F479746

General Info

Members Datasets Scaffolds Average Seq Length
764 646 349 279

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0040390|Ga0495633_0040390_242_1183
Length 313
Sequence MLRLHGHVSFISGQMSYLLDGCGLDIEDKDHIMQDAIPTTAFPSGKTVPVLGQGTWHMGERKTSASEEAKCLRHGLDLGMTLIDTAEMYADGGAERIVAEAIRGRRNDAFLVSKVLPSNASRDGTVKACEASLKRLGTDHIDLYLLHWRGRYRLAETVEAFETLRQAGKIGAWGVSNFDTDDMEELLGVPDGGNVAANQVLYNLARRGIEYDLLKDSQMRGIPVMAYSPLDEGRLLRHPDLIHIAKAHQATVAQVALAFLIRNPGVIVIPKTGMPERVRENRAAVEVHLTDDDLAILDRAFPPPGRKMPLEMI

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
11 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
14 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
15 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
16 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
17 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
18 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
19 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
20 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
21 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
22 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
23 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
24 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
25 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
26 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
27 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
28 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
29 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
30 2516143018 Ensifer sp. BR816 Isolate Nodule
31 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
32 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
33 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
34 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
35 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
36 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
37 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
38 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
39 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
40 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
41 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
42 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
43 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
44 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
45 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
46 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
47 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
48 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
49 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
50 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
51 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
52 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
53 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
54 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
55 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
56 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
57 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
58 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
59 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
60 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
61 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
62 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
63 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
64 2643221607 Rhizobium sp. Root73 Isolate Unclassified
65 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
66 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
67 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
68 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
69 2643221688 Rhizobium sp. Root482 Isolate Unclassified
70 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
71 2643221718 Rhizobium sp. Root268 Isolate Unclassified
72 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
73 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
74 2718217882 Rhizobium sp. N741 Isolate Nodule
75 2718217927 Rhizobium sp. N324 Isolate Nodule
76 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
77 2718218009 Rhizobium sp. N561 Isolate Nodule
78 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
79 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
80 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
81 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
82 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
83 2718218363 Rhizobium sp. N113 Isolate Nodule
84 2718218365 Rhizobium sp. N731 Isolate Nodule
85 2718218366 Rhizobium sp. N621 Isolate Nodule
86 2718218423 Rhizobium sp. N941 Isolate Nodule
87 2721755514 Rhizobium sp. N6212 Isolate Nodule
88 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
89 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
90 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
91 2721755809 Rhizobium sp. N541 Isolate Nodule
92 2721755810 Rhizobium sp. N871 Isolate Nodule
93 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
94 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
95 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
96 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
97 2728369365 Rhizobium sp. N1341 Isolate Nodule
98 2728369397 Rhizobium sp. N1314 Isolate Nodule
99 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
100 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
101 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
102 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
103 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
104 2791355256 Rhizobium sp. M10 Isolate Nodule
105 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
106 2791355260 Rhizobium sp. L9 Isolate Nodule
107 2791355261 Rhizobium sp. J15 Isolate Nodule
108 2791355262 Rhizobium sp. M1 Isolate Nodule
109 2791355263 Rhizobium chutanense C5 Isolate Nodule
110 2791355264 Rhizobium sp. S9 Isolate Nodule
111 2791355265 Rhizobium sp. H4 Isolate Nodule
112 2791355266 Rhizobium sp. L43 Isolate Nodule
113 2791355267 Rhizobium sp. L18 Isolate Nodule
114 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
115 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
116 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
117 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
118 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
119 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
120 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
121 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
122 2802429633 Rhizobium anhuiense J3 Isolate Nodule
123 2802429634 Rhizobium anhuiense S10 Isolate Nodule
124 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
125 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
126 2802429637 Rhizobium anhuiense C15 Isolate Nodule
127 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
128 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
129 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
130 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
131 2838048938 Rhizobium pisi 27/80 Isolate Nodule
132 2838061910 Rhizobium phaseoli L15 Isolate Nodule
133 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
134 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
135 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
136 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
137 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
138 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
139 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
140 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
141 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
142 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
143 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
144 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
145 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
146 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
147 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
148 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
149 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
150 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
151 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
152 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
153 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
154 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
155 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
156 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
157 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
158 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
159 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
160 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
161 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
162 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
163 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
164 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
165 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
166 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
167 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
168 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
169 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
170 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
171 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
172 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
173 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
174 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
175 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
176 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
177 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
178 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
179 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
180 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
181 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
182 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
183 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
184 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
185 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
186 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
187 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
188 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
189 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
190 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
191 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
192 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
193 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
194 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
195 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
196 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
197 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
198 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
199 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
200 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
201 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
202 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
203 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
204 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
205 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
206 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
207 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
208 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
209 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
210 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
211 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
212 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
213 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
214 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
215 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
216 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
217 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
218 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
219 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
220 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
221 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
222 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
223 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
224 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
225 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
226 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
227 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
228 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
229 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
230 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
231 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
232 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
233 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
234 2933599457 Rhizobium phaseoli M3 Isolate Nodule
235 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
236 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
237 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
238 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
239 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
240 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
241 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
242 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
243 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
244 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
245 2936381700 Rhizobium chutanense C16 Isolate Unclassified
246 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
247 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
248 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
249 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
250 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
251 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
252 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
253 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
254 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
255 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
256 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
257 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
258 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
259 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
260 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
261 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
262 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
263 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
264 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
265 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
266 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
267 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
268 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
269 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
270 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
271 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
272 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
273 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
274 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
275 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
276 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
277 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
278 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
279 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
280 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
281 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
282 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
283 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
284 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
285 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
286 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
287 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
288 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
289 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
290 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
291 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
292 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
293 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
294 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
295 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
296 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
297 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
298 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
299 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
300 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
301 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
302 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
303 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
304 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
305 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
306 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
307 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
308 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
309 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
310 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
311 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
312 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
313 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
314 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
315 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
316 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
317 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
318 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
319 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
320 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
321 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
322 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
323 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
324 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
325 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
326 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
327 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
328 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
329 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
330 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
331 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
332 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
333 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
334 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
335 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
336 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
337 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
338 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
339 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
340 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
341 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
342 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
343 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
344 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
345 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
346 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
347 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
348 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
349 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
350 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
351 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
352 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
353 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
354 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
355 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
356 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
357 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
358 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
359 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
360 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
361 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
362 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
363 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
364 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
365 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
366 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
367 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
368 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
369 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
370 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
371 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
372 2996893221 Rhizobium sp. R635 Isolate Nodule
373 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
374 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
375 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
376 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
377 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
378 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
379 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
380 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
381 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
382 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
383 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
384 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
385 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
386 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
387 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
388 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
389 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
390 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
391 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
392 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
393 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
394 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
395 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
396 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
397 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
398 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
399 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
400 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
401 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
402 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
403 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
404 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
405 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
406 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
407 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
408 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
409 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
410 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
411 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
412 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
413 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
414 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
415 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
416 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
417 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
418 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
419 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
420 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
421 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
422 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
423 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
424 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
425 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
426 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
427 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
428 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
429 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
430 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
431 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
432 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
433 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
434 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
435 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
436 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
437 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
438 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
439 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
440 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
441 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
442 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
443 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
444 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
445 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
446 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
447 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
448 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
449 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
450 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
451 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
452 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
453 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
454 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
455 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
456 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
457 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
458 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
459 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
460 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
461 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
462 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
463 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
464 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
465 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
466 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
481 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
482 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
484 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
485 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
486 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
487 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
488 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
489 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
490 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
491 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
492 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
493 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
494 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
495 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
496 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
497 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
498 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
499 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
500 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
501 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
502 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
503 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
504 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
505 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
506 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
507 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
508 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
509 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
510 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
511 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
512 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
513 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
514 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
515 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
516 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
517 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
518 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
519 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
520 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
521 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
522 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
523 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
524 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
525 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
526 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
527 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
528 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
529 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
530 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
531 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
532 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
533 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
534 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
535 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
536 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
537 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
538 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
539 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
540 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
541 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
542 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
543 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
544 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
545 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
546 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
547 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
548 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
549 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
550 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
551 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
552 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
553 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
554 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
555 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
556 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
557 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
558 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
559 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
560 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
561 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
562 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
563 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
564 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
565 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
566 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
567 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
568 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
569 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
570 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
571 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
572 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
573 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
574 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
575 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
576 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
577 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
578 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
579 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
580 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
581 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
582 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
583 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
584 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
585 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
586 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
587 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
588 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
589 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
590 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
591 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
592 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
593 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
594 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
595 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
596 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
597 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
598 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
599 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
600 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
601 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
602 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
603 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
604 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
605 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
606 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
607 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
608 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
609 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
610 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
611 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
612 8005275841 Rhizobium sp. N4311 Isolate Nodule
613 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
614 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
615 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
616 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
617 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
618 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
619 8005382845 Rhizobium sp. R634 Isolate Nodule
620 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
621 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
622 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
623 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
624 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
625 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
626 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
627 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
628 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
629 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
630 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
631 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
632 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
633 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
634 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
635 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
636 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
637 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
638 8018176218 Rhizobium sp. N122 Isolate Nodule
639 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
640 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
641 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
642 8024501048 Rhizobium sp. H4 Isolate Nodule
643 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
644 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
645 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
646 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.55
Metatranscriptomes 0.13
Isolates 54.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.96
Nodule 48.17
Rhizoplane 1.44
Rhizosphere 25.92
Stem 0
Stem Tuber 0
Unclassified 11.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10032326 3300001979 Bacteria 1675
2 JGI25155J39150_1000001 3300002704 Bacteria 354543
3 JGI25156J39149_1000001 3300002705 Bacteria 354557
4 JGI25162J39368_1000380 3300002737 Bacteria 37780
5 JGI25162J39368_1003103 3300002737 Bacteria 5290
6 JGI25154J39366_1000011 3300002738 Bacteria 296007
7 JGI25158J39367_1000336 3300002739 Bacteria 10357
8 JGI25157J39369_1000079 3300002741 Bacteria 86111
9 JGI25152J39213_1001866 3300002773 Bacteria 8488
10 JGI25152J39213_1010120 3300002773 Bacteria 2182
11 JGI25150J39212_1006463 3300002774 Bacteria 2416
12 JGI25159J45721_1000613 3300002987 Bacteria 15891
13 JGI25151J46595_10000802 3300003187 Bacteria 25191
14 JGI25165J46597_1000422 3300003214 Bacteria 43957
15 JGI25165J46597_1001018 3300003214 Bacteria 18487
16 JGI25153J46596_10012453 3300003215 Bacteria 3669
17 JGI25153J46596_10021072 3300003215 Bacteria 2440
18 JGI25153J46596_10026848 3300003215 Bacteria 2029
19 rootH2_10087331 3300003320 Bacteria 2004
20 rootL2_10027391 3300003322 Bacteria 3438
21 JGI25160J50197_1000001 3300003354 Bacteria 782301
22 JGI25160J50197_1003427 3300003354 Bacteria 7103
23 JGI25160J50197_1013773 3300003354 Bacteria 2739
24 JGI25161J50226_1000001 3300003374 Bacteria 655036
25 JGI25161J50226_1000099 3300003374 Bacteria 70186
26 JGI25161J50226_1000140 3300003374 Bacteria 50175
27 JGI25161J50226_1004634 3300003374 Bacteria 2832
28 Ga0055526_1000484 3300003771 Bacteria 31547
29 Ga0055524_1004689 3300003775 Bacteria 6264
30 Ga0055524_1015223 3300003775 Bacteria 2814
31 Ga0055524_1020876 3300003775 Bacteria 2191
32 Ga0055524_1034503 3300003775 Bacteria 1398
33 Ga0055528_1003598 3300003790 Bacteria 7716
34 Ga0055528_1011411 3300003790 Bacteria 3531
35 Ga0055528_1013658 3300003790 Bacteria 3061
36 Ga0055528_1023519 3300003790 Bacteria 1877
37 Ga0055528_1027241 3300003790 Bacteria 1615
38 Ga0055540_1000283 3300003792 Bacteria 45546
39 Ga0055540_1006077 3300003792 Bacteria 4876
40 Ga0055540_1016188 3300003792 Bacteria 2134
41 Ga0058692_1010762 3300003856 Bacteria 2248
42 Ga0055543_1000003 3300004625 Bacteria 358656
43 Ga0055543_1000128 3300004625 Bacteria 63029
44 Ga0055543_1000499 3300004625 Bacteria 22628
45 Ga0065165_1000068 3300005262 Bacteria 170609
46 Ga0070670_100004125 3300005331 Bacteria 12142
47 Ga0070677_10094309 3300005333 Bacteria 1308
48 Ga0070671_100043123 3300005355 Bacteria 3750
49 Ga0070674_100121698 3300005356 Bacteria 1933
50 Ga0070673_100149384 3300005364 Bacteria 1978
51 Ga0070688_100162320 3300005365 Bacteria 1536
52 Ga0070708_100119389 3300005445 Bacteria 2430
53 Ga0070663_100154358 3300005455 Bacteria 1763
54 Ga0070662_100257705 3300005457 Bacteria 1404
55 Ga0068867_100012838 3300005459 Bacteria 5928
56 Ga0070707_100270306 3300005468 Bacteria 1653
57 Ga0070698_100014394 3300005471 Bacteria 8357
58 Ga0070699_100020906 3300005518 Bacteria 5644
59 Ga0070697_100037114 3300005536 Bacteria 3936
60 Ga0070695_100032221 3300005545 Bacteria 3276
61 Ga0070696_100007560 3300005546 Bacteria 7266
62 Ga0068855_100032235 3300005563 Bacteria 6257
63 Ga0068855_100037684 3300005563 Bacteria 5748
64 Ga0068856_100020971 3300005614 Bacteria 6350
65 Ga0068856_100493792 3300005614 Bacteria 1245
66 Ga0068852_100053881 3300005616 Bacteria 3464
67 Ga0068858_100000826 3300005842 Bacteria 32308
68 Ga0075365_10031412 3300006038 Bacteria 3407
69 Ga0075367_10132302 3300006178 Bacteria 1542
70 Ga0075369_10000132 3300006186 Bacteria 20799
71 Ga0075369_10020015 3300006186 Bacteria 2738
72 Ga0075366_10052173 3300006195 Bacteria 2430
73 Ga0075370_10021568 3300006353 Bacteria 3529
74 Ga0068865_100040624 3300006881 Bacteria 3163
75 Ga0099795_10005812 3300007788 Bacteria 3316
76 Ga0099795_10037779 3300007788 Bacteria 1701
77 Ga0105240_10013633 3300009093 Bacteria 11146
78 Ga0105240_10099268 3300009093 Bacteria 3544
79 Ga0111539_10290318 3300009094 Bacteria 1903
80 Ga0105243_10365609 3300009148 Bacteria 1329
81 Ga0105242_10008311 3300009176 Bacteria 7973
82 Ga0105238_10014845 3300009551 Bacteria 7881
83 Ga0105238_10132061 3300009551 Bacteria 2475
84 Ga0105238_10221240 3300009551 Bacteria 1869
85 Ga0105238_10422202 3300009551 Bacteria 1328
86 Ga0105238_10636988 3300009551 Bacteria 1075
87 Ga0123341_1000032 3300009765 Bacteria 62527
88 Ga0123342_1005565 3300009766 Bacteria 18132
89 Ga0123342_1021015 3300009766 Bacteria 4659
90 Ga0099796_10002885 3300010159 Bacteria 3874
91 Ga0157322_1001841 3300012490 Bacteria 1120
92 Ga0157373_10199326 3300013100 Bacteria 1411
93 Ga0157371_10117615 3300013102 Bacteria 1889
94 Ga0157370_10259033 3300013104 Bacteria 1608
95 Ga0157369_10017208 3300013105 Bacteria 8125
96 Ga0157374_10282399 3300013296 Bacteria 1639
97 Ga0163162_10009958 3300013306 Bacteria 9247
98 Ga0157372_10000281 3300013307 Bacteria 56476
99 Ga0157372_10203408 3300013307 Bacteria 2294
100 Ga0157380_10190061 3300014326 Bacteria 1812
101 Ga0157379_10021629 3300014968 Bacteria 5696
102 Ga0214543_1000038 3300021327 Bacteria 182106
103 Ga0213876_10009177 3300021384 Bacteria 5325
104 Ga0228711_1000008 3300022739 Bacteria 169893
105 Ga0228710_1000009 3300022740 Bacteria 169770
106 Ga0209435_100012 3300025206 Bacteria 401621
107 Ga0209437_100047 3300025233 Bacteria 405163
108 Ga0209437_100242 3300025233 Bacteria 89060
109 Ga0207425_1008702 3300025245 Bacteria 2575
110 Ga0209646_1000026 3300025246 Bacteria 401621
111 Ga0209026_1000014 3300025250 Bacteria 401621
112 Ga0209759_1000012 3300025256 Bacteria 401621
113 Ga0209129_1001312 3300025258 Bacteria 14088
114 Ga0209129_1012421 3300025258 Bacteria 1954
115 Ga0209233_1000048 3300025261 Bacteria 453669
116 Ga0209233_1000069 3300025261 Bacteria 367639
117 Ga0209673_1000977 3300025273 Bacteria 35281
118 Ga0209673_1001611 3300025273 Bacteria 19722
119 Ga0209673_1003210 3300025273 Bacteria 9902
120 Ga0209673_1005688 3300025273 Bacteria 6218
121 Ga0209673_1025068 3300025273 Bacteria 1990
122 Ga0209130_1000003 3300025284 Bacteria 677988
123 Ga0209130_1000020 3300025284 Bacteria 379297
124 Ga0209025_1000058 3300025294 Bacteria 311398
125 Ga0209025_1000140 3300025294 Bacteria 184765
126 Ga0209025_1005836 3300025294 Bacteria 9857
127 Ga0209025_1062058 3300025294 Bacteria 1389
128 Ga0209564_1001530 3300025295 Bacteria 22948
129 Ga0209564_1009212 3300025295 Bacteria 4736
130 Ga0209564_1018866 3300025295 Bacteria 2604
131 Ga0209758_1002719 3300025297 Bacteria 17418
132 Ga0209758_1002951 3300025297 Bacteria 16327
133 Ga0209050_1010611 3300025298 Bacteria 4508
134 Ga0209256_1009135 3300025299 Bacteria 4411
135 Ga0209256_1010112 3300025299 Bacteria 4012
136 Ga0209256_1020294 3300025299 Bacteria 2079
137 Ga0209256_1027822 3300025299 Bacteria 1605
138 Ga0207426_1000008 3300025302 Bacteria 848730
139 Ga0207426_1000011 3300025302 Bacteria 791203
140 Ga0207426_1000221 3300025302 Bacteria 134756
141 Ga0207426_1000946 3300025302 Bacteria 28694
142 Ga0207426_1002076 3300025302 Bacteria 13895
143 Ga0209051_1000308 3300025303 Bacteria 76477
144 Ga0209051_1002748 3300025303 Bacteria 12192
145 Ga0209051_1004871 3300025303 Bacteria 8059
146 Ga0209257_1000853 3300025304 Bacteria 43617
147 Ga0207680_10228324 3300025903 Bacteria 1279
148 Ga0207647_10204089 3300025904 Bacteria 1143
149 Ga0207705_10017799 3300025909 Bacteria 5082
150 Ga0207695_10012059 3300025913 Bacteria 10392
151 Ga0207695_10567216 3300025913 Bacteria 1016
152 Ga0207660_10395828 3300025917 Bacteria 1112
153 Ga0207652_10062946 3300025921 Bacteria 3207
154 Ga0207646_10509159 3300025922 Bacteria 1084
155 Ga0207694_10274792 3300025924 Bacteria 1382
156 Ga0207694_10422502 3300025924 Bacteria 1110
157 Ga0207650_10012844 3300025925 Bacteria 5787
158 Ga0207644_10147752 3300025931 Bacteria 1816
159 Ga0207690_10177977 3300025932 Bacteria 1599
160 Ga0207706_10311865 3300025933 Bacteria 1370
161 Ga0207704_10114673 3300025938 Bacteria 1830
162 Ga0207711_10091151 3300025941 Bacteria 2681
163 Ga0207703_10010408 3300026035 Bacteria 7276
164 Ga0207639_10156720 3300026041 Bacteria 1914
165 Ga0207678_10240922 3300026067 Bacteria 1549
166 Ga0207702_10272557 3300026078 Bacteria 1597
167 Ga0207648_10138628 3300026089 Bacteria 2143
168 Ga0207698_10124528 3300026142 Bacteria 2189
169 Ga0209281_1000106 3300027111 Bacteria 219666
170 Ga0209281_1000426 3300027111 Bacteria 62651
171 Ga0209371_1007288 3300027312 Bacteria 3884
172 Ga0209282_1000024 3300027666 Bacteria 170348
173 Ga0209813_10014135 3300027866 Bacteria 2144
174 Ga0307515_10000307 3300028794 Bacteria 121172
175 Ga0307515_10000788 3300028794 Bacteria 72975
176 Ga0307515_10017597 3300028794 Bacteria 13001
177 Ga0268256_1007489 3300030500 Bacteria 3884
178 Ga0307513_10025659 3300031456 Bacteria 6820
179 Ga0315914_1000012 3300031967 Bacteria 169896
180 Ga0307414_10082671 3300032004 Bacteria 2355
181 Ga0315913_1000006 3300033430 Bacteria 169893
182 Ga0315915_1000010 3300033464 Bacteria 240214
183 Ga0373952_0052026 3300035092 Bacteria 979
184 Ga0373931_0177540 3300035691 Bacteria 1259
185 Ga0395905_0108798 3300037471 Bacteria 2602
186 Ga0436364_0695814 3300037853 Bacteria 2365
187 Ga0436365_1323176 3300039437 Bacteria 3703
188 Ga0436365_1451141 3300039437 Bacteria 1716
189 Ga0439436_0001576 3300041404 Bacteria 6644
190 Ga0439447_037014 3300041407 Bacteria 1204
191 Ga0439466_0072479 3300041411 Bacteria 1095
192 Ga0439465_0004189 3300041413 Bacteria 4692
193 Ga0439465_0041310 3300041413 Bacteria 1492
194 Ga0451833_0373356 3300041491 Bacteria 1667
195 Ga0451837_0308128 3300041494 Bacteria 3100
196 Ga0451839_0409093 3300041496 Bacteria 3678
197 Ga0451841_0501270 3300041498 Bacteria 2985
198 Ga0451846_41223 3300041502 Bacteria 1366
199 Ga0451851_1283930 3300041507 Bacteria 1814
200 Ga0451855_0678343 3300041511 Bacteria 961
201 Ga0439432_074279 3300042006 Bacteria 1034
202 Ga0439449_0008427 3300042007 Bacteria 3918
203 Ga0439449_0048440 3300042007 Bacteria 1573
204 Ga0439449_0092340 3300042007 Bacteria 1118
205 Ga0439457_041111 3300042014 Bacteria 1030
206 Ga0450906_004190 3300042145 Bacteria 3040
207 Ga0439434_0009578 3300042435 Bacteria 2850
208 Ga0451577_0128334 3300042876 Bacteria 2274
209 Ga0466966_0254370 3300044684 Bacteria 1058
210 Ga0466963_0006812 3300044694 Bacteria 6796
211 Ga0466970_0020090 3300044765 Bacteria 3466
212 Ga0466957_0036774 3300044842 Bacteria 2945
213 Ga0466958_0009384 3300045836 Bacteria 5453
214 Ga0466958_0167388 3300045836 Bacteria 1391
215 Ga0495638_0053703 3300046460 Bacteria 2508
216 Ga0495605_0204273 3300046474 Bacteria 860
217 Ga0495584_0162141 3300046491 Bacteria 1136
218 Ga0495585_0026571 3300046492 Bacteria 3307
219 Ga0495585_0045381 3300046492 Bacteria 2453
220 Ga0495596_0021263 3300046500 Bacteria 2650
221 Ga0495596_0056411 3300046500 Bacteria 1534
222 Ga0495607_0057110 3300046501 Bacteria 2238
223 Ga0495583_0039071 3300046506 Bacteria 2238
224 Ga0495583_0094691 3300046506 Bacteria 1282
225 Ga0495606_0002164 3300046507 Bacteria 23646
226 Ga0495606_0010451 3300046507 Bacteria 7701
227 Ga0495606_0107233 3300046507 Bacteria 1690
228 Ga0495610_0071551 3300046512 Bacteria 1617
229 Ga0495620_0027988 3300046515 Bacteria 2627
230 Ga0495620_0058422 3300046515 Bacteria 1614
231 Ga0495632_0095774 3300046519 Bacteria 1402
232 Ga0495643_0007771 3300046522 Bacteria 6862
233 Ga0495643_0015966 3300046522 Bacteria 4421
234 Ga0495648_0055191 3300046524 Bacteria 2396
235 Ga0495609_0037623 3300046538 Bacteria 2182
236 Ga0495597_0011360 3300046542 Bacteria 4320
237 Ga0495633_0012064 3300046558 Bacteria 4615
238 Ga0495633_0040390 3300046558 Bacteria 2223
239 Ga0495611_0017210 3300046648 Bacteria 3090
240 Ga0495625_0003972 3300046660 Bacteria 14184
241 Ga0495625_0040946 3300046660 Bacteria 3375
242 Ga0495625_0063735 3300046660 Bacteria 2602
243 Ga0495588_0043324 3300046674 Bacteria 2303
244 Ga0495670_0016423 3300046691 Bacteria 3638
245 Ga0495671_0035999 3300046692 Bacteria 2510
246 Ga0495660_0084057 3300046810 Bacteria 1665
247 Ga0495687_023598 3300047443 Bacteria 2936
248 Ga0495687_060379 3300047443 Bacteria 1564
249 Ga0495677_0004493 3300047445 Bacteria 5346
250 Ga0495673_0108615 3300047469 Bacteria 1112
251 Ga0495681_0064687 3300047470 Bacteria 1674
252 Ga0495681_0083166 3300047470 Bacteria 1425
253 Ga0495686_0000316 3300047472 Bacteria 80803
254 Ga0495686_0061119 3300047472 Bacteria 2340
255 Ga0495615_0006933 3300048090 Bacteria 2127
256 Ga0495626_0057653 3300048091 Bacteria 1777
257 Ga0496102_0033698 3300048905 Bacteria 4604
258 Ga0496104_0087495 3300048907 Bacteria 2975
259 Ga0496105_0014730 3300048908 Bacteria 6225
260 Ga0496106_0207084 3300048909 Bacteria 1562
261 Ga0496108_0092807 3300048911 Bacteria 2567
262 Ga0496109_0486152 3300048912 Bacteria 1165
263 Ga0496110_0011425 3300048913 Bacteria 7268
264 Ga0496113_0192147 3300048916 Bacteria 1620
265 Ga0496113_0254987 3300048916 Bacteria 1401
266 Ga0496113_0288066 3300048916 Bacteria 1314
267 Ga0496117_0041228 3300048920 Bacteria 3385
268 Ga0496117_0076711 3300048920 Bacteria 2214
269 Ga0496117_0216641 3300048920 Bacteria 1069
270 Ga0496119_0019449 3300048922 Bacteria 5001
271 Ga0496119_0117103 3300048922 Bacteria 1469
272 Ga0496120_0024294 3300048923 Bacteria 3781
273 Ga0496120_0070065 3300048923 Bacteria 1929
274 Ga0496121_0005561 3300048924 Bacteria 16097
275 Ga0496121_0026532 3300048924 Bacteria 5454
276 Ga0496121_0042223 3300048924 Bacteria 3971
277 Ga0496121_0078146 3300048924 Bacteria 2632
278 Ga0496121_0149743 3300048924 Bacteria 1719
279 Ga0496121_0259469 3300048924 Bacteria 1201
280 Ga0496122_0000190 3300048925 Bacteria 140376
281 Ga0496122_0097288 3300048925 Bacteria 1981
282 Ga0496122_0118972 3300048925 Bacteria 1709
283 Ga0496123_0001159 3300048926 Bacteria 39083
284 Ga0496123_0019000 3300048926 Bacteria 5432
285 Ga0496123_0036450 3300048926 Bacteria 3488
286 Ga0496124_0001702 3300048927 Bacteria 31109
287 Ga0496124_0011095 3300048927 Bacteria 9040
288 Ga0496124_0034478 3300048927 Bacteria 4441
289 Ga0496124_0046133 3300048927 Bacteria 3733
290 Ga0496125_0000273 3300048928 Bacteria 104663
291 Ga0496125_0027238 3300048928 Bacteria 5185
292 Ga0496125_0064881 3300048928 Bacteria 2898
293 Ga0496125_0106977 3300048928 Bacteria 2040
294 Ga0496126_0000589 3300048929 Bacteria 68753
295 Ga0496126_0030883 3300048929 Bacteria 5071
296 Ga0495678_107487 3300049459 Bacteria 957
297 Ga0495682_0000302 3300049460 Bacteria 37440
298 Ga0501032_0139355 3300049569 Bacteria 1597
299 Ga0501033_0019439 3300049570 Bacteria 5137
300 Ga0501033_0025357 3300049570 Bacteria 4465
301 Ga0501033_0033115 3300049570 Bacteria 3880
302 Ga0501033_0034506 3300049570 Bacteria 3794
303 Ga0501034_0009917 3300049571 Bacteria 9953
304 Ga0501034_0303410 3300049571 Bacteria 1533
305 Ga0501037_0054438 3300049573 Bacteria 2926
306 Ga0501037_0161424 3300049573 Bacteria 1597
307 Ga0501038_0167936 3300049574 Bacteria 1778
308 Ga0501039_0042062 3300049575 Bacteria 3530
309 Ga0501043_0189989 3300049579 Bacteria 1597
310 Ga0501047_0012932 3300049581 Bacteria 7904
311 Ga0501047_0121260 3300049581 Bacteria 2497
312 Ga0501048_0047210 3300049582 Bacteria 3072
313 Ga0501068_0065098 3300049584 Bacteria 2218
314 Ga0501069_0015244 3300049585 Bacteria 4119
315 Ga0501070_0008498 3300049586 Bacteria 8676
316 Ga0501070_0046687 3300049586 Bacteria 3601
317 Ga0501073_0192875 3300049589 Bacteria 1410
318 Ga0501074_0057850 3300049590 Bacteria 2793
319 Ga0501074_0516633 3300049590 Bacteria 846
320 Ga0501079_0232921 3300049741 Bacteria 1439
321 Ga0501080_0067410 3300049742 Bacteria 3328
322 Ga0501080_0353609 3300049742 Bacteria 1326
323 Ga0501035_0009582 3300049822 Bacteria 9005
324 Ga0501035_0035300 3300049822 Bacteria 4538
325 Ga0501035_0225769 3300049822 Bacteria 1597
326 Ga0501044_0009461 3300049823 Bacteria 10610
327 Ga0501044_0044487 3300049823 Bacteria 4606
328 Ga0501044_0131512 3300049823 Bacteria 2496
329 Ga0501045_0026287 3300049824 Bacteria 4186
330 nmdc:mga03683_72738_c1 3300050489 Bacteria 1473
331 nmdc:mga03n38_124801_c1 3300050490 Bacteria 1269
332 nmdc:mga0yw44_122698_c1 3300050492 Bacteria 1675
333 nmdc:mga0k408_84487_c1 3300050493 Bacteria 1862
334 nmdc:mga06z11_42193_c1 3300050494 Bacteria 2287
335 nmdc:mga07m45_39646_c1 3300050496 Bacteria 2633
336 nmdc:mga08y16_501429_c1 3300050511 Bacteria 1233
337 nmdc:mga0sz30_139463_c1 3300050516 Bacteria 1070
338 nmdc:mga0sz30_71000_c1 3300050516 Bacteria 1499
339 Ga0500644_0014221 3300053088 Bacteria 2241
340 Ga0500618_000361 3300053125 Bacteria 31600
341 Ga0500618_010798 3300053125 Bacteria 2440
342 Ga0500658_0002369 3300053134 Bacteria 7302
343 Ga0500559_0050613 3300053136 Bacteria 1833
344 Ga0500577_0085626 3300053142 Bacteria 1265
345 Ga0500622_0000697 3300053156 Bacteria 29561
346 Ga0500622_0000899 3300053156 Bacteria 25323
347 Ga0500622_0168394 3300053156 Bacteria 1022
348 Ga0500624_036956 3300053157 Bacteria 864
349 Ga0501084_0223985 3300054114 Bacteria 1587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046491 Ga0495584_0162141 Ga0495584_0162141_391_1122 238
2 3300025922 Ga0207646_10509159 Ga0207646_105091591 254
3 3300005333 Ga0070677_10094309 Ga0070677_100943091 256
4 3300005356 Ga0070674_100121698 Ga0070674_1001216982 256
5 3300005364 Ga0070673_100149384 Ga0070673_1001493842 256
6 3300005365 Ga0070688_100162320 Ga0070688_1001623202 256
7 3300005459 Ga0068867_100012838 Ga0068867_1000128381 256
8 3300006881 Ga0068865_100040624 Ga0068865_1000406242 256
9 3300007788 Ga0099795_10037779 Ga0099795_100377791 256
10 3300009551 Ga0105238_10422202 Ga0105238_104222022 256
11 3300010159 Ga0099796_10002885 Ga0099796_100028854 256
12 3300025924 Ga0207694_10274792 Ga0207694_102747922 256
13 3300025938 Ga0207704_10114673 Ga0207704_101146732 256
14 3300035092 Ga0373952_0052026 Ga0373952_0052026_45_818 256
15 3300042007 Ga0439449_0092340 Ga0439449_0092340_283_1053 256
16 3300042876 Ga0451577_0128334 Ga0451577_0128334_1469_2239 256
17 3300046474 Ga0495605_0204273 Ga0495605_0204273_53_823 256
18 3300046492 Ga0495585_0045381 Ga0495585_0045381_468_1253 256
19 3300046538 Ga0495609_0037623 Ga0495609_0037623_1311_2096 256
20 3300046648 Ga0495611_0017210 Ga0495611_0017210_2162_2947 256
21 3300046692 Ga0495671_0035999 Ga0495671_0035999_1311_2096 256
22 3300047445 Ga0495677_0004493 Ga0495677_0004493_4460_5245 256
23 3300049460 Ga0495682_0000302 Ga0495682_0000302_22931_23716 256
24 3300049569 Ga0501032_0139355 Ga0501032_0139355_767_1537 256
25 3300049573 Ga0501037_0161424 Ga0501037_0161424_767_1537 256
26 3300049574 Ga0501038_0167936 Ga0501038_0167936_61_831 256
27 3300049579 Ga0501043_0189989 Ga0501043_0189989_61_831 256
28 3300049590 Ga0501074_0516633 Ga0501074_0516633_23_793 256
29 3300049822 Ga0501035_0225769 Ga0501035_0225769_767_1537 256
30 3300053157 Ga0500624_036956 Ga0500624_036956_28_798 256
31 3300005563 Ga0068855_100032235 Ga0068855_1000322352 259
32 3300009093 Ga0105240_10099268 Ga0105240_100992684 259
33 3300013104 Ga0157370_10259033 Ga0157370_102590332 260
34 3300013307 Ga0157372_10203408 Ga0157372_102034082 260
35 3300044684 Ga0466966_0254370 Ga0466966_0254370_199_981 260
36 3300005563 Ga0068855_100037684 Ga0068855_1000376847 261
37 3300005614 Ga0068856_100493792 Ga0068856_1004937922 261
38 3300005616 Ga0068852_100053881 Ga0068852_1000538812 261
39 3300009093 Ga0105240_10013633 Ga0105240_100136338 261
40 3300009551 Ga0105238_10014845 Ga0105238_100148454 261
41 3300013102 Ga0157371_10117615 Ga0157371_101176152 261
42 3300013105 Ga0157369_10017208 Ga0157369_100172087 261
43 3300013307 Ga0157372_10000281 Ga0157372_100002815 261
44 3300025909 Ga0207705_10017799 Ga0207705_100177992 261
45 3300025913 Ga0207695_10012059 Ga0207695_1001205910 261
46 3300025917 Ga0207660_10395828 Ga0207660_103958282 261
47 3300025932 Ga0207690_10177977 Ga0207690_101779772 261
48 3300026041 Ga0207639_10156720 Ga0207639_101567202 261
49 3300026142 Ga0207698_10124528 Ga0207698_101245282 261
50 3300046519 Ga0495632_0095774 Ga0495632_0095774_12_812 266
51 3300046660 Ga0495625_0063735 Ga0495625_0063735_12_812 266
52 3300053156 Ga0500622_0168394 Ga0500622_0168394_184_984 266
53 3300003775 Ga0055524_1015223 Ga0055524_10152231 269
54 3300005842 Ga0068858_100000826 Ga0068858_10000082623 269
55 3300009148 Ga0105243_10365609 Ga0105243_103656092 269
56 3300009176 Ga0105242_10008311 Ga0105242_100083114 269
57 3300009551 Ga0105238_10132061 Ga0105238_101320612 269
58 3300009551 Ga0105238_10636988 Ga0105238_106369881 269
59 3300013306 Ga0163162_10009958 Ga0163162_100099589 269
60 3300014968 Ga0157379_10021629 Ga0157379_100216296 269
61 3300025913 Ga0207695_10567216 Ga0207695_105672161 269
62 3300025924 Ga0207694_10422502 Ga0207694_104225021 269
63 3300026035 Ga0207703_10010408 Ga0207703_100104086 269
64 3300026089 Ga0207648_10138628 Ga0207648_101386283 269
65 3300037471 Ga0395905_0108798 Ga0395905_0108798_912_1766 269
66 3300005518 Ga0070699_100020906 Ga0070699_1000209065 270
67 3300005546 Ga0070696_100007560 Ga0070696_1000075603 270
68 3300025921 Ga0207652_10062946 Ga0207652_100629462 271
69 3300005445 Ga0070708_100119389 Ga0070708_1001193892 273
70 3300005468 Ga0070707_100270306 Ga0070707_1002703061 273
71 3300007788 Ga0099795_10005812 Ga0099795_100058122 273
72 3300005471 Ga0070698_100014394 Ga0070698_1000143946 275
73 3300005536 Ga0070697_100037114 Ga0070697_1000371145 275
74 iso_pu_bacteria 2551306086 2551695965 275
75 iso_pu_bacteria 2551306092 2551733146 275
76 iso_pu_bacteria 2643221637 2644210092 275
77 iso_pu_bacteria 2643221718 2644653644 275
78 3300005545 Ga0070695_100032221 Ga0070695_1000322212 277
79 3300045836 Ga0466958_0167388 Ga0466958_0167388_74_907 277
80 3300049571 Ga0501034_0009917 Ga0501034_0009917_8861_9706 277
81 iso_pu_bacteria 2508501122 2509111327 277
82 iso_pu_bacteria 2509276019 2509376396 277
83 iso_pu_bacteria 2510065057 2510304395 277
84 iso_pu_bacteria 2510917022 2511135318 277
85 iso_pu_bacteria 2510917030 2511196080 277
86 iso_pu_bacteria 2511231052 2511502169 277
87 iso_pu_bacteria 2512875026 2512970777 277
88 iso_pu_bacteria 2513237086 2513582437 277
89 iso_pu_bacteria 2513237089 2513604180 277
90 iso_pu_bacteria 2513237091 2513617978 277
91 iso_pu_bacteria 2513237140 2513885510 277
92 iso_pu_bacteria 2513237143 2513903286 277
93 iso_pu_bacteria 2513237156 2513985321 277
94 iso_pu_bacteria 2513237159 2513996872 277
95 iso_pu_bacteria 2513237160 2514006471 277
96 iso_pu_bacteria 2515154107 2515608949 277
97 iso_pu_bacteria 2516143018 2516204080 277
98 iso_pu_bacteria 2516653046 2516893549 277
99 iso_pu_bacteria 2517487022 2517570252 277
100 iso_pu_bacteria 2524023207 2524448627 277
101 iso_pu_bacteria 2524023209 2524459518 277
102 iso_pu_bacteria 2551306084 2551674488 277
103 iso_pu_bacteria 2551306085 2551685843 277
104 iso_pu_bacteria 2558860100 2558867778 277
105 iso_pu_bacteria 2582581283 2585166278 277
106 iso_pu_bacteria 2582581306 2585267509 277
107 iso_pu_bacteria 2582581307 2585271055 277
108 iso_pu_bacteria 2582581315 2585323416 277
109 iso_pu_bacteria 2582581316 2585331550 277
110 iso_pu_bacteria 2582581865 2585386573 277
111 iso_pu_bacteria 2582581866 2585393188 277
112 iso_pu_bacteria 2585427531 2585558779 277
113 iso_pu_bacteria 2585427608 2585898174 277
114 iso_pu_bacteria 2585427609 2585904251 277
115 iso_pu_bacteria 2585428125 2587980632 277
116 iso_pu_bacteria 2615840698 2616556906 277
117 iso_pu_bacteria 2617270742 2617385955 277
118 iso_pu_bacteria 2643221607 2644050589 277
119 iso_pu_bacteria 2643221636 2644205063 277
120 iso_pu_bacteria 2643221686 2644483507 277
121 iso_pu_bacteria 2643221688 2644491969 277
122 iso_pu_bacteria 2643221689 2644499713 277
123 iso_pu_bacteria 2667528174 2671111508 277
124 iso_pu_bacteria 2690316117 2692315609 277
125 iso_pu_bacteria 2751185821 2753461958 277
126 iso_pu_bacteria 2775507266 2778175344 277
127 iso_pu_bacteria 2791355094 2792639142 277
128 iso_pu_bacteria 2802428858 2802719947 277
129 iso_pu_bacteria 2802428859 2802727120 277
130 iso_pu_bacteria 2802428860 2802731878 277
131 iso_pu_bacteria 2802428861 2802739209 277
132 iso_pu_bacteria 2802428862 2802745811 277
133 iso_pu_bacteria 2802428863 2802752413 277
134 iso_pu_bacteria 2818991448 2819609068 277
135 iso_pu_bacteria 2838029111 2838029887 277
136 iso_pu_bacteria 2838074704 2838076936 277
137 iso_pu_bacteria 2842298080 2842301298 277
138 iso_pu_bacteria 2842357229 2842357835 277
139 iso_pu_bacteria 2842475841 2842476828 277
140 iso_pu_bacteria 2842482326 2842484637 277
141 iso_pu_bacteria 2842502639 2842503415 277
142 iso_pu_bacteria 2842509118 2842511206 277
143 iso_pu_bacteria 2842521101 2842522889 277
144 iso_pu_bacteria 2847417321 2847419331 277
145 iso_pu_bacteria 2848992105 2848994351 277
146 iso_pu_bacteria 2850079185 2850081365 277
147 iso_pu_bacteria 2855825444 2855826270 277
148 iso_pu_bacteria 2855839649 2855841615 277
149 iso_pu_bacteria 2855872281 2855876130 277
150 iso_pu_bacteria 2858800743 2858801731 277
151 iso_pu_bacteria 2891373044 2891373268 277
152 iso_pu_bacteria 2896384573 2896388097 277
153 iso_pu_bacteria 2913295892 2913299392 277
154 iso_pu_bacteria 2915980308 2915981358 277
155 iso_pu_bacteria 2915986958 2915990413 277
156 iso_pu_bacteria 2915993759 2915998085 277
157 iso_pu_bacteria 2916000859 2916006860 277
158 iso_pu_bacteria 2916007675 2916013848 277
159 iso_pu_bacteria 2916014648 2916017580 277
160 iso_pu_bacteria 2916021584 2916025049 277
161 iso_pu_bacteria 2916028427 2916033212 277
162 iso_pu_bacteria 2916035215 2916040214 277
163 iso_pu_bacteria 2916041962 2916044043 277
164 iso_pu_bacteria 2916048683 2916054224 277
165 iso_pu_bacteria 2916055098 2916059651 277
166 iso_pu_bacteria 2916061851 2916064248 277
167 iso_pu_bacteria 2916068649 2916070333 277
168 iso_pu_bacteria 2916076590 2916079882 277
169 iso_pu_bacteria 2919100787 2919106636 277
170 iso_pu_bacteria 2919408235 2919409900 277
171 iso_pu_bacteria 2920760137 2920761612 277
172 iso_pu_bacteria 2921201388 2921208474 277
173 iso_pu_bacteria 2921208531 2921214516 277
174 iso_pu_bacteria 2921237296 2921244118 277
175 iso_pu_bacteria 2921244191 2921248571 277
176 iso_pu_bacteria 2921250672 2921252005 277
177 iso_pu_bacteria 2921257292 2921261227 277
178 iso_pu_bacteria 2921263974 2921268644 277
179 iso_pu_bacteria 2921282425 2921285865 277
180 iso_pu_bacteria 2921289301 2921289448 277
181 iso_pu_bacteria 2921296804 2921302056 277
182 iso_pu_bacteria 2924144063 2924148433 277
183 iso_pu_bacteria 2924150972 2924158061 277
184 iso_pu_bacteria 2924158325 2924159205 277
185 iso_pu_bacteria 2924165586 2924171425 277
186 iso_pu_bacteria 2924172951 2924177926 277
187 iso_pu_bacteria 2924179722 2924183718 277
188 iso_pu_bacteria 2924186466 2924191970 277
189 iso_pu_bacteria 2924193448 2924197986 277
190 iso_pu_bacteria 2924200457 2924204748 277
191 iso_pu_bacteria 2924207177 2924211494 277
192 iso_pu_bacteria 2924214083 2924218733 277
193 iso_pu_bacteria 2924221636 2924225746 277
194 iso_pu_bacteria 2924228884 2924233057 277
195 iso_pu_bacteria 2936996657 2936999682 277
196 iso_pu_bacteria 2937002841 2937007356 277
197 iso_pu_bacteria 2937009748 2937012914 277
198 iso_pu_bacteria 2937016420 2937021660 277
199 iso_pu_bacteria 2937023124 2937026890 277
200 iso_pu_bacteria 2937029754 2937030204 277
201 iso_pu_bacteria 2937036028 2937042584 277
202 iso_pu_bacteria 2937042894 2937047712 277
203 iso_pu_bacteria 2937049772 2937053673 277
204 iso_pu_bacteria 2937056579 2937063397 277
205 iso_pu_bacteria 2937063883 2937070723 277
206 iso_pu_bacteria 2937071275 2937077154 277
207 iso_pu_bacteria 2937078374 2937080358 277
208 iso_pu_bacteria 2937084907 2937085537 277
209 iso_pu_bacteria 2937091812 2937098193 277
210 iso_pu_bacteria 2937098957 2937102530 277
211 iso_pu_bacteria 2937106411 2937111240 277
212 iso_pu_bacteria 2937113482 2937117901 277
213 iso_pu_bacteria 2937119839 2937124049 277
214 iso_pu_bacteria 2937126314 2937130592 277
215 iso_pu_bacteria 2957375807 2957376467 277
216 iso_pu_bacteria 2957382221 2957386603 277
217 iso_pu_bacteria 2957388812 2957392915 277
218 iso_pu_bacteria 2957395598 2957395968 277
219 iso_pu_bacteria 2957402308 2957406702 277
220 iso_pu_bacteria 2957408893 2957410763 277
221 iso_pu_bacteria 2957415311 2957417592 277
222 iso_pu_bacteria 2957422303 2957423712 277
223 iso_pu_bacteria 2957430029 2957434308 277
224 iso_pu_bacteria 2957443900 2957446335 277
225 iso_pu_bacteria 2957450854 2957454731 277
226 iso_pu_bacteria 2957457609 2957461975 277
227 iso_pu_bacteria 2957464669 2957468649 277
228 iso_pu_bacteria 2957471148 2957476461 277
229 iso_pu_bacteria 2957478035 2957482801 277
230 iso_pu_bacteria 2957484790 2957488695 277
231 iso_pu_bacteria 2957491536 2957496964 277
232 iso_pu_bacteria 2957498199 2957503237 277
233 iso_pu_bacteria 2957505466 2957507283 277
234 iso_pu_bacteria 2960584000 2960584531 277
235 iso_pu_bacteria 2960591022 2960592003 277
236 iso_pu_bacteria 2960597568 2960602487 277
237 iso_pu_bacteria 2960603979 2960606444 277
238 iso_pu_bacteria 2960610863 2960612390 277
239 iso_pu_bacteria 2960617483 2960621481 277
240 iso_pu_bacteria 2960624210 2960630826 277
241 iso_pu_bacteria 2960631154 2960631964 277
242 iso_pu_bacteria 2960637947 2960638635 277
243 iso_pu_bacteria 2960645483 2960650004 277
244 iso_pu_bacteria 2960652885 2960654745 277
245 iso_pu_bacteria 2960660292 2960665252 277
246 iso_pu_bacteria 2960667422 2960671737 277
247 iso_pu_bacteria 2960674078 2960678342 277
248 iso_pu_bacteria 2960680706 2960681539 277
249 iso_pu_bacteria 2960687367 2960692522 277
250 iso_pu_bacteria 2960693952 2960698122 277
251 iso_pu_bacteria 2964607997 2964614500 277
252 iso_pu_bacteria 2964615318 2964621069 277
253 iso_pu_bacteria 2964621998 2964625721 277
254 iso_pu_bacteria 2964628898 2964632982 277
255 iso_pu_bacteria 2964636051 2964640152 277
256 iso_pu_bacteria 2964643177 2964646842 277
257 iso_pu_bacteria 2964649959 2964655346 277
258 iso_pu_bacteria 2964656573 2964663215 277
259 iso_pu_bacteria 2964663802 2964668292 277
260 iso_pu_bacteria 2964678106 2964681588 277
261 iso_pu_bacteria 2964685014 2964691348 277
262 iso_pu_bacteria 2964691889 2964698282 277
263 iso_pu_bacteria 2964698721 2964705092 277
264 iso_pu_bacteria 2964705432 2964709834 277
265 iso_pu_bacteria 2964712639 2964716520 277
266 iso_pu_bacteria 2964719344 2964724640 277
267 iso_pu_bacteria 2967664464 2967665482 277
268 iso_pu_bacteria 2967671571 2967675904 277
269 iso_pu_bacteria 2967678726 2967684498 277
270 iso_pu_bacteria 2967686174 2967688886 277
271 iso_pu_bacteria 2967693043 2967697350 277
272 iso_pu_bacteria 2967699805 2967706628 277
273 iso_pu_bacteria 2967706974 2967711540 277
274 iso_pu_bacteria 2967714385 2967714801 277
275 iso_pu_bacteria 2967721400 2967725805 277
276 iso_pu_bacteria 2967728569 2967729079 277
277 iso_pu_bacteria 2967735183 2967738853 277
278 iso_pu_bacteria 2967742019 2967743532 277
279 iso_pu_bacteria 2967748971 2967753561 277
280 iso_pu_bacteria 2967755722 2967758962 277
281 iso_pu_bacteria 2967762386 2967768486 277
282 iso_pu_bacteria 2967769361 2967773854 277
283 iso_pu_bacteria 2967775926 2967778022 277
284 iso_pu_bacteria 2970019648 2970023487 277
285 iso_pu_bacteria 2970026789 2970030359 277
286 iso_pu_bacteria 2970033650 2970040217 277
287 iso_pu_bacteria 2970040964 2970045854 277
288 iso_pu_bacteria 2970047711 2970053972 277
289 iso_pu_bacteria 2970054988 2970059291 277
290 iso_pu_bacteria 2970061556 2970065652 277
291 iso_pu_bacteria 2970068827 2970075485 277
292 iso_pu_bacteria 2970076120 2970080199 277
293 iso_pu_bacteria 2970082768 2970087775 277
294 iso_pu_bacteria 2970088815 2970093226 277
295 iso_pu_bacteria 2970095765 2970100077 277
296 iso_pu_bacteria 2970102677 2970108071 277
297 iso_pu_bacteria 2970109326 2970113891 277
298 iso_pu_bacteria 2970116247 2970120485 277
299 iso_pu_bacteria 2970122695 2970127032 277
300 iso_pu_bacteria 2970129317 2970133208 277
301 iso_pu_bacteria 2970136068 2970140465 277
302 iso_pu_bacteria 2970143518 2970146185 277
303 iso_pu_bacteria 2970149975 2970155974 277
304 iso_pu_bacteria 2970156795 2970161086 277
305 iso_pu_bacteria 2970164137 2970168471 277
306 iso_pu_bacteria 2970170962 2970171557 277
307 iso_pu_bacteria 2970177841 2970182889 277
308 iso_pu_bacteria 2970184632 2970188703 277
309 iso_pu_bacteria 2970191845 2970196359 277
310 iso_pu_bacteria 2977516862 2977522535 277
311 iso_pu_bacteria 2977523885 2977526255 277
312 iso_pu_bacteria 2977530762 2977534351 277
313 iso_pu_bacteria 2977537788 2977542014 277
314 iso_pu_bacteria 2977544691 2977547718 277
315 iso_pu_bacteria 2977551784 2977558359 277
316 iso_pu_bacteria 2977558990 2977562686 277
317 iso_pu_bacteria 2977565890 2977570265 277
318 iso_pu_bacteria 2977572785 2977577066 277
319 iso_pu_bacteria 2977579622 2977583583 277
320 iso_pu_bacteria 2989349275 2989349567 277
321 iso_pu_bacteria 3005416602 3005419553 277
322 iso_pu_bacteria 3005445848 3005448365 277
323 iso_pu_bacteria 643692032 643826214 277
324 iso_pu_bacteria 648276728 648740499 277
325 iso_pu_bacteria 8003992118 8003994090 277
326 iso_pu_bacteria 8003999396 8004001714 277
327 iso_pu_bacteria 8005314921 8005316844 277
328 iso_pu_bacteria 8005484373 8005485350 277
329 iso_pu_bacteria 8005645114 8005649660 277
330 iso_pu_bacteria 8005682033 8005682973 277
331 iso_pu_bacteria 8024486573 8024487950 277
332 iso_pu_bacteria 8046767195 8046771622 277
333 iso_pu_bacteria 8057575449 8057575816 277
334 3300037853 Ga0436364_0695814 Ga0436364_0695814_479_1315 278
335 3300039437 Ga0436365_1323176 Ga0436365_1323176_330_1166 278
336 iso_pu_bacteria 2509276021 2509392131 278
337 iso_pu_bacteria 2509276033 2509445777 278
338 iso_pu_bacteria 2509276033 2509446921 278
339 iso_pu_bacteria 2510461076 2510895300 278
340 iso_pu_bacteria 2510917028 2511186985 278
341 iso_pu_bacteria 2513237085 2513576869 278
342 iso_pu_bacteria 2513237088 2513596403 278
343 iso_pu_bacteria 2513237103 2513708124 278
344 iso_pu_bacteria 2513237162 2514020081 278
345 iso_pu_bacteria 2515075009 2515112924 278
346 iso_pu_bacteria 2515154116 2515655429 278
347 iso_pu_bacteria 2515154134 2515739408 278
348 iso_pu_bacteria 2516653085 2517076988 278
349 iso_pu_bacteria 2517093000 2517095758 278
350 iso_pu_bacteria 2529292951 2530646029 278
351 iso_pu_bacteria 2582581294 2585200536 278
352 iso_pu_bacteria 2582581299 2585232769 278
353 iso_pu_bacteria 2585427526 2585527368 278
354 iso_pu_bacteria 2615840624 2616293433 278
355 iso_pu_bacteria 2643221634 2644193433 278
356 iso_pu_bacteria 2718217882 2719181737 278
357 iso_pu_bacteria 2718217927 2719386261 278
358 iso_pu_bacteria 2718217997 2719666082 278
359 iso_pu_bacteria 2718218009 2719732401 278
360 iso_pu_bacteria 2718218199 2720492502 278
361 iso_pu_bacteria 2718218232 2720613938 278
362 iso_pu_bacteria 2718218233 2720620742 278
363 iso_pu_bacteria 2718218235 2720632065 278
364 iso_pu_bacteria 2718218269 2720775793 278
365 iso_pu_bacteria 2718218363 2721147828 278
366 iso_pu_bacteria 2718218365 2721159278 278
367 iso_pu_bacteria 2718218366 2721164664 278
368 iso_pu_bacteria 2718218423 2721400043 278
369 iso_pu_bacteria 2721755514 2722840834 278
370 iso_pu_bacteria 2721755556 2723027400 278
371 iso_pu_bacteria 2721755684 2723561019 278
372 iso_pu_bacteria 2721755685 2723567612 278
373 iso_pu_bacteria 2721755809 2724038856 278
374 iso_pu_bacteria 2721755810 2724045157 278
375 iso_pu_bacteria 2721755819 2724090400 278
376 iso_pu_bacteria 2721755822 2724104877 278
377 iso_pu_bacteria 2721755823 2724110682 278
378 iso_pu_bacteria 2728369352 2730108336 278
379 iso_pu_bacteria 2728369365 2730164972 278
380 iso_pu_bacteria 2728369397 2730298910 278
381 iso_pu_bacteria 2765235942 2766065792 278
382 iso_pu_bacteria 2791355256 2793294511 278
383 iso_pu_bacteria 2791355259 2793314612 278
384 iso_pu_bacteria 2791355260 2793320439 278
385 iso_pu_bacteria 2791355261 2793331713 278
386 iso_pu_bacteria 2791355262 2793336837 278
387 iso_pu_bacteria 2791355263 2793339128 278
388 iso_pu_bacteria 2791355264 2793348811 278
389 iso_pu_bacteria 2791355265 2793351906 278
390 iso_pu_bacteria 2791355266 2793363623 278
391 iso_pu_bacteria 2791355267 2793370251 278
392 iso_pu_bacteria 2802429605 2805932175 278
393 iso_pu_bacteria 2802429606 2805937428 278
394 iso_pu_bacteria 2838022645 2838028399 278
395 iso_pu_bacteria 2838042994 2838043892 278
396 iso_pu_bacteria 2838048938 2838051978 278
397 iso_pu_bacteria 2838061910 2838067404 278
398 iso_pu_bacteria 2838068647 2838070222 278
399 iso_pu_bacteria 2838668709 2838670286 278
400 iso_pu_bacteria 2838686498 2838687130 278
401 iso_pu_bacteria 2838701080 2838702657 278
402 iso_pu_bacteria 2838729681 2838729897 278
403 iso_pu_bacteria 2838742623 2838743088 278
404 iso_pu_bacteria 2841851746 2841852574 278
405 iso_pu_bacteria 2841864319 2841869873 278
406 iso_pu_bacteria 2842110456 2842114906 278
407 iso_pu_bacteria 2842146304 2842148085 278
408 iso_pu_bacteria 2842156927 2842157966 278
409 iso_pu_bacteria 2842163707 2842167484 278
410 iso_pu_bacteria 2842180545 2842181585 278
411 iso_pu_bacteria 2842198810 2842204470 278
412 iso_pu_bacteria 2842205361 2842205554 278
413 iso_pu_bacteria 2842217011 2842217857 278
414 iso_pu_bacteria 2842229732 2842230364 278
415 iso_pu_bacteria 2842243621 2842244266 278
416 iso_pu_bacteria 2842250916 2842253151 278
417 iso_pu_bacteria 2842257432 2842257648 278
418 iso_pu_bacteria 2842264693 2842266188 278
419 iso_pu_bacteria 2842271015 2842271332 278
420 iso_pu_bacteria 2842278818 2842279011 278
421 iso_pu_bacteria 2842304105 2842304961 278
422 iso_pu_bacteria 2842311132 2842314990 278
423 iso_pu_bacteria 2842317721 2842320634 278
424 iso_pu_bacteria 2842341865 2842346381 278
425 iso_pu_bacteria 2842363717 2842369040 278
426 iso_pu_bacteria 2842395702 2842399957 278
427 iso_pu_bacteria 2842422224 2842423836 278
428 iso_pu_bacteria 2842428310 2842430651 278
429 iso_pu_bacteria 2842434925 2842437362 278
430 iso_pu_bacteria 2842441272 2842443732 278
431 iso_pu_bacteria 2842447887 2842453142 278
432 iso_pu_bacteria 2842462802 2842464794 278
433 iso_pu_bacteria 2842469257 2842471980 278
434 iso_pu_bacteria 2842489311 2842491903 278
435 iso_pu_bacteria 2842495871 2842496902 278
436 iso_pu_bacteria 2844454524 2844458497 278
437 iso_pu_bacteria 2857516855 2857517513 278
438 iso_pu_bacteria 2933570622 2933570769 278
439 iso_pu_bacteria 2933586486 2933591278 278
440 iso_pu_bacteria 2933599457 2933601028 278
441 iso_pu_bacteria 2935901341 2935902034 278
442 iso_pu_bacteria 2936367885 2936372119 278
443 iso_pu_bacteria 2936375103 2936381076 278
444 iso_pu_bacteria 2936381700 2936382969 278
445 iso_pu_bacteria 2996893221 2996896432 278
446 iso_pu_bacteria 639633055 639649117 278
447 iso_pu_bacteria 8005275841 8005281052 278
448 iso_pu_bacteria 8005282627 8005283338 278
449 iso_pu_bacteria 8005289223 8005293563 278
450 iso_pu_bacteria 8005301065 8005303046 278
451 iso_pu_bacteria 8005307578 8005312755 278
452 iso_pu_bacteria 8005376324 8005380850 278
453 iso_pu_bacteria 8005382845 8005385282 278
454 iso_pu_bacteria 8005430974 8005435077 278
455 iso_pu_bacteria 8005460587 8005463601 278
456 iso_pu_bacteria 8005497431 8005500815 278
457 iso_pu_bacteria 8005542996 8005545545 278
458 iso_pu_bacteria 8005556819 8005557092 278
459 iso_pu_bacteria 8005619151 8005622192 278
460 iso_pu_bacteria 8005626139 8005632332 278
461 iso_pu_bacteria 8005668836 8005672233 278
462 iso_pu_bacteria 8005688590 8005692184 278
463 iso_pu_bacteria 8005695170 8005697322 278
464 iso_pu_bacteria 8018127388 8018134017 278
465 iso_pu_bacteria 8018163183 8018163870 278
466 iso_pu_bacteria 8018176218 8018181400 278
467 iso_pu_bacteria 8024479707 8024482944 278
468 iso_pu_bacteria 8024501048 8024504284 278
469 iso_pu_bacteria 8056375014 8056378451 278
470 iso_pu_bacteria 8057874678 8057877317 278
471 3300009551 Ga0105238_10221240 Ga0105238_102212402 279
472 3300013296 Ga0157374_10282399 Ga0157374_102823992 279
473 3300021384 Ga0213876_10009177 Ga0213876_100091773 279
474 3300039437 Ga0436365_1451141 Ga0436365_1451141_469_1308 279
475 3300049570 Ga0501033_0025357 Ga0501033_0025357_767_1606 279
476 3300049570 Ga0501033_0033115 Ga0501033_0033115_2275_3114 279
477 3300049570 Ga0501033_0034506 Ga0501033_0034506_307_1146 279
478 3300049575 Ga0501039_0042062 Ga0501039_0042062_1925_2764 279
479 3300049582 Ga0501048_0047210 Ga0501048_0047210_1762_2601 279
480 3300049584 Ga0501068_0065098 Ga0501068_0065098_1340_2179 279
481 3300049586 Ga0501070_0046687 Ga0501070_0046687_293_1132 279
482 3300049741 Ga0501079_0232921 Ga0501079_0232921_45_884 279
483 3300049742 Ga0501080_0067410 Ga0501080_0067410_2195_3034 279
484 3300049822 Ga0501035_0035300 Ga0501035_0035300_3001_3840 279
485 3300049823 Ga0501044_0044487 Ga0501044_0044487_845_1684 279
486 3300049823 Ga0501044_0131512 Ga0501044_0131512_1004_1843 279
487 3300049824 Ga0501045_0026287 Ga0501045_0026287_2821_3660 279
488 iso_pu_bacteria 2935908558 2935912525 279
489 iso_pu_bacteria 2935916978 2935921640 279
490 iso_pu_bacteria 2935926038 2935929586 279
491 iso_pu_bacteria 2935934488 2935938818 279
492 iso_pu_bacteria 2935942939 2935948347 279
493 iso_pu_bacteria 2935951376 2935955071 279
494 iso_pu_bacteria 2935967501 2935971895 279
495 iso_pu_bacteria 8016630954 8016638695 279
496 iso_pu_bacteria 8019687851 8019693804 279
497 3300028794 Ga0307515_10000307 Ga0307515_1000030732 280
498 3300049570 Ga0501033_0019439 Ga0501033_0019439_1189_2031 280
499 3300049573 Ga0501037_0054438 Ga0501037_0054438_1681_2523 280
500 3300049581 Ga0501047_0012932 Ga0501047_0012932_4681_5523 280
501 3300049585 Ga0501069_0015244 Ga0501069_0015244_3166_4008 280
502 3300049586 Ga0501070_0008498 Ga0501070_0008498_5230_6072 280
503 3300049589 Ga0501073_0192875 Ga0501073_0192875_62_904 280
504 3300049590 Ga0501074_0057850 Ga0501074_0057850_719_1561 280
505 3300049742 Ga0501080_0353609 Ga0501080_0353609_97_939 280
506 3300049822 Ga0501035_0009582 Ga0501035_0009582_4584_5426 280
507 3300049823 Ga0501044_0009461 Ga0501044_0009461_4274_5116 280
508 3300053125 Ga0500618_000361 Ga0500618_000361_14298_15140 280
509 3300053142 Ga0500577_0085626 Ga0500577_0085626_255_1100 280
510 3300054114 Ga0501084_0223985 Ga0501084_0223985_662_1504 280
511 3300001979 JGI24740J21852_10032326 JGI24740J21852_100323263 281
512 3300002704 JGI25155J39150_1000001 JGI25155J39150_1000001217 281
513 3300002705 JGI25156J39149_1000001 JGI25156J39149_1000001116 281
514 3300002737 JGI25162J39368_1000380 JGI25162J39368_10003804 281
515 3300002737 JGI25162J39368_1003103 JGI25162J39368_10031032 281
516 3300002738 JGI25154J39366_1000011 JGI25154J39366_1000011268 281
517 3300002739 JGI25158J39367_1000336 JGI25158J39367_10003365 281
518 3300002741 JGI25157J39369_1000079 JGI25157J39369_100007987 281
519 3300002773 JGI25152J39213_1001866 JGI25152J39213_10018667 281
520 3300002773 JGI25152J39213_1010120 JGI25152J39213_10101203 281
521 3300002774 JGI25150J39212_1006463 JGI25150J39212_10064632 281
522 3300002987 JGI25159J45721_1000613 JGI25159J45721_10006133 281
523 3300003187 JGI25151J46595_10000802 JGI25151J46595_1000080213 281
524 3300003214 JGI25165J46597_1000422 JGI25165J46597_10004222 281
525 3300003214 JGI25165J46597_1001018 JGI25165J46597_100101822 281
526 3300003215 JGI25153J46596_10012453 JGI25153J46596_100124534 281
527 3300003215 JGI25153J46596_10021072 JGI25153J46596_100210722 281
528 3300003215 JGI25153J46596_10026848 JGI25153J46596_100268481 281
529 3300003320 rootH2_10087331 rootH2_100873312 281
530 3300003322 rootL2_10027391 rootL2_100273912 281
531 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001725 281
532 3300003354 JGI25160J50197_1003427 JGI25160J50197_10034273 281
533 3300003354 JGI25160J50197_1013773 JGI25160J50197_10137731 281
534 3300003374 JGI25161J50226_1000001 JGI25161J50226_100000125 281
535 3300003374 JGI25161J50226_1000099 JGI25161J50226_100009929 281
536 3300003374 JGI25161J50226_1000140 JGI25161J50226_100014052 281
537 3300003374 JGI25161J50226_1004634 JGI25161J50226_10046341 281
538 3300003771 Ga0055526_1000484 Ga0055526_10004841 281
539 3300003775 Ga0055524_1004689 Ga0055524_10046893 281
540 3300003775 Ga0055524_1020876 Ga0055524_10208762 281
541 3300003775 Ga0055524_1034503 Ga0055524_10345031 281
542 3300003790 Ga0055528_1003598 Ga0055528_10035989 281
543 3300003790 Ga0055528_1011411 Ga0055528_10114113 281
544 3300003790 Ga0055528_1013658 Ga0055528_10136582 281
545 3300003790 Ga0055528_1023519 Ga0055528_10235193 281
546 3300003790 Ga0055528_1027241 Ga0055528_10272412 281
547 3300003792 Ga0055540_1000283 Ga0055540_100028346 281
548 3300003792 Ga0055540_1006077 Ga0055540_10060774 281
549 3300003792 Ga0055540_1016188 Ga0055540_10161883 281
550 3300003856 Ga0058692_1010762 Ga0058692_10107623 281
551 3300004625 Ga0055543_1000003 Ga0055543_100000341 281
552 3300004625 Ga0055543_1000128 Ga0055543_100012812 281
553 3300004625 Ga0055543_1000499 Ga0055543_100049912 281
554 3300005262 Ga0065165_1000068 Ga0065165_1000068127 281
555 3300005331 Ga0070670_100004125 Ga0070670_1000041258 281
556 3300005355 Ga0070671_100043123 Ga0070671_1000431232 281
557 3300005455 Ga0070663_100154358 Ga0070663_1001543582 281
558 3300005457 Ga0070662_100257705 Ga0070662_1002577051 281
559 3300005614 Ga0068856_100020971 Ga0068856_1000209715 281
560 3300006038 Ga0075365_10031412 Ga0075365_100314123 281
561 3300006178 Ga0075367_10132302 Ga0075367_101323021 281
562 3300006186 Ga0075369_10000132 Ga0075369_100001323 281
563 3300006186 Ga0075369_10020015 Ga0075369_100200154 281
564 3300006195 Ga0075366_10052173 Ga0075366_100521733 281
565 3300006353 Ga0075370_10021568 Ga0075370_100215683 281
566 3300009094 Ga0111539_10290318 Ga0111539_102903182 281
567 3300009765 Ga0123341_1000032 Ga0123341_100003223 281
568 3300009766 Ga0123342_1005565 Ga0123342_10055657 281
569 3300009766 Ga0123342_1021015 Ga0123342_10210153 281
570 3300012490 Ga0157322_1001841 Ga0157322_10018412 281
571 3300013100 Ga0157373_10199326 Ga0157373_101993262 281
572 3300014326 Ga0157380_10190061 Ga0157380_101900612 281
573 3300021327 Ga0214543_1000038 Ga0214543_1000038143 281
574 3300022739 Ga0228711_1000008 Ga0228711_1000008120 281
575 3300022740 Ga0228710_1000009 Ga0228710_1000009119 281
576 3300025206 Ga0209435_100012 Ga0209435_100012268 281
577 3300025233 Ga0209437_100047 Ga0209437_10004717 281
578 3300025233 Ga0209437_100242 Ga0209437_10024270 281
579 3300025245 Ga0207425_1008702 Ga0207425_10087024 281
580 3300025246 Ga0209646_1000026 Ga0209646_1000026268 281
581 3300025250 Ga0209026_1000014 Ga0209026_1000014268 281
582 3300025256 Ga0209759_1000012 Ga0209759_1000012268 281
583 3300025258 Ga0209129_1001312 Ga0209129_100131210 281
584 3300025258 Ga0209129_1012421 Ga0209129_10124211 281
585 3300025261 Ga0209233_1000048 Ga0209233_1000048385 281
586 3300025261 Ga0209233_1000069 Ga0209233_100006962 281
587 3300025273 Ga0209673_1000977 Ga0209673_100097730 281
588 3300025273 Ga0209673_1001611 Ga0209673_10016111 281
589 3300025273 Ga0209673_1003210 Ga0209673_10032102 281
590 3300025273 Ga0209673_1005688 Ga0209673_10056884 281
591 3300025273 Ga0209673_1025068 Ga0209673_10250682 281
592 3300025284 Ga0209130_1000003 Ga0209130_100000351 281
593 3300025284 Ga0209130_1000020 Ga0209130_1000020333 281
594 3300025294 Ga0209025_1000058 Ga0209025_1000058265 281
595 3300025294 Ga0209025_1000140 Ga0209025_1000140147 281
596 3300025294 Ga0209025_1005836 Ga0209025_10058366 281
597 3300025294 Ga0209025_1062058 Ga0209025_10620581 281
598 3300025295 Ga0209564_1001530 Ga0209564_10015303 281
599 3300025295 Ga0209564_1009212 Ga0209564_10092121 281
600 3300025295 Ga0209564_1018866 Ga0209564_10188662 281
601 3300025297 Ga0209758_1002719 Ga0209758_10027193 281
602 3300025297 Ga0209758_1002951 Ga0209758_10029518 281
603 3300025298 Ga0209050_1010611 Ga0209050_10106112 281
604 3300025299 Ga0209256_1009135 Ga0209256_10091353 281
605 3300025299 Ga0209256_1010112 Ga0209256_10101122 281
606 3300025299 Ga0209256_1020294 Ga0209256_10202941 281
607 3300025299 Ga0209256_1027822 Ga0209256_10278222 281
608 3300025302 Ga0207426_1000008 Ga0207426_1000008400 281
609 3300025302 Ga0207426_1000011 Ga0207426_1000011727 281
610 3300025302 Ga0207426_1000221 Ga0207426_100022150 281
611 3300025302 Ga0207426_1000946 Ga0207426_100094622 281
612 3300025302 Ga0207426_1002076 Ga0207426_10020765 281
613 3300025303 Ga0209051_1000308 Ga0209051_100030865 281
614 3300025303 Ga0209051_1002748 Ga0209051_100274811 281
615 3300025303 Ga0209051_1004871 Ga0209051_100487111 281
616 3300025304 Ga0209257_1000853 Ga0209257_100085318 281
617 3300025903 Ga0207680_10228324 Ga0207680_102283242 281
618 3300025904 Ga0207647_10204089 Ga0207647_102040891 281
619 3300025925 Ga0207650_10012844 Ga0207650_100128444 281
620 3300025931 Ga0207644_10147752 Ga0207644_101477522 281
621 3300025933 Ga0207706_10311865 Ga0207706_103118651 281
622 3300025941 Ga0207711_10091151 Ga0207711_100911512 281
623 3300026067 Ga0207678_10240922 Ga0207678_102409222 281
624 3300026078 Ga0207702_10272557 Ga0207702_102725572 281
625 3300027111 Ga0209281_1000106 Ga0209281_1000106111 281
626 3300027111 Ga0209281_1000426 Ga0209281_100042663 281
627 3300027312 Ga0209371_1007288 Ga0209371_10072884 281
628 3300027666 Ga0209282_1000024 Ga0209282_100002442 281
629 3300027866 Ga0209813_10014135 Ga0209813_100141351 281
630 3300028794 Ga0307515_10000788 Ga0307515_1000078834 281
631 3300028794 Ga0307515_10017597 Ga0307515_100175974 281
632 3300030500 Ga0268256_1007489 Ga0268256_10074892 281
633 3300031456 Ga0307513_10025659 Ga0307513_100256597 281
634 3300031967 Ga0315914_1000012 Ga0315914_1000012120 281
635 3300032004 Ga0307414_10082671 Ga0307414_100826711 281
636 3300033430 Ga0315913_1000006 Ga0315913_1000006119 281
637 3300033464 Ga0315915_1000010 Ga0315915_1000010144 281
638 3300035691 Ga0373931_0177540 Ga0373931_0177540_231_1091 281
639 3300041404 Ga0439436_0001576 Ga0439436_0001576_4712_5557 281
640 3300041407 Ga0439447_037014 Ga0439447_037014_261_1106 281
641 3300041411 Ga0439466_0072479 Ga0439466_0072479_223_1068 281
642 3300041413 Ga0439465_0004189 Ga0439465_0004189_2067_2912 281
643 3300041413 Ga0439465_0041310 Ga0439465_0041310_154_1014 281
644 3300041491 Ga0451833_0373356 Ga0451833_0373356_73_921 281
645 3300041494 Ga0451837_0308128 Ga0451837_0308128_454_1350 281
646 3300041496 Ga0451839_0409093 Ga0451839_0409093_2191_3039 281
647 3300041498 Ga0451841_0501270 Ga0451841_0501270_1549_2397 281
648 3300041502 Ga0451846_41223 Ga0451846_41223_121_969 281
649 3300041507 Ga0451851_1283930 Ga0451851_1283930_327_1175 281
650 3300041511 Ga0451855_0678343 Ga0451855_0678343_30_920 281
651 3300042006 Ga0439432_074279 Ga0439432_074279_90_950 281
652 3300042007 Ga0439449_0008427 Ga0439449_0008427_1722_2567 281
653 3300042007 Ga0439449_0048440 Ga0439449_0048440_245_1090 281
654 3300042014 Ga0439457_041111 Ga0439457_041111_42_887 281
655 3300042145 Ga0450906_004190 Ga0450906_004190_1030_1875 281
656 3300042435 Ga0439434_0009578 Ga0439434_0009578_1566_2411 281
657 3300044694 Ga0466963_0006812 Ga0466963_0006812_1537_2388 281
658 3300044765 Ga0466970_0020090 Ga0466970_0020090_2431_3282 281
659 3300044842 Ga0466957_0036774 Ga0466957_0036774_971_1822 281
660 3300045836 Ga0466958_0009384 Ga0466958_0009384_684_1535 281
661 3300046460 Ga0495638_0053703 Ga0495638_0053703_661_1515 281
662 3300046492 Ga0495585_0026571 Ga0495585_0026571_729_1577 281
663 3300046500 Ga0495596_0021263 Ga0495596_0021263_1791_2639 281
664 3300046500 Ga0495596_0056411 Ga0495596_0056411_482_1330 281
665 3300046501 Ga0495607_0057110 Ga0495607_0057110_381_1229 281
666 3300046506 Ga0495583_0039071 Ga0495583_0039071_1058_1906 281
667 3300046506 Ga0495583_0094691 Ga0495583_0094691_162_1010 281
668 3300046507 Ga0495606_0002164 Ga0495606_0002164_20059_20904 281
669 3300046507 Ga0495606_0010451 Ga0495606_0010451_2006_2854 281
670 3300046507 Ga0495606_0107233 Ga0495606_0107233_241_1086 281
671 3300046512 Ga0495610_0071551 Ga0495610_0071551_214_1059 281
672 3300046515 Ga0495620_0027988 Ga0495620_0027988_263_1111 281
673 3300046515 Ga0495620_0058422 Ga0495620_0058422_213_1103 281
674 3300046522 Ga0495643_0007771 Ga0495643_0007771_3893_4738 281
675 3300046522 Ga0495643_0015966 Ga0495643_0015966_1564_2412 281
676 3300046524 Ga0495648_0055191 Ga0495648_0055191_1459_2307 281
677 3300046542 Ga0495597_0011360 Ga0495597_0011360_2192_3040 281
678 3300046558 Ga0495633_0012064 Ga0495633_0012064_2640_3488 281
679 3300046558 Ga0495633_0040390 Ga0495633_0040390_242_1183 281
680 3300046660 Ga0495625_0003972 Ga0495625_0003972_9403_10251 281
681 3300046660 Ga0495625_0040946 Ga0495625_0040946_425_1345 281
682 3300046674 Ga0495588_0043324 Ga0495588_0043324_475_1323 281
683 3300046691 Ga0495670_0016423 Ga0495670_0016423_1534_2382 281
684 3300046810 Ga0495660_0084057 Ga0495660_0084057_627_1475 281
685 3300047443 Ga0495687_023598 Ga0495687_023598_942_1787 281
686 3300047443 Ga0495687_060379 Ga0495687_060379_208_1056 281
687 3300047469 Ga0495673_0108615 Ga0495673_0108615_62_910 281
688 3300047470 Ga0495681_0064687 Ga0495681_0064687_304_1152 281
689 3300047470 Ga0495681_0083166 Ga0495681_0083166_457_1305 281
690 3300047472 Ga0495686_0000316 Ga0495686_0000316_1509_2354 281
691 3300047472 Ga0495686_0061119 Ga0495686_0061119_124_972 281
692 3300048090 Ga0495615_0006933 Ga0495615_0006933_692_1540 281
693 3300048091 Ga0495626_0057653 Ga0495626_0057653_731_1579 281
694 3300048905 Ga0496102_0033698 Ga0496102_0033698_1639_2487 281
695 3300048907 Ga0496104_0087495 Ga0496104_0087495_458_1357 281
696 3300048908 Ga0496105_0014730 Ga0496105_0014730_1699_2598 281
697 3300048909 Ga0496106_0207084 Ga0496106_0207084_219_1118 281
698 3300048911 Ga0496108_0092807 Ga0496108_0092807_249_1148 281
699 3300048912 Ga0496109_0486152 Ga0496109_0486152_210_1109 281
700 3300048913 Ga0496110_0011425 Ga0496110_0011425_3136_3984 281
701 3300048916 Ga0496113_0192147 Ga0496113_0192147_206_1105 281
702 3300048916 Ga0496113_0254987 Ga0496113_0254987_291_1160 281
703 3300048916 Ga0496113_0288066 Ga0496113_0288066_36_893 281
704 3300048920 Ga0496117_0041228 Ga0496117_0041228_1149_2006 281
705 3300048920 Ga0496117_0076711 Ga0496117_0076711_831_1676 281
706 3300048920 Ga0496117_0216641 Ga0496117_0216641_149_1033 281
707 3300048922 Ga0496119_0019449 Ga0496119_0019449_2700_3584 281
708 3300048922 Ga0496119_0117103 Ga0496119_0117103_55_954 281
709 3300048923 Ga0496120_0024294 Ga0496120_0024294_2486_3385 281
710 3300048923 Ga0496120_0070065 Ga0496120_0070065_39_923 281
711 3300048924 Ga0496121_0005561 Ga0496121_0005561_13841_14686 281
712 3300048924 Ga0496121_0026532 Ga0496121_0026532_389_1234 281
713 3300048924 Ga0496121_0042223 Ga0496121_0042223_2979_3824 281
714 3300048924 Ga0496121_0078146 Ga0496121_0078146_1638_2486 281
715 3300048924 Ga0496121_0149743 Ga0496121_0149743_553_1398 281
716 3300048924 Ga0496121_0259469 Ga0496121_0259469_219_1067 281
717 3300048925 Ga0496122_0000190 Ga0496122_0000190_41377_42234 281
718 3300048925 Ga0496122_0097288 Ga0496122_0097288_879_1727 281
719 3300048925 Ga0496122_0118972 Ga0496122_0118972_496_1341 281
720 3300048926 Ga0496123_0001159 Ga0496123_0001159_6545_7402 281
721 3300048926 Ga0496123_0019000 Ga0496123_0019000_809_1654 281
722 3300048926 Ga0496123_0036450 Ga0496123_0036450_2553_3452 281
723 3300048927 Ga0496124_0001702 Ga0496124_0001702_24029_24886 281
724 3300048927 Ga0496124_0011095 Ga0496124_0011095_3533_4432 281
725 3300048927 Ga0496124_0034478 Ga0496124_0034478_2799_3644 281
726 3300048927 Ga0496124_0046133 Ga0496124_0046133_1475_2359 281
727 3300048928 Ga0496125_0000273 Ga0496125_0000273_73715_74572 281
728 3300048928 Ga0496125_0027238 Ga0496125_0027238_728_1576 281
729 3300048928 Ga0496125_0064881 Ga0496125_0064881_1085_1930 281
730 3300048928 Ga0496125_0106977 Ga0496125_0106977_718_1563 281
731 3300048929 Ga0496126_0000589 Ga0496126_0000589_37586_38443 281
732 3300048929 Ga0496126_0030883 Ga0496126_0030883_3172_4029 281
733 3300049459 Ga0495678_107487 Ga0495678_107487_26_874 281
734 3300049571 Ga0501034_0303410 Ga0501034_0303410_94_990 281
735 3300049581 Ga0501047_0121260 Ga0501047_0121260_1002_1847 281
736 3300050489 nmdc:mga03683_72738_c1 nmdc:mga03683_72738_c1_317_1207 281
737 3300050490 nmdc:mga03n38_124801_c1 nmdc:mga03n38_124801_c1_72_962 281
738 3300050492 nmdc:mga0yw44_122698_c1 nmdc:mga0yw44_122698_c1_42_932 281
739 3300050493 nmdc:mga0k408_84487_c1 nmdc:mga0k408_84487_c1_432_1322 281
740 3300050494 nmdc:mga06z11_42193_c1 nmdc:mga06z11_42193_c1_796_1686 281
741 3300050496 nmdc:mga07m45_39646_c1 nmdc:mga07m45_39646_c1_487_1377 281
742 3300050511 nmdc:mga08y16_501429_c1 nmdc:mga08y16_501429_c1_216_1061 281
743 3300050516 nmdc:mga0sz30_139463_c1 nmdc:mga0sz30_139463_c1_201_1046 281
744 3300050516 nmdc:mga0sz30_71000_c1 nmdc:mga0sz30_71000_c1_542_1432 281
745 3300053088 Ga0500644_0014221 Ga0500644_0014221_315_1169 281
746 3300053125 Ga0500618_010798 Ga0500618_010798_1362_2207 281
747 3300053134 Ga0500658_0002369 Ga0500658_0002369_996_1844 281
748 3300053136 Ga0500559_0050613 Ga0500559_0050613_446_1300 281
749 3300053156 Ga0500622_0000697 Ga0500622_0000697_16823_17677 281
750 3300053156 Ga0500622_0000899 Ga0500622_0000899_2241_3086 281
751 iso_pu_bacteria 2515154113 2515636397 281
752 iso_pu_bacteria 2515154114 2515640887 281
753 iso_pu_bacteria 2516653077 2517036626 281
754 iso_pu_bacteria 2517287029 2517407323 281
755 iso_pu_bacteria 2585427528 2585538110 281
756 iso_pu_bacteria 2585427593 2585836058 281
757 iso_pu_bacteria 2738541333 2739032768 281
758 iso_pu_bacteria 2802429633 2806043747 281
759 iso_pu_bacteria 2802429634 2806050321 281
760 iso_pu_bacteria 2802429635 2806057138 281
761 iso_pu_bacteria 2802429636 2806064520 281
762 iso_pu_bacteria 2802429637 2806071787 281
763 iso_pu_bacteria 8005563573 8005567913 281
764 iso_pu_bacteria 8005570704 8005573541 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

50

301

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.9894 1 280
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.9859 1 280
4wgh-assembly1.cif.gz_A crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with nadp and acetate at 1.8 a resolution 0.9772 7 280
6cia-assembly1.cif.gz_A crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with nadph. 0.9599 1 280
6cia-assembly1.cif.gz_A crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with nadph. 0.9565 1 280
ID Description Score Start End Superfamily
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9894 1 280 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9859 1 280 3.20.20.100
5danA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9274 6 268 3.20.20.100
af_Q4DJ07_1_282_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9185 7 268 3.20.20.100
af_Q2FW57_1_282_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9151 14 268 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A526YEY3-F1-model_v4 Aldo/keto reductase 1.006 33 118 GO:0016491
AF-A0A251XMJ8-F1-model_v4 General stress protein 69 1.002 56 173 GO:0016491
AF-A0A536P309-F1-model_v4 Aldo/keto reductase 1.001 6 153 GO:0016491
AF-A0A2V6KHN7-F1-model_v4 Oxidoreductase 1 6 104
AF-W1XLZ6-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9989 39 142 GO:0016491

Feature Viewer

pLDDT pTM Quality
95.53 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map