F479749

General Info

Members Datasets Scaffolds Average Seq Length
764 515 1528 211

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0318827|Ga0496113_0318827_378_1082
Length 234
Sequence VVDLTDSIRTSVEAARRRALDPHRIGHRPEHGERVHVEPTGHGEGGPASKRIVTAYGFWLFLLSDIVMFSAFFAAYAVLQNETAGGPSGHQVFELPRVAVETGVLLLSSFTCGLAAISTWNRNMMLAQGGLLITGILGAIFLGLEIQEFVGLVQQGAGPQRSAFLSSFFAVVGCHGLHVTAGLLWLGTMMAQIYVKGFTAPIMRRMLCFSLFWHTLDIIWVAIFTVVYLMGAAR

Samples

Sample ID Description Type Environment
1 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
163 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
164 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
176 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
180 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
181 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
199 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
200 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
231 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
237 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
238 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
239 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
253 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
256 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
257 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
262 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
263 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
264 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
297 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
298 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
299 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
300 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
303 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
304 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
310 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
313 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
314 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
315 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
316 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
317 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
318 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
319 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
320 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
321 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
322 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
323 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
324 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
325 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
326 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
327 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
328 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
329 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
330 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
331 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
332 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
333 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
334 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
335 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
336 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
337 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
338 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
339 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
340 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
341 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
342 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
343 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
344 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
345 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
346 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
347 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
348 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
349 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
350 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
351 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
352 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
353 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
354 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
355 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
356 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
357 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
358 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
359 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
360 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
361 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
362 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
363 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
364 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
365 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
366 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
367 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
368 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
369 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
370 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
371 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
372 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
373 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
374 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
375 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
376 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
377 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
378 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
379 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
380 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
381 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
382 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
383 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
384 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
385 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
386 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
387 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
388 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
389 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
390 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
391 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
392 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
393 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
394 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
395 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
396 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
397 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
398 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
399 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
400 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
401 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
402 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
403 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
404 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
405 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
406 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
407 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
408 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
409 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
410 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
411 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
412 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
413 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
414 2922368715
415 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
416 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
417 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
418 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
419 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
420 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
421 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
422 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
423 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
424 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
425 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
426 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
427 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
428 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
429 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
430 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
431 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
432 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
433 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
434 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
435 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
436 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
437 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
438 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
439 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
440 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
441 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
442 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
443 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
444 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
445 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
446 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
447 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
448 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
449 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
450 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
451 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
452 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
453 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
454 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
455 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
456 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
457 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
458 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
459 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
460 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
461 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
462 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
463 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
464 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
465 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
466 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
467 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
468 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
469 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
470 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
471 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
472 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
473 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
474 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
475 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
476 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
477 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
478 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
479 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
480 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
481 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
482 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
483 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
484 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
485 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
486 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
487 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
488 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
489 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
490 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
491 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
492 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
493 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
494 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
495 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
496 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
497 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
498 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
499 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
500 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
501 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
502 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
503 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
504 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
505 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
506 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
507 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
508 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
509 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
510 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
511 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
512 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
513 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
514 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
515 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.31
Metatranscriptomes 0.26
Isolates 25.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.7
Nodule 20.42
Rhizoplane 5.1
Rhizosphere 51.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496113_0318827 3300048916 Bacteria 1246
2 Ga0006778J45830_1034026 3300003162 Bacteria 1476
3 JGI25153J46596_10000382 3300003215 Bacteria 30334
4 JGI25153J46596_10000866 3300003215 Bacteria 18445
5 JGI25153J46596_10020786 3300003215 Bacteria 2469
6 JGI25160J50197_1008546 3300003354 Bacteria 3892
7 JGI25160J50197_1034463 3300003354 Bacteria 1256
8 JGI25404J52841_10005170 3300003659 Bacteria 2689
9 JGI25404J52841_10026591 3300003659 Bacteria 1245
10 Ga0055542_1011299 3300003762 Bacteria 1590
11 Ga0055531_10009703 3300003794 Bacteria 4890
12 Ga0065165_1007525 3300005262 Bacteria 5324
13 Ga0065165_1013398 3300005262 Bacteria 3262
14 Ga0065165_1021063 3300005262 Bacteria 2274
15 Ga0065165_1080168 3300005262 Bacteria 849
16 Ga0070658_10001212 3300005327 Bacteria 22108
17 Ga0070670_100207773 3300005331 Bacteria 1702
18 Ga0068869_100029200 3300005334 Bacteria 3862
19 Ga0070680_100005766 3300005336 Bacteria 9397
20 Ga0070680_100040498 3300005336 Bacteria 3773
21 Ga0068868_100297556 3300005338 Bacteria 1370
22 Ga0070660_100022424 3300005339 Bacteria 4669
23 Ga0070660_100392313 3300005339 Bacteria 1147
24 Ga0070689_100260260 3300005340 Bacteria 1434
25 Ga0070691_10001227 3300005341 Bacteria 10789
26 Ga0070691_10080946 3300005341 Bacteria 1590
27 Ga0070661_100327148 3300005344 Bacteria 1198
28 Ga0070692_10232327 3300005345 Bacteria 1095
29 Ga0070668_100008050 3300005347 Bacteria 7830
30 Ga0070668_100044763 3300005347 Bacteria 3395
31 Ga0070668_100933803 3300005347 Bacteria 777
32 Ga0070669_100207912 3300005353 Bacteria 1543
33 Ga0070669_100230897 3300005353 Bacteria 1467
34 Ga0070671_100027263 3300005355 Bacteria 4700
35 Ga0070659_100010946 3300005366 Bacteria 6695
36 Ga0070659_100721747 3300005366 Bacteria 863
37 Ga0070667_100145002 3300005367 Bacteria 2082
38 Ga0070667_100278456 3300005367 Bacteria 1502
39 Ga0070709_10005157 3300005434 Bacteria 7064
40 Ga0070714_100015761 3300005435 Bacteria 6089
41 Ga0070713_100058872 3300005436 Bacteria 3205
42 Ga0070710_10000365 3300005437 Bacteria 21212
43 Ga0070711_100026986 3300005439 Bacteria 3766
44 Ga0070700_100002024 3300005441 Bacteria 10300
45 Ga0070700_100626568 3300005441 Bacteria 846
46 Ga0070694_100209333 3300005444 Bacteria 1458
47 Ga0070694_100458294 3300005444 Bacteria 1008
48 Ga0070663_100197971 3300005455 Bacteria 1566
49 Ga0070681_10003277 3300005458 Bacteria 15111
50 Ga0068867_100247432 3300005459 Bacteria 1449
51 Ga0068867_100274054 3300005459 Bacteria 1381
52 Ga0068867_100588161 3300005459 Bacteria 969
53 Ga0070699_100180950 3300005518 Bacteria 1871
54 Ga0070679_100042350 3300005530 Bacteria 4534
55 Ga0070679_100046776 3300005530 Bacteria 4314
56 Ga0068853_100680305 3300005539 Bacteria 980
57 Ga0070672_100532313 3300005543 Bacteria 1019
58 Ga0070695_100028544 3300005545 Bacteria 3463
59 Ga0070695_100195299 3300005545 Bacteria 1443
60 Ga0070696_100318707 3300005546 Bacteria 1196
61 Ga0070693_100040292 3300005547 Bacteria 2622
62 Ga0070665_100206180 3300005548 Bacteria 1966
63 Ga0068855_100097304 3300005563 Bacteria 3390
64 Ga0070664_100056411 3300005564 Bacteria 3338
65 Ga0068857_100419995 3300005577 Bacteria 1247
66 Ga0068857_100436560 3300005577 Bacteria 1223
67 Ga0068854_100054453 3300005578 Bacteria 2877
68 Ga0068856_100232712 3300005614 Bacteria 1858
69 Ga0068852_100008125 3300005616 Bacteria 7703
70 Ga0068859_100759878 3300005617 Bacteria 1058
71 Ga0068864_100003579 3300005618 Bacteria 12843
72 Ga0068864_100121864 3300005618 Bacteria 2333
73 Ga0068861_100016921 3300005719 Bacteria 5169
74 Ga0068863_100014883 3300005841 Bacteria 7473
75 Ga0068863_100728340 3300005841 Bacteria 987
76 Ga0068858_100023729 3300005842 Bacteria 5714
77 Ga0068860_100393111 3300005843 Bacteria 1370
78 Ga0068862_100008858 3300005844 Bacteria 8328
79 Ga0068862_100084443 3300005844 Bacteria 2758
80 Ga0068862_100847467 3300005844 Bacteria 896
81 Ga0081455_10007030 3300005937 Bacteria 11953
82 Ga0081455_10009306 3300005937 Bacteria 10114
83 Ga0081540_1000017 3300005983 Bacteria 164991
84 Ga0081540_1000078 3300005983 Bacteria 105731
85 Ga0081540_1007853 3300005983 Bacteria 7543
86 Ga0081540_1012584 3300005983 Bacteria 5558
87 Ga0081540_1018670 3300005983 Bacteria 4245
88 Ga0081540_1066978 3300005983 Bacteria 1680
89 Ga0070717_10717149 3300006028 Bacteria 909
90 Ga0075365_10014773 3300006038 Bacteria 4704
91 Ga0075365_10069480 3300006038 Bacteria 2367
92 Ga0075365_10072477 3300006038 Bacteria 2320
93 Ga0075365_10123032 3300006038 Bacteria 1791
94 Ga0075365_10382220 3300006038 Bacteria 993
95 Ga0075368_10001778 3300006042 Bacteria 6934
96 Ga0075368_10012643 3300006042 Bacteria 3091
97 Ga0075368_10064874 3300006042 Bacteria 1467
98 Ga0075364_10049670 3300006051 Bacteria 2737
99 Ga0070715_10070744 3300006163 Bacteria 1558
100 Ga0070715_10191885 3300006163 Bacteria 1032
101 Ga0070716_100001478 3300006173 Bacteria 10491
102 Ga0070712_100085722 3300006175 Bacteria 2294
103 Ga0070712_100350781 3300006175 Bacteria 1208
104 Ga0070712_100539579 3300006175 Bacteria 982
105 Ga0075367_10017567 3300006178 Bacteria 3929
106 Ga0075367_10122301 3300006178 Bacteria 1604
107 Ga0075369_10090979 3300006186 Bacteria 1361
108 Ga0075366_10060210 3300006195 Bacteria 2255
109 Ga0075370_10178410 3300006353 Bacteria 1250
110 Ga0075428_100025674 3300006844 Bacteria 6524
111 Ga0075428_100229569 3300006844 Bacteria 2003
112 Ga0075431_100791770 3300006847 Bacteria 922
113 Ga0075433_10159111 3300006852 Bacteria 2010
114 Ga0075429_100064871 3300006880 Bacteria 3180
115 Ga0068865_100237362 3300006881 Bacteria 1433
116 Ga0068865_100900097 3300006881 Bacteria 769
117 Ga0075436_100145761 3300006914 Bacteria 1665
118 Ga0075436_100153831 3300006914 Bacteria 1619
119 Ga0097620_100759962 3300006931 Bacteria 1058
120 Ga0099824_1006549 3300006942 Bacteria 15916
121 Ga0099794_10005774 3300007265 Bacteria 4986
122 Ga0105250_10103767 3300009092 Bacteria 1161
123 Ga0105240_10003221 3300009093 Bacteria 25561
124 Ga0111539_10048435 3300009094 Bacteria 5074
125 Ga0111539_10720354 3300009094 Bacteria 1161
126 Ga0105245_10144738 3300009098 Bacteria 2242
127 Ga0105245_10160545 3300009098 Bacteria 2132
128 Ga0105245_10282591 3300009098 Bacteria 1622
129 Ga0105245_11224024 3300009098 Bacteria 799
130 Ga0105247_10073108 3300009101 Bacteria 2148
131 Ga0105247_10143578 3300009101 Bacteria 1566
132 Ga0105247_10379589 3300009101 Bacteria 1002
133 Ga0114129_10059664 3300009147 Bacteria 5334
134 Ga0114129_10623557 3300009147 Bacteria 1395
135 Ga0105243_10125489 3300009148 Bacteria 2170
136 Ga0105243_10793392 3300009148 Bacteria 933
137 Ga0105241_10010811 3300009174 Bacteria 6696
138 Ga0105241_10118598 3300009174 Bacteria 2128
139 Ga0105241_11050095 3300009174 Bacteria 765
140 Ga0105242_10325097 3300009176 Bacteria 1412
141 Ga0105242_10422237 3300009176 Bacteria 1250
142 Ga0105248_10132608 3300009177 Bacteria 2811
143 Ga0105237_10005500 3300009545 Bacteria 14281
144 Ga0105237_10075297 3300009545 Bacteria 3367
145 Ga0105237_10119799 3300009545 Bacteria 2625
146 Ga0105237_10119842 3300009545 Bacteria 2625
147 Ga0105237_10300958 3300009545 Bacteria 1607
148 Ga0105237_10557305 3300009545 Bacteria 1153
149 Ga0105238_10073624 3300009551 Bacteria 3410
150 Ga0105238_10181097 3300009551 Bacteria 2084
151 Ga0105238_10694498 3300009551 Bacteria 1029
152 Ga0105238_10845669 3300009551 Bacteria 932
153 Ga0105249_10067369 3300009553 Bacteria 3298
154 Ga0105249_10515424 3300009553 Bacteria 1242
155 Ga0105249_10534418 3300009553 Bacteria 1221
156 Ga0105239_10019071 3300010375 Bacteria 7580
157 Ga0105239_10087057 3300010375 Bacteria 3443
158 Ga0105239_10089922 3300010375 Bacteria 3387
159 Ga0105239_11318236 3300010375 Bacteria 833
160 Ga0105246_10007792 3300011119 Bacteria 6572
161 Ga0105246_10016096 3300011119 Bacteria 4733
162 Ga0157313_1008720 3300012503 Bacteria 823
163 Ga0157369_10798827 3300013105 Bacteria 969
164 Ga0157374_10074019 3300013296 Bacteria 3215
165 Ga0157374_10131828 3300013296 Bacteria 2419
166 Ga0157378_10452876 3300013297 Bacteria 1274
167 Ga0157378_10576021 3300013297 Bacteria 1134
168 Ga0163162_10612834 3300013306 Bacteria 1214
169 Ga0163162_10644725 3300013306 Bacteria 1183
170 Ga0163162_10810640 3300013306 Bacteria 1053
171 Ga0157375_10092375 3300013308 Bacteria 3090
172 Ga0157375_10266839 3300013308 Bacteria 1873
173 Ga0157375_10507607 3300013308 Bacteria 1370
174 Ga0157375_11121658 3300013308 Bacteria 921
175 Ga0163163_10137837 3300014325 Bacteria 2481
176 Ga0163163_10229157 3300014325 Bacteria 1907
177 Ga0157379_10084744 3300014968 Bacteria 2840
178 Ga0157376_10040795 3300014969 Bacteria 3796
179 Ga0157376_11046952 3300014969 Bacteria 840
180 Ga0213876_10327341 3300021384 Bacteria 815
181 Ga0213875_10032002 3300021388 Bacteria 2486
182 Ga0207425_1011313 3300025245 Bacteria 2135
183 Ga0209677_102259 3300025253 Bacteria 7447
184 Ga0209148_1000215 3300025254 Bacteria 99154
185 Ga0209148_1016708 3300025254 Bacteria 1259
186 Ga0209233_1003181 3300025261 Bacteria 5822
187 Ga0209455_1008636 3300025272 Bacteria 2751
188 Ga0209455_1013643 3300025272 Bacteria 1876
189 Ga0209564_1011412 3300025295 Bacteria 3983
190 Ga0209758_1000011 3300025297 Bacteria 1049685
191 Ga0209758_1001216 3300025297 Bacteria 32369
192 Ga0209758_1034165 3300025297 Bacteria 2029
193 Ga0209758_1037744 3300025297 Bacteria 1862
194 Ga0209256_1042801 3300025299 Bacteria 1141
195 Ga0207426_1000328 3300025302 Bacteria 90659
196 Ga0207426_1000401 3300025302 Bacteria 73412
197 Ga0207426_1003045 3300025302 Bacteria 9674
198 Ga0209051_1042126 3300025303 Bacteria 1616
199 Ga0209257_1001041 3300025304 Bacteria 36987
200 Ga0209257_1014048 3300025304 Bacteria 3485
201 Ga0207697_10038176 3300025315 Bacteria 1968
202 Ga0207696_1037975 3300025711 Bacteria 1423
203 Ga0207653_10025668 3300025885 Bacteria 1885
204 Ga0207692_10142245 3300025898 Bacteria 1365
205 Ga0207692_10281125 3300025898 Bacteria 1007
206 Ga0207692_10608970 3300025898 Bacteria 703
207 Ga0207710_10039883 3300025900 Bacteria 2079
208 Ga0207710_10070797 3300025900 Bacteria 1599
209 Ga0207710_10146203 3300025900 Bacteria 1144
210 Ga0207688_10332323 3300025901 Bacteria 934
211 Ga0207647_10065490 3300025904 Bacteria 2205
212 Ga0207685_10036515 3300025905 Bacteria 1802
213 Ga0207685_10219287 3300025905 Bacteria 904
214 Ga0207645_10032757 3300025907 Bacteria 3341
215 Ga0207705_10013570 3300025909 Bacteria 5881
216 Ga0207705_10467031 3300025909 Bacteria 979
217 Ga0207654_10015065 3300025911 Bacteria 4005
218 Ga0207654_10059922 3300025911 Bacteria 2222
219 Ga0207695_10000163 3300025913 Bacteria 197030
220 Ga0207695_10057168 3300025913 Bacteria 4054
221 Ga0207671_10014329 3300025914 Bacteria 6272
222 Ga0207693_10047440 3300025915 Bacteria 3375
223 Ga0207693_10057106 3300025915 Bacteria 3060
224 Ga0207663_10013373 3300025916 Bacteria 4459
225 Ga0207660_10163391 3300025917 Bacteria 1719
226 Ga0207660_10237016 3300025917 Bacteria 1436
227 Ga0207657_10032848 3300025919 Bacteria 4683
228 Ga0207657_10233010 3300025919 Bacteria 1472
229 Ga0207657_10401783 3300025919 Bacteria 1078
230 Ga0207649_10224843 3300025920 Bacteria 1339
231 Ga0207652_10040169 3300025921 Bacteria 3972
232 Ga0207681_10080928 3300025923 Bacteria 2292
233 Ga0207681_10103243 3300025923 Bacteria 2060
234 Ga0207681_10325051 3300025923 Bacteria 1224
235 Ga0207687_10732124 3300025927 Bacteria 841
236 Ga0207700_10171233 3300025928 Bacteria 1812
237 Ga0207700_10345699 3300025928 Bacteria 1294
238 Ga0207664_10064017 3300025929 Bacteria 2940
239 Ga0207644_10403010 3300025931 Bacteria 1118
240 Ga0207690_10132735 3300025932 Bacteria 1825
241 Ga0207706_10153487 3300025933 Bacteria 2026
242 Ga0207706_10574199 3300025933 Bacteria 970
243 Ga0207709_10704510 3300025935 Bacteria 808
244 Ga0207665_10045091 3300025939 Bacteria 2952
245 Ga0207711_10100127 3300025941 Bacteria 2563
246 Ga0207689_10027067 3300025942 Bacteria 4800
247 Ga0207689_10166533 3300025942 Bacteria 1816
248 Ga0207679_10585352 3300025945 Bacteria 1004
249 Ga0207667_10051440 3300025949 Bacteria 4343
250 Ga0207651_10416573 3300025960 Bacteria 1146
251 Ga0207712_10005237 3300025961 Bacteria 8203
252 Ga0207712_10107032 3300025961 Bacteria 2090
253 Ga0207668_10010796 3300025972 Bacteria 5531
254 Ga0207668_10109186 3300025972 Bacteria 2072
255 Ga0207668_10592215 3300025972 Bacteria 965
256 Ga0207668_10757214 3300025972 Bacteria 857
257 Ga0207668_10833140 3300025972 Bacteria 818
258 Ga0207640_10757380 3300025981 Bacteria 838
259 Ga0207658_10199073 3300025986 Bacteria 1671
260 Ga0207677_10977717 3300026023 Bacteria 766
261 Ga0207703_10383554 3300026035 Bacteria 1300
262 Ga0207703_10581924 3300026035 Bacteria 1058
263 Ga0207639_10040096 3300026041 Bacteria 3494
264 Ga0207678_10002535 3300026067 Bacteria 16646
265 Ga0207678_10051021 3300026067 Bacteria 3572
266 Ga0207678_10178394 3300026067 Bacteria 1814
267 Ga0207708_10053244 3300026075 Bacteria 3083
268 Ga0207702_10667428 3300026078 Bacteria 1023
269 Ga0207641_10232071 3300026088 Bacteria 1715
270 Ga0207641_10296263 3300026088 Bacteria 1526
271 Ga0207648_10098990 3300026089 Bacteria 2553
272 Ga0207676_10015881 3300026095 Bacteria 5445
273 Ga0207676_10188754 3300026095 Bacteria 1812
274 Ga0207674_10152501 3300026116 Bacteria 2267
275 Ga0207674_10296417 3300026116 Bacteria 1566
276 Ga0207674_10438554 3300026116 Bacteria 1262
277 Ga0207675_100022244 3300026118 Bacteria 5904
278 Ga0207675_100026604 3300026118 Bacteria 5386
279 Ga0207675_100090389 3300026118 Bacteria 2879
280 Ga0207675_101268520 3300026118 Bacteria 757
281 Ga0209389_1000043 3300027296 Bacteria 123224
282 Ga0209589_1000047 3300027357 Bacteria 118659
283 Ga0209489_100075 3300027361 Bacteria 136991
284 Ga0209813_10010109 3300027866 Bacteria 2432
285 Ga0209813_10037372 3300027866 Bacteria 1463
286 Ga0265356_1002401 3300028017 Bacteria 2521
287 Ga0268266_10074320 3300028379 Bacteria 2951
288 Ga0268266_10144418 3300028379 Bacteria 2138
289 Ga0268266_10179697 3300028379 Bacteria 1926
290 Ga0268266_10483692 3300028379 Bacteria 1180
291 Ga0268265_10004213 3300028380 Bacteria 10051
292 Ga0268265_10011792 3300028380 Bacteria 5909
293 Ga0268265_10753703 3300028380 Bacteria 945
294 Ga0268264_10152244 3300028381 Bacteria 2075
295 Ga0307517_10015766 3300028786 Bacteria 10008
296 Ga0265338_10518201 3300028800 Bacteria 838
297 Ga0265762_1010283 3300030760 Bacteria 1671
298 Ga0265340_10141046 3300031247 Bacteria 1102
299 Ga0307510_10013929 3300033180 Bacteria 9524
300 Ga0307510_10108851 3300033180 Bacteria 2523
301 Ga0307510_10110063 3300033180 Bacteria 2501
302 Ga0373958_0030821 3300034819 Bacteria 1051
303 Ga0373938_0047875 3300034957 Bacteria 968
304 Ga0373940_0123635 3300035088 Bacteria 805
305 Ga0373939_0002714 3300035114 Bacteria 4152
306 Ga0373939_0035806 3300035114 Bacteria 1465
307 Ga0373941_0009356 3300035115 Bacteria 2466
308 Ga0373960_0003056 3300035121 Bacteria 3778
309 Ga0373942_0120166 3300035207 Bacteria 820
310 Ga0373931_0001206 3300035691 Bacteria 11056
311 Ga0373931_0076583 3300035691 Bacteria 1838
312 Ga0373935_0221262 3300035692 Bacteria 1315
313 Ga0373935_0777394 3300035692 Bacteria 706
314 Ga0373927_0094432 3300035695 Bacteria 1943
315 Ga0373927_0205860 3300035695 Bacteria 1292
316 Ga0373933_0020776 3300035724 Bacteria 3723
317 Ga0373937_0133666 3300036401 Bacteria 2318
318 Ga0373925_0060216 3300037068 Bacteria 2851
319 Ga0373925_0372268 3300037068 Bacteria 1162
320 Ga0395899_0089761 3300037312 Bacteria 2229
321 Ga0395900_0529256 3300037418 Bacteria 1126
322 Ga0395898_0335243 3300037466 Bacteria 1442
323 Ga0395898_0542514 3300037466 Bacteria 1105
324 Ga0395905_0012507 3300037471 Bacteria 8168
325 Ga0395905_0018328 3300037471 Bacteria 6645
326 Ga0395905_0054352 3300037471 Bacteria 3748
327 Ga0395905_0155569 3300037471 Bacteria 2150
328 Ga0436364_0731834 3300037853 Bacteria 14258
329 Ga0436364_1166421 3300037853 Bacteria 4329
330 Ga0395901_0198551 3300038443 Bacteria 2103
331 Ga0436365_0458129 3300039437 Bacteria 2330
332 Ga0436365_1115190 3300039437 Bacteria 4366
333 Ga0436365_1828458 3300039437 Bacteria 1604
334 Ga0436360_0111883 3300039438 Bacteria 1546
335 Ga0436360_0595666 3300039438 Bacteria 7463
336 Ga0436360_0934711 3300039438 Bacteria 4193
337 Ga0436361_0122632 3300039447 Bacteria 5177
338 Ga0436361_0371970 3300039447 Bacteria 3745
339 Ga0436361_0420563 3300039447 Bacteria 1883
340 Ga0436361_0887352 3300039447 Bacteria 988
341 Ga0436361_1076341 3300039447 Bacteria 1930
342 Ga0436363_1321995 3300039450 Bacteria 2864
343 Ga0451793_0114728 3300041452 Bacteria 888
344 Ga0451802_0309198 3300041460 Bacteria 2262
345 Ga0451847_0585162 3300041503 Bacteria 994
346 Ga0466969_0017547 3300044656 Bacteria 3735
347 Ga0466972_0000079 3300044658 Bacteria 90348
348 Ga0466972_0009117 3300044658 Bacteria 4982
349 Ga0466965_0404835 3300044683 Bacteria 754
350 Ga0466966_0000191 3300044684 Bacteria 40906
351 Ga0466966_0038670 3300044684 Bacteria 3074
352 Ga0466961_0000005 3300044693 Bacteria 173105
353 Ga0466961_0264600 3300044693 Bacteria 1054
354 Ga0466963_0027201 3300044694 Bacteria 3661
355 Ga0466964_0013726 3300044706 Bacteria 3074
356 Ga0466968_0002291 3300044735 Bacteria 6991
357 Ga0466968_0013541 3300044735 Bacteria 3208
358 Ga0466968_0399680 3300044735 Bacteria 673
359 Ga0466960_0005971 3300044901 Bacteria 4860
360 Ga0466959_0000686 3300045049 Bacteria 19811
361 Ga0466959_0002371 3300045049 Bacteria 12012
362 Ga0466959_0008511 3300045049 Bacteria 7260
363 Ga0495592_0005617 3300046454 Bacteria 9270
364 Ga0495603_0109239 3300046455 Bacteria 1614
365 Ga0495590_0004144 3300046457 Bacteria 5874
366 Ga0495629_0068066 3300046459 Bacteria 2484
367 Ga0495638_0012188 3300046460 Bacteria 5904
368 Ga0495651_0075133 3300046462 Bacteria 2563
369 Ga0495653_0260767 3300046463 Bacteria 1146
370 Ga0495580_0335880 3300046472 Bacteria 1025
371 Ga0495605_0195907 3300046474 Bacteria 882
372 Ga0495664_0013587 3300046477 Bacteria 4617
373 Ga0495585_0086257 3300046492 Bacteria 1696
374 Ga0495594_0290599 3300046499 Bacteria 931
375 Ga0495583_0093324 3300046506 Bacteria 1293
376 Ga0495583_0133749 3300046506 Bacteria 1036
377 Ga0495606_0006512 3300046507 Bacteria 10745
378 Ga0495606_0037284 3300046507 Bacteria 3303
379 Ga0495608_0050003 3300046511 Bacteria 2774
380 Ga0495616_0117918 3300046513 Bacteria 1227
381 Ga0495616_0173136 3300046513 Bacteria 964
382 Ga0495618_0330247 3300046514 Bacteria 943
383 Ga0495630_0070906 3300046517 Bacteria 2622
384 Ga0495632_0042247 3300046519 Bacteria 2286
385 Ga0495637_0096336 3300046520 Bacteria 1161
386 Ga0495643_0113127 3300046522 Bacteria 1378
387 Ga0495648_0002859 3300046524 Bacteria 15545
388 Ga0495648_0004938 3300046524 Bacteria 11210
389 Ga0495648_0069214 3300046524 Bacteria 2055
390 Ga0495642_0122822 3300046528 Bacteria 1115
391 Ga0495652_0007795 3300046529 Bacteria 9835
392 Ga0495652_0090985 3300046529 Bacteria 2495
393 Ga0495640_0012370 3300046533 Bacteria 6523
394 Ga0495640_0018187 3300046533 Bacteria 5222
395 Ga0495640_0237112 3300046533 Bacteria 1146
396 Ga0495586_0023355 3300046535 Bacteria 3303
397 Ga0495587_0015262 3300046536 Bacteria 4799
398 Ga0495597_0085928 3300046542 Bacteria 1340
399 Ga0495622_0021822 3300046557 Bacteria 2982
400 Ga0495622_0147897 3300046557 Bacteria 1064
401 Ga0495667_0026653 3300046559 Bacteria 3895
402 Ga0495668_0202737 3300046616 Bacteria 1086
403 Ga0495611_0162669 3300046648 Bacteria 1043
404 Ga0495625_0005741 3300046660 Bacteria 11219
405 Ga0495625_0282974 3300046660 Bacteria 1066
406 Ga0495635_0016958 3300046663 Bacteria 5087
407 Ga0495635_0084299 3300046663 Bacteria 2175
408 Ga0495661_0246378 3300046665 Bacteria 914
409 Ga0495661_0289632 3300046665 Bacteria 823
410 Ga0495657_0002353 3300046675 Bacteria 15899
411 Ga0495657_0043382 3300046675 Bacteria 3067
412 Ga0495599_0040889 3300046678 Bacteria 2911
413 Ga0495623_0006848 3300046679 Bacteria 7415
414 Ga0495646_0026710 3300046680 Bacteria 3624
415 Ga0495646_0077445 3300046680 Bacteria 1945
416 Ga0495613_0033602 3300046689 Bacteria 3811
417 Ga0495624_0014326 3300046690 Bacteria 5384
418 Ga0495671_0251568 3300046692 Bacteria 853
419 Ga0495671_0319339 3300046692 Bacteria 746
420 Ga0495649_0055252 3300046694 Bacteria 2146
421 Ga0495600_0022782 3300046809 Bacteria 4025
422 Ga0495600_0047266 3300046809 Bacteria 2807
423 Ga0495660_0192882 3300046810 Bacteria 978
424 Ga0495581_0161739 3300047315 Bacteria 1309
425 Ga0495604_0000880 3300047317 Bacteria 24979
426 Ga0495604_0003285 3300047317 Bacteria 12908
427 Ga0495604_0336389 3300047317 Bacteria 1006
428 Ga0495674_0006001 3300047319 Bacteria 11663
429 Ga0495674_0360623 3300047319 Bacteria 1179
430 Ga0495674_0381103 3300047319 Bacteria 1141
431 Ga0495674_0527679 3300047319 Bacteria 942
432 Ga0495672_0060474 3300047320 Bacteria 2188
433 Ga0495676_0025204 3300047321 Bacteria 5138
434 Ga0495683_0193043 3300047323 Bacteria 923
435 Ga0495687_009990 3300047443 Bacteria 5246
436 Ga0495673_0056592 3300047469 Bacteria 1696
437 Ga0495684_0039841 3300047471 Bacteria 3602
438 Ga0495684_0120104 3300047471 Bacteria 1980
439 Ga0495686_0247308 3300047472 Bacteria 1003
440 Ga0495593_0127306 3300047673 Bacteria 1294
441 Ga0495602_0015087 3300048088 Bacteria 7814
442 Ga0495602_0159031 3300048088 Bacteria 1766
443 Ga0496100_0047811 3300048903 Bacteria 2759
444 Ga0496100_0351290 3300048903 Bacteria 1114
445 Ga0496101_0056192 3300048904 Bacteria 2845
446 Ga0496102_0233059 3300048905 Bacteria 1736
447 Ga0496103_0009908 3300048906 Bacteria 5635
448 Ga0496103_0073435 3300048906 Bacteria 2143
449 Ga0496103_0078961 3300048906 Bacteria 2067
450 Ga0496104_0016046 3300048907 Bacteria 6799
451 Ga0496104_0063133 3300048907 Bacteria 3512
452 Ga0496104_0141062 3300048907 Bacteria 2315
453 Ga0496105_0029226 3300048908 Bacteria 4511
454 Ga0496105_0066282 3300048908 Bacteria 2980
455 Ga0496105_0114413 3300048908 Bacteria 2225
456 Ga0496105_0218689 3300048908 Bacteria 1551
457 Ga0496105_0266788 3300048908 Bacteria 1383
458 Ga0496105_0445441 3300048908 Bacteria 1023
459 Ga0496106_0083480 3300048909 Bacteria 2457
460 Ga0496106_0182894 3300048909 Bacteria 1664
461 Ga0496106_0438869 3300048909 Bacteria 1049
462 Ga0496107_0021613 3300048910 Bacteria 4548
463 Ga0496107_0077875 3300048910 Bacteria 2415
464 Ga0496108_0036540 3300048911 Bacteria 4087
465 Ga0496108_0247411 3300048911 Bacteria 1551
466 Ga0496109_0086032 3300048912 Bacteria 2903
467 Ga0496110_0397006 3300048913 Bacteria 1257
468 Ga0496111_0226472 3300048914 Bacteria 1389
469 Ga0496112_0080942 3300048915 Bacteria 3211
470 Ga0496112_0484864 3300048915 Bacteria 1172
471 Ga0496113_0265711 3300048916 Bacteria 1371
472 Ga0496113_0376540 3300048916 Bacteria 1139
473 Ga0496114_0105195 3300048917 Bacteria 2414
474 Ga0496115_0012837 3300048918 Bacteria 6317
475 Ga0496115_0035582 3300048918 Bacteria 3940
476 Ga0496115_0473385 3300048918 Bacteria 1009
477 Ga0496115_0591971 3300048918 Bacteria 883
478 Ga0496116_0285380 3300048919 Bacteria 796
479 Ga0496117_0104996 3300048920 Bacteria 1777
480 Ga0496117_0109006 3300048920 Bacteria 1730
481 Ga0496118_0055077 3300048921 Bacteria 3005
482 Ga0496118_0105880 3300048921 Bacteria 1883
483 Ga0496118_0129484 3300048921 Bacteria 1624
484 Ga0496118_0191564 3300048921 Bacteria 1222
485 Ga0496119_0016898 3300048922 Bacteria 5521
486 Ga0496120_0014560 3300048923 Bacteria 5236
487 Ga0496120_0103535 3300048923 Bacteria 1499
488 Ga0496121_0000578 3300048924 Bacteria 68826
489 Ga0496121_0023197 3300048924 Bacteria 5987
490 Ga0496121_0054532 3300048924 Bacteria 3339
491 Ga0496121_0130855 3300048924 Bacteria 1878
492 Ga0496121_0133133 3300048924 Bacteria 1857
493 Ga0496121_0412282 3300048924 Bacteria 881
494 Ga0496122_0099059 3300048925 Bacteria 1956
495 Ga0496124_0052546 3300048927 Bacteria 3461
496 Ga0496124_0367582 3300048927 Bacteria 1011
497 Ga0496125_0058502 3300048928 Bacteria 3113
498 Ga0496125_0067015 3300048928 Bacteria 2832
499 Ga0496126_0000602 3300048929 Bacteria 67975
500 Ga0496126_0189002 3300048929 Bacteria 1745
501 Ga0496126_0221248 3300048929 Bacteria 1590
502 Ga0495682_0003878 3300049460 Bacteria 6544
503 Ga0495682_0064290 3300049460 Bacteria 1323
504 Ga0501040_0702627 3300049576 Bacteria 731
505 Ga0501072_0535080 3300049588 Bacteria 926
506 nmdc:mga03683_130253_c1 3300050489 Bacteria 1125
507 nmdc:mga03683_71562_c1 3300050489 Bacteria 1483
508 nmdc:mga00v17_358641_c1 3300050491 Bacteria 948
509 nmdc:mga0yw44_12388_c1 3300050492 Bacteria 4443
510 nmdc:mga0yw44_16942_c1 3300050492 Bacteria 3950
511 nmdc:mga0yw44_234702_c1 3300050492 Bacteria 1218
512 nmdc:mga0yw44_40131_c1 3300050492 Bacteria 2779
513 nmdc:mga06z11_252731_c1 3300050494 Bacteria 1038
514 nmdc:mga07m45_127364_c1 3300050496 Bacteria 1473
515 nmdc:mga05p37_50930_c1 3300050507 Bacteria 5092
516 nmdc:mga09592_100731_c1 3300050508 Bacteria 2474
517 nmdc:mga0qj67_91233_c1 3300050509 Bacteria 2448
518 nmdc:mga06r32_339688_c1 3300050510 Bacteria 1486
519 nmdc:mga06r32_485502_c1 3300050510 Bacteria 1213
520 nmdc:mga08y16_435805_c1 3300050511 Bacteria 1338
521 nmdc:mga08y16_665035_c1 3300050511 Bacteria 1044
522 nmdc:mga0n895_966492_c1 3300050512 Bacteria 834
523 nmdc:mga0sz30_104776_c1 3300050516 Bacteria 1237
524 nmdc:mga0sz30_77414_c1 3300050516 Bacteria 1437
525 Ga0495601_0334338 3300053077 Bacteria 986
526 Ga0495612_0117178 3300053078 Bacteria 1144
527 Ga0495595_0105664 3300053084 Bacteria 1362
528 Ga0495619_0496058 3300053085 Bacteria 840
529 Ga0500578_0081890 3300053086 Bacteria 2052
530 Ga0500643_013742 3300053087 Bacteria 2844
531 Ga0500646_0066429 3300053090 Bacteria 1073
532 Ga0500646_0066853 3300053090 Bacteria 1070
533 Ga0500583_0054842 3300053092 Bacteria 1862
534 Ga0500651_0057494 3300053093 Bacteria 2434
535 Ga0500566_0000750 3300053094 Bacteria 18266
536 Ga0500650_0253236 3300053098 Bacteria 789
537 Ga0500555_001349 3300053103 Bacteria 7685
538 Ga0500555_002647 3300053103 Bacteria 5154
539 Ga0500556_0073286 3300053104 Bacteria 1282
540 Ga0500556_0096857 3300053104 Bacteria 1132
541 Ga0500562_003675 3300053108 Bacteria 3853
542 Ga0500562_005493 3300053108 Bacteria 3181
543 Ga0500569_050120 3300053109 Bacteria 1257
544 Ga0500572_028763 3300053111 Bacteria 1532
545 Ga0500592_013180 3300053116 Bacteria 1324
546 Ga0500595_025573 3300053119 Bacteria 2044
547 Ga0500607_055531 3300053121 Bacteria 2093
548 Ga0500626_039862 3300053128 Bacteria 2125
549 Ga0500655_033916 3300053133 Bacteria 989
550 Ga0500658_0176213 3300053134 Bacteria 972
551 Ga0500559_0017034 3300053136 Bacteria 3069
552 Ga0500559_0021721 3300053136 Bacteria 2721
553 Ga0500561_0061702 3300053137 Bacteria 1052
554 Ga0500564_038903 3300053138 Bacteria 2192
555 Ga0500568_0006097 3300053139 Bacteria 6111
556 Ga0500568_0052991 3300053139 Bacteria 1591
557 Ga0500604_0020158 3300053151 Bacteria 1874
558 Ga0500616_0043940 3300053153 Bacteria 2386
559 Ga0500619_065754 3300053154 Bacteria 1199
560 Ga0500622_0004648 3300053156 Bacteria 8504
561 Ga0500638_099660 3300053162 Bacteria 1357
562 Ga0500636_0000041 3300053177 Bacteria 69687
563 Ga0500636_0125146 3300053177 Bacteria 1438
564 Ga0500636_0160528 3300053177 Bacteria 1226
565 Ga0500611_037853 3300053727 Bacteria 1041
566 Ga0500599_013677 3300053736 Bacteria 1099
567 Ga0500601_000017 3300053737 Bacteria 40649
568 Ga0500661_002403 3300055283 Bacteria 3536
569 Ga0530510_0621961 3300061734 Bacteria 822
570 2508692900 2508501042 Bacteria 8719808
571 2513621634 2513237092 Bacteria 8341956
572 2513636924 2513237094 Bacteria 8789602
573 2513651132 2513237095 Bacteria 8976980
574 2513700664 2513237102 Bacteria 7703324
575 2513878374 2513237139 Bacteria 8737671
576 2514011696 2513237161 Bacteria 8871253
577 2515626289 2515154112 Bacteria 8294334
578 2517107834 2517093001 Bacteria 9002274
579 2528852894 2528768022 Bacteria 10457665
580 2600204154 2599185354 Bacteria 4398675
581 2617351829 2617270735 Bacteria 9163226
582 2753767083 2751185897 Bacteria 5322941
583 2793061098 2791355196 Bacteria 7323613
584 2805920597 2802429603 Bacteria 8777136
585 2818236788 2816332527 Bacteria 8933356
586 2824605675 2824600985 Bacteria 8488197
587 2824611763 2824609381 Bacteria 8672835
588 2824622019 2824617872 Bacteria 8814715
589 2824629283 2824626560 Bacteria 8813858
590 2824639184 2824635225 Bacteria 8785348
591 2824650374 2824644064 Bacteria 8743947
592 2824654999 2824653114 Bacteria 8493680
593 2824662249 2824661429 Bacteria 9877870
594 2824664051 2824661429 Bacteria 9877870
595 2824675221 2824671348 Bacteria 8369588
596 2824681557 2824679649 Bacteria 8248951
597 2824690031 2824687955 Bacteria 8360029
598 2824701166 2824696289 Bacteria 8335049
599 2824711137 2824704595 Bacteria 9667483
600 2824720915 2824714736 Bacteria 8717648
601 2824729793 2824723954 Bacteria 8758240
602 2824760435 2824753945 Bacteria 9787441
603 2824766576 2824763712 Bacteria 9792355
604 2824776697 2824773399 Bacteria 8360218
605 2838127354 2838122688 Bacteria 8803140
606 2841946373 2841941048 Bacteria 8688029
607 2841957092 2841949485 Bacteria 8680857
608 2841965612 2841957949 Bacteria 8652217
609 2841972883 2841966195 Bacteria 8673214
610 2841978445 2841974524 Bacteria 8931498
611 2841987453 2841983080 Bacteria 8395090
612 2842336381 2842333319 Bacteria 8899485
613 2844320231 2844315083 Bacteria 8138177
614 2847947978 2847939898 Bacteria 8606328
615 2849078174 2849076700 Bacteria 7039503
616 2874598560 2874590934 Bacteria 8299676
617 2874616747 2874612657 Bacteria 8252029
618 2874628305 2874620515 Bacteria 8290088
619 2874630099 2874628541 Bacteria 8630250
620 2874632555 2874628541 Bacteria 8630250
621 2874652013 2874645413 Bacteria 8214782
622 2876768311 2876761206 Bacteria 10111113
623 2876778598 2876771140 Bacteria 8287509
624 2876823403 2876818435 Bacteria 8274608
625 2879082391 2879074833 Bacteria 8279565
626 2879107397 2879099564 Bacteria 10442239
627 2879107949 2879099564 Bacteria 10442239
628 2879131828 2879127579 Bacteria 8294491
629 2879150164 2879142872 Bacteria 8267021
630 2881370130 2881364244 Bacteria 7710352
631 2881669087 2881665667 Bacteria 8175609
632 2885414391 2885409591 Bacteria 9235467
633 2888385711 2888378607 Bacteria 9652610
634 2888392562 2888388044 Bacteria 7304136
635 2888425828 2888419890 Bacteria 7857137
636 2903731179 2903727486 Bacteria 8281579
637 2904674076 2904666416 Bacteria 8226587
638 2904711726 2904711408 Bacteria 9771557
639 2906610054 2906602504 Bacteria 8295279
640 2906631839 2906626472 Bacteria 8826946
641 2906648434 2906643746 Bacteria 8722424
642 2922375959
643 2922396842 2922393267 Bacteria 8285685
644 2929621269 2929615660 Bacteria 9193770
645 2929625900 2929624759 Bacteria 9339455
646 2932785216 2932784394 Bacteria 9704911
647 2932797108 2932794094 Bacteria 7915132
648 2932799668 2932794094 Bacteria 7915132
649 2932807456 2932801729 Bacteria 7987968
650 2932808744 2932801729 Bacteria 7987968
651 2932810249 2932809354 Bacteria 9135765
652 2932816190 2932809354 Bacteria 9135765
653 2932819592 2932818245 Bacteria 9955613
654 2932821821 2932818245 Bacteria 9955613
655 2932829052 2932828146 Bacteria 9745859
656 2932836219 2932828146 Bacteria 9745859
657 2933582862 2933577622 Bacteria 9116884
658 2935610054 2935608549 Bacteria 8203142
659 2935616964 2935616580 Bacteria 9032984
660 2935619528 2935616580 Bacteria 9032984
661 2935636326 2935630451 Bacteria 8169952
662 2935638508 2935638405 Bacteria 10015038
663 2935656339 2935648319 Bacteria 8801166
664 2935660105 2935656913 Bacteria 8965014
665 2935666640 2935665750 Bacteria 9571747
666 2935675277 2935675223 Bacteria 9928132
667 2935682171 2935675223 Bacteria 9928132
668 2935691175 2935684952 Bacteria 9590419
669 2935694401 2935694250 Bacteria 9291695
670 2935703514 2935703347 Bacteria 10242284
671 2935711715 2935703347 Bacteria 10242284
672 2935718556 2935713505 Bacteria 9608509
673 2935727464 2935722832 Bacteria 9608746
674 2935736167 2935732158 Bacteria 9706831
675 2935745547 2935741537 Bacteria 9707219
676 2935755928 2935750917 Bacteria 9590372
677 2935760808 2935760218 Bacteria 9817913
678 2935776462 2935769743 Bacteria 7878163
679 2935780857 2935777560 Bacteria 8077691
680 2935792313 2935785616 Bacteria 7962367
681 2935800512 2935793552 Bacteria 8012592
682 2935801651 2935801545 Bacteria 9301974
683 2935810139 2935801545 Bacteria 9301974
684 2935813738 2935810662 Bacteria 9401221
685 2935814939 2935810662 Bacteria 9401221
686 2935823214 2935819856 Bacteria 8261050
687 2935828002 2935827899 Bacteria 10038562
688 2935842207 2935837841 Bacteria 9454360
689 2935848796 2935847175 Bacteria 8228321
690 2935855588 2935855204 Bacteria 9035059
691 2935858156 2935855204 Bacteria 9035059
692 2935867167 2935864058 Bacteria 9784707
693 2935868061 2935864058 Bacteria 9784707
694 2935870063 2935864058 Bacteria 9784707
695 2935873916 2935873716 Bacteria 9632195
696 2935876013 2935873716 Bacteria 9632195
697 2935885673 2935883170 Bacteria 7964738
698 2935909404 2935908558 Bacteria 8568796
699 2935917126 2935916978 Bacteria 9113783
700 2935926885 2935926038 Bacteria 8601059
701 2935937271 2935934488 Bacteria 8602579
702 2935944426 2935942939 Bacteria 8599779
703 2935952863 2935951376 Bacteria 8602333
704 2935962927 2935959822 Bacteria 7869783
705 2935969703 2935967501 Bacteria 8603075
706 2935976313 2935975950 Bacteria 8347125
707 2935991844 2935984226 Bacteria 8302647
708 2935993160 2935992306 Bacteria 9802711
709 2936003097 2936002035 Bacteria 9362176
710 2936003954 2936002035 Bacteria 9362176
711 2936014521 2936011229 Bacteria 8801034
712 2936027812 2936019824 Bacteria 8804134
713 2936031282 2936028420 Bacteria 8965941
714 2936040418 2936037263 Bacteria 9446081
715 2936042910 2936037263 Bacteria 9446081
716 2936049627 2936046547 Bacteria 8903709
717 2936061157 2936055302 Bacteria 8785755
718 2940562097 2940556831 Bacteria 9590747
719 2941512957 2941507105 Bacteria 8166816
720 2941520741 2941515067 Bacteria 8166720
721 2941528756 2941523033 Bacteria 8169134
722 2941531420 2941531003 Bacteria 7653939
723 2941542256 2941538514 Bacteria 9402094
724 3000019049 3000017691 Bacteria 3772574
725 3005488462 3005483717 Bacteria 7877331
726 3005712811 3005710791 Bacteria 7622528
727 3005723367 3005718088 Bacteria 8283608
728 8006930086 8006926726 Bacteria 6749210
729 8016520408 8016511872 Bacteria 9921665
730 8016521610 8016511872 Bacteria 9921665
731 8016528482 8016522445 Bacteria 8156687
732 8016533638 8016530956 Bacteria 8155261
733 8016546862 8016539877 Bacteria 8155419
734 8016555255 8016548790 Bacteria 8155074
735 8016563617 8016557553 Bacteria 8154380
736 8016576177 8016575299 Bacteria 8154085
737 8016601352 8016595262 Bacteria 8149947
738 8016609076 8016603502 Bacteria 8731218
739 8016615829 8016613128 Bacteria 8794220
740 8016625407 8016622563 Bacteria 7999408
741 8016631164 8016630954 Bacteria 9217207
742 8016638929 8016630954 Bacteria 9217207
743 8017064030 8017057580 Bacteria 10023680
744 8017065166 8017057580 Bacteria 10023680
745 8019533422 8019530166 Bacteria 8155624
746 8019546254 8019538911 Bacteria 7872763
747 8019552452 8019547302 Bacteria 7996444
748 8019565953 8019565922 Bacteria 9639779
749 8019583351 8019576017 Bacteria 10049540
750 8019584558 8019576017 Bacteria 10049540
751 8019591163 8019586578 Bacteria 10212056
752 8019592331 8019586578 Bacteria 10212056
753 8019600175 8019597564 Bacteria 10041141
754 8019618366 8019608314 Bacteria 10042931
755 8019620043 8019619141 Bacteria 9218857
756 8019633063 8019629233 Bacteria 8687553
757 8019646845 8019638758 Bacteria 9062356
758 8019649613 8019648815 Bacteria 10014479
759 8019660943 8019659431 Bacteria 8577854
760 8019670502 8019668869 Bacteria 8791617
761 8019685731 8019678201 Bacteria 8863603
762 8019691303 8019687851 Bacteria 8712826
763 8055744870 8055742211 Bacteria 9226248
764 8056974836 8056967851 Bacteria 9038162
765 Ga0496113_0318827
766 Ga0006778J45830_1034026
767 JGI25153J46596_10000382
768 JGI25153J46596_10000866
769 JGI25153J46596_10020786
770 JGI25160J50197_1008546
771 JGI25160J50197_1034463
772 JGI25404J52841_10005170
773 JGI25404J52841_10026591
774 Ga0055542_1011299
775 Ga0055531_10009703
776 Ga0065165_1007525
777 Ga0065165_1013398
778 Ga0065165_1021063
779 Ga0065165_1080168
780 Ga0070658_10001212
781 Ga0070670_100207773
782 Ga0068869_100029200
783 Ga0070680_100005766
784 Ga0070680_100040498
785 Ga0068868_100297556
786 Ga0070660_100022424
787 Ga0070660_100392313
788 Ga0070689_100260260
789 Ga0070691_10001227
790 Ga0070691_10080946
791 Ga0070661_100327148
792 Ga0070692_10232327
793 Ga0070668_100008050
794 Ga0070668_100044763
795 Ga0070668_100933803
796 Ga0070669_100207912
797 Ga0070669_100230897
798 Ga0070671_100027263
799 Ga0070659_100010946
800 Ga0070659_100721747
801 Ga0070667_100145002
802 Ga0070667_100278456
803 Ga0070709_10005157
804 Ga0070714_100015761
805 Ga0070713_100058872
806 Ga0070710_10000365
807 Ga0070711_100026986
808 Ga0070700_100002024
809 Ga0070700_100626568
810 Ga0070694_100209333
811 Ga0070694_100458294
812 Ga0070663_100197971
813 Ga0070681_10003277
814 Ga0068867_100247432
815 Ga0068867_100274054
816 Ga0068867_100588161
817 Ga0070699_100180950
818 Ga0070679_100042350
819 Ga0070679_100046776
820 Ga0068853_100680305
821 Ga0070672_100532313
822 Ga0070695_100028544
823 Ga0070695_100195299
824 Ga0070696_100318707
825 Ga0070693_100040292
826 Ga0070665_100206180
827 Ga0068855_100097304
828 Ga0070664_100056411
829 Ga0068857_100419995
830 Ga0068857_100436560
831 Ga0068854_100054453
832 Ga0068856_100232712
833 Ga0068852_100008125
834 Ga0068859_100759878
835 Ga0068864_100003579
836 Ga0068864_100121864
837 Ga0068861_100016921
838 Ga0068863_100014883
839 Ga0068863_100728340
840 Ga0068858_100023729
841 Ga0068860_100393111
842 Ga0068862_100008858
843 Ga0068862_100084443
844 Ga0068862_100847467
845 Ga0081455_10007030
846 Ga0081455_10009306
847 Ga0081540_1000017
848 Ga0081540_1000078
849 Ga0081540_1007853
850 Ga0081540_1012584
851 Ga0081540_1018670
852 Ga0081540_1066978
853 Ga0070717_10717149
854 Ga0075365_10014773
855 Ga0075365_10069480
856 Ga0075365_10072477
857 Ga0075365_10123032
858 Ga0075365_10382220
859 Ga0075368_10001778
860 Ga0075368_10012643
861 Ga0075368_10064874
862 Ga0075364_10049670
863 Ga0070715_10070744
864 Ga0070715_10191885
865 Ga0070716_100001478
866 Ga0070712_100085722
867 Ga0070712_100350781
868 Ga0070712_100539579
869 Ga0075367_10017567
870 Ga0075367_10122301
871 Ga0075369_10090979
872 Ga0075366_10060210
873 Ga0075370_10178410
874 Ga0075428_100025674
875 Ga0075428_100229569
876 Ga0075431_100791770
877 Ga0075433_10159111
878 Ga0075429_100064871
879 Ga0068865_100237362
880 Ga0068865_100900097
881 Ga0075436_100145761
882 Ga0075436_100153831
883 Ga0097620_100759962
884 Ga0099824_1006549
885 Ga0099794_10005774
886 Ga0105250_10103767
887 Ga0105240_10003221
888 Ga0111539_10048435
889 Ga0111539_10720354
890 Ga0105245_10144738
891 Ga0105245_10160545
892 Ga0105245_10282591
893 Ga0105245_11224024
894 Ga0105247_10073108
895 Ga0105247_10143578
896 Ga0105247_10379589
897 Ga0114129_10059664
898 Ga0114129_10623557
899 Ga0105243_10125489
900 Ga0105243_10793392
901 Ga0105241_10010811
902 Ga0105241_10118598
903 Ga0105241_11050095
904 Ga0105242_10325097
905 Ga0105242_10422237
906 Ga0105248_10132608
907 Ga0105237_10005500
908 Ga0105237_10075297
909 Ga0105237_10119799
910 Ga0105237_10119842
911 Ga0105237_10300958
912 Ga0105237_10557305
913 Ga0105238_10073624
914 Ga0105238_10181097
915 Ga0105238_10694498
916 Ga0105238_10845669
917 Ga0105249_10067369
918 Ga0105249_10515424
919 Ga0105249_10534418
920 Ga0105239_10019071
921 Ga0105239_10087057
922 Ga0105239_10089922
923 Ga0105239_11318236
924 Ga0105246_10007792
925 Ga0105246_10016096
926 Ga0157313_1008720
927 Ga0157369_10798827
928 Ga0157374_10074019
929 Ga0157374_10131828
930 Ga0157378_10452876
931 Ga0157378_10576021
932 Ga0163162_10612834
933 Ga0163162_10644725
934 Ga0163162_10810640
935 Ga0157375_10092375
936 Ga0157375_10266839
937 Ga0157375_10507607
938 Ga0157375_11121658
939 Ga0163163_10137837
940 Ga0163163_10229157
941 Ga0157379_10084744
942 Ga0157376_10040795
943 Ga0157376_11046952
944 Ga0213876_10327341
945 Ga0213875_10032002
946 Ga0207425_1011313
947 Ga0209677_102259
948 Ga0209148_1000215
949 Ga0209148_1016708
950 Ga0209233_1003181
951 Ga0209455_1008636
952 Ga0209455_1013643
953 Ga0209564_1011412
954 Ga0209758_1000011
955 Ga0209758_1001216
956 Ga0209758_1034165
957 Ga0209758_1037744
958 Ga0209256_1042801
959 Ga0207426_1000328
960 Ga0207426_1000401
961 Ga0207426_1003045
962 Ga0209051_1042126
963 Ga0209257_1001041
964 Ga0209257_1014048
965 Ga0207697_10038176
966 Ga0207696_1037975
967 Ga0207653_10025668
968 Ga0207692_10142245
969 Ga0207692_10281125
970 Ga0207692_10608970
971 Ga0207710_10039883
972 Ga0207710_10070797
973 Ga0207710_10146203
974 Ga0207688_10332323
975 Ga0207647_10065490
976 Ga0207685_10036515
977 Ga0207685_10219287
978 Ga0207645_10032757
979 Ga0207705_10013570
980 Ga0207705_10467031
981 Ga0207654_10015065
982 Ga0207654_10059922
983 Ga0207695_10000163
984 Ga0207695_10057168
985 Ga0207671_10014329
986 Ga0207693_10047440
987 Ga0207693_10057106
988 Ga0207663_10013373
989 Ga0207660_10163391
990 Ga0207660_10237016
991 Ga0207657_10032848
992 Ga0207657_10233010
993 Ga0207657_10401783
994 Ga0207649_10224843
995 Ga0207652_10040169
996 Ga0207681_10080928
997 Ga0207681_10103243
998 Ga0207681_10325051
999 Ga0207687_10732124
1000 Ga0207700_10171233
1001 Ga0207700_10345699
1002 Ga0207664_10064017
1003 Ga0207644_10403010
1004 Ga0207690_10132735
1005 Ga0207706_10153487
1006 Ga0207706_10574199
1007 Ga0207709_10704510
1008 Ga0207665_10045091
1009 Ga0207711_10100127
1010 Ga0207689_10027067
1011 Ga0207689_10166533
1012 Ga0207679_10585352
1013 Ga0207667_10051440
1014 Ga0207651_10416573
1015 Ga0207712_10005237
1016 Ga0207712_10107032
1017 Ga0207668_10010796
1018 Ga0207668_10109186
1019 Ga0207668_10592215
1020 Ga0207668_10757214
1021 Ga0207668_10833140
1022 Ga0207640_10757380
1023 Ga0207658_10199073
1024 Ga0207677_10977717
1025 Ga0207703_10383554
1026 Ga0207703_10581924
1027 Ga0207639_10040096
1028 Ga0207678_10002535
1029 Ga0207678_10051021
1030 Ga0207678_10178394
1031 Ga0207708_10053244
1032 Ga0207702_10667428
1033 Ga0207641_10232071
1034 Ga0207641_10296263
1035 Ga0207648_10098990
1036 Ga0207676_10015881
1037 Ga0207676_10188754
1038 Ga0207674_10152501
1039 Ga0207674_10296417
1040 Ga0207674_10438554
1041 Ga0207675_100022244
1042 Ga0207675_100026604
1043 Ga0207675_100090389
1044 Ga0207675_101268520
1045 Ga0209389_1000043
1046 Ga0209589_1000047
1047 Ga0209489_100075
1048 Ga0209813_10010109
1049 Ga0209813_10037372
1050 Ga0265356_1002401
1051 Ga0268266_10074320
1052 Ga0268266_10144418
1053 Ga0268266_10179697
1054 Ga0268266_10483692
1055 Ga0268265_10004213
1056 Ga0268265_10011792
1057 Ga0268265_10753703
1058 Ga0268264_10152244
1059 Ga0307517_10015766
1060 Ga0265338_10518201
1061 Ga0265762_1010283
1062 Ga0265340_10141046
1063 Ga0307510_10013929
1064 Ga0307510_10108851
1065 Ga0307510_10110063
1066 Ga0373958_0030821
1067 Ga0373938_0047875
1068 Ga0373940_0123635
1069 Ga0373939_0002714
1070 Ga0373939_0035806
1071 Ga0373941_0009356
1072 Ga0373960_0003056
1073 Ga0373942_0120166
1074 Ga0373931_0001206
1075 Ga0373931_0076583
1076 Ga0373935_0221262
1077 Ga0373935_0777394
1078 Ga0373927_0094432
1079 Ga0373927_0205860
1080 Ga0373933_0020776
1081 Ga0373937_0133666
1082 Ga0373925_0060216
1083 Ga0373925_0372268
1084 Ga0395899_0089761
1085 Ga0395900_0529256
1086 Ga0395898_0335243
1087 Ga0395898_0542514
1088 Ga0395905_0012507
1089 Ga0395905_0018328
1090 Ga0395905_0054352
1091 Ga0395905_0155569
1092 Ga0436364_0731834
1093 Ga0436364_1166421
1094 Ga0395901_0198551
1095 Ga0436365_0458129
1096 Ga0436365_1115190
1097 Ga0436365_1828458
1098 Ga0436360_0111883
1099 Ga0436360_0595666
1100 Ga0436360_0934711
1101 Ga0436361_0122632
1102 Ga0436361_0371970
1103 Ga0436361_0420563
1104 Ga0436361_0887352
1105 Ga0436361_1076341
1106 Ga0436363_1321995
1107 Ga0451793_0114728
1108 Ga0451802_0309198
1109 Ga0451847_0585162
1110 Ga0466969_0017547
1111 Ga0466972_0000079
1112 Ga0466972_0009117
1113 Ga0466965_0404835
1114 Ga0466966_0000191
1115 Ga0466966_0038670
1116 Ga0466961_0000005
1117 Ga0466961_0264600
1118 Ga0466963_0027201
1119 Ga0466964_0013726
1120 Ga0466968_0002291
1121 Ga0466968_0013541
1122 Ga0466968_0399680
1123 Ga0466960_0005971
1124 Ga0466959_0000686
1125 Ga0466959_0002371
1126 Ga0466959_0008511
1127 Ga0495592_0005617
1128 Ga0495603_0109239
1129 Ga0495590_0004144
1130 Ga0495629_0068066
1131 Ga0495638_0012188
1132 Ga0495651_0075133
1133 Ga0495653_0260767
1134 Ga0495580_0335880
1135 Ga0495605_0195907
1136 Ga0495664_0013587
1137 Ga0495585_0086257
1138 Ga0495594_0290599
1139 Ga0495583_0093324
1140 Ga0495583_0133749
1141 Ga0495606_0006512
1142 Ga0495606_0037284
1143 Ga0495608_0050003
1144 Ga0495616_0117918
1145 Ga0495616_0173136
1146 Ga0495618_0330247
1147 Ga0495630_0070906
1148 Ga0495632_0042247
1149 Ga0495637_0096336
1150 Ga0495643_0113127
1151 Ga0495648_0002859
1152 Ga0495648_0004938
1153 Ga0495648_0069214
1154 Ga0495642_0122822
1155 Ga0495652_0007795
1156 Ga0495652_0090985
1157 Ga0495640_0012370
1158 Ga0495640_0018187
1159 Ga0495640_0237112
1160 Ga0495586_0023355
1161 Ga0495587_0015262
1162 Ga0495597_0085928
1163 Ga0495622_0021822
1164 Ga0495622_0147897
1165 Ga0495667_0026653
1166 Ga0495668_0202737
1167 Ga0495611_0162669
1168 Ga0495625_0005741
1169 Ga0495625_0282974
1170 Ga0495635_0016958
1171 Ga0495635_0084299
1172 Ga0495661_0246378
1173 Ga0495661_0289632
1174 Ga0495657_0002353
1175 Ga0495657_0043382
1176 Ga0495599_0040889
1177 Ga0495623_0006848
1178 Ga0495646_0026710
1179 Ga0495646_0077445
1180 Ga0495613_0033602
1181 Ga0495624_0014326
1182 Ga0495671_0251568
1183 Ga0495671_0319339
1184 Ga0495649_0055252
1185 Ga0495600_0022782
1186 Ga0495600_0047266
1187 Ga0495660_0192882
1188 Ga0495581_0161739
1189 Ga0495604_0000880
1190 Ga0495604_0003285
1191 Ga0495604_0336389
1192 Ga0495674_0006001
1193 Ga0495674_0360623
1194 Ga0495674_0381103
1195 Ga0495674_0527679
1196 Ga0495672_0060474
1197 Ga0495676_0025204
1198 Ga0495683_0193043
1199 Ga0495687_009990
1200 Ga0495673_0056592
1201 Ga0495684_0039841
1202 Ga0495684_0120104
1203 Ga0495686_0247308
1204 Ga0495593_0127306
1205 Ga0495602_0015087
1206 Ga0495602_0159031
1207 Ga0496100_0047811
1208 Ga0496100_0351290
1209 Ga0496101_0056192
1210 Ga0496102_0233059
1211 Ga0496103_0009908
1212 Ga0496103_0073435
1213 Ga0496103_0078961
1214 Ga0496104_0016046
1215 Ga0496104_0063133
1216 Ga0496104_0141062
1217 Ga0496105_0029226
1218 Ga0496105_0066282
1219 Ga0496105_0114413
1220 Ga0496105_0218689
1221 Ga0496105_0266788
1222 Ga0496105_0445441
1223 Ga0496106_0083480
1224 Ga0496106_0182894
1225 Ga0496106_0438869
1226 Ga0496107_0021613
1227 Ga0496107_0077875
1228 Ga0496108_0036540
1229 Ga0496108_0247411
1230 Ga0496109_0086032
1231 Ga0496110_0397006
1232 Ga0496111_0226472
1233 Ga0496112_0080942
1234 Ga0496112_0484864
1235 Ga0496113_0265711
1236 Ga0496113_0376540
1237 Ga0496114_0105195
1238 Ga0496115_0012837
1239 Ga0496115_0035582
1240 Ga0496115_0473385
1241 Ga0496115_0591971
1242 Ga0496116_0285380
1243 Ga0496117_0104996
1244 Ga0496117_0109006
1245 Ga0496118_0055077
1246 Ga0496118_0105880
1247 Ga0496118_0129484
1248 Ga0496118_0191564
1249 Ga0496119_0016898
1250 Ga0496120_0014560
1251 Ga0496120_0103535
1252 Ga0496121_0000578
1253 Ga0496121_0023197
1254 Ga0496121_0054532
1255 Ga0496121_0130855
1256 Ga0496121_0133133
1257 Ga0496121_0412282
1258 Ga0496122_0099059
1259 Ga0496124_0052546
1260 Ga0496124_0367582
1261 Ga0496125_0058502
1262 Ga0496125_0067015
1263 Ga0496126_0000602
1264 Ga0496126_0189002
1265 Ga0496126_0221248
1266 Ga0495682_0003878
1267 Ga0495682_0064290
1268 Ga0501040_0702627
1269 Ga0501072_0535080
1270 nmdc:mga03683_130253_c1
1271 nmdc:mga03683_71562_c1
1272 nmdc:mga00v17_358641_c1
1273 nmdc:mga0yw44_12388_c1
1274 nmdc:mga0yw44_16942_c1
1275 nmdc:mga0yw44_234702_c1
1276 nmdc:mga0yw44_40131_c1
1277 nmdc:mga06z11_252731_c1
1278 nmdc:mga07m45_127364_c1
1279 nmdc:mga05p37_50930_c1
1280 nmdc:mga09592_100731_c1
1281 nmdc:mga0qj67_91233_c1
1282 nmdc:mga06r32_339688_c1
1283 nmdc:mga06r32_485502_c1
1284 nmdc:mga08y16_435805_c1
1285 nmdc:mga08y16_665035_c1
1286 nmdc:mga0n895_966492_c1
1287 nmdc:mga0sz30_104776_c1
1288 nmdc:mga0sz30_77414_c1
1289 Ga0495601_0334338
1290 Ga0495612_0117178
1291 Ga0495595_0105664
1292 Ga0495619_0496058
1293 Ga0500578_0081890
1294 Ga0500643_013742
1295 Ga0500646_0066429
1296 Ga0500646_0066853
1297 Ga0500583_0054842
1298 Ga0500651_0057494
1299 Ga0500566_0000750
1300 Ga0500650_0253236
1301 Ga0500555_001349
1302 Ga0500555_002647
1303 Ga0500556_0073286
1304 Ga0500556_0096857
1305 Ga0500562_003675
1306 Ga0500562_005493
1307 Ga0500569_050120
1308 Ga0500572_028763
1309 Ga0500592_013180
1310 Ga0500595_025573
1311 Ga0500607_055531
1312 Ga0500626_039862
1313 Ga0500655_033916
1314 Ga0500658_0176213
1315 Ga0500559_0017034
1316 Ga0500559_0021721
1317 Ga0500561_0061702
1318 Ga0500564_038903
1319 Ga0500568_0006097
1320 Ga0500568_0052991
1321 Ga0500604_0020158
1322 Ga0500616_0043940
1323 Ga0500619_065754
1324 Ga0500622_0004648
1325 Ga0500638_099660
1326 Ga0500636_0000041
1327 Ga0500636_0125146
1328 Ga0500636_0160528
1329 Ga0500611_037853
1330 Ga0500599_013677
1331 Ga0500601_000017
1332 Ga0500661_002403
1333 Ga0530510_0621961
1334 2508692900
1335 2513621634
1336 2513636924
1337 2513651132
1338 2513700664
1339 2513878374
1340 2514011696
1341 2515626289
1342 2517107834
1343 2528852894
1344 2600204154
1345 2617351829
1346 2753767083
1347 2793061098
1348 2805920597
1349 2818236788
1350 2824605675
1351 2824611763
1352 2824622019
1353 2824629283
1354 2824639184
1355 2824650374
1356 2824654999
1357 2824662249
1358 2824664051
1359 2824675221
1360 2824681557
1361 2824690031
1362 2824701166
1363 2824711137
1364 2824720915
1365 2824729793
1366 2824760435
1367 2824766576
1368 2824776697
1369 2838127354
1370 2841946373
1371 2841957092
1372 2841965612
1373 2841972883
1374 2841978445
1375 2841987453
1376 2842336381
1377 2844320231
1378 2847947978
1379 2849078174
1380 2874598560
1381 2874616747
1382 2874628305
1383 2874630099
1384 2874632555
1385 2874652013
1386 2876768311
1387 2876778598
1388 2876823403
1389 2879082391
1390 2879107397
1391 2879107949
1392 2879131828
1393 2879150164
1394 2881370130
1395 2881669087
1396 2885414391
1397 2888385711
1398 2888392562
1399 2888425828
1400 2903731179
1401 2904674076
1402 2904711726
1403 2906610054
1404 2906631839
1405 2906648434
1406 2922375959
1407 2922396842
1408 2929621269
1409 2929625900
1410 2932785216
1411 2932797108
1412 2932799668
1413 2932807456
1414 2932808744
1415 2932810249
1416 2932816190
1417 2932819592
1418 2932821821
1419 2932829052
1420 2932836219
1421 2933582862
1422 2935610054
1423 2935616964
1424 2935619528
1425 2935636326
1426 2935638508
1427 2935656339
1428 2935660105
1429 2935666640
1430 2935675277
1431 2935682171
1432 2935691175
1433 2935694401
1434 2935703514
1435 2935711715
1436 2935718556
1437 2935727464
1438 2935736167
1439 2935745547
1440 2935755928
1441 2935760808
1442 2935776462
1443 2935780857
1444 2935792313
1445 2935800512
1446 2935801651
1447 2935810139
1448 2935813738
1449 2935814939
1450 2935823214
1451 2935828002
1452 2935842207
1453 2935848796
1454 2935855588
1455 2935858156
1456 2935867167
1457 2935868061
1458 2935870063
1459 2935873916
1460 2935876013
1461 2935885673
1462 2935909404
1463 2935917126
1464 2935926885
1465 2935937271
1466 2935944426
1467 2935952863
1468 2935962927
1469 2935969703
1470 2935976313
1471 2935991844
1472 2935993160
1473 2936003097
1474 2936003954
1475 2936014521
1476 2936027812
1477 2936031282
1478 2936040418
1479 2936042910
1480 2936049627
1481 2936061157
1482 2940562097
1483 2941512957
1484 2941520741
1485 2941528756
1486 2941531420
1487 2941542256
1488 3000019049
1489 3005488462
1490 3005712811
1491 3005723367
1492 8006930086
1493 8016520408
1494 8016521610
1495 8016528482
1496 8016533638
1497 8016546862
1498 8016555255
1499 8016563617
1500 8016576177
1501 8016601352
1502 8016609076
1503 8016615829
1504 8016625407
1505 8016631164
1506 8016638929
1507 8017064030
1508 8017065166
1509 8019533422
1510 8019546254
1511 8019552452
1512 8019565953
1513 8019583351
1514 8019584558
1515 8019591163
1516 8019592331
1517 8019600175
1518 8019618366
1519 8019620043
1520 8019633063
1521 8019646845
1522 8019649613
1523 8019660943
1524 8019670502
1525 8019685731
1526 8019691303
1527 8055744870
1528 8056974836

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

31

232

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.8738 35 214
2yev-assembly2.cif.gz_A structure of caa3-type cytochrome oxidase 0.8524 52 208
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.8518 35 214
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.8379 78 208
8hcr-assembly1.cif.gz_S cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.8314 39 211
ID Description Score Start End Superfamily
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8382 39 211 1.20.120.80
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8378 32 215 1.20.120.80
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8254 32 215 1.20.120.80
3u8vA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);IL-4 antagonist (De novo design) like domain 0.7987 84 197 1.20.120.660
2yevD03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.7966 25 208 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A316WCB9-F1-model_v4 Cytochrome o ubiquinol oxidase subunit III 0.9655 65 211 GO:0004129
GO:0005886
GO:0019646
AF-A0A5U6TQ07-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) 0.9577 71 214 GO:0004129
GO:0005886
GO:0009486
GO:0019646
AF-X8DTB9-F1-model_v4 Probable cytochrome c oxidase subunit 3 (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) 0.9516 85 211 GO:0004129
GO:0005886
GO:0019646
AF-A0A5U6TQ07-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) 0.9387 71 214 GO:0004129
GO:0005886
GO:0009486
GO:0019646
AF-A0A828R4C7-F1-model_v4 deleted 0.9373 56 214

Map