F479791

General Info

Members Datasets Scaffolds Average Seq Length
765 221 765 170

Family's Representative Sequence

Representative Sequence 3300030745|Ga0316182_1090566|Ga0316182_10905664
Length 167
Sequence MAEATGERSWVRIALVACPAIMLLGSASGWLSNSGYGNDWFAALEKPGFMPPGWLFGVVWPLLYLLMGIALAMILAEPPSALILFFLQLALNFAWSPIFFALHDIRLAKIVIFLMAGVAAAAAGQFFRLRGVAGLLLIPYLAWLVFAATLNAAIESLNPGAGTSLLG

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
152 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
165 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
214 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
215 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
216 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
217 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
218 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
219 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
220 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.66
Rhizosphere 96.08
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1015760 3300001904 Bacteria 1208
2 JGI24741J21665_1010345 3300001915 Bacteria 1672
3 JGI24741J21665_1018026 3300001915 Bacteria 1132
4 JGI24740J21852_10003631 3300001979 Bacteria 6729
5 JGI24740J21852_10016825 3300001979 Bacteria 2633
6 JGI24740J21852_10036761 3300001979 Bacteria 1518
7 JGI24740J21852_10062239 3300001979 Bacteria 1025
8 JGI24739J22299_10001669 3300001989 Bacteria 8435
9 JGI24739J22299_10003871 3300001989 Bacteria 5719
10 JGI24737J22298_10000281 3300001990 Bacteria 16865
11 JGI24737J22298_10001762 3300001990 Bacteria 7740
12 JGI24737J22298_10044984 3300001990 Bacteria 1349
13 JGI24743J22301_10052343 3300001991 Bacteria 833
14 JGI24735J21928_10020928 3300002067 Bacteria 2001
15 JGI24735J21928_10021661 3300002067 Bacteria 1961
16 JGI24748J21848_1012898 3300002074 Bacteria 987
17 JGI24738J21930_10003730 3300002075 Bacteria 3807
18 JGI24034J26672_10012146 3300002239 Bacteria 1295
19 Ga0070658_10000260 3300005327 Bacteria 46341
20 Ga0070658_10014943 3300005327 Bacteria 6216
21 Ga0070658_10018539 3300005327 Bacteria 5572
22 Ga0070658_10219903 3300005327 Bacteria 1606
23 Ga0070658_10339205 3300005327 Bacteria 1285
24 Ga0070658_10421598 3300005327 Bacteria 1148
25 Ga0070658_10487806 3300005327 Bacteria 1064
26 Ga0070658_10539228 3300005327 Bacteria 1009
27 Ga0070658_10969445 3300005327 Bacteria 739
28 Ga0070658_11117415 3300005327 Bacteria 685
29 Ga0070676_10003383 3300005328 Bacteria 8303
30 Ga0070676_10117658 3300005328 Bacteria 1664
31 Ga0070676_10498996 3300005328 Bacteria 864
32 Ga0070683_100001172 3300005329 Bacteria 19853
33 Ga0070683_100478644 3300005329 Bacteria 1189
34 Ga0070683_101235066 3300005329 Unclassified 718
35 Ga0070690_100049588 3300005330 Bacteria 2677
36 Ga0070690_100157479 3300005330 Bacteria 1554
37 Ga0070690_100303331 3300005330 Bacteria 1146
38 Ga0070690_100646627 3300005330 Bacteria 807
39 Ga0070670_100022490 3300005331 Bacteria 5426
40 Ga0070670_100100941 3300005331 Bacteria 2484
41 Ga0070670_100137930 3300005331 Bacteria 2108
42 Ga0070670_100248362 3300005331 Bacteria 1550
43 Ga0070670_100605606 3300005331 Bacteria 981
44 Ga0070677_10027028 3300005333 Bacteria 2157
45 Ga0070677_10028920 3300005333 Bacteria 2098
46 Ga0070677_10118287 3300005333 Bacteria 1193
47 Ga0068869_100106553 3300005334 Bacteria 2127
48 Ga0068869_100345454 3300005334 Bacteria 1212
49 Ga0068869_100766968 3300005334 Bacteria 827
50 Ga0068869_101387160 3300005334 Bacteria 622
51 Ga0070666_10000794 3300005335 Bacteria 19148
52 Ga0070666_10000864 3300005335 Bacteria 18346
53 Ga0070666_10033943 3300005335 Bacteria 3381
54 Ga0070666_10160740 3300005335 Bacteria 1570
55 Ga0070666_10170544 3300005335 Bacteria 1524
56 Ga0070666_10184590 3300005335 Bacteria 1464
57 Ga0070680_100066544 3300005336 Bacteria 2955
58 Ga0070680_101067542 3300005336 Bacteria 698
59 Ga0070682_100091293 3300005337 Bacteria 1993
60 Ga0070682_101359101 3300005337 Bacteria 606
61 Ga0068868_100001184 3300005338 Bacteria 17874
62 Ga0068868_100003747 3300005338 Bacteria 10618
63 Ga0068868_100006311 3300005338 Bacteria 8380
64 Ga0068868_100131350 3300005338 Bacteria 2049
65 Ga0068868_100241195 3300005338 Bacteria 1519
66 Ga0068868_100251779 3300005338 Bacteria 1487
67 Ga0068868_101232406 3300005338 Unclassified 693
68 Ga0068868_101581630 3300005338 Bacteria 615
69 Ga0070660_100001733 3300005339 Bacteria 14956
70 Ga0070660_100011437 3300005339 Bacteria 6305
71 Ga0070660_100012182 3300005339 Bacteria 6140
72 Ga0070660_100024761 3300005339 Bacteria 4456
73 Ga0070660_100052226 3300005339 Bacteria 3151
74 Ga0070660_100052485 3300005339 Bacteria 3143
75 Ga0070660_100165943 3300005339 Bacteria 1781
76 Ga0070660_100267721 3300005339 Bacteria 1396
77 Ga0070660_100295549 3300005339 Bacteria 1327
78 Ga0070660_100399306 3300005339 Bacteria 1137
79 Ga0070660_100809947 3300005339 Bacteria 788
80 Ga0070660_100859579 3300005339 Bacteria 764
81 Ga0070691_10035267 3300005341 Bacteria 2355
82 Ga0070687_100551809 3300005343 Bacteria 784
83 Ga0070661_100000439 3300005344 Bacteria 31883
84 Ga0070661_100009694 3300005344 Bacteria 6680
85 Ga0070661_100012223 3300005344 Bacteria 6003
86 Ga0070661_100052651 3300005344 Bacteria 2979
87 Ga0070661_100112445 3300005344 Bacteria 2034
88 Ga0070661_100197533 3300005344 Bacteria 1536
89 Ga0070661_100406312 3300005344 Bacteria 1077
90 Ga0070661_100481089 3300005344 Bacteria 991
91 Ga0070661_100659217 3300005344 Bacteria 850
92 Ga0070661_100690321 3300005344 Bacteria 831
93 Ga0070692_10026792 3300005345 Bacteria 2852
94 Ga0070692_10040107 3300005345 Bacteria 2393
95 Ga0070692_10171293 3300005345 Bacteria 1252
96 Ga0070668_100012244 3300005347 Bacteria 6391
97 Ga0070668_100134536 3300005347 Bacteria 1987
98 Ga0070668_100272528 3300005347 Bacteria 1411
99 Ga0070669_100000643 3300005353 Bacteria 25821
100 Ga0070669_100269595 3300005353 Bacteria 1361
101 Ga0070675_100023965 3300005354 Bacteria 4884
102 Ga0070675_100056674 3300005354 Bacteria 3230
103 Ga0070671_100012172 3300005355 Bacteria 6923
104 Ga0070671_100020782 3300005355 Bacteria 5354
105 Ga0070671_100050481 3300005355 Bacteria 3460
106 Ga0070671_100109455 3300005355 Bacteria 2320
107 Ga0070671_100190670 3300005355 Bacteria 1737
108 Ga0070671_100341970 3300005355 Bacteria 1276
109 Ga0070671_100475103 3300005355 Bacteria 1074
110 Ga0070671_100759085 3300005355 Unclassified 843
111 Ga0070674_100007903 3300005356 Bacteria 6294
112 Ga0070674_100026500 3300005356 Bacteria 3788
113 Ga0070674_100171212 3300005356 Bacteria 1656
114 Ga0070674_100299774 3300005356 Bacteria 1281
115 Ga0070674_101129164 3300005356 Bacteria 693
116 Ga0070673_100000663 3300005364 Bacteria 18945
117 Ga0070673_100012465 3300005364 Bacteria 5838
118 Ga0070673_100080383 3300005364 Bacteria 2641
119 Ga0070673_100616112 3300005364 Bacteria 991
120 Ga0070659_100000065 3300005366 Bacteria 82919
121 Ga0070659_100000382 3300005366 Bacteria 33581
122 Ga0070659_100007320 3300005366 Bacteria 8018
123 Ga0070659_100016987 3300005366 Bacteria 5470
124 Ga0070659_100066482 3300005366 Bacteria 2857
125 Ga0070659_100249214 3300005366 Bacteria 1471
126 Ga0070659_101091703 3300005366 Unclassified 703
127 Ga0070667_100000520 3300005367 Bacteria 38650
128 Ga0070667_100001684 3300005367 Bacteria 19770
129 Ga0070667_100021677 3300005367 Bacteria 5332
130 Ga0070667_100076773 3300005367 Bacteria 2852
131 Ga0070667_100123348 3300005367 Bacteria 2255
132 Ga0070667_100129286 3300005367 Bacteria 2203
133 Ga0070667_100376543 3300005367 Bacteria 1289
134 Ga0070667_100404108 3300005367 Bacteria 1244
135 Ga0070667_101257963 3300005367 Unclassified 693
136 Ga0070714_100252339 3300005435 Bacteria 1631
137 Ga0070714_100496435 3300005435 Bacteria 1164
138 Ga0070714_100556099 3300005435 Bacteria 1099
139 Ga0070713_100079429 3300005436 Bacteria 2794
140 Ga0070701_10561646 3300005438 Bacteria 750
141 Ga0070663_100001191 3300005455 Bacteria 14285
142 Ga0070663_100009586 3300005455 Bacteria 6002
143 Ga0070663_100069428 3300005455 Bacteria 2560
144 Ga0070663_100090238 3300005455 Bacteria 2269
145 Ga0070663_100240540 3300005455 Bacteria 1428
146 Ga0070663_100383033 3300005455 Bacteria 1146
147 Ga0070663_100709161 3300005455 Bacteria 856
148 Ga0070663_100970272 3300005455 Bacteria 737
149 Ga0070663_101316067 3300005455 Bacteria 638
150 Ga0070678_100002863 3300005456 Bacteria 9555
151 Ga0070678_100004790 3300005456 Bacteria 7720
152 Ga0070678_100341503 3300005456 Bacteria 1285
153 Ga0070678_101323093 3300005456 Unclassified 671
154 Ga0070662_100000010 3300005457 Bacteria 142717
155 Ga0070662_100000975 3300005457 Bacteria 17516
156 Ga0070662_100105946 3300005457 Bacteria 2135
157 Ga0070662_100291410 3300005457 Bacteria 1323
158 Ga0070662_100297298 3300005457 Bacteria 1311
159 Ga0070662_100369908 3300005457 Bacteria 1178
160 Ga0070662_100451759 3300005457 Bacteria 1067
161 Ga0070662_100475455 3300005457 Bacteria 1040
162 Ga0070681_10445489 3300005458 Bacteria 1207
163 Ga0070681_11439178 3300005458 Bacteria 613
164 Ga0068867_100001073 3300005459 Bacteria 18682
165 Ga0068867_100003113 3300005459 Bacteria 11699
166 Ga0068867_100176496 3300005459 Bacteria 1696
167 Ga0068867_100207941 3300005459 Bacteria 1570
168 Ga0070685_10406359 3300005466 Bacteria 944
169 Ga0070679_100476441 3300005530 Bacteria 1192
170 Ga0070679_100529028 3300005530 Bacteria 1123
171 Ga0070684_100147020 3300005535 Bacteria 2134
172 Ga0068853_100000396 3300005539 Bacteria 29782
173 Ga0068853_100002970 3300005539 Bacteria 12921
174 Ga0068853_100011319 3300005539 Bacteria 7243
175 Ga0068853_100146079 3300005539 Bacteria 2126
176 Ga0068853_100175341 3300005539 Bacteria 1942
177 Ga0068853_100462696 3300005539 Bacteria 1194
178 Ga0070672_100000342 3300005543 Bacteria 26866
179 Ga0070672_100009142 3300005543 Bacteria 6817
180 Ga0070672_100098005 3300005543 Bacteria 2374
181 Ga0070672_100183437 3300005543 Bacteria 1745
182 Ga0070686_100028546 3300005544 Bacteria 3385
183 Ga0070693_100135424 3300005547 Bacteria 1545
184 Ga0070693_100287365 3300005547 Bacteria 1104
185 Ga0070665_100000736 3300005548 Bacteria 43644
186 Ga0070665_100024270 3300005548 Bacteria 6106
187 Ga0070665_100050272 3300005548 Bacteria 4183
188 Ga0070665_100057220 3300005548 Bacteria 3909
189 Ga0070665_100299477 3300005548 Bacteria 1611
190 Ga0070665_100326184 3300005548 Bacteria 1539
191 Ga0070665_100473719 3300005548 Bacteria 1263
192 Ga0070665_100506388 3300005548 Bacteria 1219
193 Ga0068855_100002953 3300005563 Bacteria 20778
194 Ga0068855_100118606 3300005563 Bacteria 3030
195 Ga0068855_100696077 3300005563 Bacteria 1088
196 Ga0068855_100785625 3300005563 Bacteria 1013
197 Ga0068855_100800463 3300005563 Bacteria 1002
198 Ga0068855_101031312 3300005563 Bacteria 863
199 Ga0070664_100000921 3300005564 Bacteria 22951
200 Ga0070664_100003562 3300005564 Bacteria 12573
201 Ga0070664_100003589 3300005564 Bacteria 12514
202 Ga0070664_100025245 3300005564 Bacteria 4923
203 Ga0070664_100087081 3300005564 Bacteria 2699
204 Ga0070664_100145972 3300005564 Bacteria 2086
205 Ga0070664_100293850 3300005564 Bacteria 1467
206 Ga0070664_100664965 3300005564 Bacteria 969
207 Ga0068857_100011772 3300005577 Bacteria 7608
208 Ga0068857_100025380 3300005577 Bacteria 5218
209 Ga0068857_100585291 3300005577 Bacteria 1054
210 Ga0068857_101461621 3300005577 Bacteria 666
211 Ga0068854_100000376 3300005578 Bacteria 28529
212 Ga0068854_100009844 3300005578 Bacteria 6182
213 Ga0068854_100010635 3300005578 Bacteria 5971
214 Ga0068854_100015406 3300005578 Bacteria 5063
215 Ga0068854_100041469 3300005578 Bacteria 3252
216 Ga0068854_100079101 3300005578 Bacteria 2423
217 Ga0068854_100282997 3300005578 Bacteria 1336
218 Ga0068854_100490357 3300005578 Bacteria 1033
219 Ga0068854_100512156 3300005578 Bacteria 1012
220 Ga0068856_100000101 3300005614 Bacteria 82391
221 Ga0068856_100087310 3300005614 Bacteria 3100
222 Ga0068856_100312320 3300005614 Bacteria 1589
223 Ga0068856_100351176 3300005614 Bacteria 1493
224 Ga0068856_100517367 3300005614 Bacteria 1214
225 Ga0068856_100530075 3300005614 Bacteria 1199
226 Ga0068856_100537967 3300005614 Bacteria 1189
227 Ga0068856_100592200 3300005614 Bacteria 1130
228 Ga0070702_100180117 3300005615 Bacteria 1382
229 Ga0068852_100001271 3300005616 Bacteria 16839
230 Ga0068852_100003309 3300005616 Bacteria 11252
231 Ga0068852_100007627 3300005616 Bacteria 7914
232 Ga0068852_100018704 3300005616 Bacteria 5462
233 Ga0068852_100035005 3300005616 Bacteria 4184
234 Ga0068852_100043958 3300005616 Bacteria 3791
235 Ga0068852_100051240 3300005616 Bacteria 3542
236 Ga0068852_100114924 3300005616 Bacteria 2453
237 Ga0068852_100477513 3300005616 Bacteria 1238
238 Ga0068852_100478301 3300005616 Bacteria 1237
239 Ga0068852_100610421 3300005616 Bacteria 1096
240 Ga0068852_100645560 3300005616 Bacteria 1065
241 Ga0068859_100000982 3300005617 Bacteria 29213
242 Ga0068859_100051492 3300005617 Bacteria 4139
243 Ga0068859_100061841 3300005617 Bacteria 3774
244 Ga0068859_101207514 3300005617 Bacteria 833
245 Ga0068864_100126660 3300005618 Bacteria 2289
246 Ga0068864_100352583 3300005618 Bacteria 1389
247 Ga0068864_100510632 3300005618 Bacteria 1157
248 Ga0068864_100803985 3300005618 Bacteria 924
249 Ga0068866_10014127 3300005718 Bacteria 3519
250 Ga0068866_10021291 3300005718 Bacteria 2986
251 Ga0068866_10196041 3300005718 Bacteria 1203
252 Ga0068861_100108050 3300005719 Bacteria 2225
253 Ga0068851_10019419 3300005834 Bacteria 3284
254 Ga0068851_10020215 3300005834 Bacteria 3221
255 Ga0068851_10144867 3300005834 Bacteria 1295
256 Ga0068851_10425103 3300005834 Unclassified 785
257 Ga0068851_10458184 3300005834 Bacteria 759
258 Ga0068851_10662256 3300005834 Unclassified 640
259 Ga0068870_10025214 3300005840 Bacteria 2950
260 Ga0068863_100036755 3300005841 Bacteria 4664
261 Ga0068863_100051941 3300005841 Bacteria 3885
262 Ga0068863_100212126 3300005841 Bacteria 1865
263 Ga0068858_100006590 3300005842 Bacteria 11297
264 Ga0068858_100014737 3300005842 Bacteria 7358
265 Ga0068858_100074533 3300005842 Bacteria 3151
266 Ga0068858_100208240 3300005842 Bacteria 1850
267 Ga0068858_100499823 3300005842 Bacteria 1175
268 Ga0068860_100004562 3300005843 Bacteria 14135
269 Ga0068860_100029748 3300005843 Bacteria 5255
270 Ga0068860_100118333 3300005843 Bacteria 2536
271 Ga0068860_100318693 3300005843 Bacteria 1526
272 Ga0068860_101180287 3300005843 Bacteria 786
273 Ga0068862_100002521 3300005844 Bacteria 16207
274 Ga0068862_100010976 3300005844 Bacteria 7480
275 Ga0068862_100534286 3300005844 Bacteria 1118
276 Ga0097621_100046020 3300006237 Bacteria 3528
277 Ga0097621_100046571 3300006237 Bacteria 3509
278 Ga0097621_100209214 3300006237 Bacteria 1696
279 Ga0097621_100322482 3300006237 Bacteria 1369
280 Ga0097621_100359278 3300006237 Bacteria 1297
281 Ga0068871_100010555 3300006358 Bacteria 6747
282 Ga0068871_100061611 3300006358 Bacteria 3065
283 Ga0068871_100223579 3300006358 Bacteria 1632
284 Ga0068871_100240511 3300006358 Bacteria 1574
285 Ga0068871_100689343 3300006358 Bacteria 935
286 Ga0068871_101143361 3300006358 Unclassified 729
287 Ga0068865_100014194 3300006881 Bacteria 5056
288 Ga0068865_100062669 3300006881 Bacteria 2611
289 Ga0068865_100071863 3300006881 Bacteria 2456
290 Ga0097620_100000982 3300006931 Bacteria 29213
291 Ga0097620_100051492 3300006931 Bacteria 4139
292 Ga0097620_100061841 3300006931 Bacteria 3774
293 Ga0097620_101207312 3300006931 Bacteria 833
294 Ga0105240_10204422 3300009093 Bacteria 2313
295 Ga0105240_10438136 3300009093 Bacteria 1465
296 Ga0105240_10446978 3300009093 Bacteria 1447
297 Ga0105245_10000657 3300009098 Bacteria 31348
298 Ga0105245_10094182 3300009098 Bacteria 2760
299 Ga0105245_10150090 3300009098 Bacteria 2203
300 Ga0105245_10228927 3300009098 Bacteria 1797
301 Ga0105243_10071843 3300009148 Bacteria 2799
302 Ga0105243_10193425 3300009148 Bacteria 1778
303 Ga0105241_10092914 3300009174 Bacteria 2383
304 Ga0105241_10247080 3300009174 Bacteria 1511
305 Ga0105241_10333435 3300009174 Bacteria 1312
306 Ga0105241_10781011 3300009174 Bacteria 878
307 Ga0105242_10160691 3300009176 Bacteria 1966
308 Ga0105248_10000394 3300009177 Bacteria 50466
309 Ga0105248_10000673 3300009177 Bacteria 38736
310 Ga0105248_10000724 3300009177 Bacteria 37195
311 Ga0105248_10049783 3300009177 Bacteria 4698
312 Ga0105248_10081904 3300009177 Bacteria 3628
313 Ga0105248_10147111 3300009177 Bacteria 2659
314 Ga0105248_10554008 3300009177 Bacteria 1297
315 Ga0105248_10568577 3300009177 Bacteria 1279
316 Ga0105248_10705784 3300009177 Bacteria 1138
317 Ga0105248_11989975 3300009177 Bacteria 660
318 Ga0105237_10904600 3300009545 Bacteria 889
319 Ga0105238_10019208 3300009551 Bacteria 6961
320 Ga0105238_10081009 3300009551 Bacteria 3235
321 Ga0105238_10141251 3300009551 Bacteria 2385
322 Ga0105238_10577361 3300009551 Bacteria 1130
323 Ga0105238_11180946 3300009551 Bacteria 789
324 Ga0105032_109794 3300009979 Bacteria 779
325 Ga0105239_10071319 3300010375 Bacteria 3817
326 Ga0105239_10347196 3300010375 Bacteria 1675
327 Ga0105239_10426705 3300010375 Bacteria 1502
328 Ga0105239_10629764 3300010375 Bacteria 1224
329 Ga0105239_11148050 3300010375 Bacteria 895
330 Ga0105246_10050816 3300011119 Bacteria 2845
331 Ga0157373_10002321 3300013100 Bacteria 14423
332 Ga0157373_10019651 3300013100 Bacteria 4914
333 Ga0157373_10320208 3300013100 Bacteria 1103
334 Ga0157373_10431597 3300013100 Bacteria 947
335 Ga0157373_10448658 3300013100 Bacteria 928
336 Ga0157373_10464472 3300013100 Bacteria 912
337 Ga0157373_10710993 3300013100 Archaea 737
338 Ga0157371_10003868 3300013102 Bacteria 13346
339 Ga0157371_10021480 3300013102 Bacteria 4738
340 Ga0157371_10085790 3300013102 Bacteria 2230
341 Ga0157371_10100537 3300013102 Bacteria 2051
342 Ga0157371_10115660 3300013102 Bacteria 1905
343 Ga0157371_10249038 3300013102 Bacteria 1279
344 Ga0157371_10368237 3300013102 Bacteria 1048
345 Ga0157370_10003100 3300013104 Bacteria 19679
346 Ga0157370_10020472 3300013104 Bacteria 6608
347 Ga0157370_10069488 3300013104 Bacteria 3326
348 Ga0157370_10805127 3300013104 Bacteria 855
349 Ga0157370_11373366 3300013104 Unclassified 636
350 Ga0157369_10065909 3300013105 Bacteria 3897
351 Ga0157369_10102732 3300013105 Bacteria 3045
352 Ga0157374_10095106 3300013296 Bacteria 2848
353 Ga0157374_10111504 3300013296 Bacteria 2631
354 Ga0157374_10188332 3300013296 Bacteria 2018
355 Ga0157378_10053801 3300013297 Bacteria 3584
356 Ga0157378_10201957 3300013297 Bacteria 1880
357 Ga0157378_10335861 3300013297 Bacteria 1472
358 Ga0157378_10502725 3300013297 Bacteria 1211
359 Ga0163162_10129828 3300013306 Bacteria 2628
360 Ga0163162_10148905 3300013306 Bacteria 2457
361 Ga0163162_10433015 3300013306 Bacteria 1447
362 Ga0163162_11094314 3300013306 Bacteria 903
363 Ga0157372_10005550 3300013307 Bacteria 13406
364 Ga0157372_10329312 3300013307 Bacteria 1778
365 Ga0157372_10396569 3300013307 Bacteria 1608
366 Ga0157372_10675425 3300013307 Bacteria 1202
367 Ga0157372_11181224 3300013307 Bacteria 884
368 Ga0157375_10040319 3300013308 Bacteria 4501
369 Ga0157375_10083005 3300013308 Bacteria 3248
370 Ga0157375_10278088 3300013308 Bacteria 1837
371 Ga0157375_10699273 3300013308 Bacteria 1167
372 Ga0157375_11028066 3300013308 Bacteria 963
373 Ga0163163_10000580 3300014325 Bacteria 32211
374 Ga0157379_10108615 3300014968 Bacteria 2491
375 Ga0157379_10153038 3300014968 Bacteria 2081
376 Ga0157379_10162684 3300014968 Bacteria 2014
377 Ga0157379_10254846 3300014968 Bacteria 1594
378 Ga0157379_11275423 3300014968 Bacteria 709
379 Ga0163161_10163952 3300017792 Bacteria 1696
380 Ga0206353_10667997 3300020082 Bacteria 2345
381 Ga0206353_11733630 3300020082 Bacteria 759
382 Ga0213876_10020386 3300021384 Bacteria 3503
383 Ga0207697_10000056 3300025315 Bacteria 45867
384 Ga0207697_10021470 3300025315 Bacteria 2642
385 Ga0207656_10035895 3300025321 Bacteria 2078
386 Ga0207656_10207003 3300025321 Bacteria 949
387 Ga0207656_10257284 3300025321 Bacteria 857
388 Ga0207682_10030104 3300025893 Bacteria 2173
389 Ga0207682_10036601 3300025893 Bacteria 1986
390 Ga0207642_10019942 3300025899 Bacteria 2607
391 Ga0207642_10183404 3300025899 Bacteria 1142
392 Ga0207642_10512212 3300025899 Bacteria 736
393 Ga0207688_10000873 3300025901 Bacteria 15221
394 Ga0207688_10014674 3300025901 Bacteria 4255
395 Ga0207688_10045380 3300025901 Bacteria 2452
396 Ga0207680_10002980 3300025903 Bacteria 7937
397 Ga0207680_10004835 3300025903 Bacteria 6409
398 Ga0207680_10024179 3300025903 Bacteria 3330
399 Ga0207680_10162286 3300025903 Bacteria 1500
400 Ga0207647_10000702 3300025904 Bacteria 26284
401 Ga0207647_10004806 3300025904 Bacteria 10003
402 Ga0207647_10069277 3300025904 Bacteria 2133
403 Ga0207647_10116413 3300025904 Bacteria 1578
404 Ga0207647_10124344 3300025904 Bacteria 1519
405 Ga0207647_10126977 3300025904 Bacteria 1501
406 Ga0207647_10160078 3300025904 Bacteria 1313
407 Ga0207645_10003187 3300025907 Bacteria 12554
408 Ga0207645_10167314 3300025907 Bacteria 1440
409 Ga0207645_10340191 3300025907 Bacteria 1003
410 Ga0207643_10109324 3300025908 Bacteria 1627
411 Ga0207705_10000113 3300025909 Bacteria 90567
412 Ga0207705_10001078 3300025909 Bacteria 22139
413 Ga0207705_10004032 3300025909 Bacteria 11168
414 Ga0207705_10008819 3300025909 Bacteria 7353
415 Ga0207705_10020736 3300025909 Bacteria 4692
416 Ga0207705_10072739 3300025909 Bacteria 2494
417 Ga0207705_10167191 3300025909 Bacteria 1654
418 Ga0207705_10189635 3300025909 Bacteria 1554
419 Ga0207705_10333849 3300025909 Bacteria 1166
420 Ga0207705_10467891 3300025909 Bacteria 978
421 Ga0207705_10480632 3300025909 Bacteria 964
422 Ga0207705_10752109 3300025909 Bacteria 757
423 Ga0207654_10011465 3300025911 Bacteria 4523
424 Ga0207654_10146098 3300025911 Bacteria 1513
425 Ga0207695_10013501 3300025913 Bacteria 9736
426 Ga0207695_10117890 3300025913 Bacteria 2626
427 Ga0207671_10020216 3300025914 Bacteria 5072
428 Ga0207662_10010077 3300025918 Bacteria 5209
429 Ga0207662_10094594 3300025918 Bacteria 1843
430 Ga0207657_10000026 3300025919 Bacteria 143118
431 Ga0207657_10006986 3300025919 Bacteria 11623
432 Ga0207657_10016327 3300025919 Bacteria 7163
433 Ga0207657_10023326 3300025919 Bacteria 5764
434 Ga0207657_10031009 3300025919 Bacteria 4847
435 Ga0207657_10046030 3300025919 Bacteria 3823
436 Ga0207657_10062151 3300025919 Bacteria 3199
437 Ga0207657_10113947 3300025919 Bacteria 2230
438 Ga0207657_10180645 3300025919 Bacteria 1706
439 Ga0207657_10269697 3300025919 Bacteria 1353
440 Ga0207657_10386863 3300025919 Bacteria 1101
441 Ga0207649_10000228 3300025920 Bacteria 45916
442 Ga0207649_10000594 3300025920 Bacteria 24526
443 Ga0207649_10002750 3300025920 Bacteria 9740
444 Ga0207649_10006243 3300025920 Bacteria 6474
445 Ga0207649_10021289 3300025920 Bacteria 3730
446 Ga0207649_10074709 3300025920 Bacteria 2176
447 Ga0207649_10130793 3300025920 Bacteria 1704
448 Ga0207649_10259202 3300025920 Bacteria 1256
449 Ga0207681_10042173 3300025923 Bacteria 3046
450 Ga0207681_10213011 3300025923 Bacteria 1490
451 Ga0207681_10243642 3300025923 Bacteria 1400
452 Ga0207694_10000667 3300025924 Bacteria 30806
453 Ga0207694_10018777 3300025924 Bacteria 5226
454 Ga0207694_10042606 3300025924 Bacteria 3502
455 Ga0207650_10029446 3300025925 Bacteria 3948
456 Ga0207650_10129978 3300025925 Bacteria 1970
457 Ga0207650_10141661 3300025925 Bacteria 1891
458 Ga0207650_10370371 3300025925 Bacteria 1181
459 Ga0207650_10399286 3300025925 Bacteria 1138
460 Ga0207650_10561044 3300025925 Bacteria 958
461 Ga0207659_10028286 3300025926 Bacteria 3808
462 Ga0207659_10132935 3300025926 Bacteria 1923
463 Ga0207659_10633604 3300025926 Bacteria 913
464 Ga0207687_10037569 3300025927 Bacteria 3305
465 Ga0207687_10056090 3300025927 Bacteria 2762
466 Ga0207687_10131970 3300025927 Bacteria 1884
467 Ga0207687_10362910 3300025927 Bacteria 1183
468 Ga0207664_10075178 3300025929 Bacteria 2731
469 Ga0207664_10172139 3300025929 Bacteria 1854
470 Ga0207664_10198683 3300025929 Bacteria 1730
471 Ga0207664_11018146 3300025929 Bacteria 742
472 Ga0207644_10002444 3300025931 Bacteria 11980
473 Ga0207644_10015287 3300025931 Bacteria 5148
474 Ga0207644_10026246 3300025931 Bacteria 4012
475 Ga0207644_10095042 3300025931 Bacteria 2228
476 Ga0207644_10317769 3300025931 Bacteria 1258
477 Ga0207644_11132040 3300025931 Bacteria 658
478 Ga0207690_10000036 3300025932 Bacteria 143853
479 Ga0207690_10003797 3300025932 Bacteria 8941
480 Ga0207690_10009307 3300025932 Bacteria 5836
481 Ga0207690_10069381 3300025932 Bacteria 2425
482 Ga0207690_10201659 3300025932 Bacteria 1511
483 Ga0207690_10281251 3300025932 Bacteria 1296
484 Ga0207706_10000031 3300025933 Bacteria 143109
485 Ga0207706_10000619 3300025933 Bacteria 37719
486 Ga0207706_10089255 3300025933 Bacteria 2710
487 Ga0207706_10448657 3300025933 Bacteria 1116
488 Ga0207706_10526694 3300025933 Bacteria 1019
489 Ga0207706_10979993 3300025933 Bacteria 711
490 Ga0207709_10182162 3300025935 Bacteria 1484
491 Ga0207709_10231894 3300025935 Bacteria 1338
492 Ga0207669_10011540 3300025937 Bacteria 4305
493 Ga0207669_10016245 3300025937 Bacteria 3777
494 Ga0207669_10642399 3300025937 Bacteria 867
495 Ga0207669_11052598 3300025937 Bacteria 685
496 Ga0207704_10106951 3300025938 Bacteria 1880
497 Ga0207691_10000085 3300025940 Bacteria 79681
498 Ga0207691_10019225 3300025940 Bacteria 6466
499 Ga0207691_10114726 3300025940 Bacteria 2393
500 Ga0207691_10131904 3300025940 Bacteria 2206
501 Ga0207711_10002871 3300025941 Bacteria 15108
502 Ga0207711_10008432 3300025941 Bacteria 8618
503 Ga0207711_10016978 3300025941 Bacteria 6046
504 Ga0207711_10047841 3300025941 Bacteria 3659
505 Ga0207711_10049758 3300025941 Bacteria 3588
506 Ga0207711_10062639 3300025941 Bacteria 3208
507 Ga0207711_10139531 3300025941 Bacteria 2180
508 Ga0207711_10234066 3300025941 Bacteria 1683
509 Ga0207711_10908888 3300025941 Unclassified 818
510 Ga0207689_10000016 3300025942 Bacteria 118140
511 Ga0207661_10012875 3300025944 Bacteria 6098
512 Ga0207661_11344110 3300025944 Bacteria 656
513 Ga0207679_10000093 3300025945 Bacteria 78331
514 Ga0207679_10009865 3300025945 Bacteria 6131
515 Ga0207679_10014881 3300025945 Bacteria 5125
516 Ga0207679_10060828 3300025945 Bacteria 2808
517 Ga0207679_10216598 3300025945 Bacteria 1609
518 Ga0207679_10283200 3300025945 Bacteria 1422
519 Ga0207679_10390974 3300025945 Bacteria 1221
520 Ga0207679_10539562 3300025945 Bacteria 1045
521 Ga0207679_11068844 3300025945 Bacteria 740
522 Ga0207667_10003819 3300025949 Bacteria 18527
523 Ga0207667_10005640 3300025949 Bacteria 15272
524 Ga0207667_10015986 3300025949 Bacteria 8498
525 Ga0207667_10113869 3300025949 Bacteria 2788
526 Ga0207667_10513145 3300025949 Bacteria 1215
527 Ga0207667_10717492 3300025949 Bacteria 1001
528 Ga0207651_10000128 3300025960 Bacteria 32485
529 Ga0207651_10069082 3300025960 Bacteria 2493
530 Ga0207651_10291993 3300025960 Bacteria 1352
531 Ga0207651_11058990 3300025960 Bacteria 726
532 Ga0207651_11219879 3300025960 Bacteria 675
533 Ga0207668_10199423 3300025972 Bacteria 1592
534 Ga0207640_10005488 3300025981 Bacteria 6913
535 Ga0207640_10008178 3300025981 Bacteria 5795
536 Ga0207640_10011322 3300025981 Bacteria 5047
537 Ga0207640_10028161 3300025981 Bacteria 3432
538 Ga0207640_10032443 3300025981 Bacteria 3238
539 Ga0207640_10675212 3300025981 Bacteria 883
540 Ga0207658_10004322 3300025986 Bacteria 9890
541 Ga0207658_10011328 3300025986 Bacteria 6070
542 Ga0207658_10039285 3300025986 Bacteria 3414
543 Ga0207658_10043135 3300025986 Bacteria 3277
544 Ga0207658_10086266 3300025986 Bacteria 2420
545 Ga0207658_10127054 3300025986 Bacteria 2042
546 Ga0207658_10259407 3300025986 Bacteria 1481
547 Ga0207658_10513724 3300025986 Bacteria 1068
548 Ga0207677_10000878 3300026023 Bacteria 17015
549 Ga0207677_10005679 3300026023 Bacteria 6789
550 Ga0207677_10020023 3300026023 Bacteria 4054
551 Ga0207677_10021112 3300026023 Bacteria 3972
552 Ga0207677_10043235 3300026023 Bacteria 2994
553 Ga0207677_10415052 3300026023 Bacteria 1145
554 Ga0207677_10627607 3300026023 Bacteria 946
555 Ga0207703_10004317 3300026035 Bacteria 11690
556 Ga0207703_10019212 3300026035 Bacteria 5338
557 Ga0207703_10037721 3300026035 Bacteria 3851
558 Ga0207703_10051571 3300026035 Bacteria 3335
559 Ga0207703_10064236 3300026035 Bacteria 3012
560 Ga0207639_10000727 3300026041 Bacteria 22478
561 Ga0207639_10001448 3300026041 Bacteria 15976
562 Ga0207639_10070942 3300026041 Bacteria 2723
563 Ga0207639_10073181 3300026041 Bacteria 2686
564 Ga0207639_10146350 3300026041 Bacteria 1974
565 Ga0207678_10015424 3300026067 Bacteria 6719
566 Ga0207678_10021256 3300026067 Bacteria 5689
567 Ga0207678_10050163 3300026067 Bacteria 3606
568 Ga0207678_10084967 3300026067 Bacteria 2706
569 Ga0207678_10087071 3300026067 Bacteria 2669
570 Ga0207678_10101383 3300026067 Bacteria 2458
571 Ga0207678_10148781 3300026067 Bacteria 1999
572 Ga0207678_10165439 3300026067 Bacteria 1889
573 Ga0207678_10262767 3300026067 Bacteria 1479
574 Ga0207678_10316723 3300026067 Bacteria 1342
575 Ga0207702_10000353 3300026078 Bacteria 52560
576 Ga0207702_10425955 3300026078 Bacteria 1284
577 Ga0207702_10478562 3300026078 Bacteria 1211
578 Ga0207702_10489442 3300026078 Bacteria 1198
579 Ga0207702_10526333 3300026078 Bacteria 1154
580 Ga0207702_10939063 3300026078 Unclassified 857
581 Ga0207702_11195104 3300026078 Bacteria 755
582 Ga0207641_10016769 3300026088 Bacteria 5999
583 Ga0207641_10184204 3300026088 Bacteria 1914
584 Ga0207641_10218287 3300026088 Bacteria 1767
585 Ga0207641_10349767 3300026088 Bacteria 1408
586 Ga0207648_10000141 3300026089 Bacteria 71670
587 Ga0207648_10008103 3300026089 Bacteria 10229
588 Ga0207648_10076062 3300026089 Bacteria 2926
589 Ga0207648_10166015 3300026089 Bacteria 1951
590 Ga0207676_10013820 3300026095 Bacteria 5795
591 Ga0207676_10502536 3300026095 Bacteria 1151
592 Ga0207676_10956540 3300026095 Bacteria 842
593 Ga0207674_10000714 3300026116 Bacteria 43427
594 Ga0207674_10002253 3300026116 Bacteria 24438
595 Ga0207674_10116176 3300026116 Bacteria 2647
596 Ga0207674_10464217 3300026116 Bacteria 1224
597 Ga0207674_10511095 3300026116 Bacteria 1160
598 Ga0207675_100108433 3300026118 Bacteria 2619
599 Ga0207683_10001784 3300026121 Bacteria 19038
600 Ga0207683_10018862 3300026121 Bacteria 5885
601 Ga0207683_10045410 3300026121 Bacteria 3842
602 Ga0207683_10095887 3300026121 Bacteria 2645
603 Ga0207683_10557070 3300026121 Bacteria 1060
604 Ga0207698_10003263 3300026142 Bacteria 9747
605 Ga0207698_10003578 3300026142 Bacteria 9380
606 Ga0207698_10019729 3300026142 Bacteria 4622
607 Ga0207698_10030156 3300026142 Bacteria 3896
608 Ga0207698_10030214 3300026142 Bacteria 3893
609 Ga0207698_10045484 3300026142 Bacteria 3308
610 Ga0207698_10112772 3300026142 Bacteria 2283
611 Ga0207698_10259948 3300026142 Bacteria 1594
612 Ga0207698_10657204 3300026142 Bacteria 1039
613 Ga0207698_11081749 3300026142 Bacteria 814
614 Ga0209974_10246289 3300027876 Bacteria 671
615 Ga0268266_10000370 3300028379 Bacteria 69264
616 Ga0268266_10005701 3300028379 Bacteria 11546
617 Ga0268266_10055931 3300028379 Bacteria 3393
618 Ga0268266_10068721 3300028379 Bacteria 3068
619 Ga0268266_10084750 3300028379 Bacteria 2768
620 Ga0268266_10122336 3300028379 Bacteria 2317
621 Ga0268265_10000742 3300028380 Bacteria 31819
622 Ga0268265_10047416 3300028380 Bacteria 3219
623 Ga0268265_10815868 3300028380 Bacteria 910
624 Ga0268264_10001374 3300028381 Bacteria 22774
625 Ga0268264_10276064 3300028381 Bacteria 1572
626 Ga0268264_10338073 3300028381 Bacteria 1429
627 Ga0316183_1065227 3300030742 Bacteria 995
628 Ga0316182_1090566 3300030745 Bacteria 2836
629 Ga0316182_1199923 3300030745 Bacteria 1755
630 Ga0307408_100152273 3300031548 Bacteria 1827
631 Ga0307408_100189048 3300031548 Bacteria 1658
632 Ga0307413_10084448 3300031824 Bacteria 2047
633 Ga0307413_10107929 3300031824 Bacteria 1856
634 Ga0307410_10042216 3300031852 Bacteria 3013
635 Ga0307410_10043764 3300031852 Bacteria 2969
636 Ga0307410_10070271 3300031852 Bacteria 2424
637 Ga0307410_10108356 3300031852 Bacteria 2005
638 Ga0307410_10509594 3300031852 Bacteria 991
639 Ga0307406_10322760 3300031901 Bacteria 1195
640 Ga0307407_10015836 3300031903 Bacteria 3739
641 Ga0307407_10018337 3300031903 Bacteria 3537
642 Ga0307407_10244706 3300031903 Bacteria 1225
643 Ga0307407_10717674 3300031903 Bacteria 754
644 Ga0307412_10050272 3300031911 Bacteria 2750
645 Ga0307412_10854486 3300031911 Bacteria 794
646 Ga0307412_10941436 3300031911 Archaea 760
647 Ga0307409_100131979 3300031995 Bacteria 2136
648 Ga0307409_100151668 3300031995 Bacteria 2013
649 Ga0307416_100002975 3300032002 Bacteria 9879
650 Ga0307416_100050428 3300032002 Bacteria 3317
651 Ga0307416_100584198 3300032002 Bacteria 1195
652 Ga0307414_10063961 3300032004 Bacteria 2617
653 Ga0307414_10111383 3300032004 Bacteria 2084
654 Ga0307414_10188468 3300032004 Bacteria 1666
655 Ga0307414_10970820 3300032004 Bacteria 781
656 Ga0307411_10004667 3300032005 Bacteria 6605
657 Ga0307411_10119195 3300032005 Bacteria 1905
658 Ga0307411_10141980 3300032005 Bacteria 1772
659 Ga0307411_10431647 3300032005 Bacteria 1097
660 Ga0307415_100125797 3300032126 Bacteria 1931
661 Ga0307415_100195074 3300032126 Bacteria 1601
662 Ga0307415_100479346 3300032126 Bacteria 1083
663 Ga0373958_0143109 3300034819 Bacteria 593
664 Ga0373952_0019712 3300035092 Bacteria 1407
665 Ga0373941_0182928 3300035115 Bacteria 787
666 Ga0373945_0057945 3300035116 Bacteria 1440
667 Ga0373943_0001802 3300035170 Bacteria 9685
668 Ga0373931_0011351 3300035691 Bacteria 4304
669 Ga0373935_0007227 3300035692 Bacteria 6635
670 Ga0373925_0129781 3300037068 Bacteria 1964
671 Ga0395899_0125330 3300037312 Bacteria 1837
672 Ga0395899_0230846 3300037312 Bacteria 1278
673 Ga0395899_0278614 3300037312 Bacteria 1138
674 Ga0395900_0102140 3300037418 Bacteria 2945
675 Ga0395900_0135934 3300037418 Bacteria 2518
676 Ga0395900_0393532 3300037418 Bacteria 1351
677 Ga0395898_0040716 3300037466 Bacteria 4592
678 Ga0395898_0047607 3300037466 Bacteria 4207
679 Ga0395898_0241651 3300037466 Bacteria 1722
680 Ga0395898_0722812 3300037466 Bacteria 937
681 Ga0395905_0131739 3300037471 Bacteria 2351
682 Ga0395905_0230981 3300037471 Bacteria 1730
683 Ga0395905_0355829 3300037471 Bacteria 1357
684 Ga0395905_0689844 3300037471 Bacteria 923
685 Ga0395905_1295868 3300037471 Bacteria 632
686 Ga0395901_0058768 3300038443 Bacteria 4000
687 Ga0395901_0227407 3300038443 Bacteria 1948
688 Ga0436365_1911625 3300039437 Bacteria 11812
689 Ga0439432_023283 3300042006 Bacteria 2041
690 Ga0439432_053665 3300042006 Bacteria 1253
691 Ga0439449_0134201 3300042007 Bacteria 920
692 Ga0439464_0001952 3300042439 Bacteria 4992
693 Ga0466972_0065651 3300044658 Bacteria 1736
694 Ga0466965_0233014 3300044683 Bacteria 984
695 Ga0466966_0085503 3300044684 Bacteria 1961
696 Ga0466966_0111676 3300044684 Bacteria 1685
697 Ga0466961_0076656 3300044693 Bacteria 2118
698 Ga0466963_0118939 3300044694 Bacteria 1817
699 Ga0466963_0138024 3300044694 Bacteria 1688
700 Ga0466963_0280348 3300044694 Bacteria 1171
701 Ga0466963_0389571 3300044694 Bacteria 982
702 Ga0466964_0029131 3300044706 Bacteria 2178
703 Ga0466964_0034486 3300044706 Bacteria 2020
704 Ga0466971_0027409 3300044719 Bacteria 2552
705 Ga0466968_0001603 3300044735 Bacteria 8166
706 Ga0466970_0067725 3300044765 Bacteria 1917
707 Ga0466970_0088928 3300044765 Bacteria 1675
708 Ga0466957_0022472 3300044842 Bacteria 3721
709 Ga0466957_0364806 3300044842 Bacteria 982
710 Ga0466960_0051732 3300044901 Bacteria 1985
711 Ga0466960_0179153 3300044901 Bacteria 1148
712 Ga0466959_0066499 3300045049 Bacteria 2615
713 Ga0466958_0021475 3300045836 Bacteria 3774
714 Ga0466958_0077165 3300045836 Bacteria 2046
715 Ga0466958_0175975 3300045836 Bacteria 1357
716 Ga0466958_0521999 3300045836 Bacteria 771
717 Ga0466967_0009394 3300045976 Bacteria 7253
718 Ga0466967_0045095 3300045976 Bacteria 3829
719 Ga0466967_0048769 3300045976 Bacteria 3700
720 Ga0466967_0093847 3300045976 Bacteria 2731
721 Ga0466967_0652490 3300045976 Bacteria 1041
722 Ga0466967_1741465 3300045976 Bacteria 620
723 Ga0495621_0010089 3300046539 Bacteria 2882
724 Ga0495669_0082234 3300046684 Bacteria 1479
725 Ga0495670_0201059 3300046691 Bacteria 1055
726 Ga0496100_0115407 3300048903 Bacteria 1872
727 Ga0496100_0271845 3300048903 Bacteria 1260
728 Ga0496101_0018477 3300048904 Bacteria 4741
729 Ga0496101_0030598 3300048904 Bacteria 3777
730 Ga0496101_0486969 3300048904 Bacteria 974
731 Ga0496101_0531778 3300048904 Bacteria 929
732 Ga0496102_0102322 3300048905 Bacteria 2663
733 Ga0496104_0161176 3300048907 Bacteria 2152
734 Ga0496104_0359374 3300048907 Bacteria 1369
735 Ga0496106_0103524 3300048909 Bacteria 2209
736 Ga0496106_0113272 3300048909 Bacteria 2114
737 Ga0496106_0353708 3300048909 Bacteria 1180
738 Ga0496107_0011093 3300048910 Bacteria 6269
739 Ga0496108_0000372 3300048911 Bacteria 37378
740 Ga0496108_0073265 3300048911 Bacteria 2891
741 Ga0496109_0404855 3300048912 Bacteria 1289
742 Ga0496109_0583470 3300048912 Bacteria 1053
743 Ga0496109_0790325 3300048912 Bacteria 887
744 Ga0496109_0908857 3300048912 Bacteria 818
745 Ga0496110_0088388 3300048913 Bacteria 2767
746 Ga0496111_0018546 3300048914 Bacteria 4822
747 Ga0496111_0503320 3300048914 Bacteria 891
748 Ga0496111_0852869 3300048914 Unclassified 657
749 Ga0496111_0975154 3300048914 Unclassified 608
750 Ga0496112_0045034 3300048915 Bacteria 4324
751 Ga0496113_0143704 3300048916 Bacteria 1878
752 Ga0496114_0000023 3300048917 Bacteria 219092
753 Ga0496114_0024622 3300048917 Bacteria 4913
754 Ga0501070_0090807 3300049586 Bacteria 2528
755 Ga0501071_0624469 3300049587 Bacteria 829
756 Ga0501230_028928 3300049667 Bacteria 1021
757 Ga0501235_117609 3300049669 Bacteria 662
758 Ga0501257_020608 3300049686 Bacteria 1550
759 Ga0501258_002729 3300049687 Bacteria 1571
760 Ga0501268_000728 3300049765 Bacteria 3759
761 Ga0501271_005267 3300049768 Bacteria 1255
762 Ga0501273_005503 3300049770 Bacteria 1434
763 Ga0501212_011132 3300049851 Bacteria 1292
764 Ga0466962_0023979 3300061719 Bacteria 2932
765 Ga0466962_0313354 3300061719 Bacteria 777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100759085 Ga0070671_1007590851 147
2 3300005614 Ga0068856_100592200 Ga0068856_1005922002 150
3 3300026078 Ga0207702_10489442 Ga0207702_104894422 150
4 3300013100 Ga0157373_10710993 Ga0157373_107109932 151
5 3300025932 Ga0207690_10069381 Ga0207690_100693811 151
6 3300005327 Ga0070658_10487806 Ga0070658_104878062 154
7 3300005367 Ga0070667_100123348 Ga0070667_1001233484 154
8 3300005459 Ga0068867_100003113 Ga0068867_1000031134 154
9 3300005539 Ga0068853_100175341 Ga0068853_1001753413 154
10 3300005548 Ga0070665_100326184 Ga0070665_1003261843 154
11 3300005578 Ga0068854_100490357 Ga0068854_1004903571 154
12 3300005616 Ga0068852_100035005 Ga0068852_1000350052 154
13 3300005834 Ga0068851_10019419 Ga0068851_100194192 154
14 3300006237 Ga0097621_100209214 Ga0097621_1002092144 154
15 3300006358 Ga0068871_100240511 Ga0068871_1002405112 154
16 3300013102 Ga0157371_10249038 Ga0157371_102490382 154
17 3300025321 Ga0207656_10035895 Ga0207656_100358952 154
18 3300025981 Ga0207640_10675212 Ga0207640_106752122 154
19 3300026089 Ga0207648_10008103 Ga0207648_100081039 154
20 3300026142 Ga0207698_10045484 Ga0207698_100454843 154
21 3300028379 Ga0268266_10055931 Ga0268266_100559313 154
22 3300037471 Ga0395905_0355829 Ga0395905_0355829_667_1182 154
23 3300001979 JGI24740J21852_10003631 JGI24740J21852_100036319 155
24 3300005366 Ga0070659_101091703 Ga0070659_1010917031 155
25 3300005548 Ga0070665_100000736 Ga0070665_1000007368 155
26 3300005564 Ga0070664_100664965 Ga0070664_1006649651 155
27 3300013100 Ga0157373_10464472 Ga0157373_104644722 155
28 3300013102 Ga0157371_10115660 Ga0157371_101156602 155
29 3300025920 Ga0207649_10259202 Ga0207649_102592022 155
30 3300026067 Ga0207678_10165439 Ga0207678_101654393 155
31 3300028379 Ga0268266_10000370 Ga0268266_1000037030 155
32 3300037471 Ga0395905_0689844 Ga0395905_0689844_302_820 155
33 3300005334 Ga0068869_101387160 Ga0068869_1013871601 156
34 3300005338 Ga0068868_100241195 Ga0068868_1002411953 156
35 3300005367 Ga0070667_100129286 Ga0070667_1001292863 156
36 3300005455 Ga0070663_100709161 Ga0070663_1007091611 156
37 3300005456 Ga0070678_100341503 Ga0070678_1003415033 156
38 3300005548 Ga0070665_100506388 Ga0070665_1005063881 156
39 3300005841 Ga0068863_100036755 Ga0068863_1000367553 156
40 3300005843 Ga0068860_100004562 Ga0068860_1000045628 156
41 3300005844 Ga0068862_100002521 Ga0068862_10000252118 156
42 3300006237 Ga0097621_100322482 Ga0097621_1003224822 156
43 3300006358 Ga0068871_100061611 Ga0068871_1000616111 156
44 3300009177 Ga0105248_10568577 Ga0105248_105685772 156
45 3300013306 Ga0163162_11094314 Ga0163162_110943142 156
46 3300013308 Ga0157375_10278088 Ga0157375_102780884 156
47 3300014968 Ga0157379_11275423 Ga0157379_112754231 156
48 3300025315 Ga0207697_10021470 Ga0207697_100214704 156
49 3300025901 Ga0207688_10045380 Ga0207688_100453803 156
50 3300025908 Ga0207643_10109324 Ga0207643_101093242 156
51 3300025923 Ga0207681_10213011 Ga0207681_102130113 156
52 3300025937 Ga0207669_10642399 Ga0207669_106423992 156
53 3300025941 Ga0207711_10139531 Ga0207711_101395313 156
54 3300025986 Ga0207658_10039285 Ga0207658_100392855 156
55 3300026067 Ga0207678_10316723 Ga0207678_103167233 156
56 3300026088 Ga0207641_10016769 Ga0207641_100167697 156
57 3300026088 Ga0207641_10349767 Ga0207641_103497672 156
58 3300026121 Ga0207683_10095887 Ga0207683_100958874 156
59 3300028379 Ga0268266_10122336 Ga0268266_101223363 156
60 3300028380 Ga0268265_10000742 Ga0268265_1000074233 156
61 3300028381 Ga0268264_10001374 Ga0268264_1000137412 156
62 3300025914 Ga0207671_10020216 Ga0207671_100202164 157
63 3300044901 Ga0466960_0179153 Ga0466960_0179153_88_636 157
64 3300031911 Ga0307412_10941436 Ga0307412_109414362 158
65 3300031995 Ga0307409_100151668 Ga0307409_1001516683 158
66 3300032004 Ga0307414_10970820 Ga0307414_109708202 158
67 3300005355 Ga0070671_100020782 Ga0070671_1000207827 160
68 3300005539 Ga0068853_100146079 Ga0068853_1001460793 160
69 3300005843 Ga0068860_100318693 Ga0068860_1003186931 160
70 3300009177 Ga0105248_10554008 Ga0105248_105540083 160
71 3300025941 Ga0207711_10062639 Ga0207711_100626394 160
72 3300030745 Ga0316182_1199923 Ga0316182_11999233 160
73 3300048903 Ga0496100_0271845 Ga0496100_0271845_417_935 160
74 3300048909 Ga0496106_0113272 Ga0496106_0113272_1268_1786 160
75 3300048914 Ga0496111_0503320 Ga0496111_0503320_392_874 160
76 3300048917 Ga0496114_0024622 Ga0496114_0024622_1605_2123 160
77 3300045976 Ga0466967_1741465 Ga0466967_1741465_45_563 161
78 3300005563 Ga0068855_100696077 Ga0068855_1006960772 162
79 3300013104 Ga0157370_10003100 Ga0157370_100031005 162
80 3300025945 Ga0207679_10390974 Ga0207679_103909742 162
81 3300025949 Ga0207667_10113869 Ga0207667_101138693 162
82 3300044694 Ga0466963_0389571 Ga0466963_0389571_37_555 162
83 3300048904 Ga0496101_0030598 Ga0496101_0030598_2780_3298 163
84 3300005331 Ga0070670_100100941 Ga0070670_1001009414 164
85 3300005353 Ga0070669_100269595 Ga0070669_1002695952 164
86 3300005354 Ga0070675_100023965 Ga0070675_1000239656 164
87 3300005564 Ga0070664_100003589 Ga0070664_1000035896 164
88 3300025923 Ga0207681_10243642 Ga0207681_102436422 164
89 3300025925 Ga0207650_10370371 Ga0207650_103703712 164
90 3300025926 Ga0207659_10028286 Ga0207659_100282863 164
91 3300025945 Ga0207679_10009865 Ga0207679_100098656 164
92 3300005435 Ga0070714_100252339 Ga0070714_1002523393 166
93 3300017792 Ga0163161_10163952 Ga0163161_101639522 166
94 3300025929 Ga0207664_11018146 Ga0207664_110181461 166
95 3300027876 Ga0209974_10246289 Ga0209974_102462891 166
96 3300002067 JGI24735J21928_10020928 JGI24735J21928_100209283 167
97 3300005327 Ga0070658_10219903 Ga0070658_102199033 167
98 3300005339 Ga0070660_100012182 Ga0070660_1000121827 167
99 3300005341 Ga0070691_10035267 Ga0070691_100352672 167
100 3300005344 Ga0070661_100012223 Ga0070661_1000122235 167
101 3300005366 Ga0070659_100016987 Ga0070659_1000169877 167
102 3300005539 Ga0068853_100011319 Ga0068853_1000113194 167
103 3300005563 Ga0068855_100785625 Ga0068855_1007856252 167
104 3300005564 Ga0070664_100293850 Ga0070664_1002938502 167
105 3300005577 Ga0068857_100011772 Ga0068857_1000117727 167
106 3300005616 Ga0068852_100018704 Ga0068852_1000187046 167
107 3300009551 Ga0105238_10019208 Ga0105238_100192083 167
108 3300010375 Ga0105239_10347196 Ga0105239_103471963 167
109 3300013104 Ga0157370_10020472 Ga0157370_100204727 167
110 3300013105 Ga0157369_10065909 Ga0157369_100659093 167
111 3300013307 Ga0157372_10005550 Ga0157372_1000555014 167
112 3300025904 Ga0207647_10004806 Ga0207647_100048066 167
113 3300025909 Ga0207705_10189635 Ga0207705_101896353 167
114 3300025919 Ga0207657_10113947 Ga0207657_101139473 167
115 3300025920 Ga0207649_10006243 Ga0207649_100062433 167
116 3300025924 Ga0207694_10000667 Ga0207694_1000066739 167
117 3300025932 Ga0207690_10201659 Ga0207690_102016592 167
118 3300025945 Ga0207679_10216598 Ga0207679_102165982 167
119 3300025949 Ga0207667_10513145 Ga0207667_105131452 167
120 3300026041 Ga0207639_10001448 Ga0207639_100014487 167
121 3300026116 Ga0207674_10002253 Ga0207674_1000225325 167
122 3300026142 Ga0207698_10003578 Ga0207698_100035787 167
123 3300030745 Ga0316182_1090566 Ga0316182_10905664 167
124 3300031548 Ga0307408_100152273 Ga0307408_1001522732 168
125 3300031901 Ga0307406_10322760 Ga0307406_103227602 168
126 3300032005 Ga0307411_10431647 Ga0307411_104316472 168
127 3300032126 Ga0307415_100195074 Ga0307415_1001950742 168
128 3300005339 Ga0070660_100809947 Ga0070660_1008099471 170
129 3300005530 Ga0070679_100529028 Ga0070679_1005290282 170
130 3300009979 Ga0105032_109794 Ga0105032_1097941 170
131 3300013102 Ga0157371_10085790 Ga0157371_100857901 170
132 3300042006 Ga0439432_023283 Ga0439432_023283_832_1347 170
133 3300005330 Ga0070690_100049588 Ga0070690_1000495881 171
134 3300005334 Ga0068869_100766968 Ga0068869_1007669682 171
135 3300005335 Ga0070666_10000864 Ga0070666_100008649 171
136 3300005338 Ga0068868_100003747 Ga0068868_1000037471 171
137 3300005338 Ga0068868_101581630 Ga0068868_1015816301 171
138 3300005343 Ga0070687_100551809 Ga0070687_1005518091 171
139 3300005355 Ga0070671_100475103 Ga0070671_1004751032 171
140 3300005356 Ga0070674_100026500 Ga0070674_1000265002 171
141 3300005356 Ga0070674_100299774 Ga0070674_1002997742 171
142 3300005364 Ga0070673_100080383 Ga0070673_1000803834 171
143 3300005367 Ga0070667_100001684 Ga0070667_10000168416 171
144 3300005544 Ga0070686_100028546 Ga0070686_1000285463 171
145 3300005548 Ga0070665_100473719 Ga0070665_1004737193 171
146 3300005614 Ga0068856_100312320 Ga0068856_1003123202 171
147 3300005617 Ga0068859_100061841 Ga0068859_1000618412 171
148 3300005718 Ga0068866_10021291 Ga0068866_100212915 171
149 3300005842 Ga0068858_100006590 Ga0068858_1000065904 171
150 3300005843 Ga0068860_101180287 Ga0068860_1011802871 171
151 3300006881 Ga0068865_100071863 Ga0068865_1000718632 171
152 3300006931 Ga0097620_100061841 Ga0097620_1000618412 171
153 3300009098 Ga0105245_10228927 Ga0105245_102289273 171
154 3300009177 Ga0105248_10000673 Ga0105248_100006731 171
155 3300013308 Ga0157375_10699273 Ga0157375_106992732 171
156 3300025899 Ga0207642_10019942 Ga0207642_100199421 171
157 3300025903 Ga0207680_10004835 Ga0207680_100048355 171
158 3300025904 Ga0207647_10069277 Ga0207647_100692772 171
159 3300025918 Ga0207662_10010077 Ga0207662_100100775 171
160 3300025926 Ga0207659_10633604 Ga0207659_106336042 171
161 3300025927 Ga0207687_10131970 Ga0207687_101319703 171
162 3300025937 Ga0207669_10016245 Ga0207669_100162454 171
163 3300025940 Ga0207691_10114726 Ga0207691_101147262 171
164 3300025941 Ga0207711_10002871 Ga0207711_1000287119 171
165 3300025986 Ga0207658_10004322 Ga0207658_100043225 171
166 3300026023 Ga0207677_10020023 Ga0207677_100200236 171
167 3300026035 Ga0207703_10037721 Ga0207703_100377216 171
168 3300026078 Ga0207702_10478562 Ga0207702_104785622 171
169 3300026095 Ga0207676_10956540 Ga0207676_109565402 171
170 3300028381 Ga0268264_10338073 Ga0268264_103380733 171
171 3300032002 Ga0307416_100584198 Ga0307416_1005841982 171
172 3300035116 Ga0373945_0057945 Ga0373945_0057945_607_1134 171
173 3300035170 Ga0373943_0001802 Ga0373943_0001802_3140_3667 171
174 3300035692 Ga0373935_0007227 Ga0373935_0007227_2289_2816 171
175 3300037068 Ga0373925_0129781 Ga0373925_0129781_885_1412 171
176 3300044694 Ga0466963_0118939 Ga0466963_0118939_23_538 171
177 3300046539 Ga0495621_0010089 Ga0495621_0010089_794_1309 171
178 3300046691 Ga0495670_0201059 Ga0495670_0201059_316_831 171
179 3300048907 Ga0496104_0161176 Ga0496104_0161176_1362_1877 171
180 3300048914 Ga0496111_0975154 Ga0496111_0975154_60_575 171
181 3300049587 Ga0501071_0624469 Ga0501071_0624469_206_721 171
182 3300001904 JGI24736J21556_1015760 JGI24736J21556_10157602 172
183 3300001915 JGI24741J21665_1010345 JGI24741J21665_10103454 172
184 3300001915 JGI24741J21665_1018026 JGI24741J21665_10180262 172
185 3300001979 JGI24740J21852_10016825 JGI24740J21852_100168252 172
186 3300001979 JGI24740J21852_10036761 JGI24740J21852_100367613 172
187 3300001979 JGI24740J21852_10062239 JGI24740J21852_100622392 172
188 3300001989 JGI24739J22299_10001669 JGI24739J22299_100016699 172
189 3300001989 JGI24739J22299_10003871 JGI24739J22299_100038712 172
190 3300001990 JGI24737J22298_10000281 JGI24737J22298_1000028120 172
191 3300001990 JGI24737J22298_10001762 JGI24737J22298_1000176211 172
192 3300001990 JGI24737J22298_10044984 JGI24737J22298_100449842 172
193 3300001991 JGI24743J22301_10052343 JGI24743J22301_100523432 172
194 3300002067 JGI24735J21928_10021661 JGI24735J21928_100216613 172
195 3300002074 JGI24748J21848_1012898 JGI24748J21848_10128982 172
196 3300002075 JGI24738J21930_10003730 JGI24738J21930_100037304 172
197 3300002239 JGI24034J26672_10012146 JGI24034J26672_100121462 172
198 3300005327 Ga0070658_10000260 Ga0070658_1000026016 172
199 3300005327 Ga0070658_10014943 Ga0070658_100149436 172
200 3300005327 Ga0070658_10018539 Ga0070658_100185394 172
201 3300005327 Ga0070658_10339205 Ga0070658_103392052 172
202 3300005327 Ga0070658_10421598 Ga0070658_104215982 172
203 3300005327 Ga0070658_10539228 Ga0070658_105392282 172
204 3300005327 Ga0070658_10969445 Ga0070658_109694452 172
205 3300005327 Ga0070658_11117415 Ga0070658_111174151 172
206 3300005328 Ga0070676_10003383 Ga0070676_100033835 172
207 3300005328 Ga0070676_10117658 Ga0070676_101176582 172
208 3300005328 Ga0070676_10498996 Ga0070676_104989961 172
209 3300005329 Ga0070683_100001172 Ga0070683_10000117221 172
210 3300005329 Ga0070683_100478644 Ga0070683_1004786442 172
211 3300005329 Ga0070683_101235066 Ga0070683_1012350662 172
212 3300005330 Ga0070690_100157479 Ga0070690_1001574793 172
213 3300005330 Ga0070690_100303331 Ga0070690_1003033311 172
214 3300005330 Ga0070690_100646627 Ga0070690_1006466272 172
215 3300005331 Ga0070670_100022490 Ga0070670_1000224908 172
216 3300005331 Ga0070670_100137930 Ga0070670_1001379302 172
217 3300005331 Ga0070670_100248362 Ga0070670_1002483622 172
218 3300005331 Ga0070670_100605606 Ga0070670_1006056061 172
219 3300005333 Ga0070677_10027028 Ga0070677_100270282 172
220 3300005333 Ga0070677_10028920 Ga0070677_100289203 172
221 3300005333 Ga0070677_10118287 Ga0070677_101182872 172
222 3300005334 Ga0068869_100106553 Ga0068869_1001065531 172
223 3300005334 Ga0068869_100345454 Ga0068869_1003454541 172
224 3300005335 Ga0070666_10000794 Ga0070666_1000079414 172
225 3300005335 Ga0070666_10033943 Ga0070666_100339433 172
226 3300005335 Ga0070666_10160740 Ga0070666_101607403 172
227 3300005335 Ga0070666_10170544 Ga0070666_101705441 172
228 3300005335 Ga0070666_10184590 Ga0070666_101845903 172
229 3300005336 Ga0070680_100066544 Ga0070680_1000665445 172
230 3300005336 Ga0070680_101067542 Ga0070680_1010675421 172
231 3300005337 Ga0070682_100091293 Ga0070682_1000912931 172
232 3300005337 Ga0070682_101359101 Ga0070682_1013591011 172
233 3300005338 Ga0068868_100001184 Ga0068868_1000011844 172
234 3300005338 Ga0068868_100006311 Ga0068868_1000063119 172
235 3300005338 Ga0068868_100131350 Ga0068868_1001313502 172
236 3300005338 Ga0068868_100251779 Ga0068868_1002517792 172
237 3300005338 Ga0068868_101232406 Ga0068868_1012324061 172
238 3300005339 Ga0070660_100001733 Ga0070660_10000173313 172
239 3300005339 Ga0070660_100011437 Ga0070660_1000114376 172
240 3300005339 Ga0070660_100024761 Ga0070660_1000247614 172
241 3300005339 Ga0070660_100052226 Ga0070660_1000522262 172
242 3300005339 Ga0070660_100052485 Ga0070660_1000524853 172
243 3300005339 Ga0070660_100165943 Ga0070660_1001659434 172
244 3300005339 Ga0070660_100267721 Ga0070660_1002677213 172
245 3300005339 Ga0070660_100295549 Ga0070660_1002955491 172
246 3300005339 Ga0070660_100399306 Ga0070660_1003993062 172
247 3300005339 Ga0070660_100859579 Ga0070660_1008595791 172
248 3300005344 Ga0070661_100000439 Ga0070661_10000043916 172
249 3300005344 Ga0070661_100009694 Ga0070661_1000096946 172
250 3300005344 Ga0070661_100052651 Ga0070661_1000526514 172
251 3300005344 Ga0070661_100112445 Ga0070661_1001124453 172
252 3300005344 Ga0070661_100197533 Ga0070661_1001975333 172
253 3300005344 Ga0070661_100406312 Ga0070661_1004063121 172
254 3300005344 Ga0070661_100481089 Ga0070661_1004810892 172
255 3300005344 Ga0070661_100659217 Ga0070661_1006592172 172
256 3300005344 Ga0070661_100690321 Ga0070661_1006903212 172
257 3300005345 Ga0070692_10026792 Ga0070692_100267925 172
258 3300005345 Ga0070692_10040107 Ga0070692_100401073 172
259 3300005345 Ga0070692_10171293 Ga0070692_101712932 172
260 3300005347 Ga0070668_100012244 Ga0070668_1000122442 172
261 3300005347 Ga0070668_100134536 Ga0070668_1001345363 172
262 3300005347 Ga0070668_100272528 Ga0070668_1002725282 172
263 3300005353 Ga0070669_100000643 Ga0070669_1000006434 172
264 3300005354 Ga0070675_100056674 Ga0070675_1000566742 172
265 3300005355 Ga0070671_100012172 Ga0070671_1000121726 172
266 3300005355 Ga0070671_100050481 Ga0070671_1000504814 172
267 3300005355 Ga0070671_100109455 Ga0070671_1001094553 172
268 3300005355 Ga0070671_100190670 Ga0070671_1001906702 172
269 3300005355 Ga0070671_100341970 Ga0070671_1003419702 172
270 3300005356 Ga0070674_100007903 Ga0070674_1000079035 172
271 3300005356 Ga0070674_100171212 Ga0070674_1001712122 172
272 3300005356 Ga0070674_101129164 Ga0070674_1011291642 172
273 3300005364 Ga0070673_100000663 Ga0070673_1000006637 172
274 3300005364 Ga0070673_100012465 Ga0070673_1000124654 172
275 3300005364 Ga0070673_100616112 Ga0070673_1006161122 172
276 3300005366 Ga0070659_100000065 Ga0070659_10000006578 172
277 3300005366 Ga0070659_100000382 Ga0070659_10000038223 172
278 3300005366 Ga0070659_100007320 Ga0070659_1000073209 172
279 3300005366 Ga0070659_100066482 Ga0070659_1000664822 172
280 3300005366 Ga0070659_100249214 Ga0070659_1002492141 172
281 3300005367 Ga0070667_100000520 Ga0070667_10000052026 172
282 3300005367 Ga0070667_100021677 Ga0070667_1000216773 172
283 3300005367 Ga0070667_100076773 Ga0070667_1000767734 172
284 3300005367 Ga0070667_100376543 Ga0070667_1003765431 172
285 3300005367 Ga0070667_100404108 Ga0070667_1004041082 172
286 3300005367 Ga0070667_101257963 Ga0070667_1012579631 172
287 3300005435 Ga0070714_100496435 Ga0070714_1004964352 172
288 3300005435 Ga0070714_100556099 Ga0070714_1005560992 172
289 3300005436 Ga0070713_100079429 Ga0070713_1000794292 172
290 3300005438 Ga0070701_10561646 Ga0070701_105616461 172
291 3300005455 Ga0070663_100001191 Ga0070663_10000119118 172
292 3300005455 Ga0070663_100009586 Ga0070663_1000095862 172
293 3300005455 Ga0070663_100069428 Ga0070663_1000694282 172
294 3300005455 Ga0070663_100090238 Ga0070663_1000902383 172
295 3300005455 Ga0070663_100240540 Ga0070663_1002405401 172
296 3300005455 Ga0070663_100383033 Ga0070663_1003830332 172
297 3300005455 Ga0070663_100970272 Ga0070663_1009702721 172
298 3300005455 Ga0070663_101316067 Ga0070663_1013160671 172
299 3300005456 Ga0070678_100002863 Ga0070678_1000028634 172
300 3300005456 Ga0070678_100004790 Ga0070678_1000047907 172
301 3300005456 Ga0070678_101323093 Ga0070678_1013230931 172
302 3300005457 Ga0070662_100000010 Ga0070662_100000010121 172
303 3300005457 Ga0070662_100000975 Ga0070662_10000097518 172
304 3300005457 Ga0070662_100105946 Ga0070662_1001059462 172
305 3300005457 Ga0070662_100291410 Ga0070662_1002914102 172
306 3300005457 Ga0070662_100297298 Ga0070662_1002972982 172
307 3300005457 Ga0070662_100369908 Ga0070662_1003699081 172
308 3300005457 Ga0070662_100451759 Ga0070662_1004517591 172
309 3300005457 Ga0070662_100475455 Ga0070662_1004754552 172
310 3300005458 Ga0070681_10445489 Ga0070681_104454892 172
311 3300005458 Ga0070681_11439178 Ga0070681_114391781 172
312 3300005459 Ga0068867_100001073 Ga0068867_1000010734 172
313 3300005459 Ga0068867_100176496 Ga0068867_1001764962 172
314 3300005459 Ga0068867_100207941 Ga0068867_1002079412 172
315 3300005466 Ga0070685_10406359 Ga0070685_104063592 172
316 3300005530 Ga0070679_100476441 Ga0070679_1004764412 172
317 3300005535 Ga0070684_100147020 Ga0070684_1001470204 172
318 3300005539 Ga0068853_100000396 Ga0068853_10000039617 172
319 3300005539 Ga0068853_100002970 Ga0068853_1000029708 172
320 3300005539 Ga0068853_100462696 Ga0068853_1004626961 172
321 3300005543 Ga0070672_100000342 Ga0070672_10000034225 172
322 3300005543 Ga0070672_100009142 Ga0070672_1000091423 172
323 3300005543 Ga0070672_100098005 Ga0070672_1000980053 172
324 3300005543 Ga0070672_100183437 Ga0070672_1001834373 172
325 3300005547 Ga0070693_100135424 Ga0070693_1001354242 172
326 3300005547 Ga0070693_100287365 Ga0070693_1002873651 172
327 3300005548 Ga0070665_100024270 Ga0070665_1000242709 172
328 3300005548 Ga0070665_100050272 Ga0070665_1000502723 172
329 3300005548 Ga0070665_100057220 Ga0070665_1000572203 172
330 3300005548 Ga0070665_100299477 Ga0070665_1002994772 172
331 3300005563 Ga0068855_100002953 Ga0068855_10000295321 172
332 3300005563 Ga0068855_100118606 Ga0068855_1001186063 172
333 3300005563 Ga0068855_100800463 Ga0068855_1008004632 172
334 3300005563 Ga0068855_101031312 Ga0068855_1010313121 172
335 3300005564 Ga0070664_100000921 Ga0070664_10000092117 172
336 3300005564 Ga0070664_100003562 Ga0070664_1000035628 172
337 3300005564 Ga0070664_100025245 Ga0070664_1000252456 172
338 3300005564 Ga0070664_100087081 Ga0070664_1000870814 172
339 3300005564 Ga0070664_100145972 Ga0070664_1001459724 172
340 3300005577 Ga0068857_100025380 Ga0068857_1000253803 172
341 3300005577 Ga0068857_100585291 Ga0068857_1005852911 172
342 3300005577 Ga0068857_101461621 Ga0068857_1014616211 172
343 3300005578 Ga0068854_100000376 Ga0068854_10000037633 172
344 3300005578 Ga0068854_100009844 Ga0068854_1000098441 172
345 3300005578 Ga0068854_100010635 Ga0068854_1000106355 172
346 3300005578 Ga0068854_100015406 Ga0068854_1000154065 172
347 3300005578 Ga0068854_100041469 Ga0068854_1000414695 172
348 3300005578 Ga0068854_100079101 Ga0068854_1000791014 172
349 3300005578 Ga0068854_100282997 Ga0068854_1002829972 172
350 3300005578 Ga0068854_100512156 Ga0068854_1005121562 172
351 3300005614 Ga0068856_100000101 Ga0068856_10000010116 172
352 3300005614 Ga0068856_100087310 Ga0068856_1000873102 172
353 3300005614 Ga0068856_100351176 Ga0068856_1003511763 172
354 3300005614 Ga0068856_100517367 Ga0068856_1005173672 172
355 3300005614 Ga0068856_100530075 Ga0068856_1005300753 172
356 3300005614 Ga0068856_100537967 Ga0068856_1005379672 172
357 3300005615 Ga0070702_100180117 Ga0070702_1001801171 172
358 3300005616 Ga0068852_100001271 Ga0068852_1000012719 172
359 3300005616 Ga0068852_100003309 Ga0068852_1000033098 172
360 3300005616 Ga0068852_100007627 Ga0068852_1000076274 172
361 3300005616 Ga0068852_100043958 Ga0068852_1000439584 172
362 3300005616 Ga0068852_100051240 Ga0068852_1000512405 172
363 3300005616 Ga0068852_100114924 Ga0068852_1001149244 172
364 3300005616 Ga0068852_100477513 Ga0068852_1004775132 172
365 3300005616 Ga0068852_100478301 Ga0068852_1004783013 172
366 3300005616 Ga0068852_100610421 Ga0068852_1006104212 172
367 3300005616 Ga0068852_100645560 Ga0068852_1006455603 172
368 3300005617 Ga0068859_100000982 Ga0068859_10000098223 172
369 3300005617 Ga0068859_100051492 Ga0068859_1000514922 172
370 3300005617 Ga0068859_101207514 Ga0068859_1012075142 172
371 3300005618 Ga0068864_100126660 Ga0068864_1001266604 172
372 3300005618 Ga0068864_100352583 Ga0068864_1003525832 172
373 3300005618 Ga0068864_100510632 Ga0068864_1005106322 172
374 3300005618 Ga0068864_100803985 Ga0068864_1008039852 172
375 3300005718 Ga0068866_10014127 Ga0068866_100141273 172
376 3300005718 Ga0068866_10196041 Ga0068866_101960412 172
377 3300005719 Ga0068861_100108050 Ga0068861_1001080504 172
378 3300005834 Ga0068851_10020215 Ga0068851_100202155 172
379 3300005834 Ga0068851_10144867 Ga0068851_101448672 172
380 3300005834 Ga0068851_10425103 Ga0068851_104251032 172
381 3300005834 Ga0068851_10458184 Ga0068851_104581841 172
382 3300005834 Ga0068851_10662256 Ga0068851_106622561 172
383 3300005840 Ga0068870_10025214 Ga0068870_100252144 172
384 3300005841 Ga0068863_100051941 Ga0068863_1000519413 172
385 3300005841 Ga0068863_100212126 Ga0068863_1002121263 172
386 3300005842 Ga0068858_100014737 Ga0068858_1000147375 172
387 3300005842 Ga0068858_100074533 Ga0068858_1000745332 172
388 3300005842 Ga0068858_100208240 Ga0068858_1002082401 172
389 3300005842 Ga0068858_100499823 Ga0068858_1004998231 172
390 3300005843 Ga0068860_100029748 Ga0068860_1000297483 172
391 3300005843 Ga0068860_100118333 Ga0068860_1001183333 172
392 3300005844 Ga0068862_100010976 Ga0068862_1000109764 172
393 3300005844 Ga0068862_100534286 Ga0068862_1005342862 172
394 3300006237 Ga0097621_100046020 Ga0097621_1000460203 172
395 3300006237 Ga0097621_100046571 Ga0097621_1000465714 172
396 3300006237 Ga0097621_100359278 Ga0097621_1003592782 172
397 3300006358 Ga0068871_100010555 Ga0068871_1000105556 172
398 3300006358 Ga0068871_100223579 Ga0068871_1002235792 172
399 3300006358 Ga0068871_100689343 Ga0068871_1006893432 172
400 3300006358 Ga0068871_101143361 Ga0068871_1011433612 172
401 3300006881 Ga0068865_100014194 Ga0068865_1000141944 172
402 3300006881 Ga0068865_100062669 Ga0068865_1000626695 172
403 3300006931 Ga0097620_100000982 Ga0097620_1000009829 172
404 3300006931 Ga0097620_100051492 Ga0097620_1000514926 172
405 3300006931 Ga0097620_101207312 Ga0097620_1012073121 172
406 3300009093 Ga0105240_10204422 Ga0105240_102044221 172
407 3300009093 Ga0105240_10438136 Ga0105240_104381362 172
408 3300009093 Ga0105240_10446978 Ga0105240_104469781 172
409 3300009098 Ga0105245_10000657 Ga0105245_1000065726 172
410 3300009098 Ga0105245_10094182 Ga0105245_100941824 172
411 3300009098 Ga0105245_10150090 Ga0105245_101500903 172
412 3300009148 Ga0105243_10071843 Ga0105243_100718434 172
413 3300009148 Ga0105243_10193425 Ga0105243_101934253 172
414 3300009174 Ga0105241_10092914 Ga0105241_100929144 172
415 3300009174 Ga0105241_10247080 Ga0105241_102470802 172
416 3300009174 Ga0105241_10333435 Ga0105241_103334353 172
417 3300009174 Ga0105241_10781011 Ga0105241_107810112 172
418 3300009176 Ga0105242_10160691 Ga0105242_101606913 172
419 3300009177 Ga0105248_10000394 Ga0105248_1000039412 172
420 3300009177 Ga0105248_10000724 Ga0105248_1000072430 172
421 3300009177 Ga0105248_10049783 Ga0105248_100497834 172
422 3300009177 Ga0105248_10081904 Ga0105248_100819043 172
423 3300009177 Ga0105248_10147111 Ga0105248_101471112 172
424 3300009177 Ga0105248_10705784 Ga0105248_107057842 172
425 3300009177 Ga0105248_11989975 Ga0105248_119899751 172
426 3300009545 Ga0105237_10904600 Ga0105237_109046002 172
427 3300009551 Ga0105238_10081009 Ga0105238_100810093 172
428 3300009551 Ga0105238_10141251 Ga0105238_101412512 172
429 3300009551 Ga0105238_10577361 Ga0105238_105773612 172
430 3300009551 Ga0105238_11180946 Ga0105238_111809462 172
431 3300010375 Ga0105239_10071319 Ga0105239_100713193 172
432 3300010375 Ga0105239_10426705 Ga0105239_104267052 172
433 3300010375 Ga0105239_10629764 Ga0105239_106297643 172
434 3300010375 Ga0105239_11148050 Ga0105239_111480501 172
435 3300011119 Ga0105246_10050816 Ga0105246_100508164 172
436 3300013100 Ga0157373_10002321 Ga0157373_1000232112 172
437 3300013100 Ga0157373_10019651 Ga0157373_100196516 172
438 3300013100 Ga0157373_10320208 Ga0157373_103202082 172
439 3300013100 Ga0157373_10431597 Ga0157373_104315972 172
440 3300013100 Ga0157373_10448658 Ga0157373_104486581 172
441 3300013102 Ga0157371_10003868 Ga0157371_100038681 172
442 3300013102 Ga0157371_10021480 Ga0157371_100214804 172
443 3300013102 Ga0157371_10100537 Ga0157371_101005373 172
444 3300013102 Ga0157371_10368237 Ga0157371_103682372 172
445 3300013104 Ga0157370_10069488 Ga0157370_100694883 172
446 3300013104 Ga0157370_10805127 Ga0157370_108051271 172
447 3300013104 Ga0157370_11373366 Ga0157370_113733661 172
448 3300013105 Ga0157369_10102732 Ga0157369_101027323 172
449 3300013296 Ga0157374_10095106 Ga0157374_100951063 172
450 3300013296 Ga0157374_10111504 Ga0157374_101115043 172
451 3300013296 Ga0157374_10188332 Ga0157374_101883323 172
452 3300013297 Ga0157378_10053801 Ga0157378_100538014 172
453 3300013297 Ga0157378_10201957 Ga0157378_102019572 172
454 3300013297 Ga0157378_10335861 Ga0157378_103358613 172
455 3300013297 Ga0157378_10502725 Ga0157378_105027252 172
456 3300013306 Ga0163162_10129828 Ga0163162_101298284 172
457 3300013306 Ga0163162_10148905 Ga0163162_101489054 172
458 3300013306 Ga0163162_10433015 Ga0163162_104330152 172
459 3300013307 Ga0157372_10329312 Ga0157372_103293122 172
460 3300013307 Ga0157372_10396569 Ga0157372_103965692 172
461 3300013307 Ga0157372_10675425 Ga0157372_106754252 172
462 3300013307 Ga0157372_11181224 Ga0157372_111812242 172
463 3300013308 Ga0157375_10040319 Ga0157375_100403193 172
464 3300013308 Ga0157375_10083005 Ga0157375_100830054 172
465 3300013308 Ga0157375_11028066 Ga0157375_110280662 172
466 3300014325 Ga0163163_10000580 Ga0163163_1000058016 172
467 3300014968 Ga0157379_10108615 Ga0157379_101086153 172
468 3300014968 Ga0157379_10153038 Ga0157379_101530383 172
469 3300014968 Ga0157379_10162684 Ga0157379_101626844 172
470 3300014968 Ga0157379_10254846 Ga0157379_102548461 172
471 3300020082 Ga0206353_10667997 Ga0206353_106679973 172
472 3300020082 Ga0206353_11733630 Ga0206353_117336302 172
473 3300021384 Ga0213876_10020386 Ga0213876_100203864 172
474 3300025315 Ga0207697_10000056 Ga0207697_1000005618 172
475 3300025321 Ga0207656_10207003 Ga0207656_102070032 172
476 3300025321 Ga0207656_10257284 Ga0207656_102572841 172
477 3300025893 Ga0207682_10030104 Ga0207682_100301044 172
478 3300025893 Ga0207682_10036601 Ga0207682_100366013 172
479 3300025899 Ga0207642_10183404 Ga0207642_101834043 172
480 3300025899 Ga0207642_10512212 Ga0207642_105122121 172
481 3300025901 Ga0207688_10000873 Ga0207688_100008734 172
482 3300025901 Ga0207688_10014674 Ga0207688_100146745 172
483 3300025903 Ga0207680_10002980 Ga0207680_100029805 172
484 3300025903 Ga0207680_10024179 Ga0207680_100241793 172
485 3300025903 Ga0207680_10162286 Ga0207680_101622863 172
486 3300025904 Ga0207647_10000702 Ga0207647_1000070223 172
487 3300025904 Ga0207647_10116413 Ga0207647_101164132 172
488 3300025904 Ga0207647_10124344 Ga0207647_101243442 172
489 3300025904 Ga0207647_10126977 Ga0207647_101269772 172
490 3300025904 Ga0207647_10160078 Ga0207647_101600782 172
491 3300025907 Ga0207645_10003187 Ga0207645_100031874 172
492 3300025907 Ga0207645_10167314 Ga0207645_101673142 172
493 3300025907 Ga0207645_10340191 Ga0207645_103401912 172
494 3300025909 Ga0207705_10000113 Ga0207705_1000011368 172
495 3300025909 Ga0207705_10001078 Ga0207705_100010787 172
496 3300025909 Ga0207705_10004032 Ga0207705_100040325 172
497 3300025909 Ga0207705_10008819 Ga0207705_100088196 172
498 3300025909 Ga0207705_10020736 Ga0207705_100207364 172
499 3300025909 Ga0207705_10072739 Ga0207705_100727395 172
500 3300025909 Ga0207705_10167191 Ga0207705_101671913 172
501 3300025909 Ga0207705_10333849 Ga0207705_103338492 172
502 3300025909 Ga0207705_10467891 Ga0207705_104678912 172
503 3300025909 Ga0207705_10480632 Ga0207705_104806322 172
504 3300025909 Ga0207705_10752109 Ga0207705_107521091 172
505 3300025911 Ga0207654_10011465 Ga0207654_100114652 172
506 3300025911 Ga0207654_10146098 Ga0207654_101460982 172
507 3300025913 Ga0207695_10013501 Ga0207695_100135012 172
508 3300025913 Ga0207695_10117890 Ga0207695_101178903 172
509 3300025918 Ga0207662_10094594 Ga0207662_100945942 172
510 3300025919 Ga0207657_10000026 Ga0207657_1000002616 172
511 3300025919 Ga0207657_10006986 Ga0207657_1000698610 172
512 3300025919 Ga0207657_10016327 Ga0207657_100163273 172
513 3300025919 Ga0207657_10023326 Ga0207657_100233263 172
514 3300025919 Ga0207657_10031009 Ga0207657_100310092 172
515 3300025919 Ga0207657_10046030 Ga0207657_100460302 172
516 3300025919 Ga0207657_10062151 Ga0207657_100621515 172
517 3300025919 Ga0207657_10180645 Ga0207657_101806453 172
518 3300025919 Ga0207657_10269697 Ga0207657_102696972 172
519 3300025919 Ga0207657_10386863 Ga0207657_103868633 172
520 3300025920 Ga0207649_10000228 Ga0207649_1000022840 172
521 3300025920 Ga0207649_10000594 Ga0207649_1000059416 172
522 3300025920 Ga0207649_10002750 Ga0207649_100027509 172
523 3300025920 Ga0207649_10021289 Ga0207649_100212894 172
524 3300025920 Ga0207649_10074709 Ga0207649_100747094 172
525 3300025920 Ga0207649_10130793 Ga0207649_101307932 172
526 3300025923 Ga0207681_10042173 Ga0207681_100421734 172
527 3300025924 Ga0207694_10018777 Ga0207694_100187774 172
528 3300025924 Ga0207694_10042606 Ga0207694_100426061 172
529 3300025925 Ga0207650_10029446 Ga0207650_100294464 172
530 3300025925 Ga0207650_10129978 Ga0207650_101299782 172
531 3300025925 Ga0207650_10141661 Ga0207650_101416612 172
532 3300025925 Ga0207650_10399286 Ga0207650_103992862 172
533 3300025925 Ga0207650_10561044 Ga0207650_105610442 172
534 3300025926 Ga0207659_10132935 Ga0207659_101329352 172
535 3300025927 Ga0207687_10037569 Ga0207687_100375694 172
536 3300025927 Ga0207687_10056090 Ga0207687_100560904 172
537 3300025927 Ga0207687_10362910 Ga0207687_103629103 172
538 3300025929 Ga0207664_10075178 Ga0207664_100751784 172
539 3300025929 Ga0207664_10172139 Ga0207664_101721393 172
540 3300025929 Ga0207664_10198683 Ga0207664_101986832 172
541 3300025931 Ga0207644_10002444 Ga0207644_1000244413 172
542 3300025931 Ga0207644_10015287 Ga0207644_100152876 172
543 3300025931 Ga0207644_10026246 Ga0207644_100262463 172
544 3300025931 Ga0207644_10095042 Ga0207644_100950422 172
545 3300025931 Ga0207644_10317769 Ga0207644_103177692 172
546 3300025931 Ga0207644_11132040 Ga0207644_111320401 172
547 3300025932 Ga0207690_10000036 Ga0207690_1000003638 172
548 3300025932 Ga0207690_10003797 Ga0207690_100037974 172
549 3300025932 Ga0207690_10009307 Ga0207690_100093076 172
550 3300025932 Ga0207690_10281251 Ga0207690_102812512 172
551 3300025933 Ga0207706_10000031 Ga0207706_10000031119 172
552 3300025933 Ga0207706_10000619 Ga0207706_1000061926 172
553 3300025933 Ga0207706_10089255 Ga0207706_100892554 172
554 3300025933 Ga0207706_10448657 Ga0207706_104486572 172
555 3300025933 Ga0207706_10526694 Ga0207706_105266942 172
556 3300025933 Ga0207706_10979993 Ga0207706_109799932 172
557 3300025935 Ga0207709_10182162 Ga0207709_101821621 172
558 3300025935 Ga0207709_10231894 Ga0207709_102318943 172
559 3300025937 Ga0207669_10011540 Ga0207669_100115404 172
560 3300025937 Ga0207669_11052598 Ga0207669_110525981 172
561 3300025938 Ga0207704_10106951 Ga0207704_101069514 172
562 3300025940 Ga0207691_10000085 Ga0207691_1000008525 172
563 3300025940 Ga0207691_10019225 Ga0207691_100192252 172
564 3300025940 Ga0207691_10131904 Ga0207691_101319043 172
565 3300025941 Ga0207711_10008432 Ga0207711_100084329 172
566 3300025941 Ga0207711_10016978 Ga0207711_100169783 172
567 3300025941 Ga0207711_10047841 Ga0207711_100478414 172
568 3300025941 Ga0207711_10049758 Ga0207711_100497584 172
569 3300025941 Ga0207711_10234066 Ga0207711_102340663 172
570 3300025941 Ga0207711_10908888 Ga0207711_109088882 172
571 3300025942 Ga0207689_10000016 Ga0207689_10000016143 172
572 3300025944 Ga0207661_10012875 Ga0207661_100128752 172
573 3300025944 Ga0207661_11344110 Ga0207661_113441101 172
574 3300025945 Ga0207679_10000093 Ga0207679_1000009338 172
575 3300025945 Ga0207679_10014881 Ga0207679_100148813 172
576 3300025945 Ga0207679_10060828 Ga0207679_100608284 172
577 3300025945 Ga0207679_10283200 Ga0207679_102832002 172
578 3300025945 Ga0207679_10539562 Ga0207679_105395623 172
579 3300025945 Ga0207679_11068844 Ga0207679_110688442 172
580 3300025949 Ga0207667_10003819 Ga0207667_1000381911 172
581 3300025949 Ga0207667_10005640 Ga0207667_1000564022 172
582 3300025949 Ga0207667_10015986 Ga0207667_100159864 172
583 3300025949 Ga0207667_10717492 Ga0207667_107174922 172
584 3300025960 Ga0207651_10000128 Ga0207651_100001284 172
585 3300025960 Ga0207651_10069082 Ga0207651_100690824 172
586 3300025960 Ga0207651_10291993 Ga0207651_102919932 172
587 3300025960 Ga0207651_11058990 Ga0207651_110589902 172
588 3300025960 Ga0207651_11219879 Ga0207651_112198792 172
589 3300025972 Ga0207668_10199423 Ga0207668_101994233 172
590 3300025981 Ga0207640_10005488 Ga0207640_100054883 172
591 3300025981 Ga0207640_10008178 Ga0207640_100081783 172
592 3300025981 Ga0207640_10011322 Ga0207640_100113225 172
593 3300025981 Ga0207640_10028161 Ga0207640_100281615 172
594 3300025981 Ga0207640_10032443 Ga0207640_100324435 172
595 3300025986 Ga0207658_10011328 Ga0207658_100113289 172
596 3300025986 Ga0207658_10043135 Ga0207658_100431354 172
597 3300025986 Ga0207658_10086266 Ga0207658_100862663 172
598 3300025986 Ga0207658_10127054 Ga0207658_101270542 172
599 3300025986 Ga0207658_10259407 Ga0207658_102594072 172
600 3300025986 Ga0207658_10513724 Ga0207658_105137242 172
601 3300026023 Ga0207677_10000878 Ga0207677_1000087816 172
602 3300026023 Ga0207677_10005679 Ga0207677_100056794 172
603 3300026023 Ga0207677_10021112 Ga0207677_100211124 172
604 3300026023 Ga0207677_10043235 Ga0207677_100432355 172
605 3300026023 Ga0207677_10415052 Ga0207677_104150522 172
606 3300026023 Ga0207677_10627607 Ga0207677_106276071 172
607 3300026035 Ga0207703_10004317 Ga0207703_1000431710 172
608 3300026035 Ga0207703_10019212 Ga0207703_100192124 172
609 3300026035 Ga0207703_10051571 Ga0207703_100515712 172
610 3300026035 Ga0207703_10064236 Ga0207703_100642363 172
611 3300026041 Ga0207639_10000727 Ga0207639_1000072717 172
612 3300026041 Ga0207639_10070942 Ga0207639_100709424 172
613 3300026041 Ga0207639_10073181 Ga0207639_100731815 172
614 3300026041 Ga0207639_10146350 Ga0207639_101463503 172
615 3300026067 Ga0207678_10015424 Ga0207678_100154242 172
616 3300026067 Ga0207678_10021256 Ga0207678_100212563 172
617 3300026067 Ga0207678_10050163 Ga0207678_100501633 172
618 3300026067 Ga0207678_10084967 Ga0207678_100849674 172
619 3300026067 Ga0207678_10087071 Ga0207678_100870713 172
620 3300026067 Ga0207678_10101383 Ga0207678_101013834 172
621 3300026067 Ga0207678_10148781 Ga0207678_101487812 172
622 3300026067 Ga0207678_10262767 Ga0207678_102627672 172
623 3300026078 Ga0207702_10000353 Ga0207702_1000035341 172
624 3300026078 Ga0207702_10425955 Ga0207702_104259553 172
625 3300026078 Ga0207702_10526333 Ga0207702_105263332 172
626 3300026078 Ga0207702_10939063 Ga0207702_109390632 172
627 3300026078 Ga0207702_11195104 Ga0207702_111951042 172
628 3300026088 Ga0207641_10184204 Ga0207641_101842042 172
629 3300026088 Ga0207641_10218287 Ga0207641_102182873 172
630 3300026089 Ga0207648_10000141 Ga0207648_1000014168 172
631 3300026089 Ga0207648_10076062 Ga0207648_100760622 172
632 3300026089 Ga0207648_10166015 Ga0207648_101660153 172
633 3300026095 Ga0207676_10013820 Ga0207676_100138207 172
634 3300026095 Ga0207676_10502536 Ga0207676_105025362 172
635 3300026116 Ga0207674_10000714 Ga0207674_100007145 172
636 3300026116 Ga0207674_10116176 Ga0207674_101161762 172
637 3300026116 Ga0207674_10464217 Ga0207674_104642171 172
638 3300026116 Ga0207674_10511095 Ga0207674_105110952 172
639 3300026118 Ga0207675_100108433 Ga0207675_1001084334 172
640 3300026121 Ga0207683_10001784 Ga0207683_1000178422 172
641 3300026121 Ga0207683_10018862 Ga0207683_100188626 172
642 3300026121 Ga0207683_10045410 Ga0207683_100454106 172
643 3300026121 Ga0207683_10557070 Ga0207683_105570701 172
644 3300026142 Ga0207698_10003263 Ga0207698_100032636 172
645 3300026142 Ga0207698_10019729 Ga0207698_100197294 172
646 3300026142 Ga0207698_10030156 Ga0207698_100301563 172
647 3300026142 Ga0207698_10030214 Ga0207698_100302145 172
648 3300026142 Ga0207698_10112772 Ga0207698_101127723 172
649 3300026142 Ga0207698_10259948 Ga0207698_102599483 172
650 3300026142 Ga0207698_10657204 Ga0207698_106572041 172
651 3300026142 Ga0207698_11081749 Ga0207698_110817492 172
652 3300028379 Ga0268266_10005701 Ga0268266_100057016 172
653 3300028379 Ga0268266_10068721 Ga0268266_100687211 172
654 3300028379 Ga0268266_10084750 Ga0268266_100847504 172
655 3300028380 Ga0268265_10047416 Ga0268265_100474163 172
656 3300028380 Ga0268265_10815868 Ga0268265_108158681 172
657 3300028381 Ga0268264_10276064 Ga0268264_102760642 172
658 3300030742 Ga0316183_1065227 Ga0316183_10652272 172
659 3300031548 Ga0307408_100189048 Ga0307408_1001890482 172
660 3300031824 Ga0307413_10084448 Ga0307413_100844482 172
661 3300031824 Ga0307413_10107929 Ga0307413_101079293 172
662 3300031852 Ga0307410_10042216 Ga0307410_100422163 172
663 3300031852 Ga0307410_10043764 Ga0307410_100437644 172
664 3300031852 Ga0307410_10070271 Ga0307410_100702713 172
665 3300031852 Ga0307410_10108356 Ga0307410_101083561 172
666 3300031852 Ga0307410_10509594 Ga0307410_105095942 172
667 3300031903 Ga0307407_10015836 Ga0307407_100158365 172
668 3300031903 Ga0307407_10018337 Ga0307407_100183374 172
669 3300031903 Ga0307407_10244706 Ga0307407_102447062 172
670 3300031903 Ga0307407_10717674 Ga0307407_107176741 172
671 3300031911 Ga0307412_10050272 Ga0307412_100502723 172
672 3300031911 Ga0307412_10854486 Ga0307412_108544861 172
673 3300031995 Ga0307409_100131979 Ga0307409_1001319793 172
674 3300032002 Ga0307416_100002975 Ga0307416_1000029757 172
675 3300032002 Ga0307416_100050428 Ga0307416_1000504283 172
676 3300032004 Ga0307414_10063961 Ga0307414_100639613 172
677 3300032004 Ga0307414_10111383 Ga0307414_101113832 172
678 3300032004 Ga0307414_10188468 Ga0307414_101884682 172
679 3300032005 Ga0307411_10004667 Ga0307411_100046674 172
680 3300032005 Ga0307411_10119195 Ga0307411_101191951 172
681 3300032005 Ga0307411_10141980 Ga0307411_101419802 172
682 3300032126 Ga0307415_100125797 Ga0307415_1001257973 172
683 3300032126 Ga0307415_100479346 Ga0307415_1004793462 172
684 3300034819 Ga0373958_0143109 Ga0373958_0143109_20_538 172
685 3300035092 Ga0373952_0019712 Ga0373952_0019712_845_1363 172
686 3300035115 Ga0373941_0182928 Ga0373941_0182928_259_777 172
687 3300035691 Ga0373931_0011351 Ga0373931_0011351_3415_3933 172
688 3300037312 Ga0395899_0125330 Ga0395899_0125330_510_1037 172
689 3300037312 Ga0395899_0230846 Ga0395899_0230846_672_1202 172
690 3300037312 Ga0395899_0278614 Ga0395899_0278614_123_647 172
691 3300037418 Ga0395900_0102140 Ga0395900_0102140_990_1514 172
692 3300037418 Ga0395900_0135934 Ga0395900_0135934_272_799 172
693 3300037418 Ga0395900_0393532 Ga0395900_0393532_538_1068 172
694 3300037466 Ga0395898_0040716 Ga0395898_0040716_2554_3078 172
695 3300037466 Ga0395898_0047607 Ga0395898_0047607_530_1057 172
696 3300037466 Ga0395898_0241651 Ga0395898_0241651_1157_1675 172
697 3300037466 Ga0395898_0722812 Ga0395898_0722812_383_901 172
698 3300037471 Ga0395905_0131739 Ga0395905_0131739_111_638 172
699 3300037471 Ga0395905_0230981 Ga0395905_0230981_1051_1575 172
700 3300037471 Ga0395905_1295868 Ga0395905_1295868_52_570 172
701 3300038443 Ga0395901_0058768 Ga0395901_0058768_2158_2685 172
702 3300038443 Ga0395901_0227407 Ga0395901_0227407_119_643 172
703 3300039437 Ga0436365_1911625 Ga0436365_1911625_10772_11293 172
704 3300042006 Ga0439432_053665 Ga0439432_053665_481_999 172
705 3300042007 Ga0439449_0134201 Ga0439449_0134201_247_765 172
706 3300042439 Ga0439464_0001952 Ga0439464_0001952_227_745 172
707 3300044658 Ga0466972_0065651 Ga0466972_0065651_1042_1560 172
708 3300044683 Ga0466965_0233014 Ga0466965_0233014_287_805 172
709 3300044684 Ga0466966_0085503 Ga0466966_0085503_623_1153 172
710 3300044684 Ga0466966_0111676 Ga0466966_0111676_488_1012 172
711 3300044693 Ga0466961_0076656 Ga0466961_0076656_226_756 172
712 3300044694 Ga0466963_0138024 Ga0466963_0138024_711_1232 172
713 3300044694 Ga0466963_0280348 Ga0466963_0280348_43_573 172
714 3300044706 Ga0466964_0029131 Ga0466964_0029131_1359_1892 172
715 3300044706 Ga0466964_0034486 Ga0466964_0034486_427_957 172
716 3300044719 Ga0466971_0027409 Ga0466971_0027409_676_1206 172
717 3300044735 Ga0466968_0001603 Ga0466968_0001603_2628_3161 172
718 3300044765 Ga0466970_0067725 Ga0466970_0067725_1045_1578 172
719 3300044765 Ga0466970_0088928 Ga0466970_0088928_336_857 172
720 3300044842 Ga0466957_0022472 Ga0466957_0022472_1208_1738 172
721 3300044842 Ga0466957_0364806 Ga0466957_0364806_100_621 172
722 3300044901 Ga0466960_0051732 Ga0466960_0051732_576_1094 172
723 3300045049 Ga0466959_0066499 Ga0466959_0066499_443_976 172
724 3300045836 Ga0466958_0021475 Ga0466958_0021475_2293_2826 172
725 3300045836 Ga0466958_0077165 Ga0466958_0077165_381_899 172
726 3300045836 Ga0466958_0175975 Ga0466958_0175975_503_1033 172
727 3300045836 Ga0466958_0521999 Ga0466958_0521999_41_562 172
728 3300045976 Ga0466967_0009394 Ga0466967_0009394_6113_6631 172
729 3300045976 Ga0466967_0045095 Ga0466967_0045095_1226_1744 172
730 3300045976 Ga0466967_0048769 Ga0466967_0048769_737_1261 172
731 3300045976 Ga0466967_0093847 Ga0466967_0093847_1668_2192 172
732 3300045976 Ga0466967_0652490 Ga0466967_0652490_302_820 172
733 3300046684 Ga0495669_0082234 Ga0495669_0082234_660_1178 172
734 3300048903 Ga0496100_0115407 Ga0496100_0115407_801_1319 172
735 3300048904 Ga0496101_0018477 Ga0496101_0018477_2377_2895 172
736 3300048904 Ga0496101_0486969 Ga0496101_0486969_380_901 172
737 3300048904 Ga0496101_0531778 Ga0496101_0531778_64_582 172
738 3300048905 Ga0496102_0102322 Ga0496102_0102322_1027_1545 172
739 3300048907 Ga0496104_0359374 Ga0496104_0359374_509_1027 172
740 3300048909 Ga0496106_0103524 Ga0496106_0103524_1247_1765 172
741 3300048909 Ga0496106_0353708 Ga0496106_0353708_499_1017 172
742 3300048910 Ga0496107_0011093 Ga0496107_0011093_734_1252 172
743 3300048911 Ga0496108_0000372 Ga0496108_0000372_11871_12389 172
744 3300048911 Ga0496108_0073265 Ga0496108_0073265_1387_1905 172
745 3300048912 Ga0496109_0404855 Ga0496109_0404855_383_901 172
746 3300048912 Ga0496109_0583470 Ga0496109_0583470_298_816 172
747 3300048912 Ga0496109_0790325 Ga0496109_0790325_199_717 172
748 3300048912 Ga0496109_0908857 Ga0496109_0908857_15_533 172
749 3300048913 Ga0496110_0088388 Ga0496110_0088388_1448_1966 172
750 3300048914 Ga0496111_0018546 Ga0496111_0018546_1448_1966 172
751 3300048914 Ga0496111_0852869 Ga0496111_0852869_124_642 172
752 3300048915 Ga0496112_0045034 Ga0496112_0045034_2281_2799 172
753 3300048916 Ga0496113_0143704 Ga0496113_0143704_583_1101 172
754 3300048917 Ga0496114_0000023 Ga0496114_0000023_142346_142864 172
755 3300049586 Ga0501070_0090807 Ga0501070_0090807_1121_1642 172
756 3300049667 Ga0501230_028928 Ga0501230_028928_154_672 172
757 3300049669 Ga0501235_117609 Ga0501235_117609_131_649 172
758 3300049686 Ga0501257_020608 Ga0501257_020608_118_636 172
759 3300049687 Ga0501258_002729 Ga0501258_002729_905_1423 172
760 3300049765 Ga0501268_000728 Ga0501268_000728_2250_2768 172
761 3300049768 Ga0501271_005267 Ga0501271_005267_141_659 172
762 3300049770 Ga0501273_005503 Ga0501273_005503_799_1317 172
763 3300049851 Ga0501212_011132 Ga0501212_011132_255_773 172
764 3300061719 Ga0466962_0023979 Ga0466962_0023979_1752_2282 172
765 3300061719 Ga0466962_0313354 Ga0466962_0313354_82_600 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03073

TspO_MBR

TspO/MBR family

15

157

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rym-assembly1.cif.gz_A crystal structure of bctspo iodo type1 monomer 0.9216 12 163
8e7y-assembly1.cif.gz_A rstspo a138f with two heme bound 0.9115 11 168
8e7x-assembly1.cif.gz_B rstspo a138f with one heme bound 0.909 11 166
4uc1-assembly1.cif.gz_B high resolution crystal structure of translocator protein 18kda (tspo) from rhodobacter sphaeroides (a139t mutant) in c2 space group 0.9023 11 166
8e7z-assembly2.cif.gz_C-3 rstspo mutant -a138f 0.9012 11 163
ID Description Score Start End Superfamily
af_Q5XJB6_1_156_1.20.1260.100 Mainly Alpha;Up-down Bundle;Ferritin;TspO/MBR protein 0.9058 11 164 1.20.1260.100
af_I1MGL3_15_166_1.20.1260.100 Mainly Alpha;Up-down Bundle;Ferritin;TspO/MBR protein 0.9011 9 160 1.20.1260.100
af_Q5XJB6_1_156_1.20.1260.100 Mainly Alpha;Up-down Bundle;Ferritin;TspO/MBR protein 0.8894 11 164 1.20.1260.100
af_I1MGL3_15_166_1.20.1260.100 Mainly Alpha;Up-down Bundle;Ferritin;TspO/MBR protein 0.8846 9 160 1.20.1260.100
af_O94327_12_164_1.20.1260.100 Mainly Alpha;Up-down Bundle;Ferritin;TspO/MBR protein 0.8753 10 163 1.20.1260.100
ID Description Score Start End GO Terms
AF-A0A7G9L493-F1-model_v4 Tryptophan-rich sensory protein 0.9996 10 172 GO:0016020
GO:0033013
AF-A0A7H0G3F9-F1-model_v4 deleted 0.9995 10 165
AF-A0A2E0EMF3-F1-model_v4 TspO protein 0.9881 12 163 GO:0016020
GO:0033013
AF-A0A327J6Q1-F1-model_v4 Tryptophan-rich sensory protein 0.9855 38 163 GO:0016020
GO:0033013
AF-A0A348TNF5-F1-model_v4 TspO protein 0.9823 10 163 GO:0016020
GO:0033013

Feature Viewer

pLDDT pTM Quality
91.74 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map