 |
| 116 | Ga0075430_100043903 | 3300006846 | Bacteria | 3780 |
| 117 | Ga0075430_100052667 | 3300006846 | Bacteria | 3428 |
| 118 | Ga0075430_100056655 | 3300006846 | Bacteria | 3296 |
| 119 | Ga0075430_100084797 | 3300006846 | Bacteria | 2653 |
| 120 | Ga0075431_100056603 | 3300006847 | Bacteria | 4043 |
| 121 | Ga0075433_10047913 | 3300006852 | Bacteria | 3717 |
| 122 | Ga0075433_10121865 | 3300006852 | Bacteria | 2316 |
| 123 | Ga0075434_100020847 | 3300006871 | Bacteria | 6364 |
| 124 | Ga0075429_100040587 | 3300006880 | Bacteria | 4053 |
| 125 | Ga0075429_100084433 | 3300006880 | Unclassified | 2767 |
| 126 | Ga0075436_100003828 | 3300006914 | Bacteria | 10318 |
| 127 | Ga0097620_100000001 | 3300006931 | Bacteria | 545224 |
| 128 | Ga0097620_100006736 | 3300006931 | Bacteria | 11672 |
| 129 | Ga0097620_100094117 | 3300006931 | Bacteria | 3048 |
| 130 | Ga0097620_100146524 | 3300006931 | Bacteria | 2436 |
| 131 | Ga0097620_100154888 | 3300006931 | Bacteria | 2368 |
| 132 | Ga0099826_10000003 | 3300006948 | Bacteria | 1067817 |
| 133 | Ga0075435_100019697 | 3300007076 | Bacteria | 5158 |
| 134 | Ga0105244_10001968 | 3300009036 | Bacteria | 15915 |
| 135 | Ga0105244_10022293 | 3300009036 | Bacteria | 3487 |
| 136 | Ga0111539_10123413 | 3300009094 | Bacteria | 3035 |
| 137 | Ga0105245_10037375 | 3300009098 | Bacteria | 4316 |
| 138 | Ga0114129_10013656 | 3300009147 | Bacteria | 11571 |
| 139 | Ga0114129_10023985 | 3300009147 | Bacteria | 8645 |
| 140 | Ga0114129_10038360 | 3300009147 | Bacteria | 6759 |
| 141 | Ga0114129_10048897 | 3300009147 | Bacteria | 5944 |
| 142 | Ga0114129_10111378 | 3300009147 | Bacteria | 3777 |
| 143 | Ga0105243_10008155 | 3300009148 | Bacteria | 8043 |
| 144 | Ga0105243_10080565 | 3300009148 | Bacteria | 2656 |
| 145 | Ga0105243_10110704 | 3300009148 | Bacteria | 2297 |
| 146 | Ga0105241_10065793 | 3300009174 | Bacteria | 2802 |
| 147 | Ga0105241_10111337 | 3300009174 | Bacteria | 2192 |
| 148 | Ga0105242_10028444 | 3300009176 | Bacteria | 4451 |
| 149 | Ga0105248_10000861 | 3300009177 | Bacteria | 34162 |
| 150 | Ga0105248_10051156 | 3300009177 | Bacteria | 4636 |
| 151 | Ga0105237_10000903 | 3300009545 | Bacteria | 39910 |
| 152 | Ga0105238_10001253 | 3300009551 | Bacteria | 25546 |
| 153 | Ga0105238_10003887 | 3300009551 | Bacteria | 14828 |
| 154 | Ga0105249_10016430 | 3300009553 | Bacteria | 6567 |
| 155 | Ga0105239_10030456 | 3300010375 | Bacteria | 5933 |
| 156 | Ga0105239_10191758 | 3300010375 | Bacteria | 2287 |
| 157 | Ga0105239_10209090 | 3300010375 | Bacteria | 2187 |
| 158 | Ga0105246_10125201 | 3300011119 | Bacteria | 1911 |
| 159 | Ga0157373_10045612 | 3300013100 | Unclassified | 3128 |
| 160 | Ga0157374_10112293 | 3300013296 | Bacteria | 2622 |
| 161 | Ga0157374_10224282 | 3300013296 | Bacteria | 1845 |
| 162 | Ga0157378_10008171 | 3300013297 | Bacteria | 9131 |
| 163 | Ga0157378_10042915 | 3300013297 | Unclassified | 4015 |
| 164 | Ga0157378_10185587 | 3300013297 | Bacteria | 1959 |
| 165 | Ga0163162_10006291 | 3300013306 | Bacteria | 11500 |
| 166 | Ga0163162_10033540 | 3300013306 | Bacteria | 5102 |
| 167 | Ga0163162_10070910 | 3300013306 | Bacteria | 3537 |
| 168 | Ga0157372_10002676 | 3300013307 | Bacteria | 19281 |
| 169 | Ga0157372_10233711 | 3300013307 | Bacteria | 2132 |
| 170 | Ga0163163_10001085 | 3300014325 | Bacteria | 23094 |
| 171 | Ga0163163_10001208 | 3300014325 | Bacteria | 21839 |
| 172 | Ga0163163_10006946 | 3300014325 | Bacteria | 9946 |
| 173 | Ga0163163_10007804 | 3300014325 | Bacteria | 9460 |
| 174 | Ga0163163_10024980 | 3300014325 | Bacteria | 5691 |
| 175 | Ga0163163_10037271 | 3300014325 | Unclassified | 4729 |
| 176 | Ga0163163_10198180 | 3300014325 | Bacteria | 2056 |
| 177 | Ga0157380_10069130 | 3300014326 | Bacteria | 2849 |
| 178 | Ga0157380_10106074 | 3300014326 | Bacteria | 2350 |
| 179 | Ga0157380_10147727 | 3300014326 | Bacteria | 2028 |
| 180 | Ga0182008_10001646 | 3300014497 | Bacteria | 14758 |
| 181 | Ga0157379_10137220 | 3300014968 | Unclassified | 2204 |
| 182 | Ga0157376_10077076 | 3300014969 | Bacteria | 2851 |
| 183 | Ga0182006_1000014 | 3300015261 | Bacteria | 340159 |
| 184 | Ga0182006_1000268 | 3300015261 | Bacteria | 47147 |
| 185 | Ga0182007_10000096 | 3300015262 | Bacteria | 62363 |
| 186 | Ga0182005_1000014 | 3300015265 | Bacteria | 389763 |
| 187 | Ga0182005_1000018 | 3300015265 | Bacteria | 324307 |
| 188 | Ga0163161_10035876 | 3300017792 | Unclassified | 3550 |
| 189 | Ga0213872_10000002 | 3300021361 | Bacteria | 554092 |
| 190 | Ga0213872_10001473 | 3300021361 | Bacteria | 15262 |
| 191 | Ga0213876_10031836 | 3300021384 | Bacteria | 2782 |
| 192 | Ga0209436_100292 | 3300025208 | Bacteria | 23109 |
| 193 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 194 | Ga0209437_106718 | 3300025233 | Bacteria | 1903 |
| 195 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 196 | Ga0207425_1000428 | 3300025245 | Bacteria | 27931 |
| 197 | Ga0207425_1000474 | 3300025245 | Bacteria | 25484 |
| 198 | Ga0207425_1008411 | 3300025245 | Bacteria | 2644 |
| 199 | Ga0209646_1000028 | 3300025246 | Bacteria | 387986 |
| 200 | Ga0209148_1000741 | 3300025254 | Bacteria | 25277 |
| 201 | Ga0209129_1000093 | 3300025258 | Bacteria | 173163 |
| 202 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 203 | Ga0209565_1001220 | 3300025263 | Bacteria | 12133 |
| 204 | Ga0209455_1000049 | 3300025272 | Bacteria | 374414 |
| 205 | Ga0209673_1000036 | 3300025273 | Bacteria | 323162 |
| 206 | Ga0209130_1000044 | 3300025284 | Bacteria | 241110 |
| 207 | Ga0209130_1000853 | 3300025284 | Bacteria | 25229 |
| 208 | Ga0209130_1006522 | 3300025284 | Bacteria | 3773 |
| 209 | Ga0209675_1000013 | 3300025291 | Bacteria | 448220 |
| 210 | Ga0209025_1014127 | 3300025294 | Bacteria | 4950 |
| 211 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 212 | Ga0209564_1000038 | 3300025295 | Bacteria | 414357 |
| 213 | Ga0209564_1000122 | 3300025295 | Bacteria | 203709 |
| 214 | Ga0209564_1000751 | 3300025295 | Bacteria | 45957 |
| 215 | Ga0209564_1007615 | 3300025295 | Bacteria | 5548 |
| 216 | Ga0209758_1000055 | 3300025297 | Bacteria | 336183 |
| 217 | Ga0209758_1000149 | 3300025297 | Bacteria | 163504 |
| 218 | Ga0209050_1000092 | 3300025298 | Bacteria | 252702 |
| 219 | Ga0209050_1001070 | 3300025298 | Bacteria | 33611 |
| 220 | Ga0209050_1002850 | 3300025298 | Bacteria | 13715 |
| 221 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 222 | Ga0209256_1000106 | 3300025299 | Bacteria | 187258 |
| 223 | Ga0209256_1000586 | 3300025299 | Bacteria | 50850 |
| 224 | Ga0209256_1000879 | 3300025299 | Bacteria | 37144 |
| 225 | Ga0207426_1002992 | 3300025302 | Bacteria | 9840 |
| 226 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 227 | Ga0207655_1021874 | 3300025728 | Bacteria | 3227 |
| 228 | Ga0207653_10000481 | 3300025885 | Bacteria | 15776 |
| 229 | Ga0207653_10003134 | 3300025885 | Bacteria | 5231 |
| 230 | Ga0207647_10003657 | 3300025904 | Bacteria | 11503 |
| 231 | Ga0207645_10055294 | 3300025907 | Bacteria | 2534 |
| 232 | Ga0207643_10003613 | 3300025908 | Bacteria | 8339 |
| 233 | Ga0207705_10051373 | 3300025909 | Bacteria | 2967 |
| 234 | Ga0207684_10000314 | 3300025910 | Bacteria | 68706 |
| 235 | Ga0207684_10001424 | 3300025910 | Bacteria | 25878 |
| 236 | Ga0207684_10014100 | 3300025910 | Bacteria | 6902 |
| 237 | Ga0207654_10011450 | 3300025911 | Bacteria | 4526 |
| 238 | Ga0207707_10000006 | 3300025912 | Bacteria | 374131 |
| 239 | Ga0207707_10006367 | 3300025912 | Bacteria | 10304 |
| 240 | Ga0207707_10024302 | 3300025912 | Bacteria | 5304 |
| 241 | Ga0207695_10008579 | 3300025913 | Bacteria | 12771 |
| 242 | Ga0207671_10004805 | 3300025914 | Bacteria | 12724 |
| 243 | Ga0207663_10000003 | 3300025916 | Bacteria | 458807 |
| 244 | Ga0207662_10046356 | 3300025918 | Unclassified | 2571 |
| 245 | Ga0207657_10004692 | 3300025919 | Bacteria | 14422 |
| 246 | Ga0207652_10001029 | 3300025921 | Bacteria | 25565 |
| 247 | Ga0207681_10001077 | 3300025923 | Bacteria | 17703 |
| 248 | Ga0207681_10010892 | 3300025923 | Bacteria | 5585 |
| 249 | Ga0207681_10054985 | 3300025923 | Unclassified | 2709 |
| 250 | Ga0207694_10000938 | 3300025924 | Bacteria | 25703 |
| 251 | Ga0207650_10000047 | 3300025925 | Bacteria | 175675 |
| 252 | Ga0207650_10000542 | 3300025925 | Bacteria | 30843 |
| 253 | Ga0207659_10009883 | 3300025926 | Bacteria | 5971 |
| 254 | Ga0207644_10014449 | 3300025931 | Bacteria | 5281 |
| 255 | Ga0207706_10042700 | 3300025933 | Bacteria | 4019 |
| 256 | Ga0207686_10005640 | 3300025934 | Bacteria | 6708 |
| 257 | Ga0207709_10006794 | 3300025935 | Bacteria | 6400 |
| 258 | Ga0207709_10008485 | 3300025935 | Bacteria | 5685 |
| 259 | Ga0207670_10007735 | 3300025936 | Bacteria | 6026 |
| 260 | Ga0207691_10004303 | 3300025940 | Bacteria | 13825 |
| 261 | Ga0207691_10044274 | 3300025940 | Bacteria | 4097 |
| 262 | Ga0207711_10036305 | 3300025941 | Bacteria | 4182 |
| 263 | Ga0207711_10042429 | 3300025941 | Bacteria | 3876 |
| 264 | Ga0207711_10055952 | 3300025941 | Unclassified | 3388 |
| 265 | Ga0207689_10012384 | 3300025942 | Bacteria | 7296 |
| 266 | Ga0207689_10020503 | 3300025942 | Bacteria | 5563 |
| 267 | Ga0207689_10147406 | 3300025942 | Bacteria | 1939 |
| 268 | Ga0207651_10067531 | 3300025960 | Bacteria | 2517 |
| 269 | Ga0207712_10003390 | 3300025961 | Bacteria | 10076 |
| 270 | Ga0207703_10043102 | 3300026035 | Bacteria | 3620 |
| 271 | Ga0207703_10062490 | 3300026035 | Bacteria | 3050 |
| 272 | Ga0207703_10081974 | 3300026035 | Bacteria | 2691 |
| 273 | Ga0207639_10033421 | 3300026041 | Bacteria | 3795 |
| 274 | Ga0207708_10000246 | 3300026075 | Bacteria | 42577 |
| 275 | Ga0207708_10036784 | 3300026075 | Bacteria | 3728 |
| 276 | Ga0207708_10059437 | 3300026075 | Bacteria | 2918 |
| 277 | Ga0207702_10015334 | 3300026078 | Bacteria | 6351 |
| 278 | Ga0207641_10060297 | 3300026088 | Unclassified | 3234 |
| 279 | Ga0207648_10009860 | 3300026089 | Bacteria | 9108 |
| 280 | Ga0207648_10081979 | 3300026089 | Bacteria | 2813 |
| 281 | Ga0207676_10030712 | 3300026095 | Unclassified | 4035 |
| 282 | Ga0207676_10091378 | 3300026095 | Bacteria | 2500 |
| 283 | Ga0207676_10141139 | 3300026095 | Bacteria | 2062 |
| 284 | Ga0207676_10183941 | 3300026095 | Bacteria | 1832 |
| 285 | Ga0207674_10001412 | 3300026116 | Bacteria | 31013 |
| 286 | Ga0207674_10012633 | 3300026116 | Bacteria | 9439 |
| 287 | Ga0207674_10118129 | 3300026116 | Bacteria | 2622 |
| 288 | Ga0207675_100004692 | 3300026118 | Bacteria | 13158 |
| 289 | Ga0207675_100006123 | 3300026118 | Bacteria | 11435 |
| 290 | Ga0207675_100007738 | 3300026118 | Bacteria | 10138 |
| 291 | Ga0207683_10092724 | 3300026121 | Bacteria | 2691 |
| 292 | Ga0207698_10154543 | 3300026142 | Bacteria | 1996 |
| 293 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 294 | Ga0207428_10105532 | 3300027907 | Bacteria | 2173 |
| 295 | Ga0268265_10133339 | 3300028380 | Bacteria | 2068 |
| 296 | Ga0268264_10079077 | 3300028381 | Bacteria | 2805 |
| 297 | Ga0307515_10099407 | 3300028794 | Bacteria | 3533 |
| 298 | Ga0307408_100000498 | 3300031548 | Bacteria | 34159 |
| 299 | Ga0307408_100000774 | 3300031548 | Bacteria | 25726 |
| 300 | Ga0307518_10026887 | 3300031838 | Bacteria | 4149 |
| 301 | Ga0307410_10002233 | 3300031852 | Bacteria | 9247 |
| 302 | Ga0307410_10063431 | 3300031852 | Unclassified | 2535 |
| 303 | Ga0307409_100203894 | 3300031995 | Bacteria | 1772 |
| 304 | Ga0307416_100003518 | 3300032002 | Bacteria | 9221 |
| 305 | Ga0307411_10062329 | 3300032005 | Bacteria | 2487 |
| 306 | Ga0373951_0002546 | 3300035091 | Unclassified | 4583 |
| 307 | Ga0395899_0000330 | 3300037312 | Bacteria | 60063 |
| 308 | Ga0395899_0000715 | 3300037312 | Bacteria | 33273 |
| 309 | Ga0395900_0000372 | 3300037418 | Bacteria | 64606 |
| 310 | Ga0395900_0049778 | 3300037418 | Bacteria | 4317 |
| 311 | Ga0395900_0086306 | 3300037418 | Bacteria | 3225 |
| 312 | Ga0395905_0009240 | 3300037471 | Bacteria | 9651 |
| 313 | Ga0395905_0018620 | 3300037471 | Bacteria | 6586 |
| 314 | Ga0395905_0031408 | 3300037471 | Bacteria | 5000 |
| 315 | Ga0395905_0049000 | 3300037471 | Bacteria | 3958 |
| 316 | Ga0395905_0102623 | 3300037471 | Bacteria | 2685 |
| 317 | Ga0395901_0001123 | 3300038443 | Bacteria | 28428 |
| 318 | Ga0395901_0004045 | 3300038443 | Bacteria | 14768 |
| 319 | Ga0395901_0094591 | 3300038443 | Bacteria | 3131 |
| 320 | Ga0436365_1170609 | 3300039437 | Bacteria | 2918 |
| 321 | Ga0436361_0111397 | 3300039447 | Bacteria | 9308 |
| 322 | Ga0436361_0667736 | 3300039447 | Bacteria | 15392 |
| 323 | Ga0436361_0872359 | 3300039447 | Bacteria | 6580 |
| 324 | Ga0436361_0977466 | 3300039447 | Bacteria | 31080 |
| 325 | Ga0439448_0001145 | 3300042005 | Bacteria | 6710 |
| 326 | Ga0439450_002379 | 3300042008 | Bacteria | 2949 |
| 327 | Ga0450904_000130 | 3300042139 | Bacteria | 16713 |
| 328 | Ga0439458_0001237 | 3300042157 | Bacteria | 6453 |
| 329 | Ga0466972_0001600 | 3300044658 | Bacteria | 11067 |
| 330 | Ga0453683_0011548 | 3300044673 | Bacteria | 5818 |
| 331 | Ga0466966_0001121 | 3300044684 | Bacteria | 17200 |
| 332 | Ga0466957_0000545 | 3300044842 | Bacteria | 19030 |
| 333 | Ga0466959_0027945 | 3300045049 | Bacteria | 4183 |
| 334 | Ga0466967_0004194 | 3300045976 | Bacteria | 9658 |
| 335 | Ga0466967_0045615 | 3300045976 | Bacteria | 3809 |
| 336 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 337 | Ga0495617_000147 | 3300046452 | Bacteria | 45169 |
| 338 | Ga0495617_000539 | 3300046452 | Bacteria | 19621 |
| 339 | Ga0495617_012984 | 3300046452 | Bacteria | 2839 |
| 340 | Ga0495627_000006 | 3300046453 | Bacteria | 581750 |
| 341 | Ga0495627_000207 | 3300046453 | Bacteria | 63763 |
| 342 | Ga0495590_0000004 | 3300046457 | Bacteria | 402091 |
| 343 | Ga0495590_0000025 | 3300046457 | Bacteria | 165221 |
| 344 | Ga0495590_0002187 | 3300046457 | Bacteria | 8178 |
| 345 | Ga0495591_000246 | 3300046458 | Bacteria | 52198 |
| 346 | Ga0495629_0024427 | 3300046459 | Bacteria | 4304 |
| 347 | Ga0495638_0000066 | 3300046460 | Bacteria | 168673 |
| 348 | Ga0495638_0001537 | 3300046460 | Bacteria | 20765 |
| 349 | Ga0495638_0003279 | 3300046460 | Bacteria | 12760 |
| 350 | Ga0495638_0025016 | 3300046460 | Bacteria | 3885 |
| 351 | Ga0495653_0000037 | 3300046463 | Bacteria | 120575 |
| 352 | Ga0495653_0007115 | 3300046463 | Bacteria | 9172 |
| 353 | Ga0495653_0010485 | 3300046463 | Bacteria | 7582 |
| 354 | Ga0495650_0000695 | 3300046471 | Bacteria | 43367 |
| 355 | Ga0495650_0000871 | 3300046471 | Bacteria | 35889 |
| 356 | Ga0495650_0000930 | 3300046471 | Bacteria | 34077 |
| 357 | Ga0495650_0001046 | 3300046471 | Bacteria | 30824 |
| 358 | Ga0495650_0001111 | 3300046471 | Bacteria | 29425 |
| 359 | Ga0495582_0036807 | 3300046473 | Bacteria | 2692 |
| 360 | Ga0495582_0038166 | 3300046473 | Bacteria | 2642 |
| 361 | Ga0495605_0000003 | 3300046474 | Bacteria | 491502 |
| 362 | Ga0495605_0000034 | 3300046474 | Bacteria | 208277 |
| 363 | Ga0495605_0000293 | 3300046474 | Bacteria | 55067 |
| 364 | Ga0495605_0003564 | 3300046474 | Bacteria | 9226 |
| 365 | Ga0495605_0020413 | 3300046474 | Bacteria | 3521 |
| 366 | Ga0495605_0022360 | 3300046474 | Bacteria | 3340 |
| 367 | Ga0495605_0025115 | 3300046474 | Bacteria | 3106 |
| 368 | Ga0495605_0028603 | 3300046474 | Bacteria | 2876 |
| 369 | Ga0495605_0034862 | 3300046474 | Bacteria | 2545 |
| 370 | Ga0495605_0036014 | 3300046474 | Bacteria | 2498 |
| 371 | Ga0495639_0014226 | 3300046475 | Bacteria | 3443 |
| 372 | Ga0495584_0000017 | 3300046491 | Bacteria | 149686 |
| 373 | Ga0495584_0000070 | 3300046491 | Bacteria | 73237 |
| 374 | Ga0495584_0000345 | 3300046491 | Bacteria | 32162 |
| 375 | Ga0495584_0000401 | 3300046491 | Bacteria | 29931 |
| 376 | Ga0495584_0001098 | 3300046491 | Bacteria | 16805 |
| 377 | Ga0495584_0002836 | 3300046491 | Bacteria | 9675 |
| 378 | Ga0495584_0002986 | 3300046491 | Bacteria | 9388 |
| 379 | Ga0495584_0005999 | 3300046491 | Bacteria | 6400 |
| 380 | Ga0495584_0009791 | 3300046491 | Bacteria | 4930 |
| 381 | Ga0495584_0017380 | 3300046491 | Bacteria | 3662 |
| 382 | Ga0495585_0000006 | 3300046492 | Bacteria | 320556 |
| 383 | Ga0495585_0000064 | 3300046492 | Bacteria | 109302 |
| 384 | Ga0495585_0000254 | 3300046492 | Bacteria | 54984 |
| 385 | Ga0495585_0000941 | 3300046492 | Bacteria | 24552 |
| 386 | Ga0495585_0001061 | 3300046492 | Bacteria | 22624 |
| 387 | Ga0495585_0002026 | 3300046492 | Bacteria | 15005 |
| 388 | Ga0495585_0003330 | 3300046492 | Bacteria | 10902 |
| 389 | Ga0495585_0009300 | 3300046492 | Bacteria | 5902 |
| 390 | Ga0495585_0026537 | 3300046492 | Bacteria | 3309 |
| 391 | Ga0495585_0058990 | 3300046492 | Bacteria | 2116 |
| 392 | Ga0495594_0029580 | 3300046499 | Bacteria | 2961 |
| 393 | Ga0495596_0000224 | 3300046500 | Bacteria | 38703 |
| 394 | Ga0495596_0000838 | 3300046500 | Bacteria | 18592 |
| 395 | Ga0495596_0001873 | 3300046500 | Bacteria | 11670 |
| 396 | Ga0495596_0002814 | 3300046500 | Bacteria | 9109 |
| 397 | Ga0495596_0003137 | 3300046500 | Bacteria | 8520 |
| 398 | Ga0495596_0006614 | 3300046500 | Bacteria | 5317 |
| 399 | Ga0495596_0010139 | 3300046500 | Bacteria | 4117 |
| 400 | Ga0495607_0000398 | 3300046501 | Bacteria | 44114 |
| 401 | Ga0495607_0002518 | 3300046501 | Bacteria | 14850 |
| 402 | Ga0495607_0004773 | 3300046501 | Bacteria | 9907 |
| 403 | Ga0495607_0005452 | 3300046501 | Bacteria | 9102 |
| 404 | Ga0495607_0005454 | 3300046501 | Bacteria | 9100 |
| 405 | Ga0495607_0016521 | 3300046501 | Bacteria | 4761 |
| 406 | Ga0495583_0000195 | 3300046506 | Bacteria | 101598 |
| 407 | Ga0495583_0000372 | 3300046506 | Bacteria | 69750 |
| 408 | Ga0495583_0000382 | 3300046506 | Bacteria | 68388 |
| 409 | Ga0495583_0000600 | 3300046506 | Bacteria | 48984 |
| 410 | Ga0495583_0000808 | 3300046506 | Bacteria | 38650 |
| 411 | Ga0495583_0003755 | 3300046506 | Bacteria | 11296 |
| 412 | Ga0495583_0005962 | 3300046506 | Bacteria | 8086 |
| 413 | Ga0495583_0007066 | 3300046506 | Bacteria | 7175 |
| 414 | Ga0495583_0040612 | 3300046506 | Bacteria | 2184 |
| 415 | Ga0495583_0043941 | 3300046506 | Bacteria | 2077 |
| 416 | Ga0495606_0000024 | 3300046507 | Bacteria | 262080 |
| 417 | Ga0495606_0000268 | 3300046507 | Bacteria | 91857 |
| 418 | Ga0495606_0001211 | 3300046507 | Bacteria | 36201 |
| 419 | Ga0495606_0001586 | 3300046507 | Bacteria | 29713 |
| 420 | Ga0495606_0004274 | 3300046507 | Bacteria | 14413 |
| 421 | Ga0495606_0004483 | 3300046507 | Bacteria | 13920 |
| 422 | Ga0495606_0011433 | 3300046507 | Bacteria | 7239 |
| 423 | Ga0495606_0025925 | 3300046507 | Bacteria | 4187 |
| 424 | Ga0495606_0027466 | 3300046507 | Bacteria | 4035 |
| 425 | Ga0495606_0036142 | 3300046507 | Bacteria | 3368 |
| 426 | Ga0495606_0037147 | 3300046507 | Bacteria | 3309 |
| 427 | Ga0495610_0000004 | 3300046512 | Bacteria | 1006135 |
| 428 | Ga0495610_0000229 | 3300046512 | Bacteria | 59730 |
| 429 | Ga0495610_0001082 | 3300046512 | Bacteria | 24922 |
| 430 | Ga0495610_0010579 | 3300046512 | Bacteria | 5720 |
| 431 | Ga0495616_0000057 | 3300046513 | Bacteria | 100806 |
| 432 | Ga0495616_0000207 | 3300046513 | Bacteria | 48768 |
| 433 | Ga0495616_0000378 | 3300046513 | Bacteria | 34726 |
| 434 | Ga0495616_0000996 | 3300046513 | Bacteria | 20276 |
| 435 | Ga0495616_0003899 | 3300046513 | Bacteria | 9504 |
| 436 | Ga0495616_0007442 | 3300046513 | Bacteria | 6554 |
| 437 | Ga0495616_0009424 | 3300046513 | Bacteria | 5711 |
| 438 | Ga0495631_0001464 | 3300046518 | Bacteria | 14314 |
| 439 | Ga0495631_0003789 | 3300046518 | Bacteria | 8228 |
| 440 | Ga0495631_0009360 | 3300046518 | Bacteria | 4895 |
| 441 | Ga0495631_0012909 | 3300046518 | Bacteria | 4067 |
| 442 | Ga0495631_0047878 | 3300046518 | Bacteria | 1875 |
| 443 | Ga0495632_0000077 | 3300046519 | Bacteria | 100834 |
| 444 | Ga0495632_0000129 | 3300046519 | Bacteria | 77134 |
| 445 | Ga0495632_0000296 | 3300046519 | Bacteria | 48157 |
| 446 | Ga0495632_0000375 | 3300046519 | Bacteria | 42575 |
| 447 | Ga0495632_0004693 | 3300046519 | Bacteria | 9233 |
| 448 | Ga0495637_0000019 | 3300046520 | Bacteria | 185953 |
| 449 | Ga0495637_0000914 | 3300046520 | Bacteria | 18934 |
| 450 | Ga0495637_0000991 | 3300046520 | Bacteria | 17941 |
| 451 | Ga0495637_0003088 | 3300046520 | Bacteria | 8884 |
| 452 | Ga0495637_0006965 | 3300046520 | Bacteria | 5634 |
| 453 | Ga0495643_0000415 | 3300046522 | Bacteria | 55824 |
| 454 | Ga0495643_0000453 | 3300046522 | Bacteria | 52189 |
| 455 | Ga0495643_0000567 | 3300046522 | Bacteria | 45722 |
| 456 | Ga0495643_0000626 | 3300046522 | Bacteria | 42009 |
| 457 | Ga0495643_0000661 | 3300046522 | Bacteria | 40615 |
| 458 | Ga0495644_0020657 | 3300046523 | Bacteria | 2512 |
| 459 | Ga0495648_0000007 | 3300046524 | Bacteria | 347305 |
| 460 | Ga0495648_0000045 | 3300046524 | Bacteria | 172587 |
| 461 | Ga0495648_0001105 | 3300046524 | Bacteria | 27423 |
| 462 | Ga0495648_0004308 | 3300046524 | Bacteria | 12194 |
| 463 | Ga0495648_0004611 | 3300046524 | Bacteria | 11729 |
| 464 | Ga0495648_0009124 | 3300046524 | Bacteria | 7735 |
| 465 | Ga0495648_0018963 | 3300046524 | Bacteria | 4853 |
| 466 | Ga0495648_0032006 | 3300046524 | Bacteria | 3457 |
| 467 | Ga0495648_0045976 | 3300046524 | Bacteria | 2710 |
| 468 | Ga0495648_0076214 | 3300046524 | Bacteria | 1926 |
| 469 | Ga0495648_0080197 | 3300046524 | Bacteria | 1860 |
| 470 | Ga0495663_0013019 | 3300046525 | Bacteria | 2323 |
| 471 | Ga0495642_0000085 | 3300046528 | Bacteria | 54372 |
| 472 | Ga0495642_0000285 | 3300046528 | Bacteria | 28471 |
| 473 | Ga0495642_0000485 | 3300046528 | Bacteria | 20381 |
| 474 | Ga0495642_0005862 | 3300046528 | Bacteria | 4713 |
| 475 | Ga0495642_0006531 | 3300046528 | Bacteria | 4473 |
| 476 | Ga0495642_0009424 | 3300046528 | Bacteria | 3738 |
| 477 | Ga0495654_0000004 | 3300046530 | Bacteria | 515304 |
| 478 | Ga0495654_0009140 | 3300046530 | Bacteria | 5435 |
| 479 | Ga0495654_0038101 | 3300046530 | Bacteria | 2406 |
| 480 | Ga0495665_0004421 | 3300046531 | Bacteria | 7590 |
| 481 | Ga0495665_0026182 | 3300046531 | Bacteria | 3133 |
| 482 | Ga0495665_0047463 | 3300046531 | Bacteria | 2278 |
| 483 | Ga0495586_0012766 | 3300046535 | Bacteria | 4452 |
| 484 | Ga0495586_0026284 | 3300046535 | Bacteria | 3114 |
| 485 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 486 | Ga0495609_0000910 | 3300046538 | Bacteria | 21411 |
| 487 | Ga0495609_0001921 | 3300046538 | Bacteria | 13230 |
| 488 | Ga0495609_0001963 | 3300046538 | Bacteria | 13048 |
| 489 | Ga0495609_0005513 | 3300046538 | Bacteria | 6618 |
| 490 | Ga0495609_0010671 | 3300046538 | Bacteria | 4397 |
| 491 | Ga0495609_0017017 | 3300046538 | Bacteria | 3382 |
| 492 | Ga0495597_0000226 | 3300046542 | Bacteria | 51108 |
| 493 | Ga0495597_0000409 | 3300046542 | Bacteria | 37065 |
| 494 | Ga0495597_0000812 | 3300046542 | Bacteria | 24678 |
| 495 | Ga0495597_0000957 | 3300046542 | Bacteria | 22305 |
| 496 | Ga0495597_0000958 | 3300046542 | Bacteria | 22301 |
| 497 | Ga0495597_0001519 | 3300046542 | Bacteria | 16517 |
| 498 | Ga0495597_0005958 | 3300046542 | Bacteria | 6360 |
| 499 | Ga0495597_0009351 | 3300046542 | Bacteria | 4847 |
| 500 | Ga0495597_0010112 | 3300046542 | Bacteria | 4624 |
| 501 | Ga0495597_0017371 | 3300046542 | Bacteria | 3387 |
| 502 | Ga0495597_0050618 | 3300046542 | Bacteria | 1833 |
| 503 | Ga0495622_0000064 | 3300046557 | Bacteria | 93789 |
| 504 | Ga0495633_0000401 | 3300046558 | Bacteria | 45374 |
| 505 | Ga0495633_0000527 | 3300046558 | Bacteria | 38323 |
| 506 | Ga0495633_0000815 | 3300046558 | Bacteria | 27611 |
| 507 | Ga0495633_0001332 | 3300046558 | Bacteria | 19368 |
| 508 | Ga0495633_0002100 | 3300046558 | Bacteria | 14322 |
| 509 | Ga0495633_0002968 | 3300046558 | Bacteria | 11604 |
| 510 | Ga0495633_0012539 | 3300046558 | Bacteria | 4502 |
| 511 | Ga0495633_0016211 | 3300046558 | Bacteria | 3849 |
| 512 | Ga0495633_0016762 | 3300046558 | Bacteria | 3767 |
| 513 | Ga0495668_0000025 | 3300046616 | Bacteria | 304546 |
| 514 | Ga0495668_0000126 | 3300046616 | Bacteria | 114185 |
| 515 | Ga0495668_0000274 | 3300046616 | Bacteria | 72330 |
| 516 | Ga0495668_0000544 | 3300046616 | Bacteria | 46835 |
| 517 | Ga0495668_0000941 | 3300046616 | Bacteria | 32463 |
| 518 | Ga0495668_0001238 | 3300046616 | Bacteria | 25633 |
| 519 | Ga0495668_0001842 | 3300046616 | Bacteria | 19110 |
| 520 | Ga0495668_0002219 | 3300046616 | Bacteria | 16499 |
| 521 | Ga0495668_0020953 | 3300046616 | Bacteria | 3755 |
| 522 | Ga0495634_0027471 | 3300046642 | Bacteria | 3958 |
| 523 | Ga0495611_0000195 | 3300046648 | Bacteria | 42925 |
| 524 | Ga0495611_0000773 | 3300046648 | Bacteria | 17861 |
| 525 | Ga0495611_0001877 | 3300046648 | Bacteria | 10006 |
| 526 | Ga0495611_0002974 | 3300046648 | Bacteria | 7559 |
| 527 | Ga0495611_0007350 | 3300046648 | Bacteria | 4676 |
| 528 | Ga0495611_0020067 | 3300046648 | Bacteria | 2874 |
| 529 | Ga0495625_0000850 | 3300046660 | Bacteria | 41673 |
| 530 | Ga0495625_0002274 | 3300046660 | Bacteria | 21098 |
| 531 | Ga0495625_0006331 | 3300046660 | Bacteria | 10577 |
| 532 | Ga0495625_0013621 | 3300046660 | Bacteria | 6525 |
| 533 | Ga0495625_0018164 | 3300046660 | Bacteria | 5497 |
| 534 | Ga0495625_0022531 | 3300046660 | Bacteria | 4829 |
| 535 | Ga0495625_0044881 | 3300046660 | Bacteria | 3198 |
| 536 | Ga0495625_0078564 | 3300046660 | Bacteria | 2303 |
| 537 | Ga0495635_0002840 | 3300046663 | Bacteria | 11897 |
| 538 | Ga0495659_0000124 | 3300046664 | Bacteria | 33876 |
| 539 | Ga0495659_0012157 | 3300046664 | Bacteria | 2783 |
| 540 | Ga0495661_0000281 | 3300046665 | Bacteria | 57922 |
| 541 | Ga0495661_0000980 | 3300046665 | Bacteria | 25764 |
| 542 | Ga0495661_0001170 | 3300046665 | Bacteria | 22890 |
| 543 | Ga0495661_0002244 | 3300046665 | Bacteria | 14973 |
| 544 | Ga0495661_0002737 | 3300046665 | Bacteria | 13416 |
| 545 | Ga0495661_0011882 | 3300046665 | Bacteria | 5897 |
| 546 | Ga0495661_0033230 | 3300046665 | Bacteria | 3255 |
| 547 | Ga0495661_0037848 | 3300046665 | Bacteria | 3009 |
| 548 | Ga0495588_0000177 | 3300046674 | Bacteria | 78598 |
| 549 | Ga0495588_0019032 | 3300046674 | Bacteria | 3358 |
| 550 | Ga0495588_0035646 | 3300046674 | Bacteria | 2522 |
| 551 | Ga0495669_0000092 | 3300046684 | Bacteria | 59765 |
| 552 | Ga0495669_0000502 | 3300046684 | Bacteria | 17877 |
| 553 | Ga0495669_0001901 | 3300046684 | Bacteria | 8561 |
| 554 | Ga0495669_0002014 | 3300046684 | Bacteria | 8331 |
| 555 | Ga0495669_0004319 | 3300046684 | Bacteria | 5865 |
| 556 | Ga0495670_0000157 | 3300046691 | Bacteria | 29533 |
| 557 | Ga0495670_0000312 | 3300046691 | Bacteria | 23108 |
| 558 | Ga0495670_0001319 | 3300046691 | Bacteria | 12093 |
| 559 | Ga0495670_0001945 | 3300046691 | Bacteria | 10176 |
| 560 | Ga0495670_0018547 | 3300046691 | Bacteria | 3425 |
| 561 | Ga0495670_0037095 | 3300046691 | Bacteria | 2429 |
| 562 | Ga0495670_0061925 | 3300046691 | Bacteria | 1881 |
| 563 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 564 | Ga0495671_0000575 | 3300046692 | Bacteria | 27425 |
| 565 | Ga0495671_0000965 | 3300046692 | Bacteria | 20129 |
| 566 | Ga0495671_0003679 | 3300046692 | Bacteria | 9336 |
| 567 | Ga0495671_0025379 | 3300046692 | Bacteria | 3081 |
| 568 | Ga0495671_0044534 | 3300046692 | Bacteria | 2224 |
| 569 | Ga0495671_0055826 | 3300046692 | Bacteria | 1956 |
| 570 | Ga0495649_0000277 | 3300046694 | Bacteria | 45216 |
| 571 | Ga0495649_0007938 | 3300046694 | Bacteria | 6419 |
| 572 | Ga0495649_0015329 | 3300046694 | Bacteria | 4364 |
| 573 | Ga0495649_0049528 | 3300046694 | Bacteria | 2282 |
| 574 | Ga0495589_0000230 | 3300046794 | Bacteria | 47199 |
| 575 | Ga0495589_0000535 | 3300046794 | Bacteria | 26576 |
| 576 | Ga0495589_0001364 | 3300046794 | Bacteria | 14251 |
| 577 | Ga0495589_0022217 | 3300046794 | Bacteria | 3239 |
| 578 | Ga0495589_0035253 | 3300046794 | Bacteria | 2509 |
| 579 | Ga0495589_0035755 | 3300046794 | Bacteria | 2490 |
| 580 | Ga0495589_0044531 | 3300046794 | Bacteria | 2207 |
| 581 | Ga0495660_0000026 | 3300046810 | Bacteria | 256223 |
| 582 | Ga0495660_0002729 | 3300046810 | Bacteria | 11142 |
| 583 | Ga0495660_0002963 | 3300046810 | Bacteria | 10613 |
| 584 | Ga0495660_0004933 | 3300046810 | Bacteria | 8039 |
| 585 | Ga0495660_0011889 | 3300046810 | Bacteria | 5050 |
| 586 | Ga0495660_0016405 | 3300046810 | Bacteria | 4271 |
| 587 | Ga0495581_0007297 | 3300047315 | Bacteria | 6396 |
| 588 | Ga0495604_0029462 | 3300047317 | Bacteria | 4367 |
| 589 | Ga0495604_0058512 | 3300047317 | Bacteria | 2959 |
| 590 | Ga0495636_0005231 | 3300047318 | Bacteria | 5092 |
| 591 | Ga0495636_0005273 | 3300047318 | Bacteria | 5074 |
| 592 | Ga0495636_0012438 | 3300047318 | Bacteria | 3369 |
| 593 | Ga0495672_0000041 | 3300047320 | Bacteria | 267545 |
| 594 | Ga0495672_0000045 | 3300047320 | Bacteria | 255145 |
| 595 | Ga0495672_0000505 | 3300047320 | Bacteria | 45047 |
| 596 | Ga0495672_0000748 | 3300047320 | Bacteria | 35552 |
| 597 | Ga0495672_0001178 | 3300047320 | Bacteria | 26523 |
| 598 | Ga0495672_0003428 | 3300047320 | Bacteria | 13591 |
| 599 | Ga0495672_0013058 | 3300047320 | Bacteria | 5748 |
| 600 | Ga0495672_0017777 | 3300047320 | Bacteria | 4745 |
| 601 | Ga0495676_0000309 | 3300047321 | Bacteria | 39532 |
| 602 | Ga0495676_0002463 | 3300047321 | Bacteria | 16453 |
| 603 | Ga0495676_0042180 | 3300047321 | Bacteria | 3748 |
| 604 | Ga0495680_0054663 | 3300047322 | Bacteria | 3099 |
| 605 | Ga0495683_0000179 | 3300047323 | Bacteria | 62241 |
| 606 | Ga0495683_0000763 | 3300047323 | Bacteria | 23208 |
| 607 | Ga0495683_0006600 | 3300047323 | Bacteria | 6327 |
| 608 | Ga0495683_0009925 | 3300047323 | Bacteria | 5056 |
| 609 | Ga0495687_000013 | 3300047443 | Bacteria | 371058 |
| 610 | Ga0495687_000127 | 3300047443 | Bacteria | 117520 |
| 611 | Ga0495687_000143 | 3300047443 | Bacteria | 108306 |
| 612 | Ga0495687_000280 | 3300047443 | Bacteria | 67023 |
| 613 | Ga0495687_001126 | 3300047443 | Bacteria | 25966 |
| 614 | Ga0495687_001213 | 3300047443 | Bacteria | 24676 |
| 615 | Ga0495687_001550 | 3300047443 | Bacteria | 20895 |
| 616 | Ga0495675_0038544 | 3300047444 | Bacteria | 3043 |
| 617 | Ga0495677_0000041 | 3300047445 | Bacteria | 75366 |
| 618 | Ga0495677_0000104 | 3300047445 | Bacteria | 41829 |
| 619 | Ga0495677_0000210 | 3300047445 | Bacteria | 26828 |
| 620 | Ga0495677_0001887 | 3300047445 | Bacteria | 8373 |
| 621 | Ga0495677_0005929 | 3300047445 | Bacteria | 4628 |
| 622 | Ga0495679_001712 | 3300047446 | Bacteria | 12130 |
| 623 | Ga0495679_002516 | 3300047446 | Bacteria | 9255 |
| 624 | Ga0495685_001298 | 3300047447 | Bacteria | 7619 |
| 625 | Ga0495685_030530 | 3300047447 | Bacteria | 1853 |
| 626 | Ga0495673_0000006 | 3300047469 | Bacteria | 908691 |
| 627 | Ga0495673_0000014 | 3300047469 | Bacteria | 599202 |
| 628 | Ga0495673_0000017 | 3300047469 | Bacteria | 574970 |
| 629 | Ga0495673_0017040 | 3300047469 | Bacteria | 3699 |
| 630 | Ga0495681_0000667 | 3300047470 | Bacteria | 26095 |
| 631 | Ga0495681_0000815 | 3300047470 | Bacteria | 23974 |
| 632 | Ga0495681_0010372 | 3300047470 | Bacteria | 5640 |
| 633 | Ga0495681_0017512 | 3300047470 | Bacteria | 3974 |
| 634 | Ga0495681_0022331 | 3300047470 | Bacteria | 3389 |
| 635 | Ga0495686_0000656 | 3300047472 | Bacteria | 47216 |
| 636 | Ga0495686_0000732 | 3300047472 | Bacteria | 43872 |
| 637 | Ga0495686_0022414 | 3300047472 | Bacteria | 4180 |
| 638 | Ga0495593_0023123 | 3300047673 | Bacteria | 3457 |
| 639 | Ga0495602_0005903 | 3300048088 | Bacteria | 12859 |
| 640 | Ga0495614_0005144 | 3300048089 | Bacteria | 5903 |
| 641 | Ga0495626_0000383 | 3300048091 | Bacteria | 45903 |
| 642 | Ga0495626_0001009 | 3300048091 | Bacteria | 24183 |
| 643 | Ga0495626_0001865 | 3300048091 | Bacteria | 15814 |
| 644 | Ga0495626_0002453 | 3300048091 | Bacteria | 12850 |
| 645 | Ga0495626_0006233 | 3300048091 | Bacteria | 6812 |
| 646 | Ga0495626_0008221 | 3300048091 | Bacteria | 5745 |
| 647 | Ga0495626_0009080 | 3300048091 | Bacteria | 5393 |
| 648 | Ga0495626_0013526 | 3300048091 | Bacteria | 4238 |
| 649 | Ga0495626_0042634 | 3300048091 | Bacteria | 2131 |
| 650 | Ga0495626_0043083 | 3300048091 | Bacteria | 2118 |
| 651 | Ga0495626_0049584 | 3300048091 | Bacteria | 1943 |
| 652 | Ga0495626_0052809 | 3300048091 | Bacteria | 1872 |
| 653 | Ga0496100_0082565 | 3300048903 | Bacteria | 2173 |
| 654 | Ga0496102_0000454 | 3300048905 | Bacteria | 46487 |
| 655 | Ga0496102_0000931 | 3300048905 | Bacteria | 27579 |
| 656 | Ga0496102_0022302 | 3300048905 | Bacteria | 5610 |
| 657 | Ga0496103_0007341 | 3300048906 | Bacteria | 6569 |
| 658 | Ga0496103_0026176 | 3300048906 | Bacteria | 3531 |
| 659 | Ga0496104_0075039 | 3300048907 | Bacteria | 3220 |
| 660 | Ga0496105_0168157 | 3300048908 | Bacteria | 1798 |
| 661 | Ga0496106_0011144 | 3300048909 | Bacteria | 6651 |
| 662 | Ga0496110_0000068 | 3300048913 | Bacteria | 51803 |
| 663 | Ga0496110_0051568 | 3300048913 | Bacteria | 3615 |
| 664 | Ga0496111_0025612 | 3300048914 | Bacteria | 4163 |
| 665 | Ga0496112_0099876 | 3300048915 | Bacteria | 2872 |
| 666 | Ga0496112_0229064 | 3300048915 | Bacteria | 1813 |
| 667 | Ga0496113_0029183 | 3300048916 | Bacteria | 3979 |
| 668 | Ga0496115_0015932 | 3300048918 | Bacteria | 5713 |
| 669 | Ga0496116_0040323 | 3300048919 | Bacteria | 3216 |
| 670 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 671 | Ga0496118_0000008 | 3300048921 | Bacteria | 644537 |
| 672 | Ga0496121_0004172 | 3300048924 | Bacteria | 19754 |
| 673 | Ga0496121_0005269 | 3300048924 | Bacteria | 16693 |
| 674 | Ga0496121_0025979 | 3300048924 | Bacteria | 5538 |
| 675 | Ga0496122_0000445 | 3300048925 | Bacteria | 86566 |
| 676 | Ga0496122_0001558 | 3300048925 | Bacteria | 36307 |
| 677 | Ga0496122_0002321 | 3300048925 | Bacteria | 27457 |
| 678 | Ga0496122_0059997 | 3300048925 | Bacteria | 2805 |
| 679 | Ga0496123_0001531 | 3300048926 | Bacteria | 31933 |
| 680 | Ga0496123_0007447 | 3300048926 | Bacteria | 10303 |
| 681 | Ga0496123_0031575 | 3300048926 | Bacteria | 3851 |
| 682 | Ga0496124_0008544 | 3300048927 | Bacteria | 10691 |
| 683 | Ga0496124_0024873 | 3300048927 | Bacteria | 5435 |
| 684 | Ga0496124_0027329 | 3300048927 | Bacteria | 5123 |
| 685 | Ga0496125_0002437 | 3300048928 | Bacteria | 24169 |
| 686 | Ga0495678_000042 | 3300049459 | Bacteria | 174125 |
| 687 | Ga0495678_000233 | 3300049459 | Bacteria | 63499 |
| 688 | Ga0495678_000316 | 3300049459 | Bacteria | 51625 |
| 689 | Ga0495678_001513 | 3300049459 | Bacteria | 18039 |
| 690 | Ga0495678_001703 | 3300049459 | Bacteria | 16504 |
| 691 | Ga0495678_001985 | 3300049459 | Bacteria | 14727 |
| 692 | Ga0495678_014117 | 3300049459 | Bacteria | 3723 |
| 693 | Ga0495682_0000107 | 3300049460 | Bacteria | 73486 |
| 694 | Ga0495682_0001172 | 3300049460 | Bacteria | 14944 |
| 695 | Ga0495682_0002913 | 3300049460 | Bacteria | 7852 |
| 696 | Ga0495682_0008541 | 3300049460 | Bacteria | 4031 |
| 697 | Ga0501038_0034715 | 3300049574 | Bacteria | 4433 |
| 698 | Ga0501069_0019786 | 3300049585 | Bacteria | 3641 |
| 699 | Ga0501070_0000019 | 3300049586 | Bacteria | 171935 |
| 700 | Ga0501070_0080110 | 3300049586 | Bacteria | 2702 |
| 701 | Ga0501073_0024768 | 3300049589 | Bacteria | 4308 |
| 702 | Ga0501073_0036578 | 3300049589 | Bacteria | 3488 |
| 703 | Ga0501198_001067 | 3300049649 | Bacteria | 3499 |
| 704 | Ga0501217_007428 | 3300049661 | Bacteria | 2350 |
| 705 | Ga0501223_000399 | 3300049663 | Bacteria | 10644 |
| 706 | Ga0501227_000931 | 3300049665 | Bacteria | 6413 |
| 707 | Ga0501238_000859 | 3300049671 | Bacteria | 3460 |
| 708 | Ga0501249_001226 | 3300049679 | Bacteria | 5381 |
| 709 | Ga0501257_002375 | 3300049686 | Bacteria | 3964 |
| 710 | Ga0501221_003830 | 3300049704 | Unclassified | 2482 |
| 711 | Ga0501225_0002188 | 3300049705 | Bacteria | 6042 |
| 712 | Ga0501225_0011682 | 3300049705 | Bacteria | 2470 |
| 713 | Ga0501080_0020549 | 3300049742 | Bacteria | 6115 |
| 714 | Ga0501083_0016339 | 3300049744 | Bacteria | 5196 |
| 715 | Ga0501269_000155 | 3300049766 | Bacteria | 21098 |
| 716 | Ga0501035_0003621 | 3300049822 | Bacteria | 14734 |
| 717 | Ga0501212_001911 | 3300049851 | Bacteria | 2432 |
| 718 | nmdc:mga05p37_19426_c1 | 3300050507 | Bacteria | 8220 |
| 719 | nmdc:mga05p37_2364_c1 | 3300050507 | Bacteria | 21951 |
| 720 | nmdc:mga05p37_38576_c1 | 3300050507 | Bacteria | 5860 |
| 721 | nmdc:mga05p37_60640_c1 | 3300050507 | Bacteria | 4657 |
| 722 | nmdc:mga09592_150152_c1 | 3300050508 | Bacteria | 2010 |
| 723 | nmdc:mga06r32_161666_c1 | 3300050510 | Bacteria | 2222 |
| 724 | nmdc:mga06r32_232889_c1 | 3300050510 | Bacteria | 1830 |
| 725 | nmdc:mga08y16_140020_c1 | 3300050511 | Bacteria | 2515 |
| 726 | nmdc:mga08y16_140929_c1 | 3300050511 | Bacteria | 2507 |
| 727 | nmdc:mga08x19_10_c1 | 3300050514 | Bacteria | 404490 |
| 728 | nmdc:mga08x19_1288_c1 | 3300050514 | Bacteria | 15581 |
| 729 | nmdc:mga08x19_170371_c1 | 3300050514 | Bacteria | 1483 |
| 730 | nmdc:mga0a205_139277_c1 | 3300050515 | Bacteria | 2327 |
| 731 | nmdc:mga0a205_200926_c1 | 3300050515 | Bacteria | 1884 |
| 732 | nmdc:mga0a205_33639_c1 | 3300050515 | Bacteria | 4915 |
| 733 | Ga0500594_0010803 | 3300053118 | Bacteria | 2124 |
| 734 | Ga0500618_000630 | 3300053125 | Bacteria | 21289 |
| 735 | Ga0500586_004143 | 3300053145 | Bacteria | 3508 |
| 736 | Ga0501084_0109808 | 3300054114 | Unclassified | 2317 |
| 737 | Ga0501082_0071990 | 3300060353 | Bacteria | 2977 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050514 | nmdc:mga08x19_170371_c1 | nmdc:mga08x19_170371_c1_23_1468 | 479 |
| 2 | 3300046524 | Ga0495648_0009124 | Ga0495648_0009124_5933_7687 | 512 |
| 3 | 3300046531 | Ga0495665_0047463 | Ga0495665_0047463_335_1888 | 516 |
| 4 | 3300049460 | Ga0495682_0008541 | Ga0495682_0008541_1645_3459 | 518 |
| 5 | 3300048915 | Ga0496112_0229064 | Ga0496112_0229064_49_1773 | 519 |
| 6 | 3300005617 | Ga0068859_100154893 | Ga0068859_1001548931 | 520 |
| 7 | 3300006931 | Ga0097620_100154888 | Ga0097620_1001548881 | 520 |
| 8 | 3300046518 | Ga0495631_0047878 | Ga0495631_0047878_246_1859 | 520 |
| 9 | 3300047472 | Ga0495686_0022414 | Ga0495686_0022414_2552_4165 | 520 |
| 10 | 3300048091 | Ga0495626_0009080 | Ga0495626_0009080_3768_5378 | 520 |
| 11 | 3300005354 | Ga0070675_100016465 | Ga0070675_1000164652 | 521 |
| 12 | 3300025926 | Ga0207659_10009883 | Ga0207659_100098832 | 521 |
| 13 | 3300025940 | Ga0207691_10044274 | Ga0207691_100442743 | 521 |
| 14 | 3300009176 | Ga0105242_10028444 | Ga0105242_100284443 | 523 |
| 15 | 3300038443 | Ga0395901_0094591 | Ga0395901_0094591_924_2765 | 524 |
| 16 | 3300046660 | Ga0495625_0013621 | Ga0495625_0013621_1982_3682 | 524 |
| 17 | 3300009036 | Ga0105244_10001968 | Ga0105244_100019688 | 525 |
| 18 | 3300046457 | Ga0495590_0002187 | Ga0495590_0002187_2808_4580 | 525 |
| 19 | 3300046507 | Ga0495606_0036142 | Ga0495606_0036142_383_2155 | 525 |
| 20 | 3300046473 | Ga0495582_0036807 | Ga0495582_0036807_272_1978 | 526 |
| 21 | 3300046518 | Ga0495631_0012909 | Ga0495631_0012909_1398_3104 | 527 |
| 22 | 3300046531 | Ga0495665_0026182 | Ga0495665_0026182_1039_2754 | 527 |
| 23 | 3300046616 | Ga0495668_0020953 | Ga0495668_0020953_873_2579 | 527 |
| 24 | 3300046692 | Ga0495671_0044534 | Ga0495671_0044534_322_2028 | 527 |
| 25 | 3300047445 | Ga0495677_0000104 | Ga0495677_0000104_2113_3855 | 527 |
| 26 | 3300049585 | Ga0501069_0019786 | Ga0501069_0019786_314_1972 | 528 |
| 27 | 3300049586 | Ga0501070_0000019 | Ga0501070_0000019_49708_51366 | 528 |
| 28 | 3300049589 | Ga0501073_0036578 | Ga0501073_0036578_1355_3013 | 528 |
| 29 | 3300049744 | Ga0501083_0016339 | Ga0501083_0016339_2685_4343 | 528 |
| 30 | 3300050511 | nmdc:mga08y16_140929_c1 | nmdc:mga08y16_140929_c1_875_2485 | 528 |
| 31 | 3300060353 | Ga0501082_0071990 | Ga0501082_0071990_1218_2876 | 528 |
| 32 | 3300014325 | Ga0163163_10007804 | Ga0163163_100078044 | 529 |
| 33 | 3300025885 | Ga0207653_10000481 | Ga0207653_1000048110 | 529 |
| 34 | 3300046524 | Ga0495648_0076214 | Ga0495648_0076214_156_1874 | 529 |
| 35 | 3300046557 | Ga0495622_0000064 | Ga0495622_0000064_24624_26330 | 529 |
| 36 | 3300037471 | Ga0395905_0102623 | Ga0395905_0102623_874_2619 | 530 |
| 37 | 3300048924 | Ga0496121_0005269 | Ga0496121_0005269_4768_6501 | 530 |
| 38 | 3300005563 | Ga0068855_100003154 | Ga0068855_1000031547 | 531 |
| 39 | 3300046558 | Ga0495633_0000815 | Ga0495633_0000815_19729_21450 | 531 |
| 40 | 3300049586 | Ga0501070_0080110 | Ga0501070_0080110_119_1792 | 531 |
| 41 | 3300049589 | Ga0501073_0024768 | Ga0501073_0024768_869_2542 | 531 |
| 42 | 3300049679 | Ga0501249_001226 | Ga0501249_001226_3361_5061 | 531 |
| 43 | 3300049742 | Ga0501080_0020549 | Ga0501080_0020549_2788_4461 | 531 |
| 44 | 3300049766 | Ga0501269_000155 | Ga0501269_000155_8802_10502 | 531 |
| 45 | 3300005564 | Ga0070664_100152457 | Ga0070664_1001524572 | 532 |
| 46 | 3300006237 | Ga0097621_100057637 | Ga0097621_1000576374 | 532 |
| 47 | 3300006237 | Ga0097621_100180895 | Ga0097621_1001808952 | 532 |
| 48 | 3300006846 | Ga0075430_100084797 | Ga0075430_1000847971 | 532 |
| 49 | 3300009147 | Ga0114129_10023985 | Ga0114129_100239855 | 532 |
| 50 | 3300046459 | Ga0495629_0024427 | Ga0495629_0024427_1077_2783 | 532 |
| 51 | 3300046535 | Ga0495586_0012766 | Ga0495586_0012766_1350_3056 | 532 |
| 52 | 3300046542 | Ga0495597_0000957 | Ga0495597_0000957_15185_16891 | 532 |
| 53 | 3300047443 | Ga0495687_001550 | Ga0495687_001550_9175_10932 | 532 |
| 54 | 3300050510 | nmdc:mga06r32_161666_c1 | nmdc:mga06r32_161666_c1_220_1932 | 532 |
| 55 | 3300003771 | Ga0055526_1007917 | Ga0055526_10079175 | 533 |
| 56 | 3300003773 | Ga0055537_1003987 | Ga0055537_10039874 | 533 |
| 57 | 3300003775 | Ga0055524_1000615 | Ga0055524_100061518 | 533 |
| 58 | 3300025295 | Ga0209564_1000751 | Ga0209564_100075121 | 533 |
| 59 | 3300025295 | Ga0209564_1007615 | Ga0209564_10076152 | 533 |
| 60 | 3300025299 | Ga0209256_1000586 | Ga0209256_100058619 | 533 |
| 61 | 3300046519 | Ga0495632_0000375 | Ga0495632_0000375_30325_32082 | 533 |
| 62 | 3300046520 | Ga0495637_0000914 | Ga0495637_0000914_5259_6959 | 533 |
| 63 | 3300046524 | Ga0495648_0045976 | Ga0495648_0045976_189_1940 | 533 |
| 64 | 3300046530 | Ga0495654_0000004 | Ga0495654_0000004_134226_135926 | 533 |
| 65 | 3300046542 | Ga0495597_0000958 | Ga0495597_0000958_14510_16222 | 533 |
| 66 | 3300046665 | Ga0495661_0002737 | Ga0495661_0002737_4264_6021 | 533 |
| 67 | 3300047445 | Ga0495677_0001887 | Ga0495677_0001887_1723_3480 | 533 |
| 68 | 3300003354 | JGI25160J50197_1005010 | JGI25160J50197_10050103 | 534 |
| 69 | 3300003374 | JGI25161J50226_1006659 | JGI25161J50226_10066592 | 534 |
| 70 | 3300003771 | Ga0055526_1001981 | Ga0055526_10019816 | 534 |
| 71 | 3300003771 | Ga0055526_1008551 | Ga0055526_10085513 | 534 |
| 72 | 3300003773 | Ga0055537_1000035 | Ga0055537_100003566 | 534 |
| 73 | 3300003775 | Ga0055524_1001052 | Ga0055524_100105213 | 534 |
| 74 | 3300003775 | Ga0055524_1002035 | Ga0055524_10020355 | 534 |
| 75 | 3300003784 | Ga0055534_1000843 | Ga0055534_10008434 | 534 |
| 76 | 3300003784 | Ga0055534_1002519 | Ga0055534_10025192 | 534 |
| 77 | 3300003790 | Ga0055528_1000058 | Ga0055528_100005819 | 534 |
| 78 | 3300003791 | Ga0055530_10001617 | Ga0055530_100016175 | 534 |
| 79 | 3300003791 | Ga0055530_10004677 | Ga0055530_100046773 | 534 |
| 80 | 3300003791 | Ga0055530_10005605 | Ga0055530_100056052 | 534 |
| 81 | 3300003794 | Ga0055531_10003927 | Ga0055531_100039275 | 534 |
| 82 | 3300025208 | Ga0209436_100292 | Ga0209436_1002924 | 534 |
| 83 | 3300025245 | Ga0207425_1000428 | Ga0207425_100042812 | 534 |
| 84 | 3300025263 | Ga0209565_1000009 | Ga0209565_1000009616 | 534 |
| 85 | 3300025273 | Ga0209673_1000036 | Ga0209673_100003667 | 534 |
| 86 | 3300025284 | Ga0209130_1000853 | Ga0209130_10008536 | 534 |
| 87 | 3300025284 | Ga0209130_1006522 | Ga0209130_10065222 | 534 |
| 88 | 3300025291 | Ga0209675_1000013 | Ga0209675_100001367 | 534 |
| 89 | 3300025295 | Ga0209564_1000122 | Ga0209564_100012267 | 534 |
| 90 | 3300025298 | Ga0209050_1000092 | Ga0209050_1000092185 | 534 |
| 91 | 3300025298 | Ga0209050_1001070 | Ga0209050_100107019 | 534 |
| 92 | 3300025298 | Ga0209050_1002850 | Ga0209050_10028506 | 534 |
| 93 | 3300025299 | Ga0209256_1000106 | Ga0209256_1000106109 | 534 |
| 94 | 3300025302 | Ga0207426_1002992 | Ga0207426_10029926 | 534 |
| 95 | 3300025304 | Ga0209257_1000010 | Ga0209257_1000010982 | 534 |
| 96 | 3300031548 | Ga0307408_100000498 | Ga0307408_10000049812 | 534 |
| 97 | 3300046491 | Ga0495584_0001098 | Ga0495584_0001098_12519_14264 | 534 |
| 98 | 3300046492 | Ga0495585_0000254 | Ga0495585_0000254_18336_20081 | 534 |
| 99 | 3300046500 | Ga0495596_0002814 | Ga0495596_0002814_1939_3684 | 534 |
| 100 | 3300046500 | Ga0495596_0003137 | Ga0495596_0003137_6640_8385 | 534 |
| 101 | 3300046501 | Ga0495607_0005452 | Ga0495607_0005452_3266_5020 | 534 |
| 102 | 3300046506 | Ga0495583_0003755 | Ga0495583_0003755_14_1756 | 534 |
| 103 | 3300046513 | Ga0495616_0000996 | Ga0495616_0000996_69_1814 | 534 |
| 104 | 3300046530 | Ga0495654_0038101 | Ga0495654_0038101_304_2037 | 534 |
| 105 | 3300046542 | Ga0495597_0050618 | Ga0495597_0050618_76_1818 | 534 |
| 106 | 3300047323 | Ga0495683_0000179 | Ga0495683_0000179_34884_36629 | 534 |
| 107 | 3300006177 | Ga0075362_10015886 | Ga0075362_100158861 | 535 |
| 108 | 3300037312 | Ga0395899_0000330 | Ga0395899_0000330_47612_49327 | 535 |
| 109 | 3300046463 | Ga0495653_0007115 | Ga0495653_0007115_4111_5880 | 535 |
| 110 | 3300046519 | Ga0495632_0000129 | Ga0495632_0000129_32469_34214 | 535 |
| 111 | 3300046520 | Ga0495637_0006965 | Ga0495637_0006965_3915_5624 | 535 |
| 112 | 3300046522 | Ga0495643_0000415 | Ga0495643_0000415_8436_10154 | 535 |
| 113 | 3300046528 | Ga0495642_0009424 | Ga0495642_0009424_1013_2758 | 535 |
| 114 | 3300046692 | Ga0495671_0003679 | Ga0495671_0003679_868_2613 | 535 |
| 115 | 3300047444 | Ga0495675_0038544 | Ga0495675_0038544_1215_2984 | 535 |
| 116 | 3300048906 | Ga0496103_0007341 | Ga0496103_0007341_2657_4357 | 535 |
| 117 | 3300049459 | Ga0495678_001703 | Ga0495678_001703_10514_12259 | 535 |
| 118 | 3300049459 | Ga0495678_001985 | Ga0495678_001985_12782_14527 | 535 |
| 119 | 3300049460 | Ga0495682_0000107 | Ga0495682_0000107_39134_40879 | 535 |
| 120 | 3300050507 | nmdc:mga05p37_2364_c1 | nmdc:mga05p37_2364_c1_3885_5573 | 535 |
| 121 | 3300005518 | Ga0070699_100000013 | Ga0070699_10000001351 | 536 |
| 122 | 3300005843 | Ga0068860_100044352 | Ga0068860_1000443522 | 536 |
| 123 | 3300009147 | Ga0114129_10048897 | Ga0114129_100488973 | 536 |
| 124 | 3300013297 | Ga0157378_10008171 | Ga0157378_100081715 | 536 |
| 125 | 3300025272 | Ga0209455_1000049 | Ga0209455_1000049222 | 536 |
| 126 | 3300046492 | Ga0495585_0000006 | Ga0495585_0000006_253759_255504 | 536 |
| 127 | 3300046558 | Ga0495633_0016211 | Ga0495633_0016211_1341_3101 | 536 |
| 128 | 3300048907 | Ga0496104_0075039 | Ga0496104_0075039_82_1698 | 536 |
| 129 | 3300048913 | Ga0496110_0000068 | Ga0496110_0000068_23102_24838 | 536 |
| 130 | 3300050507 | nmdc:mga05p37_38576_c1 | nmdc:mga05p37_38576_c1_3814_5436 | 536 |
| 131 | 3300053125 | Ga0500618_000630 | Ga0500618_000630_14102_15850 | 536 |
| 132 | 3300015261 | Ga0182006_1000014 | Ga0182006_1000014243 | 537 |
| 133 | 3300046471 | Ga0495650_0000930 | Ga0495650_0000930_17397_19157 | 537 |
| 134 | 3300046492 | Ga0495585_0002026 | Ga0495585_0002026_5712_7457 | 537 |
| 135 | 3300046500 | Ga0495596_0010139 | Ga0495596_0010139_560_2317 | 537 |
| 136 | 3300046506 | Ga0495583_0000808 | Ga0495583_0000808_1488_3227 | 537 |
| 137 | 3300046507 | Ga0495606_0000024 | Ga0495606_0000024_87857_89617 | 537 |
| 138 | 3300046512 | Ga0495610_0010579 | Ga0495610_0010579_2619_4379 | 537 |
| 139 | 3300046558 | Ga0495633_0016762 | Ga0495633_0016762_504_2249 | 537 |
| 140 | 3300046616 | Ga0495668_0000126 | Ga0495668_0000126_38017_39777 | 537 |
| 141 | 3300046616 | Ga0495668_0001842 | Ga0495668_0001842_1602_3362 | 537 |
| 142 | 3300046691 | Ga0495670_0001945 | Ga0495670_0001945_8382_10127 | 537 |
| 143 | 3300046694 | Ga0495649_0049528 | Ga0495649_0049528_496_2196 | 537 |
| 144 | 3300005549 | Ga0070704_100021829 | Ga0070704_1000218292 | 538 |
| 145 | 3300006914 | Ga0075436_100003828 | Ga0075436_1000038283 | 538 |
| 146 | 3300031838 | Ga0307518_10026887 | Ga0307518_100268872 | 538 |
| 147 | 3300046471 | Ga0495650_0001111 | Ga0495650_0001111_7396_9123 | 538 |
| 148 | 3300046500 | Ga0495596_0001873 | Ga0495596_0001873_2397_4115 | 538 |
| 149 | 3300046507 | Ga0495606_0027466 | Ga0495606_0027466_1686_3425 | 538 |
| 150 | 3300046518 | Ga0495631_0009360 | Ga0495631_0009360_2383_4122 | 538 |
| 151 | 3300046648 | Ga0495611_0020067 | Ga0495611_0020067_426_2165 | 538 |
| 152 | 3300046660 | Ga0495625_0000850 | Ga0495625_0000850_22271_23998 | 538 |
| 153 | 3300046665 | Ga0495661_0033230 | Ga0495661_0033230_352_2085 | 538 |
| 154 | 3300046684 | Ga0495669_0000092 | Ga0495669_0000092_39643_41361 | 538 |
| 155 | 3300046810 | Ga0495660_0011889 | Ga0495660_0011889_767_2506 | 538 |
| 156 | 3300047321 | Ga0495676_0042180 | Ga0495676_0042180_1450_3195 | 538 |
| 157 | 3300048091 | Ga0495626_0008221 | Ga0495626_0008221_2862_4580 | 538 |
| 158 | 3300048913 | Ga0496110_0051568 | Ga0496110_0051568_1789_3522 | 538 |
| 159 | 3300048914 | Ga0496111_0025612 | Ga0496111_0025612_2338_4071 | 538 |
| 160 | 3300050514 | nmdc:mga08x19_1288_c1 | nmdc:mga08x19_1288_c1_2035_3708 | 538 |
| 161 | 3300053118 | Ga0500594_0010803 | Ga0500594_0010803_343_2043 | 538 |
| 162 | 3300006880 | Ga0075429_100040587 | Ga0075429_1000405872 | 539 |
| 163 | 3300037471 | Ga0395905_0009240 | Ga0395905_0009240_3313_5034 | 539 |
| 164 | 3300046452 | Ga0495617_000539 | Ga0495617_000539_11425_13170 | 539 |
| 165 | 3300046492 | Ga0495585_0000064 | Ga0495585_0000064_92395_94140 | 539 |
| 166 | 3300046513 | Ga0495616_0003899 | Ga0495616_0003899_1770_3515 | 539 |
| 167 | 3300046524 | Ga0495648_0000007 | Ga0495648_0000007_238237_239982 | 539 |
| 168 | 3300046538 | Ga0495609_0001963 | Ga0495609_0001963_6853_8595 | 539 |
| 169 | 3300046542 | Ga0495597_0000226 | Ga0495597_0000226_22173_23915 | 539 |
| 170 | 3300047320 | Ga0495672_0013058 | Ga0495672_0013058_3186_4925 | 539 |
| 171 | 3300048927 | Ga0496124_0027329 | Ga0496124_0027329_1342_3042 | 539 |
| 172 | 3300049574 | Ga0501038_0034715 | Ga0501038_0034715_1238_2863 | 539 |
| 173 | 3300050511 | nmdc:mga08y16_140020_c1 | nmdc:mga08y16_140020_c1_195_1814 | 539 |
| 174 | iso_pu_bacteria | 2643221554 | 2643788383 | 539 |
| 175 | iso_pu_bacteria | 2643221638 | 2644213693 | 539 |
| 176 | 3300009147 | Ga0114129_10013656 | Ga0114129_100136566 | 540 |
| 177 | 3300013297 | Ga0157378_10185587 | Ga0157378_101855871 | 540 |
| 178 | 3300014326 | Ga0157380_10147727 | Ga0157380_101477271 | 540 |
| 179 | 3300046463 | Ga0495653_0010485 | Ga0495653_0010485_4250_5974 | 540 |
| 180 | 3300046492 | Ga0495585_0001061 | Ga0495585_0001061_5118_6857 | 540 |
| 181 | 3300046522 | Ga0495643_0000567 | Ga0495643_0000567_40345_42081 | 540 |
| 182 | 3300046535 | Ga0495586_0026284 | Ga0495586_0026284_803_2527 | 540 |
| 183 | 3300046663 | Ga0495635_0002840 | Ga0495635_0002840_855_2579 | 540 |
| 184 | 3300047317 | Ga0495604_0029462 | Ga0495604_0029462_673_2397 | 540 |
| 185 | 3300047322 | Ga0495680_0054663 | Ga0495680_0054663_919_2643 | 540 |
| 186 | 3300047673 | Ga0495593_0023123 | Ga0495593_0023123_1161_2885 | 540 |
| 187 | 3300048089 | Ga0495614_0005144 | Ga0495614_0005144_3141_4865 | 540 |
| 188 | 3300048091 | Ga0495626_0043083 | Ga0495626_0043083_253_1989 | 540 |
| 189 | iso_pu_bacteria | 2643221556 | 2643798088 | 540 |
| 190 | iso_pu_bacteria | 2643221645 | 2644253813 | 540 |
| 191 | iso_pu_bacteria | 2643221684 | 2644473266 | 540 |
| 192 | iso_pu_bacteria | 2738541280 | 2738738784 | 540 |
| 193 | iso_pu_bacteria | 2738541297 | 2738825172 | 540 |
| 194 | iso_pu_bacteria | 2738541300 | 2738844670 | 540 |
| 195 | iso_pu_bacteria | 2738541357 | 2739148969 | 540 |
| 196 | iso_pu_bacteria | 2738543003 | 2739190888 | 540 |
| 197 | iso_pu_bacteria | 2738543018 | 2739276195 | 540 |
| 198 | iso_pu_bacteria | 2738543026 | 2739317365 | 540 |
| 199 | iso_pu_bacteria | 2738543029 | 2739335606 | 540 |
| 200 | iso_pu_bacteria | 2738543030 | 2739345281 | 540 |
| 201 | iso_pu_bacteria | 2821131069 | 2821133766 | 540 |
| 202 | iso_pu_bacteria | 2842711865 | 2842717166 | 540 |
| 203 | iso_pu_bacteria | 2857553236 | 2857553875 | 540 |
| 204 | iso_pu_bacteria | 2857558681 | 2857560337 | 540 |
| 205 | iso_pu_bacteria | 2857564685 | 2857565558 | 540 |
| 206 | iso_pu_bacteria | 2904424332 | 2904430621 | 540 |
| 207 | iso_pu_bacteria | 2919476304 | 2919480490 | 540 |
| 208 | iso_pu_bacteria | 8047673197 | 8047678093 | 540 |
| 209 | 3300014497 | Ga0182008_10001646 | Ga0182008_1000164610 | 541 |
| 210 | 3300015262 | Ga0182007_10000096 | Ga0182007_100000969 | 541 |
| 211 | 3300015265 | Ga0182005_1000014 | Ga0182005_1000014249 | 541 |
| 212 | 3300032002 | Ga0307416_100003518 | Ga0307416_1000035185 | 541 |
| 213 | 3300046460 | Ga0495638_0003279 | Ga0495638_0003279_1023_2714 | 541 |
| 214 | 3300046471 | Ga0495650_0001046 | Ga0495650_0001046_12757_14448 | 541 |
| 215 | 3300046474 | Ga0495605_0025115 | Ga0495605_0025115_1018_2766 | 541 |
| 216 | 3300046474 | Ga0495605_0034862 | Ga0495605_0034862_85_1824 | 541 |
| 217 | 3300046491 | Ga0495584_0009791 | Ga0495584_0009791_1174_2865 | 541 |
| 218 | 3300046500 | Ga0495596_0006614 | Ga0495596_0006614_2516_4255 | 541 |
| 219 | 3300046501 | Ga0495607_0016521 | Ga0495607_0016521_2954_4645 | 541 |
| 220 | 3300046506 | Ga0495583_0000195 | Ga0495583_0000195_61315_63060 | 541 |
| 221 | 3300046506 | Ga0495583_0005962 | Ga0495583_0005962_2010_3749 | 541 |
| 222 | 3300046506 | Ga0495583_0043941 | Ga0495583_0043941_64_1755 | 541 |
| 223 | 3300046507 | Ga0495606_0004483 | Ga0495606_0004483_6734_8425 | 541 |
| 224 | 3300046513 | Ga0495616_0007442 | Ga0495616_0007442_103_1842 | 541 |
| 225 | 3300046538 | Ga0495609_0000910 | Ga0495609_0000910_4346_6037 | 541 |
| 226 | 3300046538 | Ga0495609_0005513 | Ga0495609_0005513_2540_4270 | 541 |
| 227 | 3300046660 | Ga0495625_0018164 | Ga0495625_0018164_2113_3804 | 541 |
| 228 | 3300046664 | Ga0495659_0012157 | Ga0495659_0012157_323_2014 | 541 |
| 229 | 3300046665 | Ga0495661_0001170 | Ga0495661_0001170_10947_12665 | 541 |
| 230 | 3300046794 | Ga0495589_0035755 | Ga0495589_0035755_704_2443 | 541 |
| 231 | 3300047318 | Ga0495636_0005231 | Ga0495636_0005231_2245_3957 | 541 |
| 232 | 3300047318 | Ga0495636_0012438 | Ga0495636_0012438_1053_2744 | 541 |
| 233 | 3300047447 | Ga0495685_001298 | Ga0495685_001298_3302_4993 | 541 |
| 234 | 3300047469 | Ga0495673_0017040 | Ga0495673_0017040_328_2067 | 541 |
| 235 | 3300047470 | Ga0495681_0022331 | Ga0495681_0022331_1520_3214 | 541 |
| 236 | 3300048091 | Ga0495626_0013526 | Ga0495626_0013526_1813_3543 | 541 |
| 237 | 3300048091 | Ga0495626_0042634 | Ga0495626_0042634_254_2002 | 541 |
| 238 | 3300048091 | Ga0495626_0049584 | Ga0495626_0049584_148_1842 | 541 |
| 239 | 3300048091 | Ga0495626_0052809 | Ga0495626_0052809_90_1829 | 541 |
| 240 | 3300048903 | Ga0496100_0082565 | Ga0496100_0082565_33_1751 | 541 |
| 241 | 3300048916 | Ga0496113_0029183 | Ga0496113_0029183_1199_2917 | 541 |
| 242 | 3300048918 | Ga0496115_0015932 | Ga0496115_0015932_872_2566 | 541 |
| 243 | 3300048920 | Ga0496117_0000001 | Ga0496117_0000001_2264147_2265880 | 541 |
| 244 | 3300048921 | Ga0496118_0000008 | Ga0496118_0000008_382440_384173 | 541 |
| 245 | 3300048924 | Ga0496121_0004172 | Ga0496121_0004172_3764_5497 | 541 |
| 246 | 3300048925 | Ga0496122_0000445 | Ga0496122_0000445_63316_65034 | 541 |
| 247 | 3300048925 | Ga0496122_0002321 | Ga0496122_0002321_14081_15814 | 541 |
| 248 | 3300048926 | Ga0496123_0001531 | Ga0496123_0001531_8681_10399 | 541 |
| 249 | 3300048928 | Ga0496125_0002437 | Ga0496125_0002437_961_2679 | 541 |
| 250 | iso_pu_bacteria | 2600255292 | 2601671013 | 541 |
| 251 | iso_pu_bacteria | 2808606418 | 2809144563 | 541 |
| 252 | iso_pu_bacteria | 2857547612 | 2857547785 | 541 |
| 253 | iso_pu_bacteria | 2885080285 | 2885086235 | 541 |
| 254 | iso_pu_bacteria | 2932410948 | 2932412392 | 541 |
| 255 | iso_pu_bacteria | 2932416698 | 2932419907 | 541 |
| 256 | 3300005345 | Ga0070692_10023322 | Ga0070692_100233223 | 542 |
| 257 | 3300005545 | Ga0070695_100010081 | Ga0070695_1000100813 | 542 |
| 258 | 3300005577 | Ga0068857_100035718 | Ga0068857_1000357182 | 542 |
| 259 | 3300025908 | Ga0207643_10003613 | Ga0207643_100036132 | 542 |
| 260 | 3300025935 | Ga0207709_10008485 | Ga0207709_100084852 | 542 |
| 261 | 3300026041 | Ga0207639_10033421 | Ga0207639_100334213 | 542 |
| 262 | 3300026095 | Ga0207676_10183941 | Ga0207676_101839411 | 542 |
| 263 | 3300026116 | Ga0207674_10118129 | Ga0207674_101181292 | 542 |
| 264 | 3300031995 | Ga0307409_100203894 | Ga0307409_1002038941 | 542 |
| 265 | 3300046519 | Ga0495632_0000077 | Ga0495632_0000077_65754_67472 | 542 |
| 266 | 3300002773 | JGI25152J39213_1000217 | JGI25152J39213_100021713 | 543 |
| 267 | 3300003215 | JGI25153J46596_10003209 | JGI25153J46596_100032098 | 543 |
| 268 | 3300003775 | Ga0055524_1001567 | Ga0055524_10015672 | 543 |
| 269 | 3300005468 | Ga0070707_100054170 | Ga0070707_1000541703 | 543 |
| 270 | 3300005471 | Ga0070698_100104020 | Ga0070698_1001040202 | 543 |
| 271 | 3300005577 | Ga0068857_100088981 | Ga0068857_1000889812 | 543 |
| 272 | 3300006852 | Ga0075433_10121865 | Ga0075433_101218652 | 543 |
| 273 | 3300010375 | Ga0105239_10191758 | Ga0105239_101917582 | 543 |
| 274 | 3300021361 | Ga0213872_10000002 | Ga0213872_10000002254 | 543 |
| 275 | 3300021361 | Ga0213872_10001473 | Ga0213872_100014735 | 543 |
| 276 | 3300025245 | Ga0207425_1000001 | Ga0207425_10000012225 | 543 |
| 277 | 3300025245 | Ga0207425_1008411 | Ga0207425_10084112 | 543 |
| 278 | 3300025258 | Ga0209129_1000093 | Ga0209129_1000093127 | 543 |
| 279 | 3300025263 | Ga0209565_1001220 | Ga0209565_100122012 | 543 |
| 280 | 3300025297 | Ga0209758_1000055 | Ga0209758_1000055127 | 543 |
| 281 | 3300025299 | Ga0209256_1000879 | Ga0209256_100087913 | 543 |
| 282 | 3300025923 | Ga0207681_10010892 | Ga0207681_100108923 | 543 |
| 283 | 3300025924 | Ga0207694_10000938 | Ga0207694_1000093823 | 543 |
| 284 | 3300025934 | Ga0207686_10005640 | Ga0207686_100056403 | 543 |
| 285 | 3300025941 | Ga0207711_10042429 | Ga0207711_100424292 | 543 |
| 286 | 3300025941 | Ga0207711_10055952 | Ga0207711_100559522 | 543 |
| 287 | 3300025960 | Ga0207651_10067531 | Ga0207651_100675312 | 543 |
| 288 | 3300025961 | Ga0207712_10003390 | Ga0207712_100033908 | 543 |
| 289 | 3300026035 | Ga0207703_10081974 | Ga0207703_100819741 | 543 |
| 290 | 3300026089 | Ga0207648_10081979 | Ga0207648_100819792 | 543 |
| 291 | 3300035091 | Ga0373951_0002546 | Ga0373951_0002546_150_1781 | 543 |
| 292 | 3300039447 | Ga0436361_0111397 | Ga0436361_0111397_921_2621 | 543 |
| 293 | 3300039447 | Ga0436361_0667736 | Ga0436361_0667736_6208_7917 | 543 |
| 294 | 3300039447 | Ga0436361_0977466 | Ga0436361_0977466_14154_15848 | 543 |
| 295 | 3300042139 | Ga0450904_000130 | Ga0450904_000130_14791_16524 | 543 |
| 296 | 3300042157 | Ga0439458_0001237 | Ga0439458_0001237_3059_4690 | 543 |
| 297 | 3300046460 | Ga0495638_0001537 | Ga0495638_0001537_2789_4525 | 543 |
| 298 | 3300046491 | Ga0495584_0000017 | Ga0495584_0000017_69926_71671 | 543 |
| 299 | 3300046492 | Ga0495585_0058990 | Ga0495585_0058990_54_1814 | 543 |
| 300 | 3300046500 | Ga0495596_0000224 | Ga0495596_0000224_3585_5345 | 543 |
| 301 | 3300046507 | Ga0495606_0025925 | Ga0495606_0025925_1920_3665 | 543 |
| 302 | 3300046513 | Ga0495616_0000057 | Ga0495616_0000057_86920_88650 | 543 |
| 303 | 3300046525 | Ga0495663_0013019 | Ga0495663_0013019_364_2088 | 543 |
| 304 | 3300046528 | Ga0495642_0006531 | Ga0495642_0006531_865_2601 | 543 |
| 305 | 3300046531 | Ga0495665_0004421 | Ga0495665_0004421_111_1877 | 543 |
| 306 | 3300046542 | Ga0495597_0010112 | Ga0495597_0010112_677_2401 | 543 |
| 307 | 3300046542 | Ga0495597_0017371 | Ga0495597_0017371_566_2302 | 543 |
| 308 | 3300046558 | Ga0495633_0012539 | Ga0495633_0012539_302_2062 | 543 |
| 309 | 3300046642 | Ga0495634_0027471 | Ga0495634_0027471_1777_3543 | 543 |
| 310 | 3300046648 | Ga0495611_0007350 | Ga0495611_0007350_373_2109 | 543 |
| 311 | 3300046660 | Ga0495625_0044881 | Ga0495625_0044881_800_2521 | 543 |
| 312 | 3300046684 | Ga0495669_0000502 | Ga0495669_0000502_14761_16521 | 543 |
| 313 | 3300046691 | Ga0495670_0000157 | Ga0495670_0000157_3029_4750 | 543 |
| 314 | 3300046691 | Ga0495670_0037095 | Ga0495670_0037095_531_2291 | 543 |
| 315 | 3300046691 | Ga0495670_0061925 | Ga0495670_0061925_141_1865 | 543 |
| 316 | 3300046692 | Ga0495671_0055826 | Ga0495671_0055826_221_1945 | 543 |
| 317 | 3300046794 | Ga0495589_0022217 | Ga0495589_0022217_1459_3183 | 543 |
| 318 | 3300047321 | Ga0495676_0002463 | Ga0495676_0002463_7685_9424 | 543 |
| 319 | 3300047443 | Ga0495687_000143 | Ga0495687_000143_98853_100568 | 543 |
| 320 | 3300047447 | Ga0495685_030530 | Ga0495685_030530_121_1839 | 543 |
| 321 | 3300047470 | Ga0495681_0010372 | Ga0495681_0010372_3520_5244 | 543 |
| 322 | 3300047472 | Ga0495686_0000656 | Ga0495686_0000656_10887_12593 | 543 |
| 323 | 3300048088 | Ga0495602_0005903 | Ga0495602_0005903_10914_12671 | 543 |
| 324 | 3300048091 | Ga0495626_0001009 | Ga0495626_0001009_2465_4198 | 543 |
| 325 | 3300048091 | Ga0495626_0002453 | Ga0495626_0002453_7500_9236 | 543 |
| 326 | 3300048915 | Ga0496112_0099876 | Ga0496112_0099876_383_2014 | 543 |
| 327 | 3300048927 | Ga0496124_0008544 | Ga0496124_0008544_3029_4780 | 543 |
| 328 | 3300049460 | Ga0495682_0002913 | Ga0495682_0002913_5719_7455 | 543 |
| 329 | 3300049851 | Ga0501212_001911 | Ga0501212_001911_533_2173 | 543 |
| 330 | 3300050515 | nmdc:mga0a205_139277_c1 | nmdc:mga0a205_139277_c1_245_1945 | 543 |
| 331 | 3300002738 | JGI25154J39366_1002264 | JGI25154J39366_10022641 | 544 |
| 332 | 3300002774 | JGI25150J39212_1001645 | JGI25150J39212_10016452 | 544 |
| 333 | 3300002987 | JGI25159J45721_1004474 | JGI25159J45721_10044742 | 544 |
| 334 | 3300003693 | Ga0032354_1086905 | Ga0032354_10869052 | 544 |
| 335 | 3300003771 | Ga0055526_1000161 | Ga0055526_100016123 | 544 |
| 336 | 3300003771 | Ga0055526_1000309 | Ga0055526_100030923 | 544 |
| 337 | 3300003775 | Ga0055524_1000015 | Ga0055524_1000015157 | 544 |
| 338 | 3300005262 | Ga0065165_1000224 | Ga0065165_100022430 | 544 |
| 339 | 3300005366 | Ga0070659_100038344 | Ga0070659_1000383442 | 544 |
| 340 | 3300006948 | Ga0099826_10000003 | Ga0099826_10000003265 | 544 |
| 341 | 3300009036 | Ga0105244_10022293 | Ga0105244_100222932 | 544 |
| 342 | 3300025233 | Ga0209437_106718 | Ga0209437_1067182 | 544 |
| 343 | 3300025245 | Ga0207425_1000474 | Ga0207425_100047422 | 544 |
| 344 | 3300025246 | Ga0209646_1000028 | Ga0209646_100002893 | 544 |
| 345 | 3300025284 | Ga0209130_1000044 | Ga0209130_1000044131 | 544 |
| 346 | 3300025294 | Ga0209025_1014127 | Ga0209025_10141273 | 544 |
| 347 | 3300025295 | Ga0209564_1000006 | Ga0209564_1000006105 | 544 |
| 348 | 3300025295 | Ga0209564_1000038 | Ga0209564_100003873 | 544 |
| 349 | 3300025297 | Ga0209758_1000149 | Ga0209758_1000149148 | 544 |
| 350 | 3300025299 | Ga0209256_1000005 | Ga0209256_1000005158 | 544 |
| 351 | 3300025728 | Ga0207655_1021874 | Ga0207655_10218742 | 544 |
| 352 | 3300025919 | Ga0207657_10004692 | Ga0207657_100046924 | 544 |
| 353 | 3300027666 | Ga0209282_1000002 | Ga0209282_1000002732 | 544 |
| 354 | 3300028794 | Ga0307515_10099407 | Ga0307515_100994072 | 544 |
| 355 | 3300031548 | Ga0307408_100000774 | Ga0307408_10000077423 | 544 |
| 356 | 3300037312 | Ga0395899_0000715 | Ga0395899_0000715_7054_8766 | 544 |
| 357 | 3300037418 | Ga0395900_0000372 | Ga0395900_0000372_3051_4772 | 544 |
| 358 | 3300037418 | Ga0395900_0049778 | Ga0395900_0049778_149_1861 | 544 |
| 359 | 3300037418 | Ga0395900_0086306 | Ga0395900_0086306_48_1757 | 544 |
| 360 | 3300037471 | Ga0395905_0018620 | Ga0395905_0018620_1869_3581 | 544 |
| 361 | 3300038443 | Ga0395901_0001123 | Ga0395901_0001123_3464_5173 | 544 |
| 362 | 3300039447 | Ga0436361_0872359 | Ga0436361_0872359_673_2385 | 544 |
| 363 | 3300042008 | Ga0439450_002379 | Ga0439450_002379_984_2696 | 544 |
| 364 | 3300044658 | Ga0466972_0001600 | Ga0466972_0001600_3612_5321 | 544 |
| 365 | 3300044684 | Ga0466966_0001121 | Ga0466966_0001121_210_1919 | 544 |
| 366 | 3300045049 | Ga0466959_0027945 | Ga0466959_0027945_2137_3846 | 544 |
| 367 | 3300046452 | Ga0495617_000147 | Ga0495617_000147_24731_26470 | 544 |
| 368 | 3300046452 | Ga0495617_012984 | Ga0495617_012984_976_2673 | 544 |
| 369 | 3300046453 | Ga0495627_000006 | Ga0495627_000006_29889_31589 | 544 |
| 370 | 3300046457 | Ga0495590_0000004 | Ga0495590_0000004_400248_401948 | 544 |
| 371 | 3300046460 | Ga0495638_0000066 | Ga0495638_0000066_21251_22951 | 544 |
| 372 | 3300046463 | Ga0495653_0000037 | Ga0495653_0000037_5376_7076 | 544 |
| 373 | 3300046471 | Ga0495650_0000695 | Ga0495650_0000695_18719_20419 | 544 |
| 374 | 3300046471 | Ga0495650_0000871 | Ga0495650_0000871_17626_19326 | 544 |
| 375 | 3300046474 | Ga0495605_0000003 | Ga0495605_0000003_384532_386244 | 544 |
| 376 | 3300046474 | Ga0495605_0000034 | Ga0495605_0000034_195164_196876 | 544 |
| 377 | 3300046474 | Ga0495605_0003564 | Ga0495605_0003564_3677_5410 | 544 |
| 378 | 3300046474 | Ga0495605_0022360 | Ga0495605_0022360_129_1844 | 544 |
| 379 | 3300046475 | Ga0495639_0014226 | Ga0495639_0014226_1247_2947 | 544 |
| 380 | 3300046491 | Ga0495584_0000345 | Ga0495584_0000345_28286_29995 | 544 |
| 381 | 3300046491 | Ga0495584_0000401 | Ga0495584_0000401_10395_12095 | 544 |
| 382 | 3300046491 | Ga0495584_0002836 | Ga0495584_0002836_5558_7273 | 544 |
| 383 | 3300046491 | Ga0495584_0002986 | Ga0495584_0002986_6037_7767 | 544 |
| 384 | 3300046491 | Ga0495584_0005999 | Ga0495584_0005999_300_2018 | 544 |
| 385 | 3300046491 | Ga0495584_0017380 | Ga0495584_0017380_312_2036 | 544 |
| 386 | 3300046492 | Ga0495585_0000941 | Ga0495585_0000941_10025_11755 | 544 |
| 387 | 3300046492 | Ga0495585_0003330 | Ga0495585_0003330_2513_4270 | 544 |
| 388 | 3300046492 | Ga0495585_0009300 | Ga0495585_0009300_2354_4051 | 544 |
| 389 | 3300046492 | Ga0495585_0026537 | Ga0495585_0026537_625_2325 | 544 |
| 390 | 3300046501 | Ga0495607_0000398 | Ga0495607_0000398_38232_39947 | 544 |
| 391 | 3300046501 | Ga0495607_0002518 | Ga0495607_0002518_10777_12489 | 544 |
| 392 | 3300046501 | Ga0495607_0005454 | Ga0495607_0005454_7287_9029 | 544 |
| 393 | 3300046506 | Ga0495583_0000372 | Ga0495583_0000372_19031_20755 | 544 |
| 394 | 3300046506 | Ga0495583_0000600 | Ga0495583_0000600_20590_22290 | 544 |
| 395 | 3300046506 | Ga0495583_0040612 | Ga0495583_0040612_345_2087 | 544 |
| 396 | 3300046507 | Ga0495606_0000268 | Ga0495606_0000268_21852_23552 | 544 |
| 397 | 3300046507 | Ga0495606_0001211 | Ga0495606_0001211_5324_7066 | 544 |
| 398 | 3300046507 | Ga0495606_0001586 | Ga0495606_0001586_7347_9047 | 544 |
| 399 | 3300046507 | Ga0495606_0004274 | Ga0495606_0004274_1697_3397 | 544 |
| 400 | 3300046507 | Ga0495606_0011433 | Ga0495606_0011433_174_1874 | 544 |
| 401 | 3300046507 | Ga0495606_0037147 | Ga0495606_0037147_540_2252 | 544 |
| 402 | 3300046512 | Ga0495610_0000004 | Ga0495610_0000004_402717_404417 | 544 |
| 403 | 3300046512 | Ga0495610_0001082 | Ga0495610_0001082_12410_14110 | 544 |
| 404 | 3300046513 | Ga0495616_0000378 | Ga0495616_0000378_20326_22023 | 544 |
| 405 | 3300046513 | Ga0495616_0009424 | Ga0495616_0009424_3299_5014 | 544 |
| 406 | 3300046519 | Ga0495632_0004693 | Ga0495632_0004693_2790_4514 | 544 |
| 407 | 3300046520 | Ga0495637_0000991 | Ga0495637_0000991_1544_3244 | 544 |
| 408 | 3300046522 | Ga0495643_0000453 | Ga0495643_0000453_22445_24157 | 544 |
| 409 | 3300046522 | Ga0495643_0000626 | Ga0495643_0000626_19206_20903 | 544 |
| 410 | 3300046522 | Ga0495643_0000661 | Ga0495643_0000661_15083_16783 | 544 |
| 411 | 3300046523 | Ga0495644_0020657 | Ga0495644_0020657_681_2405 | 544 |
| 412 | 3300046524 | Ga0495648_0000045 | Ga0495648_0000045_77203_78903 | 544 |
| 413 | 3300046524 | Ga0495648_0004611 | Ga0495648_0004611_6778_8478 | 544 |
| 414 | 3300046524 | Ga0495648_0018963 | Ga0495648_0018963_2955_4667 | 544 |
| 415 | 3300046524 | Ga0495648_0080197 | Ga0495648_0080197_146_1846 | 544 |
| 416 | 3300046528 | Ga0495642_0000485 | Ga0495642_0000485_9818_11530 | 544 |
| 417 | 3300046528 | Ga0495642_0005862 | Ga0495642_0005862_455_2173 | 544 |
| 418 | 3300046530 | Ga0495654_0009140 | Ga0495654_0009140_2761_4461 | 544 |
| 419 | 3300046538 | Ga0495609_0000002 | Ga0495609_0000002_376250_377965 | 544 |
| 420 | 3300046538 | Ga0495609_0001921 | Ga0495609_0001921_7130_8830 | 544 |
| 421 | 3300046538 | Ga0495609_0017017 | Ga0495609_0017017_1275_2975 | 544 |
| 422 | 3300046542 | Ga0495597_0000409 | Ga0495597_0000409_30064_31761 | 544 |
| 423 | 3300046542 | Ga0495597_0009351 | Ga0495597_0009351_1615_3315 | 544 |
| 424 | 3300046558 | Ga0495633_0000401 | Ga0495633_0000401_16635_18335 | 544 |
| 425 | 3300046558 | Ga0495633_0000527 | Ga0495633_0000527_14615_16324 | 544 |
| 426 | 3300046558 | Ga0495633_0001332 | Ga0495633_0001332_6614_8344 | 544 |
| 427 | 3300046558 | Ga0495633_0002100 | Ga0495633_0002100_1666_3366 | 544 |
| 428 | 3300046616 | Ga0495668_0000025 | Ga0495668_0000025_173393_175102 | 544 |
| 429 | 3300046616 | Ga0495668_0000274 | Ga0495668_0000274_35142_36866 | 544 |
| 430 | 3300046616 | Ga0495668_0001238 | Ga0495668_0001238_60_1760 | 544 |
| 431 | 3300046616 | Ga0495668_0002219 | Ga0495668_0002219_6366_8066 | 544 |
| 432 | 3300046648 | Ga0495611_0001877 | Ga0495611_0001877_4166_5890 | 544 |
| 433 | 3300046648 | Ga0495611_0002974 | Ga0495611_0002974_4011_5708 | 544 |
| 434 | 3300046660 | Ga0495625_0002274 | Ga0495625_0002274_2763_4463 | 544 |
| 435 | 3300046660 | Ga0495625_0006331 | Ga0495625_0006331_3678_5378 | 544 |
| 436 | 3300046660 | Ga0495625_0022531 | Ga0495625_0022531_480_2186 | 544 |
| 437 | 3300046660 | Ga0495625_0078564 | Ga0495625_0078564_197_1894 | 544 |
| 438 | 3300046664 | Ga0495659_0000124 | Ga0495659_0000124_32157_33857 | 544 |
| 439 | 3300046665 | Ga0495661_0000281 | Ga0495661_0000281_10519_12234 | 544 |
| 440 | 3300046665 | Ga0495661_0000980 | Ga0495661_0000980_11215_12945 | 544 |
| 441 | 3300046665 | Ga0495661_0011882 | Ga0495661_0011882_258_1967 | 544 |
| 442 | 3300046665 | Ga0495661_0037848 | Ga0495661_0037848_84_1796 | 544 |
| 443 | 3300046674 | Ga0495588_0000177 | Ga0495588_0000177_41855_43567 | 544 |
| 444 | 3300046691 | Ga0495670_0000312 | Ga0495670_0000312_8462_10192 | 544 |
| 445 | 3300046691 | Ga0495670_0001319 | Ga0495670_0001319_4733_6430 | 544 |
| 446 | 3300046691 | Ga0495670_0018547 | Ga0495670_0018547_150_1868 | 544 |
| 447 | 3300046692 | Ga0495671_0000001 | Ga0495671_0000001_1050182_1051882 | 544 |
| 448 | 3300046692 | Ga0495671_0000575 | Ga0495671_0000575_10393_12093 | 544 |
| 449 | 3300046692 | Ga0495671_0025379 | Ga0495671_0025379_785_2485 | 544 |
| 450 | 3300046694 | Ga0495649_0007938 | Ga0495649_0007938_1769_3493 | 544 |
| 451 | 3300046694 | Ga0495649_0015329 | Ga0495649_0015329_171_1871 | 544 |
| 452 | 3300046794 | Ga0495589_0000230 | Ga0495589_0000230_34535_36250 | 544 |
| 453 | 3300046794 | Ga0495589_0001364 | Ga0495589_0001364_1649_3361 | 544 |
| 454 | 3300046794 | Ga0495589_0035253 | Ga0495589_0035253_583_2307 | 544 |
| 455 | 3300046810 | Ga0495660_0000026 | Ga0495660_0000026_243344_245056 | 544 |
| 456 | 3300046810 | Ga0495660_0002729 | Ga0495660_0002729_284_2008 | 544 |
| 457 | 3300046810 | Ga0495660_0002963 | Ga0495660_0002963_5856_7556 | 544 |
| 458 | 3300046810 | Ga0495660_0004933 | Ga0495660_0004933_3030_4730 | 544 |
| 459 | 3300046810 | Ga0495660_0016405 | Ga0495660_0016405_835_2535 | 544 |
| 460 | 3300047315 | Ga0495581_0007297 | Ga0495581_0007297_2314_4032 | 544 |
| 461 | 3300047318 | Ga0495636_0005273 | Ga0495636_0005273_2808_4550 | 544 |
| 462 | 3300047320 | Ga0495672_0000045 | Ga0495672_0000045_198086_199786 | 544 |
| 463 | 3300047320 | Ga0495672_0000505 | Ga0495672_0000505_40133_41833 | 544 |
| 464 | 3300047320 | Ga0495672_0001178 | Ga0495672_0001178_15647_17371 | 544 |
| 465 | 3300047320 | Ga0495672_0003428 | Ga0495672_0003428_152_1864 | 544 |
| 466 | 3300047323 | Ga0495683_0006600 | Ga0495683_0006600_4571_6295 | 544 |
| 467 | 3300047323 | Ga0495683_0009925 | Ga0495683_0009925_2017_3717 | 544 |
| 468 | 3300047443 | Ga0495687_000013 | Ga0495687_000013_358891_360606 | 544 |
| 469 | 3300047443 | Ga0495687_000280 | Ga0495687_000280_2365_4077 | 544 |
| 470 | 3300047443 | Ga0495687_001126 | Ga0495687_001126_1675_3375 | 544 |
| 471 | 3300047443 | Ga0495687_001213 | Ga0495687_001213_21268_22968 | 544 |
| 472 | 3300047445 | Ga0495677_0000041 | Ga0495677_0000041_45699_47414 | 544 |
| 473 | 3300047445 | Ga0495677_0005929 | Ga0495677_0005929_211_1923 | 544 |
| 474 | 3300047446 | Ga0495679_002516 | Ga0495679_002516_5895_7619 | 544 |
| 475 | 3300047469 | Ga0495673_0000006 | Ga0495673_0000006_131523_133223 | 544 |
| 476 | 3300047469 | Ga0495673_0000014 | Ga0495673_0000014_349328_351028 | 544 |
| 477 | 3300047469 | Ga0495673_0000017 | Ga0495673_0000017_80467_82167 | 544 |
| 478 | 3300047470 | Ga0495681_0000815 | Ga0495681_0000815_12627_14357 | 544 |
| 479 | 3300047470 | Ga0495681_0017512 | Ga0495681_0017512_411_2135 | 544 |
| 480 | 3300048091 | Ga0495626_0000383 | Ga0495626_0000383_9855_11570 | 544 |
| 481 | 3300048091 | Ga0495626_0001865 | Ga0495626_0001865_2383_4095 | 544 |
| 482 | 3300048091 | Ga0495626_0006233 | Ga0495626_0006233_4938_6671 | 544 |
| 483 | 3300048905 | Ga0496102_0000454 | Ga0496102_0000454_43086_44822 | 544 |
| 484 | 3300048906 | Ga0496103_0026176 | Ga0496103_0026176_1103_2827 | 544 |
| 485 | 3300048909 | Ga0496106_0011144 | Ga0496106_0011144_1452_3164 | 544 |
| 486 | 3300048919 | Ga0496116_0040323 | Ga0496116_0040323_1121_2821 | 544 |
| 487 | 3300048924 | Ga0496121_0025979 | Ga0496121_0025979_3496_5196 | 544 |
| 488 | 3300048925 | Ga0496122_0059997 | Ga0496122_0059997_614_2326 | 544 |
| 489 | 3300048926 | Ga0496123_0007447 | Ga0496123_0007447_6897_8609 | 544 |
| 490 | 3300048927 | Ga0496124_0024873 | Ga0496124_0024873_2908_4632 | 544 |
| 491 | 3300049459 | Ga0495678_000042 | Ga0495678_000042_157397_159097 | 544 |
| 492 | 3300049459 | Ga0495678_001513 | Ga0495678_001513_3240_4940 | 544 |
| 493 | 3300049459 | Ga0495678_014117 | Ga0495678_014117_1700_3400 | 544 |
| 494 | 3300049671 | Ga0501238_000859 | Ga0501238_000859_676_2376 | 544 |
| 495 | 3300049822 | Ga0501035_0003621 | Ga0501035_0003621_8706_10418 | 544 |
| 496 | 3300053145 | Ga0500586_004143 | Ga0500586_004143_1625_3325 | 544 |
| 497 | 3300003759 | Ga0055525_1000009 | Ga0055525_100000921 | 545 |
| 498 | 3300005262 | Ga0065165_1000286 | Ga0065165_100028624 | 545 |
| 499 | 3300005327 | Ga0070658_10097302 | Ga0070658_100973021 | 545 |
| 500 | 3300005439 | Ga0070711_100000055 | Ga0070711_1000000553 | 545 |
| 501 | 3300005457 | Ga0070662_100037956 | Ga0070662_1000379561 | 545 |
| 502 | 3300005617 | Ga0068859_100000001 | Ga0068859_100000001259 | 545 |
| 503 | 3300006931 | Ga0097620_100000001 | Ga0097620_100000001259 | 545 |
| 504 | 3300009098 | Ga0105245_10037375 | Ga0105245_100373751 | 545 |
| 505 | 3300009148 | Ga0105243_10008155 | Ga0105243_100081556 | 545 |
| 506 | 3300009174 | Ga0105241_10065793 | Ga0105241_100657931 | 545 |
| 507 | 3300013296 | Ga0157374_10224282 | Ga0157374_102242821 | 545 |
| 508 | 3300015261 | Ga0182006_1000268 | Ga0182006_100026819 | 545 |
| 509 | 3300015265 | Ga0182005_1000018 | Ga0182005_1000018225 | 545 |
| 510 | 3300025230 | Ga0209563_100015 | Ga0209563_100015134 | 545 |
| 511 | 3300025254 | Ga0209148_1000741 | Ga0209148_100074118 | 545 |
| 512 | 3300025909 | Ga0207705_10051373 | Ga0207705_100513732 | 545 |
| 513 | 3300025911 | Ga0207654_10011450 | Ga0207654_100114505 | 545 |
| 514 | 3300025933 | Ga0207706_10042700 | Ga0207706_100427001 | 545 |
| 515 | 3300025935 | Ga0207709_10006794 | Ga0207709_100067946 | 545 |
| 516 | 3300037471 | Ga0395905_0031408 | Ga0395905_0031408_1470_3215 | 545 |
| 517 | 3300037471 | Ga0395905_0049000 | Ga0395905_0049000_1682_3409 | 545 |
| 518 | 3300038443 | Ga0395901_0004045 | Ga0395901_0004045_2743_4470 | 545 |
| 519 | 3300042005 | Ga0439448_0001145 | Ga0439448_0001145_4762_6480 | 545 |
| 520 | 3300044842 | Ga0466957_0000545 | Ga0466957_0000545_10028_11767 | 545 |
| 521 | 3300045976 | Ga0466967_0004194 | Ga0466967_0004194_318_2045 | 545 |
| 522 | 3300045976 | Ga0466967_0045615 | Ga0466967_0045615_662_2386 | 545 |
| 523 | 3300046457 | Ga0495590_0000025 | Ga0495590_0000025_103264_105015 | 545 |
| 524 | 3300046458 | Ga0495591_000246 | Ga0495591_000246_25425_27176 | 545 |
| 525 | 3300046460 | Ga0495638_0025016 | Ga0495638_0025016_1445_3187 | 545 |
| 526 | 3300046474 | Ga0495605_0028603 | Ga0495605_0028603_1024_2781 | 545 |
| 527 | 3300046491 | Ga0495584_0000070 | Ga0495584_0000070_25515_27266 | 545 |
| 528 | 3300046499 | Ga0495594_0029580 | Ga0495594_0029580_560_2311 | 545 |
| 529 | 3300046501 | Ga0495607_0004773 | Ga0495607_0004773_2327_4078 | 545 |
| 530 | 3300046506 | Ga0495583_0000382 | Ga0495583_0000382_24109_25860 | 545 |
| 531 | 3300046506 | Ga0495583_0007066 | Ga0495583_0007066_3066_4808 | 545 |
| 532 | 3300046512 | Ga0495610_0000229 | Ga0495610_0000229_26078_27829 | 545 |
| 533 | 3300046518 | Ga0495631_0001464 | Ga0495631_0001464_2552_4294 | 545 |
| 534 | 3300046520 | Ga0495637_0000019 | Ga0495637_0000019_16205_17956 | 545 |
| 535 | 3300046520 | Ga0495637_0003088 | Ga0495637_0003088_7056_8867 | 545 |
| 536 | 3300046524 | Ga0495648_0004308 | Ga0495648_0004308_4151_5893 | 545 |
| 537 | 3300046538 | Ga0495609_0010671 | Ga0495609_0010671_1429_3189 | 545 |
| 538 | 3300046542 | Ga0495597_0000812 | Ga0495597_0000812_14427_16169 | 545 |
| 539 | 3300046542 | Ga0495597_0005958 | Ga0495597_0005958_1844_3601 | 545 |
| 540 | 3300046558 | Ga0495633_0002968 | Ga0495633_0002968_2346_4097 | 545 |
| 541 | 3300046616 | Ga0495668_0000544 | Ga0495668_0000544_38958_40700 | 545 |
| 542 | 3300046648 | Ga0495611_0000195 | Ga0495611_0000195_25845_27596 | 545 |
| 543 | 3300046648 | Ga0495611_0000773 | Ga0495611_0000773_15821_17551 | 545 |
| 544 | 3300046674 | Ga0495588_0035646 | Ga0495588_0035646_528_2279 | 545 |
| 545 | 3300046684 | Ga0495669_0004319 | Ga0495669_0004319_2668_4398 | 545 |
| 546 | 3300046694 | Ga0495649_0000277 | Ga0495649_0000277_18074_19825 | 545 |
| 547 | 3300046794 | Ga0495589_0000535 | Ga0495589_0000535_7193_8935 | 545 |
| 548 | 3300046794 | Ga0495589_0044531 | Ga0495589_0044531_171_1928 | 545 |
| 549 | 3300047320 | Ga0495672_0000041 | Ga0495672_0000041_171601_173352 | 545 |
| 550 | 3300047320 | Ga0495672_0017777 | Ga0495672_0017777_962_2719 | 545 |
| 551 | 3300047321 | Ga0495676_0000309 | Ga0495676_0000309_20650_22470 | 545 |
| 552 | 3300047323 | Ga0495683_0000763 | Ga0495683_0000763_11136_12887 | 545 |
| 553 | 3300047443 | Ga0495687_000127 | Ga0495687_000127_98570_100330 | 545 |
| 554 | 3300047445 | Ga0495677_0000210 | Ga0495677_0000210_10689_12440 | 545 |
| 555 | 3300047446 | Ga0495679_001712 | Ga0495679_001712_7091_8833 | 545 |
| 556 | 3300047472 | Ga0495686_0000732 | Ga0495686_0000732_9452_11203 | 545 |
| 557 | 3300048905 | Ga0496102_0022302 | Ga0496102_0022302_916_2640 | 545 |
| 558 | 3300048908 | Ga0496105_0168157 | Ga0496105_0168157_20_1750 | 545 |
| 559 | 3300048925 | Ga0496122_0001558 | Ga0496122_0001558_3602_5326 | 545 |
| 560 | 3300048926 | Ga0496123_0031575 | Ga0496123_0031575_1095_2819 | 545 |
| 561 | 3300049459 | Ga0495678_000233 | Ga0495678_000233_34564_36294 | 545 |
| 562 | 3300049459 | Ga0495678_000316 | Ga0495678_000316_26157_28010 | 545 |
| 563 | 3300049460 | Ga0495682_0001172 | Ga0495682_0001172_10048_11799 | 545 |
| 564 | 3300006846 | Ga0075430_100043903 | Ga0075430_1000439032 | 546 |
| 565 | 3300044673 | Ga0453683_0011548 | Ga0453683_0011548_4073_5752 | 546 |
| 566 | 3300046473 | Ga0495582_0038166 | Ga0495582_0038166_772_2547 | 546 |
| 567 | 3300046542 | Ga0495597_0001519 | Ga0495597_0001519_5835_7589 | 546 |
| 568 | 3300047317 | Ga0495604_0058512 | Ga0495604_0058512_120_1895 | 546 |
| 569 | 3300046452 | Ga0495617_000002 | Ga0495617_000002_613263_615020 | 547 |
| 570 | 3300046453 | Ga0495627_000207 | Ga0495627_000207_39914_41671 | 547 |
| 571 | 3300046474 | Ga0495605_0000293 | Ga0495605_0000293_20130_21887 | 547 |
| 572 | 3300046474 | Ga0495605_0036014 | Ga0495605_0036014_542_2293 | 547 |
| 573 | 3300046513 | Ga0495616_0000207 | Ga0495616_0000207_17045_18784 | 547 |
| 574 | 3300046518 | Ga0495631_0003789 | Ga0495631_0003789_29_1786 | 547 |
| 575 | 3300046519 | Ga0495632_0000296 | Ga0495632_0000296_30689_32428 | 547 |
| 576 | 3300046524 | Ga0495648_0001105 | Ga0495648_0001105_17163_18920 | 547 |
| 577 | 3300046528 | Ga0495642_0000085 | Ga0495642_0000085_29840_31597 | 547 |
| 578 | 3300046528 | Ga0495642_0000285 | Ga0495642_0000285_16126_17865 | 547 |
| 579 | 3300046616 | Ga0495668_0000941 | Ga0495668_0000941_14323_16080 | 547 |
| 580 | 3300046665 | Ga0495661_0002244 | Ga0495661_0002244_5560_7317 | 547 |
| 581 | 3300046674 | Ga0495588_0019032 | Ga0495588_0019032_417_2156 | 547 |
| 582 | 3300046684 | Ga0495669_0001901 | Ga0495669_0001901_909_2666 | 547 |
| 583 | 3300046684 | Ga0495669_0002014 | Ga0495669_0002014_1980_3719 | 547 |
| 584 | 3300046692 | Ga0495671_0000965 | Ga0495671_0000965_1383_3140 | 547 |
| 585 | 3300047470 | Ga0495681_0000667 | Ga0495681_0000667_7477_9237 | 547 |
| 586 | 3300048905 | Ga0496102_0000931 | Ga0496102_0000931_4826_6583 | 547 |
| 587 | 3300005618 | Ga0068864_100106835 | Ga0068864_1001068352 | 548 |
| 588 | 3300046474 | Ga0495605_0020413 | Ga0495605_0020413_671_2443 | 548 |
| 589 | 3300046500 | Ga0495596_0000838 | Ga0495596_0000838_15022_16794 | 548 |
| 590 | 3300046524 | Ga0495648_0032006 | Ga0495648_0032006_675_2447 | 548 |
| 591 | 3300047320 | Ga0495672_0000748 | Ga0495672_0000748_6191_7963 | 548 |
| 592 | 3300009147 | Ga0114129_10038360 | Ga0114129_100383606 | 549 |
| 593 | 3300013307 | Ga0157372_10002676 | Ga0157372_1000267624 | 549 |
| 594 | 3300021384 | Ga0213876_10031836 | Ga0213876_100318362 | 549 |
| 595 | 3300025913 | Ga0207695_10008579 | Ga0207695_100085795 | 549 |
| 596 | 3300032005 | Ga0307411_10062329 | Ga0307411_100623292 | 549 |
| 597 | 3300039437 | Ga0436365_1170609 | Ga0436365_1170609_582_2267 | 549 |
| 598 | 3300050507 | nmdc:mga05p37_60640_c1 | nmdc:mga05p37_60640_c1_2437_4098 | 549 |
| 599 | 3300005438 | Ga0070701_10039354 | Ga0070701_100393542 | 550 |
| 600 | 3300006846 | Ga0075430_100056655 | Ga0075430_1000566552 | 550 |
| 601 | 3300006847 | Ga0075431_100056603 | Ga0075431_1000566032 | 550 |
| 602 | 3300009147 | Ga0114129_10111378 | Ga0114129_101113782 | 550 |
| 603 | 3300013306 | Ga0163162_10070910 | Ga0163162_100709101 | 550 |
| 604 | 3300025907 | Ga0207645_10055294 | Ga0207645_100552942 | 550 |
| 605 | 3300026075 | Ga0207708_10036784 | Ga0207708_100367841 | 550 |
| 606 | 3300050508 | nmdc:mga09592_150152_c1 | nmdc:mga09592_150152_c1_170_1834 | 550 |
| 607 | 3300050510 | nmdc:mga06r32_232889_c1 | nmdc:mga06r32_232889_c1_74_1738 | 550 |
| 608 | 3300005330 | Ga0070690_100001410 | Ga0070690_1000014102 | 551 |
| 609 | 3300005544 | Ga0070686_100099080 | Ga0070686_1000990801 | 551 |
| 610 | 3300005617 | Ga0068859_100146528 | Ga0068859_1001465282 | 551 |
| 611 | 3300006846 | Ga0075430_100052667 | Ga0075430_1000526673 | 551 |
| 612 | 3300006931 | Ga0097620_100146524 | Ga0097620_1001465242 | 551 |
| 613 | 3300013297 | Ga0157378_10042915 | Ga0157378_100429152 | 551 |
| 614 | 3300005334 | Ga0068869_100034319 | Ga0068869_1000343192 | 552 |
| 615 | 3300005337 | Ga0070682_100001655 | Ga0070682_1000016551 | 552 |
| 616 | 3300005337 | Ga0070682_100020846 | Ga0070682_1000208463 | 552 |
| 617 | 3300005340 | Ga0070689_100012356 | Ga0070689_1000123563 | 552 |
| 618 | 3300005366 | Ga0070659_100012300 | Ga0070659_1000123004 | 552 |
| 619 | 3300005444 | Ga0070694_100028495 | Ga0070694_1000284952 | 552 |
| 620 | 3300005444 | Ga0070694_100080250 | Ga0070694_1000802501 | 552 |
| 621 | 3300005444 | Ga0070694_100089146 | Ga0070694_1000891461 | 552 |
| 622 | 3300005458 | Ga0070681_10007691 | Ga0070681_100076912 | 552 |
| 623 | 3300005458 | Ga0070681_10014121 | Ga0070681_100141214 | 552 |
| 624 | 3300005467 | Ga0070706_100000137 | Ga0070706_1000001376 | 552 |
| 625 | 3300005618 | Ga0068864_100025978 | Ga0068864_1000259784 | 552 |
| 626 | 3300005985 | Ga0081539_10029181 | Ga0081539_100291812 | 552 |
| 627 | 3300006237 | Ga0097621_100060162 | Ga0097621_1000601622 | 552 |
| 628 | 3300006358 | Ga0068871_100008018 | Ga0068871_1000080187 | 552 |
| 629 | 3300006852 | Ga0075433_10047913 | Ga0075433_100479131 | 552 |
| 630 | 3300006880 | Ga0075429_100084433 | Ga0075429_1000844332 | 552 |
| 631 | 3300009094 | Ga0111539_10123413 | Ga0111539_101234131 | 552 |
| 632 | 3300009545 | Ga0105237_10000903 | Ga0105237_1000090333 | 552 |
| 633 | 3300009551 | Ga0105238_10003887 | Ga0105238_100038875 | 552 |
| 634 | 3300011119 | Ga0105246_10125201 | Ga0105246_101252011 | 552 |
| 635 | 3300013100 | Ga0157373_10045612 | Ga0157373_100456123 | 552 |
| 636 | 3300014325 | Ga0163163_10024980 | Ga0163163_100249804 | 552 |
| 637 | 3300014325 | Ga0163163_10037271 | Ga0163163_100372711 | 552 |
| 638 | 3300014326 | Ga0157380_10069130 | Ga0157380_100691302 | 552 |
| 639 | 3300014326 | Ga0157380_10106074 | Ga0157380_101060742 | 552 |
| 640 | 3300025885 | Ga0207653_10003134 | Ga0207653_100031343 | 552 |
| 641 | 3300025904 | Ga0207647_10003657 | Ga0207647_100036578 | 552 |
| 642 | 3300025910 | Ga0207684_10000314 | Ga0207684_100003145 | 552 |
| 643 | 3300025912 | Ga0207707_10006367 | Ga0207707_100063674 | 552 |
| 644 | 3300025912 | Ga0207707_10024302 | Ga0207707_100243021 | 552 |
| 645 | 3300025914 | Ga0207671_10004805 | Ga0207671_100048059 | 552 |
| 646 | 3300025936 | Ga0207670_10007735 | Ga0207670_100077353 | 552 |
| 647 | 3300025942 | Ga0207689_10012384 | Ga0207689_100123842 | 552 |
| 648 | 3300026035 | Ga0207703_10062490 | Ga0207703_100624901 | 552 |
| 649 | 3300026078 | Ga0207702_10015334 | Ga0207702_100153341 | 552 |
| 650 | 3300026095 | Ga0207676_10091378 | Ga0207676_100913782 | 552 |
| 651 | 3300026116 | Ga0207674_10001412 | Ga0207674_1000141230 | 552 |
| 652 | 3300026118 | Ga0207675_100007738 | Ga0207675_1000077382 | 552 |
| 653 | 3300027907 | Ga0207428_10105532 | Ga0207428_101055322 | 552 |
| 654 | 3300028381 | Ga0268264_10079077 | Ga0268264_100790772 | 552 |
| 655 | 3300031852 | Ga0307410_10002233 | Ga0307410_100022336 | 552 |
| 656 | 3300049649 | Ga0501198_001067 | Ga0501198_001067_1166_2833 | 552 |
| 657 | 3300049663 | Ga0501223_000399 | Ga0501223_000399_7437_9104 | 552 |
| 658 | 3300049665 | Ga0501227_000931 | Ga0501227_000931_1004_2671 | 552 |
| 659 | 3300049686 | Ga0501257_002375 | Ga0501257_002375_435_2102 | 552 |
| 660 | 3300049704 | Ga0501221_003830 | Ga0501221_003830_606_2270 | 552 |
| 661 | 3300049705 | Ga0501225_0002188 | Ga0501225_0002188_2549_4216 | 552 |
| 662 | 3300049705 | Ga0501225_0011682 | Ga0501225_0011682_290_1954 | 552 |
| 663 | 3300050507 | nmdc:mga05p37_19426_c1 | nmdc:mga05p37_19426_c1_2544_4202 | 552 |
| 664 | 3300054114 | Ga0501084_0109808 | Ga0501084_0109808_77_1753 | 552 |
| 665 | 3300000532 | CNAas_1000265 | CNAas_10002651 | 553 |
| 666 | 3300002459 | JGI24751J29686_10000044 | JGI24751J29686_1000004436 | 553 |
| 667 | 3300003203 | JGI25406J46586_10001956 | JGI25406J46586_100019563 | 553 |
| 668 | 3300005288 | Ga0065714_10064531 | Ga0065714_1006453131 | 553 |
| 669 | 3300005290 | Ga0065712_10000123 | Ga0065712_100001236 | 553 |
| 670 | 3300005293 | Ga0065715_10013050 | Ga0065715_100130502 | 553 |
| 671 | 3300005330 | Ga0070690_100002314 | Ga0070690_1000023147 | 553 |
| 672 | 3300005331 | Ga0070670_100000144 | Ga0070670_10000014430 | 553 |
| 673 | 3300005334 | Ga0068869_100034758 | Ga0068869_1000347582 | 553 |
| 674 | 3300005334 | Ga0068869_100038074 | Ga0068869_1000380741 | 553 |
| 675 | 3300005338 | Ga0068868_100089034 | Ga0068868_1000890343 | 553 |
| 676 | 3300005340 | Ga0070689_100092455 | Ga0070689_1000924552 | 553 |
| 677 | 3300005343 | Ga0070687_100061094 | Ga0070687_1000610941 | 553 |
| 678 | 3300005353 | Ga0070669_100000609 | Ga0070669_10000060928 | 553 |
| 679 | 3300005353 | Ga0070669_100068143 | Ga0070669_1000681431 | 553 |
| 680 | 3300005353 | Ga0070669_100093359 | Ga0070669_1000933592 | 553 |
| 681 | 3300005354 | Ga0070675_100071206 | Ga0070675_1000712062 | 553 |
| 682 | 3300005355 | Ga0070671_100082869 | Ga0070671_1000828692 | 553 |
| 683 | 3300005406 | Ga0070703_10000254 | Ga0070703_1000025415 | 553 |
| 684 | 3300005438 | Ga0070701_10039425 | Ga0070701_100394252 | 553 |
| 685 | 3300005440 | Ga0070705_100000012 | Ga0070705_10000001297 | 553 |
| 686 | 3300005441 | Ga0070700_100000062 | Ga0070700_1000000629 | 553 |
| 687 | 3300005458 | Ga0070681_10000078 | Ga0070681_1000007811 | 553 |
| 688 | 3300005467 | Ga0070706_100001373 | Ga0070706_10000137315 | 553 |
| 689 | 3300005471 | Ga0070698_100013194 | Ga0070698_1000131946 | 553 |
| 690 | 3300005471 | Ga0070698_100025017 | Ga0070698_1000250175 | 553 |
| 691 | 3300005518 | Ga0070699_100002577 | Ga0070699_10000257718 | 553 |
| 692 | 3300005518 | Ga0070699_100005594 | Ga0070699_1000055948 | 553 |
| 693 | 3300005518 | Ga0070699_100078904 | Ga0070699_1000789042 | 553 |
| 694 | 3300005530 | Ga0070679_100000047 | Ga0070679_10000004735 | 553 |
| 695 | 3300005536 | Ga0070697_100088995 | Ga0070697_1000889952 | 553 |
| 696 | 3300005547 | Ga0070693_100000269 | Ga0070693_1000002693 | 553 |
| 697 | 3300005617 | Ga0068859_100006736 | Ga0068859_1000067364 | 553 |
| 698 | 3300005617 | Ga0068859_100094120 | Ga0068859_1000941202 | 553 |
| 699 | 3300005618 | Ga0068864_100032457 | Ga0068864_1000324573 | 553 |
| 700 | 3300005841 | Ga0068863_100052347 | Ga0068863_1000523473 | 553 |
| 701 | 3300005842 | Ga0068858_100025848 | Ga0068858_1000258483 | 553 |
| 702 | 3300005843 | Ga0068860_100035238 | Ga0068860_1000352383 | 553 |
| 703 | 3300005844 | Ga0068862_100016781 | Ga0068862_1000167815 | 553 |
| 704 | 3300005844 | Ga0068862_100050130 | Ga0068862_1000501302 | 553 |
| 705 | 3300005985 | Ga0081539_10000422 | Ga0081539_1000042254 | 553 |
| 706 | 3300005985 | Ga0081539_10004930 | Ga0081539_1000493017 | 553 |
| 707 | 3300006237 | Ga0097621_100028387 | Ga0097621_1000283873 | 553 |
| 708 | 3300006358 | Ga0068871_100054453 | Ga0068871_1000544532 | 553 |
| 709 | 3300006871 | Ga0075434_100020847 | Ga0075434_1000208477 | 553 |
| 710 | 3300006931 | Ga0097620_100006736 | Ga0097620_1000067369 | 553 |
| 711 | 3300006931 | Ga0097620_100094117 | Ga0097620_1000941172 | 553 |
| 712 | 3300007076 | Ga0075435_100019697 | Ga0075435_1000196974 | 553 |
| 713 | 3300009148 | Ga0105243_10080565 | Ga0105243_100805652 | 553 |
| 714 | 3300009148 | Ga0105243_10110704 | Ga0105243_101107042 | 553 |
| 715 | 3300009174 | Ga0105241_10111337 | Ga0105241_101113371 | 553 |
| 716 | 3300009177 | Ga0105248_10000861 | Ga0105248_100008618 | 553 |
| 717 | 3300009177 | Ga0105248_10051156 | Ga0105248_100511563 | 553 |
| 718 | 3300009551 | Ga0105238_10001253 | Ga0105238_1000125320 | 553 |
| 719 | 3300009553 | Ga0105249_10016430 | Ga0105249_100164307 | 553 |
| 720 | 3300010375 | Ga0105239_10030456 | Ga0105239_100304563 | 553 |
| 721 | 3300010375 | Ga0105239_10209090 | Ga0105239_102090902 | 553 |
| 722 | 3300013296 | Ga0157374_10112293 | Ga0157374_101122931 | 553 |
| 723 | 3300013306 | Ga0163162_10006291 | Ga0163162_1000629110 | 553 |
| 724 | 3300013306 | Ga0163162_10033540 | Ga0163162_100335402 | 553 |
| 725 | 3300013307 | Ga0157372_10233711 | Ga0157372_102337112 | 553 |
| 726 | 3300014325 | Ga0163163_10001085 | Ga0163163_1000108519 | 553 |
| 727 | 3300014325 | Ga0163163_10001208 | Ga0163163_1000120814 | 553 |
| 728 | 3300014325 | Ga0163163_10006946 | Ga0163163_100069465 | 553 |
| 729 | 3300014325 | Ga0163163_10198180 | Ga0163163_101981801 | 553 |
| 730 | 3300014968 | Ga0157379_10137220 | Ga0157379_101372202 | 553 |
| 731 | 3300014969 | Ga0157376_10077076 | Ga0157376_100770763 | 553 |
| 732 | 3300017792 | Ga0163161_10035876 | Ga0163161_100358762 | 553 |
| 733 | 3300025910 | Ga0207684_10001424 | Ga0207684_1000142410 | 553 |
| 734 | 3300025910 | Ga0207684_10014100 | Ga0207684_100141006 | 553 |
| 735 | 3300025912 | Ga0207707_10000006 | Ga0207707_10000006279 | 553 |
| 736 | 3300025916 | Ga0207663_10000003 | Ga0207663_10000003346 | 553 |
| 737 | 3300025918 | Ga0207662_10046356 | Ga0207662_100463561 | 553 |
| 738 | 3300025921 | Ga0207652_10001029 | Ga0207652_1000102925 | 553 |
| 739 | 3300025923 | Ga0207681_10001077 | Ga0207681_1000107715 | 553 |
| 740 | 3300025923 | Ga0207681_10054985 | Ga0207681_100549852 | 553 |
| 741 | 3300025925 | Ga0207650_10000047 | Ga0207650_1000004780 | 553 |
| 742 | 3300025925 | Ga0207650_10000542 | Ga0207650_1000054210 | 553 |
| 743 | 3300025931 | Ga0207644_10014449 | Ga0207644_100144492 | 553 |
| 744 | 3300025940 | Ga0207691_10004303 | Ga0207691_1000430310 | 553 |
| 745 | 3300025941 | Ga0207711_10036305 | Ga0207711_100363053 | 553 |
| 746 | 3300025942 | Ga0207689_10020503 | Ga0207689_100205033 | 553 |
| 747 | 3300025942 | Ga0207689_10147406 | Ga0207689_101474061 | 553 |
| 748 | 3300026035 | Ga0207703_10043102 | Ga0207703_100431021 | 553 |
| 749 | 3300026075 | Ga0207708_10000246 | Ga0207708_100002469 | 553 |
| 750 | 3300026075 | Ga0207708_10059437 | Ga0207708_100594372 | 553 |
| 751 | 3300026088 | Ga0207641_10060297 | Ga0207641_100602972 | 553 |
| 752 | 3300026089 | Ga0207648_10009860 | Ga0207648_100098602 | 553 |
| 753 | 3300026095 | Ga0207676_10030712 | Ga0207676_100307122 | 553 |
| 754 | 3300026095 | Ga0207676_10141139 | Ga0207676_101411391 | 553 |
| 755 | 3300026116 | Ga0207674_10012633 | Ga0207674_100126332 | 553 |
| 756 | 3300026118 | Ga0207675_100004692 | Ga0207675_1000046929 | 553 |
| 757 | 3300026118 | Ga0207675_100006123 | Ga0207675_1000061232 | 553 |
| 758 | 3300026121 | Ga0207683_10092724 | Ga0207683_100927242 | 553 |
| 759 | 3300026142 | Ga0207698_10154543 | Ga0207698_101545431 | 553 |
| 760 | 3300028380 | Ga0268265_10133339 | Ga0268265_101333391 | 553 |
| 761 | 3300031852 | Ga0307410_10063431 | Ga0307410_100634312 | 553 |
| 762 | 3300049661 | Ga0501217_007428 | Ga0501217_007428_503_2173 | 553 |
| 763 | 3300050514 | nmdc:mga08x19_10_c1 | nmdc:mga08x19_10_c1_188873_190573 | 553 |
| 764 | 3300050515 | nmdc:mga0a205_200926_c1 | nmdc:mga0a205_200926_c1_101_1777 | 553 |
| 765 | 3300050515 | nmdc:mga0a205_33639_c1 | nmdc:mga0a205_33639_c1_3089_4750 | 553 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6eom-assembly1.cif.gz_A | structure of dpp iii from caldithrix abyssi | 0.9679 | 31 | 551 |
| 6eom-assembly1.cif.gz_A | structure of dpp iii from caldithrix abyssi | 0.9552 | 31 | 551 |
| 5zum-assembly1.cif.gz_B | structure of dipeptidyl-peptidase iii from corallococcus sp. strain egb | 0.9218 | 28 | 552 |
| 5zum-assembly1.cif.gz_B | structure of dipeptidyl-peptidase iii from corallococcus sp. strain egb | 0.8974 | 28 | 552 |
| 5na8-assembly1.cif.gz_A | structure of dpp iii from bacteroides thetaiotaomicron in closed form | 0.8681 | 39 | 546 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6QCD2_379_579_3.30.540.30 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1; | 0.8382 | 148 | 349 | 3.30.540.30 |
| af_A0A1D6QCD2_379_579_3.30.540.30 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1; | 0.8261 | 148 | 349 | 3.30.540.30 |
| af_A0A1D8PQB4_223_346_3.30.540.30 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1; | 0.7451 | 163 | 269 | 3.30.540.30 |
| 5e2qA02 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1; | 0.6934 | 145 | 348 | 3.30.540.30 |
| 5e2qA02 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1; | 0.6777 | 145 | 348 | 3.30.540.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0QES0-F1-model_v4 | Zn-dependent hydrolase | 0.9939 | 164 | 551 |
GO:0005737
GO:0008239 GO:0046872 |
| AF-A0A0L9VIV3-F1-model_v4 | Fis family transcriptional regulator | 0.9932 | 403 | 538 |
GO:0005737
GO:0008239 GO:0046872 |
| AF-A0A2W0B6R4-F1-model_v4 | Uncharacterized protein | 0.9906 | 136 | 236 |
GO:0005737
GO:0008239 GO:0046872 |
| AF-A0A3N5LL21-F1-model_v4 | Uncharacterized protein | 0.9902 | 442 | 549 |
GO:0005737
GO:0008239 GO:0046872 |
| AF-A0A7C7XE90-F1-model_v4 | Peptidase | 0.9889 | 250 | 552 |
GO:0005737
GO:0008239 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar