F479749
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 764 | 515 | 1528 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300048916|Ga0496113_0318827|Ga0496113_0318827_378_1082 |
| Length | 234 |
| Sequence | VVDLTDSIRTSVEAARRRALDPHRIGHRPEHGERVHVEPTGHGEGGPASKRIVTAYGFWLFLLSDIVMFSAFFAAYAVLQNETAGGPSGHQVFELPRVAVETGVLLLSSFTCGLAAISTWNRNMMLAQGGLLITGILGAIFLGLEIQEFVGLVQQGAGPQRSAFLSSFFAVVGCHGLHVTAGLLWLGTMMAQIYVKGFTAPIMRRMLCFSLFWHTLDIIWVAIFTVVYLMGAAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 2 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 76 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 77 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 103 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 163 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 164 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 165 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 175 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 176 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 177 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 179 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 196 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 197 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 198 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 201 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 202 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 203 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 204 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 205 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 208 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 209 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 210 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 211 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 284 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 285 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 286 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 287 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 288 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 289 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 290 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 291 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 292 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 293 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 297 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 298 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 299 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 300 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 313 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 314 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 315 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 316 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 317 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 319 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 320 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 321 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 322 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 323 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 324 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 325 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 326 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 327 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 328 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 329 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 331 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 332 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 334 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 335 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 336 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 337 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 338 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 339 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 341 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 342 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 343 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 344 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 345 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 346 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 347 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 348 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 349 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 350 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 351 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 352 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 353 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 354 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 355 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 356 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 357 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 358 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 359 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 360 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 361 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 362 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 363 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 364 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 365 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 366 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 367 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 368 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 369 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 370 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 371 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 372 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 373 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 374 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 375 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 376 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 377 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 378 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 379 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 380 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 381 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 382 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 383 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 384 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 385 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 386 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 387 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 388 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 389 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 390 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 391 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 392 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 393 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 394 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 395 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 396 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 397 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 398 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 399 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 400 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 401 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 402 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 403 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 404 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 405 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 406 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 407 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 408 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 409 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 410 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 411 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 412 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 413 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 414 | 2922368715 | |||
| 415 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 416 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 417 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 418 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 419 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 420 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 421 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 422 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 423 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 424 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 425 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 426 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 427 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 428 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 429 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 430 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 431 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 432 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 433 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 434 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 435 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 436 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 437 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 438 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 439 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 440 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 441 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 442 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 443 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 444 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 445 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 446 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 447 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 448 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 449 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 450 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 451 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 452 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 453 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 454 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 455 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 456 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 457 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 458 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 459 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 460 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 461 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 462 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 463 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 464 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 465 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 466 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 467 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 468 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 469 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 470 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 471 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 472 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 473 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 474 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 475 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 476 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 477 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 478 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 479 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 480 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 481 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 482 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 483 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 484 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 485 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 486 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 487 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 488 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 489 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 490 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 491 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 492 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 493 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 494 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 495 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 496 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 497 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 498 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 499 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 500 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 501 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 502 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 503 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 504 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 505 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 506 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 507 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 508 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 509 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 510 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 511 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 512 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 513 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 514 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 515 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.31 |
| Metatranscriptomes | 0.26 |
| Isolates | 25.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.7 |
| Nodule | 20.42 |
| Rhizoplane | 5.1 |
| Rhizosphere | 51.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496113_0318827 | 3300048916 | Bacteria | 1246 |
| 2 | Ga0006778J45830_1034026 | 3300003162 | Bacteria | 1476 |
| 3 | JGI25153J46596_10000382 | 3300003215 | Bacteria | 30334 |
| 4 | JGI25153J46596_10000866 | 3300003215 | Bacteria | 18445 |
| 5 | JGI25153J46596_10020786 | 3300003215 | Bacteria | 2469 |
| 6 | JGI25160J50197_1008546 | 3300003354 | Bacteria | 3892 |
| 7 | JGI25160J50197_1034463 | 3300003354 | Bacteria | 1256 |
| 8 | JGI25404J52841_10005170 | 3300003659 | Bacteria | 2689 |
| 9 | JGI25404J52841_10026591 | 3300003659 | Bacteria | 1245 |
| 10 | Ga0055542_1011299 | 3300003762 | Bacteria | 1590 |
| 11 | Ga0055531_10009703 | 3300003794 | Bacteria | 4890 |
| 12 | Ga0065165_1007525 | 3300005262 | Bacteria | 5324 |
| 13 | Ga0065165_1013398 | 3300005262 | Bacteria | 3262 |
| 14 | Ga0065165_1021063 | 3300005262 | Bacteria | 2274 |
| 15 | Ga0065165_1080168 | 3300005262 | Bacteria | 849 |
| 16 | Ga0070658_10001212 | 3300005327 | Bacteria | 22108 |
| 17 | Ga0070670_100207773 | 3300005331 | Bacteria | 1702 |
| 18 | Ga0068869_100029200 | 3300005334 | Bacteria | 3862 |
| 19 | Ga0070680_100005766 | 3300005336 | Bacteria | 9397 |
| 20 | Ga0070680_100040498 | 3300005336 | Bacteria | 3773 |
| 21 | Ga0068868_100297556 | 3300005338 | Bacteria | 1370 |
| 22 | Ga0070660_100022424 | 3300005339 | Bacteria | 4669 |
| 23 | Ga0070660_100392313 | 3300005339 | Bacteria | 1147 |
| 24 | Ga0070689_100260260 | 3300005340 | Bacteria | 1434 |
| 25 | Ga0070691_10001227 | 3300005341 | Bacteria | 10789 |
| 26 | Ga0070691_10080946 | 3300005341 | Bacteria | 1590 |
| 27 | Ga0070661_100327148 | 3300005344 | Bacteria | 1198 |
| 28 | Ga0070692_10232327 | 3300005345 | Bacteria | 1095 |
| 29 | Ga0070668_100008050 | 3300005347 | Bacteria | 7830 |
| 30 | Ga0070668_100044763 | 3300005347 | Bacteria | 3395 |
| 31 | Ga0070668_100933803 | 3300005347 | Bacteria | 777 |
| 32 | Ga0070669_100207912 | 3300005353 | Bacteria | 1543 |
| 33 | Ga0070669_100230897 | 3300005353 | Bacteria | 1467 |
| 34 | Ga0070671_100027263 | 3300005355 | Bacteria | 4700 |
| 35 | Ga0070659_100010946 | 3300005366 | Bacteria | 6695 |
| 36 | Ga0070659_100721747 | 3300005366 | Bacteria | 863 |
| 37 | Ga0070667_100145002 | 3300005367 | Bacteria | 2082 |
| 38 | Ga0070667_100278456 | 3300005367 | Bacteria | 1502 |
| 39 | Ga0070709_10005157 | 3300005434 | Bacteria | 7064 |
| 40 | Ga0070714_100015761 | 3300005435 | Bacteria | 6089 |
| 41 | Ga0070713_100058872 | 3300005436 | Bacteria | 3205 |
| 42 | Ga0070710_10000365 | 3300005437 | Bacteria | 21212 |
| 43 | Ga0070711_100026986 | 3300005439 | Bacteria | 3766 |
| 44 | Ga0070700_100002024 | 3300005441 | Bacteria | 10300 |
| 45 | Ga0070700_100626568 | 3300005441 | Bacteria | 846 |
| 46 | Ga0070694_100209333 | 3300005444 | Bacteria | 1458 |
| 47 | Ga0070694_100458294 | 3300005444 | Bacteria | 1008 |
| 48 | Ga0070663_100197971 | 3300005455 | Bacteria | 1566 |
| 49 | Ga0070681_10003277 | 3300005458 | Bacteria | 15111 |
| 50 | Ga0068867_100247432 | 3300005459 | Bacteria | 1449 |
| 51 | Ga0068867_100274054 | 3300005459 | Bacteria | 1381 |
| 52 | Ga0068867_100588161 | 3300005459 | Bacteria | 969 |
| 53 | Ga0070699_100180950 | 3300005518 | Bacteria | 1871 |
| 54 | Ga0070679_100042350 | 3300005530 | Bacteria | 4534 |
| 55 | Ga0070679_100046776 | 3300005530 | Bacteria | 4314 |
| 56 | Ga0068853_100680305 | 3300005539 | Bacteria | 980 |
| 57 | Ga0070672_100532313 | 3300005543 | Bacteria | 1019 |
| 58 | Ga0070695_100028544 | 3300005545 | Bacteria | 3463 |
| 59 | Ga0070695_100195299 | 3300005545 | Bacteria | 1443 |
| 60 | Ga0070696_100318707 | 3300005546 | Bacteria | 1196 |
| 61 | Ga0070693_100040292 | 3300005547 | Bacteria | 2622 |
| 62 | Ga0070665_100206180 | 3300005548 | Bacteria | 1966 |
| 63 | Ga0068855_100097304 | 3300005563 | Bacteria | 3390 |
| 64 | Ga0070664_100056411 | 3300005564 | Bacteria | 3338 |
| 65 | Ga0068857_100419995 | 3300005577 | Bacteria | 1247 |
| 66 | Ga0068857_100436560 | 3300005577 | Bacteria | 1223 |
| 67 | Ga0068854_100054453 | 3300005578 | Bacteria | 2877 |
| 68 | Ga0068856_100232712 | 3300005614 | Bacteria | 1858 |
| 69 | Ga0068852_100008125 | 3300005616 | Bacteria | 7703 |
| 70 | Ga0068859_100759878 | 3300005617 | Bacteria | 1058 |
| 71 | Ga0068864_100003579 | 3300005618 | Bacteria | 12843 |
| 72 | Ga0068864_100121864 | 3300005618 | Bacteria | 2333 |
| 73 | Ga0068861_100016921 | 3300005719 | Bacteria | 5169 |
| 74 | Ga0068863_100014883 | 3300005841 | Bacteria | 7473 |
| 75 | Ga0068863_100728340 | 3300005841 | Bacteria | 987 |
| 76 | Ga0068858_100023729 | 3300005842 | Bacteria | 5714 |
| 77 | Ga0068860_100393111 | 3300005843 | Bacteria | 1370 |
| 78 | Ga0068862_100008858 | 3300005844 | Bacteria | 8328 |
| 79 | Ga0068862_100084443 | 3300005844 | Bacteria | 2758 |
| 80 | Ga0068862_100847467 | 3300005844 | Bacteria | 896 |
| 81 | Ga0081455_10007030 | 3300005937 | Bacteria | 11953 |
| 82 | Ga0081455_10009306 | 3300005937 | Bacteria | 10114 |
| 83 | Ga0081540_1000017 | 3300005983 | Bacteria | 164991 |
| 84 | Ga0081540_1000078 | 3300005983 | Bacteria | 105731 |
| 85 | Ga0081540_1007853 | 3300005983 | Bacteria | 7543 |
| 86 | Ga0081540_1012584 | 3300005983 | Bacteria | 5558 |
| 87 | Ga0081540_1018670 | 3300005983 | Bacteria | 4245 |
| 88 | Ga0081540_1066978 | 3300005983 | Bacteria | 1680 |
| 89 | Ga0070717_10717149 | 3300006028 | Bacteria | 909 |
| 90 | Ga0075365_10014773 | 3300006038 | Bacteria | 4704 |
| 91 | Ga0075365_10069480 | 3300006038 | Bacteria | 2367 |
| 92 | Ga0075365_10072477 | 3300006038 | Bacteria | 2320 |
| 93 | Ga0075365_10123032 | 3300006038 | Bacteria | 1791 |
| 94 | Ga0075365_10382220 | 3300006038 | Bacteria | 993 |
| 95 | Ga0075368_10001778 | 3300006042 | Bacteria | 6934 |
| 96 | Ga0075368_10012643 | 3300006042 | Bacteria | 3091 |
| 97 | Ga0075368_10064874 | 3300006042 | Bacteria | 1467 |
| 98 | Ga0075364_10049670 | 3300006051 | Bacteria | 2737 |
| 99 | Ga0070715_10070744 | 3300006163 | Bacteria | 1558 |
| 100 | Ga0070715_10191885 | 3300006163 | Bacteria | 1032 |
| 101 | Ga0070716_100001478 | 3300006173 | Bacteria | 10491 |
| 102 | Ga0070712_100085722 | 3300006175 | Bacteria | 2294 |
| 103 | Ga0070712_100350781 | 3300006175 | Bacteria | 1208 |
| 104 | Ga0070712_100539579 | 3300006175 | Bacteria | 982 |
| 105 | Ga0075367_10017567 | 3300006178 | Bacteria | 3929 |
| 106 | Ga0075367_10122301 | 3300006178 | Bacteria | 1604 |
| 107 | Ga0075369_10090979 | 3300006186 | Bacteria | 1361 |
| 108 | Ga0075366_10060210 | 3300006195 | Bacteria | 2255 |
| 109 | Ga0075370_10178410 | 3300006353 | Bacteria | 1250 |
| 110 | Ga0075428_100025674 | 3300006844 | Bacteria | 6524 |
| 111 | Ga0075428_100229569 | 3300006844 | Bacteria | 2003 |
| 112 | Ga0075431_100791770 | 3300006847 | Bacteria | 922 |
| 113 | Ga0075433_10159111 | 3300006852 | Bacteria | 2010 |
| 114 | Ga0075429_100064871 | 3300006880 | Bacteria | 3180 |
| 115 | Ga0068865_100237362 | 3300006881 | Bacteria | 1433 |
| 116 | Ga0068865_100900097 | 3300006881 | Bacteria | 769 |
| 117 | Ga0075436_100145761 | 3300006914 | Bacteria | 1665 |
| 118 | Ga0075436_100153831 | 3300006914 | Bacteria | 1619 |
| 119 | Ga0097620_100759962 | 3300006931 | Bacteria | 1058 |
| 120 | Ga0099824_1006549 | 3300006942 | Bacteria | 15916 |
| 121 | Ga0099794_10005774 | 3300007265 | Bacteria | 4986 |
| 122 | Ga0105250_10103767 | 3300009092 | Bacteria | 1161 |
| 123 | Ga0105240_10003221 | 3300009093 | Bacteria | 25561 |
| 124 | Ga0111539_10048435 | 3300009094 | Bacteria | 5074 |
| 125 | Ga0111539_10720354 | 3300009094 | Bacteria | 1161 |
| 126 | Ga0105245_10144738 | 3300009098 | Bacteria | 2242 |
| 127 | Ga0105245_10160545 | 3300009098 | Bacteria | 2132 |
| 128 | Ga0105245_10282591 | 3300009098 | Bacteria | 1622 |
| 129 | Ga0105245_11224024 | 3300009098 | Bacteria | 799 |
| 130 | Ga0105247_10073108 | 3300009101 | Bacteria | 2148 |
| 131 | Ga0105247_10143578 | 3300009101 | Bacteria | 1566 |
| 132 | Ga0105247_10379589 | 3300009101 | Bacteria | 1002 |
| 133 | Ga0114129_10059664 | 3300009147 | Bacteria | 5334 |
| 134 | Ga0114129_10623557 | 3300009147 | Bacteria | 1395 |
| 135 | Ga0105243_10125489 | 3300009148 | Bacteria | 2170 |
| 136 | Ga0105243_10793392 | 3300009148 | Bacteria | 933 |
| 137 | Ga0105241_10010811 | 3300009174 | Bacteria | 6696 |
| 138 | Ga0105241_10118598 | 3300009174 | Bacteria | 2128 |
| 139 | Ga0105241_11050095 | 3300009174 | Bacteria | 765 |
| 140 | Ga0105242_10325097 | 3300009176 | Bacteria | 1412 |
| 141 | Ga0105242_10422237 | 3300009176 | Bacteria | 1250 |
| 142 | Ga0105248_10132608 | 3300009177 | Bacteria | 2811 |
| 143 | Ga0105237_10005500 | 3300009545 | Bacteria | 14281 |
| 144 | Ga0105237_10075297 | 3300009545 | Bacteria | 3367 |
| 145 | Ga0105237_10119799 | 3300009545 | Bacteria | 2625 |
| 146 | Ga0105237_10119842 | 3300009545 | Bacteria | 2625 |
| 147 | Ga0105237_10300958 | 3300009545 | Bacteria | 1607 |
| 148 | Ga0105237_10557305 | 3300009545 | Bacteria | 1153 |
| 149 | Ga0105238_10073624 | 3300009551 | Bacteria | 3410 |
| 150 | Ga0105238_10181097 | 3300009551 | Bacteria | 2084 |
| 151 | Ga0105238_10694498 | 3300009551 | Bacteria | 1029 |
| 152 | Ga0105238_10845669 | 3300009551 | Bacteria | 932 |
| 153 | Ga0105249_10067369 | 3300009553 | Bacteria | 3298 |
| 154 | Ga0105249_10515424 | 3300009553 | Bacteria | 1242 |
| 155 | Ga0105249_10534418 | 3300009553 | Bacteria | 1221 |
| 156 | Ga0105239_10019071 | 3300010375 | Bacteria | 7580 |
| 157 | Ga0105239_10087057 | 3300010375 | Bacteria | 3443 |
| 158 | Ga0105239_10089922 | 3300010375 | Bacteria | 3387 |
| 159 | Ga0105239_11318236 | 3300010375 | Bacteria | 833 |
| 160 | Ga0105246_10007792 | 3300011119 | Bacteria | 6572 |
| 161 | Ga0105246_10016096 | 3300011119 | Bacteria | 4733 |
| 162 | Ga0157313_1008720 | 3300012503 | Bacteria | 823 |
| 163 | Ga0157369_10798827 | 3300013105 | Bacteria | 969 |
| 164 | Ga0157374_10074019 | 3300013296 | Bacteria | 3215 |
| 165 | Ga0157374_10131828 | 3300013296 | Bacteria | 2419 |
| 166 | Ga0157378_10452876 | 3300013297 | Bacteria | 1274 |
| 167 | Ga0157378_10576021 | 3300013297 | Bacteria | 1134 |
| 168 | Ga0163162_10612834 | 3300013306 | Bacteria | 1214 |
| 169 | Ga0163162_10644725 | 3300013306 | Bacteria | 1183 |
| 170 | Ga0163162_10810640 | 3300013306 | Bacteria | 1053 |
| 171 | Ga0157375_10092375 | 3300013308 | Bacteria | 3090 |
| 172 | Ga0157375_10266839 | 3300013308 | Bacteria | 1873 |
| 173 | Ga0157375_10507607 | 3300013308 | Bacteria | 1370 |
| 174 | Ga0157375_11121658 | 3300013308 | Bacteria | 921 |
| 175 | Ga0163163_10137837 | 3300014325 | Bacteria | 2481 |
| 176 | Ga0163163_10229157 | 3300014325 | Bacteria | 1907 |
| 177 | Ga0157379_10084744 | 3300014968 | Bacteria | 2840 |
| 178 | Ga0157376_10040795 | 3300014969 | Bacteria | 3796 |
| 179 | Ga0157376_11046952 | 3300014969 | Bacteria | 840 |
| 180 | Ga0213876_10327341 | 3300021384 | Bacteria | 815 |
| 181 | Ga0213875_10032002 | 3300021388 | Bacteria | 2486 |
| 182 | Ga0207425_1011313 | 3300025245 | Bacteria | 2135 |
| 183 | Ga0209677_102259 | 3300025253 | Bacteria | 7447 |
| 184 | Ga0209148_1000215 | 3300025254 | Bacteria | 99154 |
| 185 | Ga0209148_1016708 | 3300025254 | Bacteria | 1259 |
| 186 | Ga0209233_1003181 | 3300025261 | Bacteria | 5822 |
| 187 | Ga0209455_1008636 | 3300025272 | Bacteria | 2751 |
| 188 | Ga0209455_1013643 | 3300025272 | Bacteria | 1876 |
| 189 | Ga0209564_1011412 | 3300025295 | Bacteria | 3983 |
| 190 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 191 | Ga0209758_1001216 | 3300025297 | Bacteria | 32369 |
| 192 | Ga0209758_1034165 | 3300025297 | Bacteria | 2029 |
| 193 | Ga0209758_1037744 | 3300025297 | Bacteria | 1862 |
| 194 | Ga0209256_1042801 | 3300025299 | Bacteria | 1141 |
| 195 | Ga0207426_1000328 | 3300025302 | Bacteria | 90659 |
| 196 | Ga0207426_1000401 | 3300025302 | Bacteria | 73412 |
| 197 | Ga0207426_1003045 | 3300025302 | Bacteria | 9674 |
| 198 | Ga0209051_1042126 | 3300025303 | Bacteria | 1616 |
| 199 | Ga0209257_1001041 | 3300025304 | Bacteria | 36987 |
| 200 | Ga0209257_1014048 | 3300025304 | Bacteria | 3485 |
| 201 | Ga0207697_10038176 | 3300025315 | Bacteria | 1968 |
| 202 | Ga0207696_1037975 | 3300025711 | Bacteria | 1423 |
| 203 | Ga0207653_10025668 | 3300025885 | Bacteria | 1885 |
| 204 | Ga0207692_10142245 | 3300025898 | Bacteria | 1365 |
| 205 | Ga0207692_10281125 | 3300025898 | Bacteria | 1007 |
| 206 | Ga0207692_10608970 | 3300025898 | Bacteria | 703 |
| 207 | Ga0207710_10039883 | 3300025900 | Bacteria | 2079 |
| 208 | Ga0207710_10070797 | 3300025900 | Bacteria | 1599 |
| 209 | Ga0207710_10146203 | 3300025900 | Bacteria | 1144 |
| 210 | Ga0207688_10332323 | 3300025901 | Bacteria | 934 |
| 211 | Ga0207647_10065490 | 3300025904 | Bacteria | 2205 |
| 212 | Ga0207685_10036515 | 3300025905 | Bacteria | 1802 |
| 213 | Ga0207685_10219287 | 3300025905 | Bacteria | 904 |
| 214 | Ga0207645_10032757 | 3300025907 | Bacteria | 3341 |
| 215 | Ga0207705_10013570 | 3300025909 | Bacteria | 5881 |
| 216 | Ga0207705_10467031 | 3300025909 | Bacteria | 979 |
| 217 | Ga0207654_10015065 | 3300025911 | Bacteria | 4005 |
| 218 | Ga0207654_10059922 | 3300025911 | Bacteria | 2222 |
| 219 | Ga0207695_10000163 | 3300025913 | Bacteria | 197030 |
| 220 | Ga0207695_10057168 | 3300025913 | Bacteria | 4054 |
| 221 | Ga0207671_10014329 | 3300025914 | Bacteria | 6272 |
| 222 | Ga0207693_10047440 | 3300025915 | Bacteria | 3375 |
| 223 | Ga0207693_10057106 | 3300025915 | Bacteria | 3060 |
| 224 | Ga0207663_10013373 | 3300025916 | Bacteria | 4459 |
| 225 | Ga0207660_10163391 | 3300025917 | Bacteria | 1719 |
| 226 | Ga0207660_10237016 | 3300025917 | Bacteria | 1436 |
| 227 | Ga0207657_10032848 | 3300025919 | Bacteria | 4683 |
| 228 | Ga0207657_10233010 | 3300025919 | Bacteria | 1472 |
| 229 | Ga0207657_10401783 | 3300025919 | Bacteria | 1078 |
| 230 | Ga0207649_10224843 | 3300025920 | Bacteria | 1339 |
| 231 | Ga0207652_10040169 | 3300025921 | Bacteria | 3972 |
| 232 | Ga0207681_10080928 | 3300025923 | Bacteria | 2292 |
| 233 | Ga0207681_10103243 | 3300025923 | Bacteria | 2060 |
| 234 | Ga0207681_10325051 | 3300025923 | Bacteria | 1224 |
| 235 | Ga0207687_10732124 | 3300025927 | Bacteria | 841 |
| 236 | Ga0207700_10171233 | 3300025928 | Bacteria | 1812 |
| 237 | Ga0207700_10345699 | 3300025928 | Bacteria | 1294 |
| 238 | Ga0207664_10064017 | 3300025929 | Bacteria | 2940 |
| 239 | Ga0207644_10403010 | 3300025931 | Bacteria | 1118 |
| 240 | Ga0207690_10132735 | 3300025932 | Bacteria | 1825 |
| 241 | Ga0207706_10153487 | 3300025933 | Bacteria | 2026 |
| 242 | Ga0207706_10574199 | 3300025933 | Bacteria | 970 |
| 243 | Ga0207709_10704510 | 3300025935 | Bacteria | 808 |
| 244 | Ga0207665_10045091 | 3300025939 | Bacteria | 2952 |
| 245 | Ga0207711_10100127 | 3300025941 | Bacteria | 2563 |
| 246 | Ga0207689_10027067 | 3300025942 | Bacteria | 4800 |
| 247 | Ga0207689_10166533 | 3300025942 | Bacteria | 1816 |
| 248 | Ga0207679_10585352 | 3300025945 | Bacteria | 1004 |
| 249 | Ga0207667_10051440 | 3300025949 | Bacteria | 4343 |
| 250 | Ga0207651_10416573 | 3300025960 | Bacteria | 1146 |
| 251 | Ga0207712_10005237 | 3300025961 | Bacteria | 8203 |
| 252 | Ga0207712_10107032 | 3300025961 | Bacteria | 2090 |
| 253 | Ga0207668_10010796 | 3300025972 | Bacteria | 5531 |
| 254 | Ga0207668_10109186 | 3300025972 | Bacteria | 2072 |
| 255 | Ga0207668_10592215 | 3300025972 | Bacteria | 965 |
| 256 | Ga0207668_10757214 | 3300025972 | Bacteria | 857 |
| 257 | Ga0207668_10833140 | 3300025972 | Bacteria | 818 |
| 258 | Ga0207640_10757380 | 3300025981 | Bacteria | 838 |
| 259 | Ga0207658_10199073 | 3300025986 | Bacteria | 1671 |
| 260 | Ga0207677_10977717 | 3300026023 | Bacteria | 766 |
| 261 | Ga0207703_10383554 | 3300026035 | Bacteria | 1300 |
| 262 | Ga0207703_10581924 | 3300026035 | Bacteria | 1058 |
| 263 | Ga0207639_10040096 | 3300026041 | Bacteria | 3494 |
| 264 | Ga0207678_10002535 | 3300026067 | Bacteria | 16646 |
| 265 | Ga0207678_10051021 | 3300026067 | Bacteria | 3572 |
| 266 | Ga0207678_10178394 | 3300026067 | Bacteria | 1814 |
| 267 | Ga0207708_10053244 | 3300026075 | Bacteria | 3083 |
| 268 | Ga0207702_10667428 | 3300026078 | Bacteria | 1023 |
| 269 | Ga0207641_10232071 | 3300026088 | Bacteria | 1715 |
| 270 | Ga0207641_10296263 | 3300026088 | Bacteria | 1526 |
| 271 | Ga0207648_10098990 | 3300026089 | Bacteria | 2553 |
| 272 | Ga0207676_10015881 | 3300026095 | Bacteria | 5445 |
| 273 | Ga0207676_10188754 | 3300026095 | Bacteria | 1812 |
| 274 | Ga0207674_10152501 | 3300026116 | Bacteria | 2267 |
| 275 | Ga0207674_10296417 | 3300026116 | Bacteria | 1566 |
| 276 | Ga0207674_10438554 | 3300026116 | Bacteria | 1262 |
| 277 | Ga0207675_100022244 | 3300026118 | Bacteria | 5904 |
| 278 | Ga0207675_100026604 | 3300026118 | Bacteria | 5386 |
| 279 | Ga0207675_100090389 | 3300026118 | Bacteria | 2879 |
| 280 | Ga0207675_101268520 | 3300026118 | Bacteria | 757 |
| 281 | Ga0209389_1000043 | 3300027296 | Bacteria | 123224 |
| 282 | Ga0209589_1000047 | 3300027357 | Bacteria | 118659 |
| 283 | Ga0209489_100075 | 3300027361 | Bacteria | 136991 |
| 284 | Ga0209813_10010109 | 3300027866 | Bacteria | 2432 |
| 285 | Ga0209813_10037372 | 3300027866 | Bacteria | 1463 |
| 286 | Ga0265356_1002401 | 3300028017 | Bacteria | 2521 |
| 287 | Ga0268266_10074320 | 3300028379 | Bacteria | 2951 |
| 288 | Ga0268266_10144418 | 3300028379 | Bacteria | 2138 |
| 289 | Ga0268266_10179697 | 3300028379 | Bacteria | 1926 |
| 290 | Ga0268266_10483692 | 3300028379 | Bacteria | 1180 |
| 291 | Ga0268265_10004213 | 3300028380 | Bacteria | 10051 |
| 292 | Ga0268265_10011792 | 3300028380 | Bacteria | 5909 |
| 293 | Ga0268265_10753703 | 3300028380 | Bacteria | 945 |
| 294 | Ga0268264_10152244 | 3300028381 | Bacteria | 2075 |
| 295 | Ga0307517_10015766 | 3300028786 | Bacteria | 10008 |
| 296 | Ga0265338_10518201 | 3300028800 | Bacteria | 838 |
| 297 | Ga0265762_1010283 | 3300030760 | Bacteria | 1671 |
| 298 | Ga0265340_10141046 | 3300031247 | Bacteria | 1102 |
| 299 | Ga0307510_10013929 | 3300033180 | Bacteria | 9524 |
| 300 | Ga0307510_10108851 | 3300033180 | Bacteria | 2523 |
| 301 | Ga0307510_10110063 | 3300033180 | Bacteria | 2501 |
| 302 | Ga0373958_0030821 | 3300034819 | Bacteria | 1051 |
| 303 | Ga0373938_0047875 | 3300034957 | Bacteria | 968 |
| 304 | Ga0373940_0123635 | 3300035088 | Bacteria | 805 |
| 305 | Ga0373939_0002714 | 3300035114 | Bacteria | 4152 |
| 306 | Ga0373939_0035806 | 3300035114 | Bacteria | 1465 |
| 307 | Ga0373941_0009356 | 3300035115 | Bacteria | 2466 |
| 308 | Ga0373960_0003056 | 3300035121 | Bacteria | 3778 |
| 309 | Ga0373942_0120166 | 3300035207 | Bacteria | 820 |
| 310 | Ga0373931_0001206 | 3300035691 | Bacteria | 11056 |
| 311 | Ga0373931_0076583 | 3300035691 | Bacteria | 1838 |
| 312 | Ga0373935_0221262 | 3300035692 | Bacteria | 1315 |
| 313 | Ga0373935_0777394 | 3300035692 | Bacteria | 706 |
| 314 | Ga0373927_0094432 | 3300035695 | Bacteria | 1943 |
| 315 | Ga0373927_0205860 | 3300035695 | Bacteria | 1292 |
| 316 | Ga0373933_0020776 | 3300035724 | Bacteria | 3723 |
| 317 | Ga0373937_0133666 | 3300036401 | Bacteria | 2318 |
| 318 | Ga0373925_0060216 | 3300037068 | Bacteria | 2851 |
| 319 | Ga0373925_0372268 | 3300037068 | Bacteria | 1162 |
| 320 | Ga0395899_0089761 | 3300037312 | Bacteria | 2229 |
| 321 | Ga0395900_0529256 | 3300037418 | Bacteria | 1126 |
| 322 | Ga0395898_0335243 | 3300037466 | Bacteria | 1442 |
| 323 | Ga0395898_0542514 | 3300037466 | Bacteria | 1105 |
| 324 | Ga0395905_0012507 | 3300037471 | Bacteria | 8168 |
| 325 | Ga0395905_0018328 | 3300037471 | Bacteria | 6645 |
| 326 | Ga0395905_0054352 | 3300037471 | Bacteria | 3748 |
| 327 | Ga0395905_0155569 | 3300037471 | Bacteria | 2150 |
| 328 | Ga0436364_0731834 | 3300037853 | Bacteria | 14258 |
| 329 | Ga0436364_1166421 | 3300037853 | Bacteria | 4329 |
| 330 | Ga0395901_0198551 | 3300038443 | Bacteria | 2103 |
| 331 | Ga0436365_0458129 | 3300039437 | Bacteria | 2330 |
| 332 | Ga0436365_1115190 | 3300039437 | Bacteria | 4366 |
| 333 | Ga0436365_1828458 | 3300039437 | Bacteria | 1604 |
| 334 | Ga0436360_0111883 | 3300039438 | Bacteria | 1546 |
| 335 | Ga0436360_0595666 | 3300039438 | Bacteria | 7463 |
| 336 | Ga0436360_0934711 | 3300039438 | Bacteria | 4193 |
| 337 | Ga0436361_0122632 | 3300039447 | Bacteria | 5177 |
| 338 | Ga0436361_0371970 | 3300039447 | Bacteria | 3745 |
| 339 | Ga0436361_0420563 | 3300039447 | Bacteria | 1883 |
| 340 | Ga0436361_0887352 | 3300039447 | Bacteria | 988 |
| 341 | Ga0436361_1076341 | 3300039447 | Bacteria | 1930 |
| 342 | Ga0436363_1321995 | 3300039450 | Bacteria | 2864 |
| 343 | Ga0451793_0114728 | 3300041452 | Bacteria | 888 |
| 344 | Ga0451802_0309198 | 3300041460 | Bacteria | 2262 |
| 345 | Ga0451847_0585162 | 3300041503 | Bacteria | 994 |
| 346 | Ga0466969_0017547 | 3300044656 | Bacteria | 3735 |
| 347 | Ga0466972_0000079 | 3300044658 | Bacteria | 90348 |
| 348 | Ga0466972_0009117 | 3300044658 | Bacteria | 4982 |
| 349 | Ga0466965_0404835 | 3300044683 | Bacteria | 754 |
| 350 | Ga0466966_0000191 | 3300044684 | Bacteria | 40906 |
| 351 | Ga0466966_0038670 | 3300044684 | Bacteria | 3074 |
| 352 | Ga0466961_0000005 | 3300044693 | Bacteria | 173105 |
| 353 | Ga0466961_0264600 | 3300044693 | Bacteria | 1054 |
| 354 | Ga0466963_0027201 | 3300044694 | Bacteria | 3661 |
| 355 | Ga0466964_0013726 | 3300044706 | Bacteria | 3074 |
| 356 | Ga0466968_0002291 | 3300044735 | Bacteria | 6991 |
| 357 | Ga0466968_0013541 | 3300044735 | Bacteria | 3208 |
| 358 | Ga0466968_0399680 | 3300044735 | Bacteria | 673 |
| 359 | Ga0466960_0005971 | 3300044901 | Bacteria | 4860 |
| 360 | Ga0466959_0000686 | 3300045049 | Bacteria | 19811 |
| 361 | Ga0466959_0002371 | 3300045049 | Bacteria | 12012 |
| 362 | Ga0466959_0008511 | 3300045049 | Bacteria | 7260 |
| 363 | Ga0495592_0005617 | 3300046454 | Bacteria | 9270 |
| 364 | Ga0495603_0109239 | 3300046455 | Bacteria | 1614 |
| 365 | Ga0495590_0004144 | 3300046457 | Bacteria | 5874 |
| 366 | Ga0495629_0068066 | 3300046459 | Bacteria | 2484 |
| 367 | Ga0495638_0012188 | 3300046460 | Bacteria | 5904 |
| 368 | Ga0495651_0075133 | 3300046462 | Bacteria | 2563 |
| 369 | Ga0495653_0260767 | 3300046463 | Bacteria | 1146 |
| 370 | Ga0495580_0335880 | 3300046472 | Bacteria | 1025 |
| 371 | Ga0495605_0195907 | 3300046474 | Bacteria | 882 |
| 372 | Ga0495664_0013587 | 3300046477 | Bacteria | 4617 |
| 373 | Ga0495585_0086257 | 3300046492 | Bacteria | 1696 |
| 374 | Ga0495594_0290599 | 3300046499 | Bacteria | 931 |
| 375 | Ga0495583_0093324 | 3300046506 | Bacteria | 1293 |
| 376 | Ga0495583_0133749 | 3300046506 | Bacteria | 1036 |
| 377 | Ga0495606_0006512 | 3300046507 | Bacteria | 10745 |
| 378 | Ga0495606_0037284 | 3300046507 | Bacteria | 3303 |
| 379 | Ga0495608_0050003 | 3300046511 | Bacteria | 2774 |
| 380 | Ga0495616_0117918 | 3300046513 | Bacteria | 1227 |
| 381 | Ga0495616_0173136 | 3300046513 | Bacteria | 964 |
| 382 | Ga0495618_0330247 | 3300046514 | Bacteria | 943 |
| 383 | Ga0495630_0070906 | 3300046517 | Bacteria | 2622 |
| 384 | Ga0495632_0042247 | 3300046519 | Bacteria | 2286 |
| 385 | Ga0495637_0096336 | 3300046520 | Bacteria | 1161 |
| 386 | Ga0495643_0113127 | 3300046522 | Bacteria | 1378 |
| 387 | Ga0495648_0002859 | 3300046524 | Bacteria | 15545 |
| 388 | Ga0495648_0004938 | 3300046524 | Bacteria | 11210 |
| 389 | Ga0495648_0069214 | 3300046524 | Bacteria | 2055 |
| 390 | Ga0495642_0122822 | 3300046528 | Bacteria | 1115 |
| 391 | Ga0495652_0007795 | 3300046529 | Bacteria | 9835 |
| 392 | Ga0495652_0090985 | 3300046529 | Bacteria | 2495 |
| 393 | Ga0495640_0012370 | 3300046533 | Bacteria | 6523 |
| 394 | Ga0495640_0018187 | 3300046533 | Bacteria | 5222 |
| 395 | Ga0495640_0237112 | 3300046533 | Bacteria | 1146 |
| 396 | Ga0495586_0023355 | 3300046535 | Bacteria | 3303 |
| 397 | Ga0495587_0015262 | 3300046536 | Bacteria | 4799 |
| 398 | Ga0495597_0085928 | 3300046542 | Bacteria | 1340 |
| 399 | Ga0495622_0021822 | 3300046557 | Bacteria | 2982 |
| 400 | Ga0495622_0147897 | 3300046557 | Bacteria | 1064 |
| 401 | Ga0495667_0026653 | 3300046559 | Bacteria | 3895 |
| 402 | Ga0495668_0202737 | 3300046616 | Bacteria | 1086 |
| 403 | Ga0495611_0162669 | 3300046648 | Bacteria | 1043 |
| 404 | Ga0495625_0005741 | 3300046660 | Bacteria | 11219 |
| 405 | Ga0495625_0282974 | 3300046660 | Bacteria | 1066 |
| 406 | Ga0495635_0016958 | 3300046663 | Bacteria | 5087 |
| 407 | Ga0495635_0084299 | 3300046663 | Bacteria | 2175 |
| 408 | Ga0495661_0246378 | 3300046665 | Bacteria | 914 |
| 409 | Ga0495661_0289632 | 3300046665 | Bacteria | 823 |
| 410 | Ga0495657_0002353 | 3300046675 | Bacteria | 15899 |
| 411 | Ga0495657_0043382 | 3300046675 | Bacteria | 3067 |
| 412 | Ga0495599_0040889 | 3300046678 | Bacteria | 2911 |
| 413 | Ga0495623_0006848 | 3300046679 | Bacteria | 7415 |
| 414 | Ga0495646_0026710 | 3300046680 | Bacteria | 3624 |
| 415 | Ga0495646_0077445 | 3300046680 | Bacteria | 1945 |
| 416 | Ga0495613_0033602 | 3300046689 | Bacteria | 3811 |
| 417 | Ga0495624_0014326 | 3300046690 | Bacteria | 5384 |
| 418 | Ga0495671_0251568 | 3300046692 | Bacteria | 853 |
| 419 | Ga0495671_0319339 | 3300046692 | Bacteria | 746 |
| 420 | Ga0495649_0055252 | 3300046694 | Bacteria | 2146 |
| 421 | Ga0495600_0022782 | 3300046809 | Bacteria | 4025 |
| 422 | Ga0495600_0047266 | 3300046809 | Bacteria | 2807 |
| 423 | Ga0495660_0192882 | 3300046810 | Bacteria | 978 |
| 424 | Ga0495581_0161739 | 3300047315 | Bacteria | 1309 |
| 425 | Ga0495604_0000880 | 3300047317 | Bacteria | 24979 |
| 426 | Ga0495604_0003285 | 3300047317 | Bacteria | 12908 |
| 427 | Ga0495604_0336389 | 3300047317 | Bacteria | 1006 |
| 428 | Ga0495674_0006001 | 3300047319 | Bacteria | 11663 |
| 429 | Ga0495674_0360623 | 3300047319 | Bacteria | 1179 |
| 430 | Ga0495674_0381103 | 3300047319 | Bacteria | 1141 |
| 431 | Ga0495674_0527679 | 3300047319 | Bacteria | 942 |
| 432 | Ga0495672_0060474 | 3300047320 | Bacteria | 2188 |
| 433 | Ga0495676_0025204 | 3300047321 | Bacteria | 5138 |
| 434 | Ga0495683_0193043 | 3300047323 | Bacteria | 923 |
| 435 | Ga0495687_009990 | 3300047443 | Bacteria | 5246 |
| 436 | Ga0495673_0056592 | 3300047469 | Bacteria | 1696 |
| 437 | Ga0495684_0039841 | 3300047471 | Bacteria | 3602 |
| 438 | Ga0495684_0120104 | 3300047471 | Bacteria | 1980 |
| 439 | Ga0495686_0247308 | 3300047472 | Bacteria | 1003 |
| 440 | Ga0495593_0127306 | 3300047673 | Bacteria | 1294 |
| 441 | Ga0495602_0015087 | 3300048088 | Bacteria | 7814 |
| 442 | Ga0495602_0159031 | 3300048088 | Bacteria | 1766 |
| 443 | Ga0496100_0047811 | 3300048903 | Bacteria | 2759 |
| 444 | Ga0496100_0351290 | 3300048903 | Bacteria | 1114 |
| 445 | Ga0496101_0056192 | 3300048904 | Bacteria | 2845 |
| 446 | Ga0496102_0233059 | 3300048905 | Bacteria | 1736 |
| 447 | Ga0496103_0009908 | 3300048906 | Bacteria | 5635 |
| 448 | Ga0496103_0073435 | 3300048906 | Bacteria | 2143 |
| 449 | Ga0496103_0078961 | 3300048906 | Bacteria | 2067 |
| 450 | Ga0496104_0016046 | 3300048907 | Bacteria | 6799 |
| 451 | Ga0496104_0063133 | 3300048907 | Bacteria | 3512 |
| 452 | Ga0496104_0141062 | 3300048907 | Bacteria | 2315 |
| 453 | Ga0496105_0029226 | 3300048908 | Bacteria | 4511 |
| 454 | Ga0496105_0066282 | 3300048908 | Bacteria | 2980 |
| 455 | Ga0496105_0114413 | 3300048908 | Bacteria | 2225 |
| 456 | Ga0496105_0218689 | 3300048908 | Bacteria | 1551 |
| 457 | Ga0496105_0266788 | 3300048908 | Bacteria | 1383 |
| 458 | Ga0496105_0445441 | 3300048908 | Bacteria | 1023 |
| 459 | Ga0496106_0083480 | 3300048909 | Bacteria | 2457 |
| 460 | Ga0496106_0182894 | 3300048909 | Bacteria | 1664 |
| 461 | Ga0496106_0438869 | 3300048909 | Bacteria | 1049 |
| 462 | Ga0496107_0021613 | 3300048910 | Bacteria | 4548 |
| 463 | Ga0496107_0077875 | 3300048910 | Bacteria | 2415 |
| 464 | Ga0496108_0036540 | 3300048911 | Bacteria | 4087 |
| 465 | Ga0496108_0247411 | 3300048911 | Bacteria | 1551 |
| 466 | Ga0496109_0086032 | 3300048912 | Bacteria | 2903 |
| 467 | Ga0496110_0397006 | 3300048913 | Bacteria | 1257 |
| 468 | Ga0496111_0226472 | 3300048914 | Bacteria | 1389 |
| 469 | Ga0496112_0080942 | 3300048915 | Bacteria | 3211 |
| 470 | Ga0496112_0484864 | 3300048915 | Bacteria | 1172 |
| 471 | Ga0496113_0265711 | 3300048916 | Bacteria | 1371 |
| 472 | Ga0496113_0376540 | 3300048916 | Bacteria | 1139 |
| 473 | Ga0496114_0105195 | 3300048917 | Bacteria | 2414 |
| 474 | Ga0496115_0012837 | 3300048918 | Bacteria | 6317 |
| 475 | Ga0496115_0035582 | 3300048918 | Bacteria | 3940 |
| 476 | Ga0496115_0473385 | 3300048918 | Bacteria | 1009 |
| 477 | Ga0496115_0591971 | 3300048918 | Bacteria | 883 |
| 478 | Ga0496116_0285380 | 3300048919 | Bacteria | 796 |
| 479 | Ga0496117_0104996 | 3300048920 | Bacteria | 1777 |
| 480 | Ga0496117_0109006 | 3300048920 | Bacteria | 1730 |
| 481 | Ga0496118_0055077 | 3300048921 | Bacteria | 3005 |
| 482 | Ga0496118_0105880 | 3300048921 | Bacteria | 1883 |
| 483 | Ga0496118_0129484 | 3300048921 | Bacteria | 1624 |
| 484 | Ga0496118_0191564 | 3300048921 | Bacteria | 1222 |
| 485 | Ga0496119_0016898 | 3300048922 | Bacteria | 5521 |
| 486 | Ga0496120_0014560 | 3300048923 | Bacteria | 5236 |
| 487 | Ga0496120_0103535 | 3300048923 | Bacteria | 1499 |
| 488 | Ga0496121_0000578 | 3300048924 | Bacteria | 68826 |
| 489 | Ga0496121_0023197 | 3300048924 | Bacteria | 5987 |
| 490 | Ga0496121_0054532 | 3300048924 | Bacteria | 3339 |
| 491 | Ga0496121_0130855 | 3300048924 | Bacteria | 1878 |
| 492 | Ga0496121_0133133 | 3300048924 | Bacteria | 1857 |
| 493 | Ga0496121_0412282 | 3300048924 | Bacteria | 881 |
| 494 | Ga0496122_0099059 | 3300048925 | Bacteria | 1956 |
| 495 | Ga0496124_0052546 | 3300048927 | Bacteria | 3461 |
| 496 | Ga0496124_0367582 | 3300048927 | Bacteria | 1011 |
| 497 | Ga0496125_0058502 | 3300048928 | Bacteria | 3113 |
| 498 | Ga0496125_0067015 | 3300048928 | Bacteria | 2832 |
| 499 | Ga0496126_0000602 | 3300048929 | Bacteria | 67975 |
| 500 | Ga0496126_0189002 | 3300048929 | Bacteria | 1745 |
| 501 | Ga0496126_0221248 | 3300048929 | Bacteria | 1590 |
| 502 | Ga0495682_0003878 | 3300049460 | Bacteria | 6544 |
| 503 | Ga0495682_0064290 | 3300049460 | Bacteria | 1323 |
| 504 | Ga0501040_0702627 | 3300049576 | Bacteria | 731 |
| 505 | Ga0501072_0535080 | 3300049588 | Bacteria | 926 |
| 506 | nmdc:mga03683_130253_c1 | 3300050489 | Bacteria | 1125 |
| 507 | nmdc:mga03683_71562_c1 | 3300050489 | Bacteria | 1483 |
| 508 | nmdc:mga00v17_358641_c1 | 3300050491 | Bacteria | 948 |
| 509 | nmdc:mga0yw44_12388_c1 | 3300050492 | Bacteria | 4443 |
| 510 | nmdc:mga0yw44_16942_c1 | 3300050492 | Bacteria | 3950 |
| 511 | nmdc:mga0yw44_234702_c1 | 3300050492 | Bacteria | 1218 |
| 512 | nmdc:mga0yw44_40131_c1 | 3300050492 | Bacteria | 2779 |
| 513 | nmdc:mga06z11_252731_c1 | 3300050494 | Bacteria | 1038 |
| 514 | nmdc:mga07m45_127364_c1 | 3300050496 | Bacteria | 1473 |
| 515 | nmdc:mga05p37_50930_c1 | 3300050507 | Bacteria | 5092 |
| 516 | nmdc:mga09592_100731_c1 | 3300050508 | Bacteria | 2474 |
| 517 | nmdc:mga0qj67_91233_c1 | 3300050509 | Bacteria | 2448 |
| 518 | nmdc:mga06r32_339688_c1 | 3300050510 | Bacteria | 1486 |
| 519 | nmdc:mga06r32_485502_c1 | 3300050510 | Bacteria | 1213 |
| 520 | nmdc:mga08y16_435805_c1 | 3300050511 | Bacteria | 1338 |
| 521 | nmdc:mga08y16_665035_c1 | 3300050511 | Bacteria | 1044 |
| 522 | nmdc:mga0n895_966492_c1 | 3300050512 | Bacteria | 834 |
| 523 | nmdc:mga0sz30_104776_c1 | 3300050516 | Bacteria | 1237 |
| 524 | nmdc:mga0sz30_77414_c1 | 3300050516 | Bacteria | 1437 |
| 525 | Ga0495601_0334338 | 3300053077 | Bacteria | 986 |
| 526 | Ga0495612_0117178 | 3300053078 | Bacteria | 1144 |
| 527 | Ga0495595_0105664 | 3300053084 | Bacteria | 1362 |
| 528 | Ga0495619_0496058 | 3300053085 | Bacteria | 840 |
| 529 | Ga0500578_0081890 | 3300053086 | Bacteria | 2052 |
| 530 | Ga0500643_013742 | 3300053087 | Bacteria | 2844 |
| 531 | Ga0500646_0066429 | 3300053090 | Bacteria | 1073 |
| 532 | Ga0500646_0066853 | 3300053090 | Bacteria | 1070 |
| 533 | Ga0500583_0054842 | 3300053092 | Bacteria | 1862 |
| 534 | Ga0500651_0057494 | 3300053093 | Bacteria | 2434 |
| 535 | Ga0500566_0000750 | 3300053094 | Bacteria | 18266 |
| 536 | Ga0500650_0253236 | 3300053098 | Bacteria | 789 |
| 537 | Ga0500555_001349 | 3300053103 | Bacteria | 7685 |
| 538 | Ga0500555_002647 | 3300053103 | Bacteria | 5154 |
| 539 | Ga0500556_0073286 | 3300053104 | Bacteria | 1282 |
| 540 | Ga0500556_0096857 | 3300053104 | Bacteria | 1132 |
| 541 | Ga0500562_003675 | 3300053108 | Bacteria | 3853 |
| 542 | Ga0500562_005493 | 3300053108 | Bacteria | 3181 |
| 543 | Ga0500569_050120 | 3300053109 | Bacteria | 1257 |
| 544 | Ga0500572_028763 | 3300053111 | Bacteria | 1532 |
| 545 | Ga0500592_013180 | 3300053116 | Bacteria | 1324 |
| 546 | Ga0500595_025573 | 3300053119 | Bacteria | 2044 |
| 547 | Ga0500607_055531 | 3300053121 | Bacteria | 2093 |
| 548 | Ga0500626_039862 | 3300053128 | Bacteria | 2125 |
| 549 | Ga0500655_033916 | 3300053133 | Bacteria | 989 |
| 550 | Ga0500658_0176213 | 3300053134 | Bacteria | 972 |
| 551 | Ga0500559_0017034 | 3300053136 | Bacteria | 3069 |
| 552 | Ga0500559_0021721 | 3300053136 | Bacteria | 2721 |
| 553 | Ga0500561_0061702 | 3300053137 | Bacteria | 1052 |
| 554 | Ga0500564_038903 | 3300053138 | Bacteria | 2192 |
| 555 | Ga0500568_0006097 | 3300053139 | Bacteria | 6111 |
| 556 | Ga0500568_0052991 | 3300053139 | Bacteria | 1591 |
| 557 | Ga0500604_0020158 | 3300053151 | Bacteria | 1874 |
| 558 | Ga0500616_0043940 | 3300053153 | Bacteria | 2386 |
| 559 | Ga0500619_065754 | 3300053154 | Bacteria | 1199 |
| 560 | Ga0500622_0004648 | 3300053156 | Bacteria | 8504 |
| 561 | Ga0500638_099660 | 3300053162 | Bacteria | 1357 |
| 562 | Ga0500636_0000041 | 3300053177 | Bacteria | 69687 |
| 563 | Ga0500636_0125146 | 3300053177 | Bacteria | 1438 |
| 564 | Ga0500636_0160528 | 3300053177 | Bacteria | 1226 |
| 565 | Ga0500611_037853 | 3300053727 | Bacteria | 1041 |
| 566 | Ga0500599_013677 | 3300053736 | Bacteria | 1099 |
| 567 | Ga0500601_000017 | 3300053737 | Bacteria | 40649 |
| 568 | Ga0500661_002403 | 3300055283 | Bacteria | 3536 |
| 569 | Ga0530510_0621961 | 3300061734 | Bacteria | 822 |
| 570 | 2508692900 | 2508501042 | Bacteria | 8719808 |
| 571 | 2513621634 | 2513237092 | Bacteria | 8341956 |
| 572 | 2513636924 | 2513237094 | Bacteria | 8789602 |
| 573 | 2513651132 | 2513237095 | Bacteria | 8976980 |
| 574 | 2513700664 | 2513237102 | Bacteria | 7703324 |
| 575 | 2513878374 | 2513237139 | Bacteria | 8737671 |
| 576 | 2514011696 | 2513237161 | Bacteria | 8871253 |
| 577 | 2515626289 | 2515154112 | Bacteria | 8294334 |
| 578 | 2517107834 | 2517093001 | Bacteria | 9002274 |
| 579 | 2528852894 | 2528768022 | Bacteria | 10457665 |
| 580 | 2600204154 | 2599185354 | Bacteria | 4398675 |
| 581 | 2617351829 | 2617270735 | Bacteria | 9163226 |
| 582 | 2753767083 | 2751185897 | Bacteria | 5322941 |
| 583 | 2793061098 | 2791355196 | Bacteria | 7323613 |
| 584 | 2805920597 | 2802429603 | Bacteria | 8777136 |
| 585 | 2818236788 | 2816332527 | Bacteria | 8933356 |
| 586 | 2824605675 | 2824600985 | Bacteria | 8488197 |
| 587 | 2824611763 | 2824609381 | Bacteria | 8672835 |
| 588 | 2824622019 | 2824617872 | Bacteria | 8814715 |
| 589 | 2824629283 | 2824626560 | Bacteria | 8813858 |
| 590 | 2824639184 | 2824635225 | Bacteria | 8785348 |
| 591 | 2824650374 | 2824644064 | Bacteria | 8743947 |
| 592 | 2824654999 | 2824653114 | Bacteria | 8493680 |
| 593 | 2824662249 | 2824661429 | Bacteria | 9877870 |
| 594 | 2824664051 | 2824661429 | Bacteria | 9877870 |
| 595 | 2824675221 | 2824671348 | Bacteria | 8369588 |
| 596 | 2824681557 | 2824679649 | Bacteria | 8248951 |
| 597 | 2824690031 | 2824687955 | Bacteria | 8360029 |
| 598 | 2824701166 | 2824696289 | Bacteria | 8335049 |
| 599 | 2824711137 | 2824704595 | Bacteria | 9667483 |
| 600 | 2824720915 | 2824714736 | Bacteria | 8717648 |
| 601 | 2824729793 | 2824723954 | Bacteria | 8758240 |
| 602 | 2824760435 | 2824753945 | Bacteria | 9787441 |
| 603 | 2824766576 | 2824763712 | Bacteria | 9792355 |
| 604 | 2824776697 | 2824773399 | Bacteria | 8360218 |
| 605 | 2838127354 | 2838122688 | Bacteria | 8803140 |
| 606 | 2841946373 | 2841941048 | Bacteria | 8688029 |
| 607 | 2841957092 | 2841949485 | Bacteria | 8680857 |
| 608 | 2841965612 | 2841957949 | Bacteria | 8652217 |
| 609 | 2841972883 | 2841966195 | Bacteria | 8673214 |
| 610 | 2841978445 | 2841974524 | Bacteria | 8931498 |
| 611 | 2841987453 | 2841983080 | Bacteria | 8395090 |
| 612 | 2842336381 | 2842333319 | Bacteria | 8899485 |
| 613 | 2844320231 | 2844315083 | Bacteria | 8138177 |
| 614 | 2847947978 | 2847939898 | Bacteria | 8606328 |
| 615 | 2849078174 | 2849076700 | Bacteria | 7039503 |
| 616 | 2874598560 | 2874590934 | Bacteria | 8299676 |
| 617 | 2874616747 | 2874612657 | Bacteria | 8252029 |
| 618 | 2874628305 | 2874620515 | Bacteria | 8290088 |
| 619 | 2874630099 | 2874628541 | Bacteria | 8630250 |
| 620 | 2874632555 | 2874628541 | Bacteria | 8630250 |
| 621 | 2874652013 | 2874645413 | Bacteria | 8214782 |
| 622 | 2876768311 | 2876761206 | Bacteria | 10111113 |
| 623 | 2876778598 | 2876771140 | Bacteria | 8287509 |
| 624 | 2876823403 | 2876818435 | Bacteria | 8274608 |
| 625 | 2879082391 | 2879074833 | Bacteria | 8279565 |
| 626 | 2879107397 | 2879099564 | Bacteria | 10442239 |
| 627 | 2879107949 | 2879099564 | Bacteria | 10442239 |
| 628 | 2879131828 | 2879127579 | Bacteria | 8294491 |
| 629 | 2879150164 | 2879142872 | Bacteria | 8267021 |
| 630 | 2881370130 | 2881364244 | Bacteria | 7710352 |
| 631 | 2881669087 | 2881665667 | Bacteria | 8175609 |
| 632 | 2885414391 | 2885409591 | Bacteria | 9235467 |
| 633 | 2888385711 | 2888378607 | Bacteria | 9652610 |
| 634 | 2888392562 | 2888388044 | Bacteria | 7304136 |
| 635 | 2888425828 | 2888419890 | Bacteria | 7857137 |
| 636 | 2903731179 | 2903727486 | Bacteria | 8281579 |
| 637 | 2904674076 | 2904666416 | Bacteria | 8226587 |
| 638 | 2904711726 | 2904711408 | Bacteria | 9771557 |
| 639 | 2906610054 | 2906602504 | Bacteria | 8295279 |
| 640 | 2906631839 | 2906626472 | Bacteria | 8826946 |
| 641 | 2906648434 | 2906643746 | Bacteria | 8722424 |
| 642 | 2922375959 | |||
| 643 | 2922396842 | 2922393267 | Bacteria | 8285685 |
| 644 | 2929621269 | 2929615660 | Bacteria | 9193770 |
| 645 | 2929625900 | 2929624759 | Bacteria | 9339455 |
| 646 | 2932785216 | 2932784394 | Bacteria | 9704911 |
| 647 | 2932797108 | 2932794094 | Bacteria | 7915132 |
| 648 | 2932799668 | 2932794094 | Bacteria | 7915132 |
| 649 | 2932807456 | 2932801729 | Bacteria | 7987968 |
| 650 | 2932808744 | 2932801729 | Bacteria | 7987968 |
| 651 | 2932810249 | 2932809354 | Bacteria | 9135765 |
| 652 | 2932816190 | 2932809354 | Bacteria | 9135765 |
| 653 | 2932819592 | 2932818245 | Bacteria | 9955613 |
| 654 | 2932821821 | 2932818245 | Bacteria | 9955613 |
| 655 | 2932829052 | 2932828146 | Bacteria | 9745859 |
| 656 | 2932836219 | 2932828146 | Bacteria | 9745859 |
| 657 | 2933582862 | 2933577622 | Bacteria | 9116884 |
| 658 | 2935610054 | 2935608549 | Bacteria | 8203142 |
| 659 | 2935616964 | 2935616580 | Bacteria | 9032984 |
| 660 | 2935619528 | 2935616580 | Bacteria | 9032984 |
| 661 | 2935636326 | 2935630451 | Bacteria | 8169952 |
| 662 | 2935638508 | 2935638405 | Bacteria | 10015038 |
| 663 | 2935656339 | 2935648319 | Bacteria | 8801166 |
| 664 | 2935660105 | 2935656913 | Bacteria | 8965014 |
| 665 | 2935666640 | 2935665750 | Bacteria | 9571747 |
| 666 | 2935675277 | 2935675223 | Bacteria | 9928132 |
| 667 | 2935682171 | 2935675223 | Bacteria | 9928132 |
| 668 | 2935691175 | 2935684952 | Bacteria | 9590419 |
| 669 | 2935694401 | 2935694250 | Bacteria | 9291695 |
| 670 | 2935703514 | 2935703347 | Bacteria | 10242284 |
| 671 | 2935711715 | 2935703347 | Bacteria | 10242284 |
| 672 | 2935718556 | 2935713505 | Bacteria | 9608509 |
| 673 | 2935727464 | 2935722832 | Bacteria | 9608746 |
| 674 | 2935736167 | 2935732158 | Bacteria | 9706831 |
| 675 | 2935745547 | 2935741537 | Bacteria | 9707219 |
| 676 | 2935755928 | 2935750917 | Bacteria | 9590372 |
| 677 | 2935760808 | 2935760218 | Bacteria | 9817913 |
| 678 | 2935776462 | 2935769743 | Bacteria | 7878163 |
| 679 | 2935780857 | 2935777560 | Bacteria | 8077691 |
| 680 | 2935792313 | 2935785616 | Bacteria | 7962367 |
| 681 | 2935800512 | 2935793552 | Bacteria | 8012592 |
| 682 | 2935801651 | 2935801545 | Bacteria | 9301974 |
| 683 | 2935810139 | 2935801545 | Bacteria | 9301974 |
| 684 | 2935813738 | 2935810662 | Bacteria | 9401221 |
| 685 | 2935814939 | 2935810662 | Bacteria | 9401221 |
| 686 | 2935823214 | 2935819856 | Bacteria | 8261050 |
| 687 | 2935828002 | 2935827899 | Bacteria | 10038562 |
| 688 | 2935842207 | 2935837841 | Bacteria | 9454360 |
| 689 | 2935848796 | 2935847175 | Bacteria | 8228321 |
| 690 | 2935855588 | 2935855204 | Bacteria | 9035059 |
| 691 | 2935858156 | 2935855204 | Bacteria | 9035059 |
| 692 | 2935867167 | 2935864058 | Bacteria | 9784707 |
| 693 | 2935868061 | 2935864058 | Bacteria | 9784707 |
| 694 | 2935870063 | 2935864058 | Bacteria | 9784707 |
| 695 | 2935873916 | 2935873716 | Bacteria | 9632195 |
| 696 | 2935876013 | 2935873716 | Bacteria | 9632195 |
| 697 | 2935885673 | 2935883170 | Bacteria | 7964738 |
| 698 | 2935909404 | 2935908558 | Bacteria | 8568796 |
| 699 | 2935917126 | 2935916978 | Bacteria | 9113783 |
| 700 | 2935926885 | 2935926038 | Bacteria | 8601059 |
| 701 | 2935937271 | 2935934488 | Bacteria | 8602579 |
| 702 | 2935944426 | 2935942939 | Bacteria | 8599779 |
| 703 | 2935952863 | 2935951376 | Bacteria | 8602333 |
| 704 | 2935962927 | 2935959822 | Bacteria | 7869783 |
| 705 | 2935969703 | 2935967501 | Bacteria | 8603075 |
| 706 | 2935976313 | 2935975950 | Bacteria | 8347125 |
| 707 | 2935991844 | 2935984226 | Bacteria | 8302647 |
| 708 | 2935993160 | 2935992306 | Bacteria | 9802711 |
| 709 | 2936003097 | 2936002035 | Bacteria | 9362176 |
| 710 | 2936003954 | 2936002035 | Bacteria | 9362176 |
| 711 | 2936014521 | 2936011229 | Bacteria | 8801034 |
| 712 | 2936027812 | 2936019824 | Bacteria | 8804134 |
| 713 | 2936031282 | 2936028420 | Bacteria | 8965941 |
| 714 | 2936040418 | 2936037263 | Bacteria | 9446081 |
| 715 | 2936042910 | 2936037263 | Bacteria | 9446081 |
| 716 | 2936049627 | 2936046547 | Bacteria | 8903709 |
| 717 | 2936061157 | 2936055302 | Bacteria | 8785755 |
| 718 | 2940562097 | 2940556831 | Bacteria | 9590747 |
| 719 | 2941512957 | 2941507105 | Bacteria | 8166816 |
| 720 | 2941520741 | 2941515067 | Bacteria | 8166720 |
| 721 | 2941528756 | 2941523033 | Bacteria | 8169134 |
| 722 | 2941531420 | 2941531003 | Bacteria | 7653939 |
| 723 | 2941542256 | 2941538514 | Bacteria | 9402094 |
| 724 | 3000019049 | 3000017691 | Bacteria | 3772574 |
| 725 | 3005488462 | 3005483717 | Bacteria | 7877331 |
| 726 | 3005712811 | 3005710791 | Bacteria | 7622528 |
| 727 | 3005723367 | 3005718088 | Bacteria | 8283608 |
| 728 | 8006930086 | 8006926726 | Bacteria | 6749210 |
| 729 | 8016520408 | 8016511872 | Bacteria | 9921665 |
| 730 | 8016521610 | 8016511872 | Bacteria | 9921665 |
| 731 | 8016528482 | 8016522445 | Bacteria | 8156687 |
| 732 | 8016533638 | 8016530956 | Bacteria | 8155261 |
| 733 | 8016546862 | 8016539877 | Bacteria | 8155419 |
| 734 | 8016555255 | 8016548790 | Bacteria | 8155074 |
| 735 | 8016563617 | 8016557553 | Bacteria | 8154380 |
| 736 | 8016576177 | 8016575299 | Bacteria | 8154085 |
| 737 | 8016601352 | 8016595262 | Bacteria | 8149947 |
| 738 | 8016609076 | 8016603502 | Bacteria | 8731218 |
| 739 | 8016615829 | 8016613128 | Bacteria | 8794220 |
| 740 | 8016625407 | 8016622563 | Bacteria | 7999408 |
| 741 | 8016631164 | 8016630954 | Bacteria | 9217207 |
| 742 | 8016638929 | 8016630954 | Bacteria | 9217207 |
| 743 | 8017064030 | 8017057580 | Bacteria | 10023680 |
| 744 | 8017065166 | 8017057580 | Bacteria | 10023680 |
| 745 | 8019533422 | 8019530166 | Bacteria | 8155624 |
| 746 | 8019546254 | 8019538911 | Bacteria | 7872763 |
| 747 | 8019552452 | 8019547302 | Bacteria | 7996444 |
| 748 | 8019565953 | 8019565922 | Bacteria | 9639779 |
| 749 | 8019583351 | 8019576017 | Bacteria | 10049540 |
| 750 | 8019584558 | 8019576017 | Bacteria | 10049540 |
| 751 | 8019591163 | 8019586578 | Bacteria | 10212056 |
| 752 | 8019592331 | 8019586578 | Bacteria | 10212056 |
| 753 | 8019600175 | 8019597564 | Bacteria | 10041141 |
| 754 | 8019618366 | 8019608314 | Bacteria | 10042931 |
| 755 | 8019620043 | 8019619141 | Bacteria | 9218857 |
| 756 | 8019633063 | 8019629233 | Bacteria | 8687553 |
| 757 | 8019646845 | 8019638758 | Bacteria | 9062356 |
| 758 | 8019649613 | 8019648815 | Bacteria | 10014479 |
| 759 | 8019660943 | 8019659431 | Bacteria | 8577854 |
| 760 | 8019670502 | 8019668869 | Bacteria | 8791617 |
| 761 | 8019685731 | 8019678201 | Bacteria | 8863603 |
| 762 | 8019691303 | 8019687851 | Bacteria | 8712826 |
| 763 | 8055744870 | 8055742211 | Bacteria | 9226248 |
| 764 | 8056974836 | 8056967851 | Bacteria | 9038162 |
| 765 | Ga0496113_0318827 | |||
| 766 | Ga0006778J45830_1034026 | |||
| 767 | JGI25153J46596_10000382 | |||
| 768 | JGI25153J46596_10000866 | |||
| 769 | JGI25153J46596_10020786 | |||
| 770 | JGI25160J50197_1008546 | |||
| 771 | JGI25160J50197_1034463 | |||
| 772 | JGI25404J52841_10005170 | |||
| 773 | JGI25404J52841_10026591 | |||
| 774 | Ga0055542_1011299 | |||
| 775 | Ga0055531_10009703 | |||
| 776 | Ga0065165_1007525 | |||
| 777 | Ga0065165_1013398 | |||
| 778 | Ga0065165_1021063 | |||
| 779 | Ga0065165_1080168 | |||
| 780 | Ga0070658_10001212 | |||
| 781 | Ga0070670_100207773 | |||
| 782 | Ga0068869_100029200 | |||
| 783 | Ga0070680_100005766 | |||
| 784 | Ga0070680_100040498 | |||
| 785 | Ga0068868_100297556 | |||
| 786 | Ga0070660_100022424 | |||
| 787 | Ga0070660_100392313 | |||
| 788 | Ga0070689_100260260 | |||
| 789 | Ga0070691_10001227 | |||
| 790 | Ga0070691_10080946 | |||
| 791 | Ga0070661_100327148 | |||
| 792 | Ga0070692_10232327 | |||
| 793 | Ga0070668_100008050 | |||
| 794 | Ga0070668_100044763 | |||
| 795 | Ga0070668_100933803 | |||
| 796 | Ga0070669_100207912 | |||
| 797 | Ga0070669_100230897 | |||
| 798 | Ga0070671_100027263 | |||
| 799 | Ga0070659_100010946 | |||
| 800 | Ga0070659_100721747 | |||
| 801 | Ga0070667_100145002 | |||
| 802 | Ga0070667_100278456 | |||
| 803 | Ga0070709_10005157 | |||
| 804 | Ga0070714_100015761 | |||
| 805 | Ga0070713_100058872 | |||
| 806 | Ga0070710_10000365 | |||
| 807 | Ga0070711_100026986 | |||
| 808 | Ga0070700_100002024 | |||
| 809 | Ga0070700_100626568 | |||
| 810 | Ga0070694_100209333 | |||
| 811 | Ga0070694_100458294 | |||
| 812 | Ga0070663_100197971 | |||
| 813 | Ga0070681_10003277 | |||
| 814 | Ga0068867_100247432 | |||
| 815 | Ga0068867_100274054 | |||
| 816 | Ga0068867_100588161 | |||
| 817 | Ga0070699_100180950 | |||
| 818 | Ga0070679_100042350 | |||
| 819 | Ga0070679_100046776 | |||
| 820 | Ga0068853_100680305 | |||
| 821 | Ga0070672_100532313 | |||
| 822 | Ga0070695_100028544 | |||
| 823 | Ga0070695_100195299 | |||
| 824 | Ga0070696_100318707 | |||
| 825 | Ga0070693_100040292 | |||
| 826 | Ga0070665_100206180 | |||
| 827 | Ga0068855_100097304 | |||
| 828 | Ga0070664_100056411 | |||
| 829 | Ga0068857_100419995 | |||
| 830 | Ga0068857_100436560 | |||
| 831 | Ga0068854_100054453 | |||
| 832 | Ga0068856_100232712 | |||
| 833 | Ga0068852_100008125 | |||
| 834 | Ga0068859_100759878 | |||
| 835 | Ga0068864_100003579 | |||
| 836 | Ga0068864_100121864 | |||
| 837 | Ga0068861_100016921 | |||
| 838 | Ga0068863_100014883 | |||
| 839 | Ga0068863_100728340 | |||
| 840 | Ga0068858_100023729 | |||
| 841 | Ga0068860_100393111 | |||
| 842 | Ga0068862_100008858 | |||
| 843 | Ga0068862_100084443 | |||
| 844 | Ga0068862_100847467 | |||
| 845 | Ga0081455_10007030 | |||
| 846 | Ga0081455_10009306 | |||
| 847 | Ga0081540_1000017 | |||
| 848 | Ga0081540_1000078 | |||
| 849 | Ga0081540_1007853 | |||
| 850 | Ga0081540_1012584 | |||
| 851 | Ga0081540_1018670 | |||
| 852 | Ga0081540_1066978 | |||
| 853 | Ga0070717_10717149 | |||
| 854 | Ga0075365_10014773 | |||
| 855 | Ga0075365_10069480 | |||
| 856 | Ga0075365_10072477 | |||
| 857 | Ga0075365_10123032 | |||
| 858 | Ga0075365_10382220 | |||
| 859 | Ga0075368_10001778 | |||
| 860 | Ga0075368_10012643 | |||
| 861 | Ga0075368_10064874 | |||
| 862 | Ga0075364_10049670 | |||
| 863 | Ga0070715_10070744 | |||
| 864 | Ga0070715_10191885 | |||
| 865 | Ga0070716_100001478 | |||
| 866 | Ga0070712_100085722 | |||
| 867 | Ga0070712_100350781 | |||
| 868 | Ga0070712_100539579 | |||
| 869 | Ga0075367_10017567 | |||
| 870 | Ga0075367_10122301 | |||
| 871 | Ga0075369_10090979 | |||
| 872 | Ga0075366_10060210 | |||
| 873 | Ga0075370_10178410 | |||
| 874 | Ga0075428_100025674 | |||
| 875 | Ga0075428_100229569 | |||
| 876 | Ga0075431_100791770 | |||
| 877 | Ga0075433_10159111 | |||
| 878 | Ga0075429_100064871 | |||
| 879 | Ga0068865_100237362 | |||
| 880 | Ga0068865_100900097 | |||
| 881 | Ga0075436_100145761 | |||
| 882 | Ga0075436_100153831 | |||
| 883 | Ga0097620_100759962 | |||
| 884 | Ga0099824_1006549 | |||
| 885 | Ga0099794_10005774 | |||
| 886 | Ga0105250_10103767 | |||
| 887 | Ga0105240_10003221 | |||
| 888 | Ga0111539_10048435 | |||
| 889 | Ga0111539_10720354 | |||
| 890 | Ga0105245_10144738 | |||
| 891 | Ga0105245_10160545 | |||
| 892 | Ga0105245_10282591 | |||
| 893 | Ga0105245_11224024 | |||
| 894 | Ga0105247_10073108 | |||
| 895 | Ga0105247_10143578 | |||
| 896 | Ga0105247_10379589 | |||
| 897 | Ga0114129_10059664 | |||
| 898 | Ga0114129_10623557 | |||
| 899 | Ga0105243_10125489 | |||
| 900 | Ga0105243_10793392 | |||
| 901 | Ga0105241_10010811 | |||
| 902 | Ga0105241_10118598 | |||
| 903 | Ga0105241_11050095 | |||
| 904 | Ga0105242_10325097 | |||
| 905 | Ga0105242_10422237 | |||
| 906 | Ga0105248_10132608 | |||
| 907 | Ga0105237_10005500 | |||
| 908 | Ga0105237_10075297 | |||
| 909 | Ga0105237_10119799 | |||
| 910 | Ga0105237_10119842 | |||
| 911 | Ga0105237_10300958 | |||
| 912 | Ga0105237_10557305 | |||
| 913 | Ga0105238_10073624 | |||
| 914 | Ga0105238_10181097 | |||
| 915 | Ga0105238_10694498 | |||
| 916 | Ga0105238_10845669 | |||
| 917 | Ga0105249_10067369 | |||
| 918 | Ga0105249_10515424 | |||
| 919 | Ga0105249_10534418 | |||
| 920 | Ga0105239_10019071 | |||
| 921 | Ga0105239_10087057 | |||
| 922 | Ga0105239_10089922 | |||
| 923 | Ga0105239_11318236 | |||
| 924 | Ga0105246_10007792 | |||
| 925 | Ga0105246_10016096 | |||
| 926 | Ga0157313_1008720 | |||
| 927 | Ga0157369_10798827 | |||
| 928 | Ga0157374_10074019 | |||
| 929 | Ga0157374_10131828 | |||
| 930 | Ga0157378_10452876 | |||
| 931 | Ga0157378_10576021 | |||
| 932 | Ga0163162_10612834 | |||
| 933 | Ga0163162_10644725 | |||
| 934 | Ga0163162_10810640 | |||
| 935 | Ga0157375_10092375 | |||
| 936 | Ga0157375_10266839 | |||
| 937 | Ga0157375_10507607 | |||
| 938 | Ga0157375_11121658 | |||
| 939 | Ga0163163_10137837 | |||
| 940 | Ga0163163_10229157 | |||
| 941 | Ga0157379_10084744 | |||
| 942 | Ga0157376_10040795 | |||
| 943 | Ga0157376_11046952 | |||
| 944 | Ga0213876_10327341 | |||
| 945 | Ga0213875_10032002 | |||
| 946 | Ga0207425_1011313 | |||
| 947 | Ga0209677_102259 | |||
| 948 | Ga0209148_1000215 | |||
| 949 | Ga0209148_1016708 | |||
| 950 | Ga0209233_1003181 | |||
| 951 | Ga0209455_1008636 | |||
| 952 | Ga0209455_1013643 | |||
| 953 | Ga0209564_1011412 | |||
| 954 | Ga0209758_1000011 | |||
| 955 | Ga0209758_1001216 | |||
| 956 | Ga0209758_1034165 | |||
| 957 | Ga0209758_1037744 | |||
| 958 | Ga0209256_1042801 | |||
| 959 | Ga0207426_1000328 | |||
| 960 | Ga0207426_1000401 | |||
| 961 | Ga0207426_1003045 | |||
| 962 | Ga0209051_1042126 | |||
| 963 | Ga0209257_1001041 | |||
| 964 | Ga0209257_1014048 | |||
| 965 | Ga0207697_10038176 | |||
| 966 | Ga0207696_1037975 | |||
| 967 | Ga0207653_10025668 | |||
| 968 | Ga0207692_10142245 | |||
| 969 | Ga0207692_10281125 | |||
| 970 | Ga0207692_10608970 | |||
| 971 | Ga0207710_10039883 | |||
| 972 | Ga0207710_10070797 | |||
| 973 | Ga0207710_10146203 | |||
| 974 | Ga0207688_10332323 | |||
| 975 | Ga0207647_10065490 | |||
| 976 | Ga0207685_10036515 | |||
| 977 | Ga0207685_10219287 | |||
| 978 | Ga0207645_10032757 | |||
| 979 | Ga0207705_10013570 | |||
| 980 | Ga0207705_10467031 | |||
| 981 | Ga0207654_10015065 | |||
| 982 | Ga0207654_10059922 | |||
| 983 | Ga0207695_10000163 | |||
| 984 | Ga0207695_10057168 | |||
| 985 | Ga0207671_10014329 | |||
| 986 | Ga0207693_10047440 | |||
| 987 | Ga0207693_10057106 | |||
| 988 | Ga0207663_10013373 | |||
| 989 | Ga0207660_10163391 | |||
| 990 | Ga0207660_10237016 | |||
| 991 | Ga0207657_10032848 | |||
| 992 | Ga0207657_10233010 | |||
| 993 | Ga0207657_10401783 | |||
| 994 | Ga0207649_10224843 | |||
| 995 | Ga0207652_10040169 | |||
| 996 | Ga0207681_10080928 | |||
| 997 | Ga0207681_10103243 | |||
| 998 | Ga0207681_10325051 | |||
| 999 | Ga0207687_10732124 | |||
| 1000 | Ga0207700_10171233 | |||
| 1001 | Ga0207700_10345699 | |||
| 1002 | Ga0207664_10064017 | |||
| 1003 | Ga0207644_10403010 | |||
| 1004 | Ga0207690_10132735 | |||
| 1005 | Ga0207706_10153487 | |||
| 1006 | Ga0207706_10574199 | |||
| 1007 | Ga0207709_10704510 | |||
| 1008 | Ga0207665_10045091 | |||
| 1009 | Ga0207711_10100127 | |||
| 1010 | Ga0207689_10027067 | |||
| 1011 | Ga0207689_10166533 | |||
| 1012 | Ga0207679_10585352 | |||
| 1013 | Ga0207667_10051440 | |||
| 1014 | Ga0207651_10416573 | |||
| 1015 | Ga0207712_10005237 | |||
| 1016 | Ga0207712_10107032 | |||
| 1017 | Ga0207668_10010796 | |||
| 1018 | Ga0207668_10109186 | |||
| 1019 | Ga0207668_10592215 | |||
| 1020 | Ga0207668_10757214 | |||
| 1021 | Ga0207668_10833140 | |||
| 1022 | Ga0207640_10757380 | |||
| 1023 | Ga0207658_10199073 | |||
| 1024 | Ga0207677_10977717 | |||
| 1025 | Ga0207703_10383554 | |||
| 1026 | Ga0207703_10581924 | |||
| 1027 | Ga0207639_10040096 | |||
| 1028 | Ga0207678_10002535 | |||
| 1029 | Ga0207678_10051021 | |||
| 1030 | Ga0207678_10178394 | |||
| 1031 | Ga0207708_10053244 | |||
| 1032 | Ga0207702_10667428 | |||
| 1033 | Ga0207641_10232071 | |||
| 1034 | Ga0207641_10296263 | |||
| 1035 | Ga0207648_10098990 | |||
| 1036 | Ga0207676_10015881 | |||
| 1037 | Ga0207676_10188754 | |||
| 1038 | Ga0207674_10152501 | |||
| 1039 | Ga0207674_10296417 | |||
| 1040 | Ga0207674_10438554 | |||
| 1041 | Ga0207675_100022244 | |||
| 1042 | Ga0207675_100026604 | |||
| 1043 | Ga0207675_100090389 | |||
| 1044 | Ga0207675_101268520 | |||
| 1045 | Ga0209389_1000043 | |||
| 1046 | Ga0209589_1000047 | |||
| 1047 | Ga0209489_100075 | |||
| 1048 | Ga0209813_10010109 | |||
| 1049 | Ga0209813_10037372 | |||
| 1050 | Ga0265356_1002401 | |||
| 1051 | Ga0268266_10074320 | |||
| 1052 | Ga0268266_10144418 | |||
| 1053 | Ga0268266_10179697 | |||
| 1054 | Ga0268266_10483692 | |||
| 1055 | Ga0268265_10004213 | |||
| 1056 | Ga0268265_10011792 | |||
| 1057 | Ga0268265_10753703 | |||
| 1058 | Ga0268264_10152244 | |||
| 1059 | Ga0307517_10015766 | |||
| 1060 | Ga0265338_10518201 | |||
| 1061 | Ga0265762_1010283 | |||
| 1062 | Ga0265340_10141046 | |||
| 1063 | Ga0307510_10013929 | |||
| 1064 | Ga0307510_10108851 | |||
| 1065 | Ga0307510_10110063 | |||
| 1066 | Ga0373958_0030821 | |||
| 1067 | Ga0373938_0047875 | |||
| 1068 | Ga0373940_0123635 | |||
| 1069 | Ga0373939_0002714 | |||
| 1070 | Ga0373939_0035806 | |||
| 1071 | Ga0373941_0009356 | |||
| 1072 | Ga0373960_0003056 | |||
| 1073 | Ga0373942_0120166 | |||
| 1074 | Ga0373931_0001206 | |||
| 1075 | Ga0373931_0076583 | |||
| 1076 | Ga0373935_0221262 | |||
| 1077 | Ga0373935_0777394 | |||
| 1078 | Ga0373927_0094432 | |||
| 1079 | Ga0373927_0205860 | |||
| 1080 | Ga0373933_0020776 | |||
| 1081 | Ga0373937_0133666 | |||
| 1082 | Ga0373925_0060216 | |||
| 1083 | Ga0373925_0372268 | |||
| 1084 | Ga0395899_0089761 | |||
| 1085 | Ga0395900_0529256 | |||
| 1086 | Ga0395898_0335243 | |||
| 1087 | Ga0395898_0542514 | |||
| 1088 | Ga0395905_0012507 | |||
| 1089 | Ga0395905_0018328 | |||
| 1090 | Ga0395905_0054352 | |||
| 1091 | Ga0395905_0155569 | |||
| 1092 | Ga0436364_0731834 | |||
| 1093 | Ga0436364_1166421 | |||
| 1094 | Ga0395901_0198551 | |||
| 1095 | Ga0436365_0458129 | |||
| 1096 | Ga0436365_1115190 | |||
| 1097 | Ga0436365_1828458 | |||
| 1098 | Ga0436360_0111883 | |||
| 1099 | Ga0436360_0595666 | |||
| 1100 | Ga0436360_0934711 | |||
| 1101 | Ga0436361_0122632 | |||
| 1102 | Ga0436361_0371970 | |||
| 1103 | Ga0436361_0420563 | |||
| 1104 | Ga0436361_0887352 | |||
| 1105 | Ga0436361_1076341 | |||
| 1106 | Ga0436363_1321995 | |||
| 1107 | Ga0451793_0114728 | |||
| 1108 | Ga0451802_0309198 | |||
| 1109 | Ga0451847_0585162 | |||
| 1110 | Ga0466969_0017547 | |||
| 1111 | Ga0466972_0000079 | |||
| 1112 | Ga0466972_0009117 | |||
| 1113 | Ga0466965_0404835 | |||
| 1114 | Ga0466966_0000191 | |||
| 1115 | Ga0466966_0038670 | |||
| 1116 | Ga0466961_0000005 | |||
| 1117 | Ga0466961_0264600 | |||
| 1118 | Ga0466963_0027201 | |||
| 1119 | Ga0466964_0013726 | |||
| 1120 | Ga0466968_0002291 | |||
| 1121 | Ga0466968_0013541 | |||
| 1122 | Ga0466968_0399680 | |||
| 1123 | Ga0466960_0005971 | |||
| 1124 | Ga0466959_0000686 | |||
| 1125 | Ga0466959_0002371 | |||
| 1126 | Ga0466959_0008511 | |||
| 1127 | Ga0495592_0005617 | |||
| 1128 | Ga0495603_0109239 | |||
| 1129 | Ga0495590_0004144 | |||
| 1130 | Ga0495629_0068066 | |||
| 1131 | Ga0495638_0012188 | |||
| 1132 | Ga0495651_0075133 | |||
| 1133 | Ga0495653_0260767 | |||
| 1134 | Ga0495580_0335880 | |||
| 1135 | Ga0495605_0195907 | |||
| 1136 | Ga0495664_0013587 | |||
| 1137 | Ga0495585_0086257 | |||
| 1138 | Ga0495594_0290599 | |||
| 1139 | Ga0495583_0093324 | |||
| 1140 | Ga0495583_0133749 | |||
| 1141 | Ga0495606_0006512 | |||
| 1142 | Ga0495606_0037284 | |||
| 1143 | Ga0495608_0050003 | |||
| 1144 | Ga0495616_0117918 | |||
| 1145 | Ga0495616_0173136 | |||
| 1146 | Ga0495618_0330247 | |||
| 1147 | Ga0495630_0070906 | |||
| 1148 | Ga0495632_0042247 | |||
| 1149 | Ga0495637_0096336 | |||
| 1150 | Ga0495643_0113127 | |||
| 1151 | Ga0495648_0002859 | |||
| 1152 | Ga0495648_0004938 | |||
| 1153 | Ga0495648_0069214 | |||
| 1154 | Ga0495642_0122822 | |||
| 1155 | Ga0495652_0007795 | |||
| 1156 | Ga0495652_0090985 | |||
| 1157 | Ga0495640_0012370 | |||
| 1158 | Ga0495640_0018187 | |||
| 1159 | Ga0495640_0237112 | |||
| 1160 | Ga0495586_0023355 | |||
| 1161 | Ga0495587_0015262 | |||
| 1162 | Ga0495597_0085928 | |||
| 1163 | Ga0495622_0021822 | |||
| 1164 | Ga0495622_0147897 | |||
| 1165 | Ga0495667_0026653 | |||
| 1166 | Ga0495668_0202737 | |||
| 1167 | Ga0495611_0162669 | |||
| 1168 | Ga0495625_0005741 | |||
| 1169 | Ga0495625_0282974 | |||
| 1170 | Ga0495635_0016958 | |||
| 1171 | Ga0495635_0084299 | |||
| 1172 | Ga0495661_0246378 | |||
| 1173 | Ga0495661_0289632 | |||
| 1174 | Ga0495657_0002353 | |||
| 1175 | Ga0495657_0043382 | |||
| 1176 | Ga0495599_0040889 | |||
| 1177 | Ga0495623_0006848 | |||
| 1178 | Ga0495646_0026710 | |||
| 1179 | Ga0495646_0077445 | |||
| 1180 | Ga0495613_0033602 | |||
| 1181 | Ga0495624_0014326 | |||
| 1182 | Ga0495671_0251568 | |||
| 1183 | Ga0495671_0319339 | |||
| 1184 | Ga0495649_0055252 | |||
| 1185 | Ga0495600_0022782 | |||
| 1186 | Ga0495600_0047266 | |||
| 1187 | Ga0495660_0192882 | |||
| 1188 | Ga0495581_0161739 | |||
| 1189 | Ga0495604_0000880 | |||
| 1190 | Ga0495604_0003285 | |||
| 1191 | Ga0495604_0336389 | |||
| 1192 | Ga0495674_0006001 | |||
| 1193 | Ga0495674_0360623 | |||
| 1194 | Ga0495674_0381103 | |||
| 1195 | Ga0495674_0527679 | |||
| 1196 | Ga0495672_0060474 | |||
| 1197 | Ga0495676_0025204 | |||
| 1198 | Ga0495683_0193043 | |||
| 1199 | Ga0495687_009990 | |||
| 1200 | Ga0495673_0056592 | |||
| 1201 | Ga0495684_0039841 | |||
| 1202 | Ga0495684_0120104 | |||
| 1203 | Ga0495686_0247308 | |||
| 1204 | Ga0495593_0127306 | |||
| 1205 | Ga0495602_0015087 | |||
| 1206 | Ga0495602_0159031 | |||
| 1207 | Ga0496100_0047811 | |||
| 1208 | Ga0496100_0351290 | |||
| 1209 | Ga0496101_0056192 | |||
| 1210 | Ga0496102_0233059 | |||
| 1211 | Ga0496103_0009908 | |||
| 1212 | Ga0496103_0073435 | |||
| 1213 | Ga0496103_0078961 | |||
| 1214 | Ga0496104_0016046 | |||
| 1215 | Ga0496104_0063133 | |||
| 1216 | Ga0496104_0141062 | |||
| 1217 | Ga0496105_0029226 | |||
| 1218 | Ga0496105_0066282 | |||
| 1219 | Ga0496105_0114413 | |||
| 1220 | Ga0496105_0218689 | |||
| 1221 | Ga0496105_0266788 | |||
| 1222 | Ga0496105_0445441 | |||
| 1223 | Ga0496106_0083480 | |||
| 1224 | Ga0496106_0182894 | |||
| 1225 | Ga0496106_0438869 | |||
| 1226 | Ga0496107_0021613 | |||
| 1227 | Ga0496107_0077875 | |||
| 1228 | Ga0496108_0036540 | |||
| 1229 | Ga0496108_0247411 | |||
| 1230 | Ga0496109_0086032 | |||
| 1231 | Ga0496110_0397006 | |||
| 1232 | Ga0496111_0226472 | |||
| 1233 | Ga0496112_0080942 | |||
| 1234 | Ga0496112_0484864 | |||
| 1235 | Ga0496113_0265711 | |||
| 1236 | Ga0496113_0376540 | |||
| 1237 | Ga0496114_0105195 | |||
| 1238 | Ga0496115_0012837 | |||
| 1239 | Ga0496115_0035582 | |||
| 1240 | Ga0496115_0473385 | |||
| 1241 | Ga0496115_0591971 | |||
| 1242 | Ga0496116_0285380 | |||
| 1243 | Ga0496117_0104996 | |||
| 1244 | Ga0496117_0109006 | |||
| 1245 | Ga0496118_0055077 | |||
| 1246 | Ga0496118_0105880 | |||
| 1247 | Ga0496118_0129484 | |||
| 1248 | Ga0496118_0191564 | |||
| 1249 | Ga0496119_0016898 | |||
| 1250 | Ga0496120_0014560 | |||
| 1251 | Ga0496120_0103535 | |||
| 1252 | Ga0496121_0000578 | |||
| 1253 | Ga0496121_0023197 | |||
| 1254 | Ga0496121_0054532 | |||
| 1255 | Ga0496121_0130855 | |||
| 1256 | Ga0496121_0133133 | |||
| 1257 | Ga0496121_0412282 | |||
| 1258 | Ga0496122_0099059 | |||
| 1259 | Ga0496124_0052546 | |||
| 1260 | Ga0496124_0367582 | |||
| 1261 | Ga0496125_0058502 | |||
| 1262 | Ga0496125_0067015 | |||
| 1263 | Ga0496126_0000602 | |||
| 1264 | Ga0496126_0189002 | |||
| 1265 | Ga0496126_0221248 | |||
| 1266 | Ga0495682_0003878 | |||
| 1267 | Ga0495682_0064290 | |||
| 1268 | Ga0501040_0702627 | |||
| 1269 | Ga0501072_0535080 | |||
| 1270 | nmdc:mga03683_130253_c1 | |||
| 1271 | nmdc:mga03683_71562_c1 | |||
| 1272 | nmdc:mga00v17_358641_c1 | |||
| 1273 | nmdc:mga0yw44_12388_c1 | |||
| 1274 | nmdc:mga0yw44_16942_c1 | |||
| 1275 | nmdc:mga0yw44_234702_c1 | |||
| 1276 | nmdc:mga0yw44_40131_c1 | |||
| 1277 | nmdc:mga06z11_252731_c1 | |||
| 1278 | nmdc:mga07m45_127364_c1 | |||
| 1279 | nmdc:mga05p37_50930_c1 | |||
| 1280 | nmdc:mga09592_100731_c1 | |||
| 1281 | nmdc:mga0qj67_91233_c1 | |||
| 1282 | nmdc:mga06r32_339688_c1 | |||
| 1283 | nmdc:mga06r32_485502_c1 | |||
| 1284 | nmdc:mga08y16_435805_c1 | |||
| 1285 | nmdc:mga08y16_665035_c1 | |||
| 1286 | nmdc:mga0n895_966492_c1 | |||
| 1287 | nmdc:mga0sz30_104776_c1 | |||
| 1288 | nmdc:mga0sz30_77414_c1 | |||
| 1289 | Ga0495601_0334338 | |||
| 1290 | Ga0495612_0117178 | |||
| 1291 | Ga0495595_0105664 | |||
| 1292 | Ga0495619_0496058 | |||
| 1293 | Ga0500578_0081890 | |||
| 1294 | Ga0500643_013742 | |||
| 1295 | Ga0500646_0066429 | |||
| 1296 | Ga0500646_0066853 | |||
| 1297 | Ga0500583_0054842 | |||
| 1298 | Ga0500651_0057494 | |||
| 1299 | Ga0500566_0000750 | |||
| 1300 | Ga0500650_0253236 | |||
| 1301 | Ga0500555_001349 | |||
| 1302 | Ga0500555_002647 | |||
| 1303 | Ga0500556_0073286 | |||
| 1304 | Ga0500556_0096857 | |||
| 1305 | Ga0500562_003675 | |||
| 1306 | Ga0500562_005493 | |||
| 1307 | Ga0500569_050120 | |||
| 1308 | Ga0500572_028763 | |||
| 1309 | Ga0500592_013180 | |||
| 1310 | Ga0500595_025573 | |||
| 1311 | Ga0500607_055531 | |||
| 1312 | Ga0500626_039862 | |||
| 1313 | Ga0500655_033916 | |||
| 1314 | Ga0500658_0176213 | |||
| 1315 | Ga0500559_0017034 | |||
| 1316 | Ga0500559_0021721 | |||
| 1317 | Ga0500561_0061702 | |||
| 1318 | Ga0500564_038903 | |||
| 1319 | Ga0500568_0006097 | |||
| 1320 | Ga0500568_0052991 | |||
| 1321 | Ga0500604_0020158 | |||
| 1322 | Ga0500616_0043940 | |||
| 1323 | Ga0500619_065754 | |||
| 1324 | Ga0500622_0004648 | |||
| 1325 | Ga0500638_099660 | |||
| 1326 | Ga0500636_0000041 | |||
| 1327 | Ga0500636_0125146 | |||
| 1328 | Ga0500636_0160528 | |||
| 1329 | Ga0500611_037853 | |||
| 1330 | Ga0500599_013677 | |||
| 1331 | Ga0500601_000017 | |||
| 1332 | Ga0500661_002403 | |||
| 1333 | Ga0530510_0621961 | |||
| 1334 | 2508692900 | |||
| 1335 | 2513621634 | |||
| 1336 | 2513636924 | |||
| 1337 | 2513651132 | |||
| 1338 | 2513700664 | |||
| 1339 | 2513878374 | |||
| 1340 | 2514011696 | |||
| 1341 | 2515626289 | |||
| 1342 | 2517107834 | |||
| 1343 | 2528852894 | |||
| 1344 | 2600204154 | |||
| 1345 | 2617351829 | |||
| 1346 | 2753767083 | |||
| 1347 | 2793061098 | |||
| 1348 | 2805920597 | |||
| 1349 | 2818236788 | |||
| 1350 | 2824605675 | |||
| 1351 | 2824611763 | |||
| 1352 | 2824622019 | |||
| 1353 | 2824629283 | |||
| 1354 | 2824639184 | |||
| 1355 | 2824650374 | |||
| 1356 | 2824654999 | |||
| 1357 | 2824662249 | |||
| 1358 | 2824664051 | |||
| 1359 | 2824675221 | |||
| 1360 | 2824681557 | |||
| 1361 | 2824690031 | |||
| 1362 | 2824701166 | |||
| 1363 | 2824711137 | |||
| 1364 | 2824720915 | |||
| 1365 | 2824729793 | |||
| 1366 | 2824760435 | |||
| 1367 | 2824766576 | |||
| 1368 | 2824776697 | |||
| 1369 | 2838127354 | |||
| 1370 | 2841946373 | |||
| 1371 | 2841957092 | |||
| 1372 | 2841965612 | |||
| 1373 | 2841972883 | |||
| 1374 | 2841978445 | |||
| 1375 | 2841987453 | |||
| 1376 | 2842336381 | |||
| 1377 | 2844320231 | |||
| 1378 | 2847947978 | |||
| 1379 | 2849078174 | |||
| 1380 | 2874598560 | |||
| 1381 | 2874616747 | |||
| 1382 | 2874628305 | |||
| 1383 | 2874630099 | |||
| 1384 | 2874632555 | |||
| 1385 | 2874652013 | |||
| 1386 | 2876768311 | |||
| 1387 | 2876778598 | |||
| 1388 | 2876823403 | |||
| 1389 | 2879082391 | |||
| 1390 | 2879107397 | |||
| 1391 | 2879107949 | |||
| 1392 | 2879131828 | |||
| 1393 | 2879150164 | |||
| 1394 | 2881370130 | |||
| 1395 | 2881669087 | |||
| 1396 | 2885414391 | |||
| 1397 | 2888385711 | |||
| 1398 | 2888392562 | |||
| 1399 | 2888425828 | |||
| 1400 | 2903731179 | |||
| 1401 | 2904674076 | |||
| 1402 | 2904711726 | |||
| 1403 | 2906610054 | |||
| 1404 | 2906631839 | |||
| 1405 | 2906648434 | |||
| 1406 | 2922375959 | |||
| 1407 | 2922396842 | |||
| 1408 | 2929621269 | |||
| 1409 | 2929625900 | |||
| 1410 | 2932785216 | |||
| 1411 | 2932797108 | |||
| 1412 | 2932799668 | |||
| 1413 | 2932807456 | |||
| 1414 | 2932808744 | |||
| 1415 | 2932810249 | |||
| 1416 | 2932816190 | |||
| 1417 | 2932819592 | |||
| 1418 | 2932821821 | |||
| 1419 | 2932829052 | |||
| 1420 | 2932836219 | |||
| 1421 | 2933582862 | |||
| 1422 | 2935610054 | |||
| 1423 | 2935616964 | |||
| 1424 | 2935619528 | |||
| 1425 | 2935636326 | |||
| 1426 | 2935638508 | |||
| 1427 | 2935656339 | |||
| 1428 | 2935660105 | |||
| 1429 | 2935666640 | |||
| 1430 | 2935675277 | |||
| 1431 | 2935682171 | |||
| 1432 | 2935691175 | |||
| 1433 | 2935694401 | |||
| 1434 | 2935703514 | |||
| 1435 | 2935711715 | |||
| 1436 | 2935718556 | |||
| 1437 | 2935727464 | |||
| 1438 | 2935736167 | |||
| 1439 | 2935745547 | |||
| 1440 | 2935755928 | |||
| 1441 | 2935760808 | |||
| 1442 | 2935776462 | |||
| 1443 | 2935780857 | |||
| 1444 | 2935792313 | |||
| 1445 | 2935800512 | |||
| 1446 | 2935801651 | |||
| 1447 | 2935810139 | |||
| 1448 | 2935813738 | |||
| 1449 | 2935814939 | |||
| 1450 | 2935823214 | |||
| 1451 | 2935828002 | |||
| 1452 | 2935842207 | |||
| 1453 | 2935848796 | |||
| 1454 | 2935855588 | |||
| 1455 | 2935858156 | |||
| 1456 | 2935867167 | |||
| 1457 | 2935868061 | |||
| 1458 | 2935870063 | |||
| 1459 | 2935873916 | |||
| 1460 | 2935876013 | |||
| 1461 | 2935885673 | |||
| 1462 | 2935909404 | |||
| 1463 | 2935917126 | |||
| 1464 | 2935926885 | |||
| 1465 | 2935937271 | |||
| 1466 | 2935944426 | |||
| 1467 | 2935952863 | |||
| 1468 | 2935962927 | |||
| 1469 | 2935969703 | |||
| 1470 | 2935976313 | |||
| 1471 | 2935991844 | |||
| 1472 | 2935993160 | |||
| 1473 | 2936003097 | |||
| 1474 | 2936003954 | |||
| 1475 | 2936014521 | |||
| 1476 | 2936027812 | |||
| 1477 | 2936031282 | |||
| 1478 | 2936040418 | |||
| 1479 | 2936042910 | |||
| 1480 | 2936049627 | |||
| 1481 | 2936061157 | |||
| 1482 | 2940562097 | |||
| 1483 | 2941512957 | |||
| 1484 | 2941520741 | |||
| 1485 | 2941528756 | |||
| 1486 | 2941531420 | |||
| 1487 | 2941542256 | |||
| 1488 | 3000019049 | |||
| 1489 | 3005488462 | |||
| 1490 | 3005712811 | |||
| 1491 | 3005723367 | |||
| 1492 | 8006930086 | |||
| 1493 | 8016520408 | |||
| 1494 | 8016521610 | |||
| 1495 | 8016528482 | |||
| 1496 | 8016533638 | |||
| 1497 | 8016546862 | |||
| 1498 | 8016555255 | |||
| 1499 | 8016563617 | |||
| 1500 | 8016576177 | |||
| 1501 | 8016601352 | |||
| 1502 | 8016609076 | |||
| 1503 | 8016615829 | |||
| 1504 | 8016625407 | |||
| 1505 | 8016631164 | |||
| 1506 | 8016638929 | |||
| 1507 | 8017064030 | |||
| 1508 | 8017065166 | |||
| 1509 | 8019533422 | |||
| 1510 | 8019546254 | |||
| 1511 | 8019552452 | |||
| 1512 | 8019565953 | |||
| 1513 | 8019583351 | |||
| 1514 | 8019584558 | |||
| 1515 | 8019591163 | |||
| 1516 | 8019592331 | |||
| 1517 | 8019600175 | |||
| 1518 | 8019618366 | |||
| 1519 | 8019620043 | |||
| 1520 | 8019633063 | |||
| 1521 | 8019646845 | |||
| 1522 | 8019649613 | |||
| 1523 | 8019660943 | |||
| 1524 | 8019670502 | |||
| 1525 | 8019685731 | |||
| 1526 | 8019691303 | |||
| 1527 | 8055744870 | |||
| 1528 | 8056974836 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cub-assembly1.cif.gz_C | 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane | 0.8738 | 35 | 214 |
| 2yev-assembly2.cif.gz_A | structure of caa3-type cytochrome oxidase | 0.8524 | 52 | 208 |
| 7cub-assembly1.cif.gz_C | 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane | 0.8518 | 35 | 214 |
| 6x8n-assembly2.cif.gz_B | crystal structure of h49a able mutant | 0.8379 | 78 | 208 |
| 8hcr-assembly1.cif.gz_S | cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci | 0.8314 | 39 | 211 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WP67_20_203_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8382 | 39 | 211 | 1.20.120.80 |
| af_Q2FZK1_13_198_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8378 | 32 | 215 | 1.20.120.80 |
| af_Q2FZK1_13_198_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8254 | 32 | 215 | 1.20.120.80 |
| 3u8vA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);IL-4 antagonist (De novo design) like domain | 0.7987 | 84 | 197 | 1.20.120.660 |
| 2yevD03 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.7966 | 25 | 208 | 1.20.120.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A316WCB9-F1-model_v4 | Cytochrome o ubiquinol oxidase subunit III | 0.9655 | 65 | 211 |
GO:0004129
GO:0005886 GO:0019646 |
| AF-A0A5U6TQ07-F1-model_v4 | Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) | 0.9577 | 71 | 214 |
GO:0004129
GO:0005886 GO:0009486 GO:0019646 |
| AF-X8DTB9-F1-model_v4 | Probable cytochrome c oxidase subunit 3 (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) | 0.9516 | 85 | 211 |
GO:0004129
GO:0005886 GO:0019646 |
| AF-A0A5U6TQ07-F1-model_v4 | Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) | 0.9387 | 71 | 214 |
GO:0004129
GO:0005886 GO:0009486 GO:0019646 |
| AF-A0A828R4C7-F1-model_v4 | deleted | 0.9373 | 56 | 214 |
|