F479731

General Info

Members Datasets Scaffolds Average Seq Length
764 245 1528 326

Family's Representative Sequence

Representative Sequence 3300025926|Ga0207659_10023766|Ga0207659_100237663
Length 319
Sequence MTRRILVLLLFATLVLVSCSSNSSDTASKGLKLAFVTNNAADFWTIARRGVEKADEELADVTAEFKINADPTAAEQKRILDDLLATGINGIAISPVDPQNQTALINDAAQKTLVFTQDSDAPDSNRACYIGTDNVAAGRQAGELIKEVVPSGKIMLFVGRLDAKNAQERIQGIKEVLMGTKIEIVDVRTDDVDNVRAKANVADTIVKYPDIKALVGLWSYNGPAILSAVKDAKKTGQIKIVAFDEADETLAGIQEGAIHGTVVQQPYEFGYQAIKIMAQVLKGDRSVIPESKQIIIPTQVIKKEDVEAFAAKIKQLRGN

Samples

Sample ID Description Type Environment
1 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
192 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
193 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
218 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
219 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
220 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
221 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
222 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
223 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
224 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
225 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
226 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
227 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
228 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
229 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
232 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 1.05
Rhizosphere 98.17
Stem 0
Stem Tuber 0
Unclassified 9.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207659_10023766 3300025926 Bacteria 4096
2 SwRhRL2b_contig_3850439 2162886007 Bacteria 1681
3 MRS1b_contig_1683322 2162886011 Bacteria 1209
4 CNAas_1000550 3300000532 Bacteria 3633
5 JGI25406J46586_10007918 3300003203 Bacteria 4835
6 JGI25406J46586_10022904 3300003203 Bacteria 2478
7 rootL2_10268796 3300003322 Bacteria 1139
8 Ga0065714_10064443 3300005288 Bacteria 96728
9 Ga0065712_10005645 3300005290 Bacteria 2824
10 Ga0065712_10019905 3300005290 Bacteria 2600
11 Ga0065712_10067735 3300005290 Bacteria 96722
12 Ga0065712_10069675 3300005290 Bacteria 6902
13 Ga0065712_10152710 3300005290 Bacteria 1357
14 Ga0065715_10099289 3300005293 Bacteria 3431
15 Ga0065715_10105530 3300005293 Bacteria 2887
16 Ga0065715_10133163 3300005293 Bacteria 1977
17 Ga0065715_10139141 3300005293 Bacteria 1881
18 Ga0065715_10237905 3300005293 Bacteria 1210
19 Ga0065707_10000758 3300005295 Bacteria 13705
20 Ga0065707_10004571 3300005295 Bacteria 4015
21 Ga0065707_10093675 3300005295 Bacteria 3583
22 Ga0065707_10112754 3300005295 Bacteria 2335
23 Ga0070676_10008068 3300005328 Bacteria 5661
24 Ga0070676_10150913 3300005328 Unclassified 1487
25 Ga0070683_100039366 3300005329 Bacteria 4339
26 Ga0070683_100050657 3300005329 Bacteria 3845
27 Ga0070690_100015827 3300005330 Unclassified 4506
28 Ga0070690_100017961 3300005330 Bacteria 4263
29 Ga0070690_100029467 3300005330 Bacteria 3405
30 Ga0070670_100005403 3300005331 Bacteria 10784
31 Ga0070670_100063427 3300005331 Bacteria 3171
32 Ga0070670_100070241 3300005331 Bacteria 3006
33 Ga0070670_100076610 3300005331 Bacteria 2873
34 Ga0070670_100128011 3300005331 Bacteria 2191
35 Ga0070670_100194853 3300005331 Bacteria 1760
36 Ga0070677_10019563 3300005333 Bacteria 2455
37 Ga0068869_100002240 3300005334 Bacteria 11636
38 Ga0068869_100056380 3300005334 Bacteria 2866
39 Ga0068869_100073683 3300005334 Bacteria 2532
40 Ga0068869_100190510 3300005334 Bacteria 1612
41 Ga0068869_100242791 3300005334 Bacteria 1436
42 Ga0070666_10009119 3300005335 Bacteria 6187
43 Ga0070666_10042742 3300005335 Bacteria 3033
44 Ga0070666_10063771 3300005335 Bacteria 2498
45 Ga0070680_100031524 3300005336 Bacteria 4263
46 Ga0070680_100363526 3300005336 Bacteria 1231
47 Ga0070682_100007279 3300005337 Bacteria 6239
48 Ga0068868_100014059 3300005338 Bacteria 5892
49 Ga0068868_100076074 3300005338 Unclassified 2684
50 Ga0068868_100316847 3300005338 Bacteria 1328
51 Ga0068868_100325116 3300005338 Bacteria 1311
52 Ga0070660_100070853 3300005339 Bacteria 2721
53 Ga0070689_100217775 3300005340 Unclassified 1565
54 Ga0070687_100006287 3300005343 Bacteria 4862
55 Ga0070687_100161843 3300005343 Bacteria 1324
56 Ga0070687_100190376 3300005343 Unclassified 1236
57 Ga0070692_10013072 3300005345 Bacteria 3862
58 Ga0070692_10062316 3300005345 Bacteria 1968
59 Ga0070668_100044653 3300005347 Bacteria 3399
60 Ga0070668_100140012 3300005347 Unclassified 1949
61 Ga0070668_100179887 3300005347 Bacteria 1727
62 Ga0070669_100000513 3300005353 Bacteria 29162
63 Ga0070669_100001394 3300005353 Bacteria 17440
64 Ga0070669_100058375 3300005353 Bacteria 2831
65 Ga0070669_100196335 3300005353 Bacteria 1586
66 Ga0070669_100299662 3300005353 Bacteria 1293
67 Ga0070675_100013812 3300005354 Bacteria 6357
68 Ga0070675_100027342 3300005354 Bacteria 4582
69 Ga0070675_100033962 3300005354 Bacteria 4137
70 Ga0070675_100076062 3300005354 Bacteria 2792
71 Ga0070675_100077372 3300005354 Bacteria 2769
72 Ga0070675_100079099 3300005354 Unclassified 2739
73 Ga0070671_100009426 3300005355 Bacteria 7838
74 Ga0070671_100009746 3300005355 Bacteria 7716
75 Ga0070671_100143439 3300005355 Bacteria 2016
76 Ga0070671_100189357 3300005355 Bacteria 1744
77 Ga0070671_100209846 3300005355 Bacteria 1652
78 Ga0070674_100148102 3300005356 Bacteria 1769
79 Ga0070674_100150963 3300005356 Bacteria 1753
80 Ga0070673_100001658 3300005364 Bacteria 13180
81 Ga0070673_100038051 3300005364 Bacteria 3671
82 Ga0070673_100056950 3300005364 Bacteria 3086
83 Ga0070673_100089380 3300005364 Unclassified 2514
84 Ga0070673_100156022 3300005364 Bacteria 1937
85 Ga0070673_100365919 3300005364 Bacteria 1283
86 Ga0070688_100131684 3300005365 Unclassified 1688
87 Ga0070688_100251070 3300005365 Bacteria 1259
88 Ga0070659_100013438 3300005366 Bacteria 6094
89 Ga0070667_100025214 3300005367 Bacteria 4943
90 Ga0070667_100197954 3300005367 Bacteria 1782
91 Ga0070667_100463563 3300005367 Bacteria 1159
92 Ga0070709_10000007 3300005434 Bacteria 182605
93 Ga0070709_10175762 3300005434 Bacteria 1500
94 Ga0070701_10025660 3300005438 Bacteria 2864
95 Ga0070705_100002331 3300005440 Bacteria 9577
96 Ga0070705_100045085 3300005440 Bacteria 2535
97 Ga0070705_100200877 3300005440 Unclassified 1366
98 Ga0070700_100000005 3300005441 Bacteria 233160
99 Ga0070700_100100339 3300005441 Bacteria 1906
100 Ga0070700_100137802 3300005441 Bacteria 1655
101 Ga0070694_100009478 3300005444 Bacteria 5972
102 Ga0070694_100012281 3300005444 Bacteria 5321
103 Ga0070694_100025089 3300005444 Bacteria 3855
104 Ga0070694_100030684 3300005444 Bacteria 3518
105 Ga0070694_100099718 3300005444 Bacteria 2053
106 Ga0070694_100146834 3300005444 Bacteria 1719
107 Ga0070694_100189868 3300005444 Bacteria 1525
108 Ga0070694_100239552 3300005444 Bacteria 1368
109 Ga0070694_100286455 3300005444 Bacteria 1258
110 Ga0070708_100001306 3300005445 Bacteria 19096
111 Ga0070708_100002323 3300005445 Bacteria 14714
112 Ga0070708_100576863 3300005445 Bacteria 1061
113 Ga0070678_100053899 3300005456 Bacteria 2927
114 Ga0070681_10011804 3300005458 Bacteria 8660
115 Ga0070681_10015413 3300005458 Bacteria 7608
116 Ga0068867_100036440 3300005459 Bacteria 3571
117 Ga0068867_100199297 3300005459 Bacteria 1602
118 Ga0068867_100254007 3300005459 Bacteria 1430
119 Ga0068867_100347500 3300005459 Bacteria 1237
120 Ga0068867_100363599 3300005459 Bacteria 1211
121 Ga0070685_10258886 3300005466 Bacteria 1156
122 Ga0070706_100000085 3300005467 Bacteria 108868
123 Ga0070706_100005555 3300005467 Bacteria 12003
124 Ga0070706_100009600 3300005467 Bacteria 8998
125 Ga0070706_100209888 3300005467 Bacteria 1818
126 Ga0070706_100304035 3300005467 Bacteria 1488
127 Ga0070707_100005286 3300005468 Bacteria 12090
128 Ga0070707_100054650 3300005468 Bacteria 3828
129 Ga0070707_100060889 3300005468 Bacteria 3620
130 Ga0070707_100085498 3300005468 Bacteria 3049
131 Ga0070707_100102046 3300005468 Bacteria 2780
132 Ga0070698_100002308 3300005471 Bacteria 21131
133 Ga0070698_100029830 3300005471 Bacteria 5659
134 Ga0070698_100066562 3300005471 Bacteria 3625
135 Ga0070698_100102638 3300005471 Bacteria 2830
136 Ga0070698_100151008 3300005471 Bacteria 2271
137 Ga0070698_100190077 3300005471 Bacteria 1991
138 Ga0070699_100000642 3300005518 Bacteria 32720
139 Ga0070699_100006443 3300005518 Bacteria 10222
140 Ga0070699_100014525 3300005518 Bacteria 6774
141 Ga0070699_100137918 3300005518 Bacteria 2152
142 Ga0070699_100240732 3300005518 Bacteria 1615
143 Ga0070699_100309628 3300005518 Bacteria 1418
144 Ga0070679_100046874 3300005530 Bacteria 4309
145 Ga0070679_100064443 3300005530 Bacteria 3652
146 Ga0070684_100039859 3300005535 Bacteria 4042
147 Ga0070684_100040634 3300005535 Bacteria 4006
148 Ga0070684_100090316 3300005535 Bacteria 2724
149 Ga0070684_100201850 3300005535 Bacteria 1811
150 Ga0070697_100000174 3300005536 Bacteria 52444
151 Ga0070697_100021533 3300005536 Bacteria 5108
152 Ga0070697_100336170 3300005536 Unclassified 1303
153 Ga0070697_100494375 3300005536 Unclassified 1069
154 Ga0070697_100538822 3300005536 Bacteria 1023
155 Ga0068853_100117012 3300005539 Bacteria 2374
156 Ga0068853_100129910 3300005539 Bacteria 2254
157 Ga0070672_100037329 3300005543 Bacteria 3706
158 Ga0070672_100045454 3300005543 Bacteria 3397
159 Ga0070672_100122778 3300005543 Bacteria 2128
160 Ga0070672_100201275 3300005543 Unclassified 1665
161 Ga0070672_100262261 3300005543 Bacteria 1457
162 Ga0070686_100000360 3300005544 Bacteria 29215
163 Ga0070686_100023369 3300005544 Bacteria 3694
164 Ga0070686_100143302 3300005544 Bacteria 1665
165 Ga0070695_100063591 3300005545 Unclassified 2399
166 Ga0070695_100430432 3300005545 Bacteria 1007
167 Ga0070696_100056368 3300005546 Bacteria 2741
168 Ga0070696_100057506 3300005546 Bacteria 2715
169 Ga0070696_100071761 3300005546 Bacteria 2437
170 Ga0070696_100235191 3300005546 Bacteria 1380
171 Ga0070693_100005591 3300005547 Bacteria 6056
172 Ga0070693_100082415 3300005547 Bacteria 1920
173 Ga0070665_100004134 3300005548 Bacteria 15265
174 Ga0070665_100028955 3300005548 Bacteria 5576
175 Ga0070665_100269695 3300005548 Unclassified 1703
176 Ga0070704_100006585 3300005549 Bacteria 6853
177 Ga0070704_100287562 3300005549 Unclassified 1365
178 Ga0070704_100391859 3300005549 Bacteria 1183
179 Ga0070704_100485281 3300005549 Bacteria 1070
180 Ga0070664_100007698 3300005564 Bacteria 8699
181 Ga0070664_100008545 3300005564 Bacteria 8281
182 Ga0070664_100016573 3300005564 Bacteria 6044
183 Ga0070664_100056083 3300005564 Bacteria 3348
184 Ga0070664_100076714 3300005564 Bacteria 2872
185 Ga0070664_100093221 3300005564 Bacteria 2609
186 Ga0070664_100335710 3300005564 Bacteria 1372
187 Ga0068857_100019110 3300005577 Bacteria 6014
188 Ga0068857_100059476 3300005577 Bacteria 3395
189 Ga0068857_100349617 3300005577 Bacteria 1369
190 Ga0068854_100024092 3300005578 Bacteria 4164
191 Ga0068854_100026750 3300005578 Bacteria 3968
192 Ga0068854_100076171 3300005578 Bacteria 2465
193 Ga0068854_100157737 3300005578 Bacteria 1755
194 Ga0070702_100044234 3300005615 Unclassified 2513
195 Ga0070702_100128171 3300005615 Bacteria 1599
196 Ga0068852_100114564 3300005616 Bacteria 2456
197 Ga0068859_100009476 3300005617 Bacteria 9834
198 Ga0068859_100025185 3300005617 Bacteria 5970
199 Ga0068859_100025298 3300005617 Bacteria 5955
200 Ga0068859_100027605 3300005617 Bacteria 5693
201 Ga0068859_100050938 3300005617 Bacteria 4161
202 Ga0068859_100054790 3300005617 Bacteria 4012
203 Ga0068859_100106060 3300005617 Bacteria 2869
204 Ga0068859_100110333 3300005617 Bacteria 2813
205 Ga0068859_100152452 3300005617 Bacteria 2387
206 Ga0068859_100166549 3300005617 Bacteria 2284
207 Ga0068859_100218194 3300005617 Bacteria 1995
208 Ga0068859_100261660 3300005617 Bacteria 1821
209 Ga0068859_100274147 3300005617 Bacteria 1779
210 Ga0068859_100361572 3300005617 Unclassified 1546
211 Ga0068864_100000940 3300005618 Bacteria 24377
212 Ga0068864_100015209 3300005618 Bacteria 6400
213 Ga0068864_100027228 3300005618 Bacteria 4825
214 Ga0068864_100131132 3300005618 Bacteria 2251
215 Ga0068864_100139794 3300005618 Bacteria 2184
216 Ga0068864_100321612 3300005618 Bacteria 1453
217 Ga0068866_10007596 3300005718 Bacteria 4544
218 Ga0068866_10070267 3300005718 Bacteria 1847
219 Ga0068866_10091671 3300005718 Bacteria 1656
220 Ga0068861_100006960 3300005719 Bacteria 7726
221 Ga0068861_100078825 3300005719 Bacteria 2573
222 Ga0068861_100104268 3300005719 Bacteria 2262
223 Ga0068861_100141903 3300005719 Bacteria 1961
224 Ga0068861_100239903 3300005719 Bacteria 1541
225 Ga0068851_10002299 3300005834 Bacteria 8405
226 Ga0068870_10012545 3300005840 Bacteria 3964
227 Ga0068870_10070940 3300005840 Bacteria 1900
228 Ga0068863_100105166 3300005841 Bacteria 2685
229 Ga0068863_100134069 3300005841 Bacteria 2366
230 Ga0068863_100155775 3300005841 Bacteria 2187
231 Ga0068863_100192572 3300005841 Bacteria 1960
232 Ga0068863_100237913 3300005841 Bacteria 1757
233 Ga0068863_100408744 3300005841 Unclassified 1328
234 Ga0068858_100006092 3300005842 Bacteria 11764
235 Ga0068858_100032810 3300005842 Bacteria 4823
236 Ga0068858_100040582 3300005842 Bacteria 4317
237 Ga0068858_100188885 3300005842 Unclassified 1946
238 Ga0068858_100279165 3300005842 Bacteria 1590
239 Ga0068858_100489206 3300005842 Bacteria 1188
240 Ga0068860_100003772 3300005843 Bacteria 15593
241 Ga0068860_100020149 3300005843 Bacteria 6463
242 Ga0068860_100031053 3300005843 Bacteria 5136
243 Ga0068860_100032002 3300005843 Bacteria 5057
244 Ga0068860_100033059 3300005843 Bacteria 4966
245 Ga0068860_100078078 3300005843 Bacteria 3149
246 Ga0068860_100117020 3300005843 Bacteria 2550
247 Ga0068860_100120434 3300005843 Unclassified 2513
248 Ga0068860_100139428 3300005843 Unclassified 2330
249 Ga0068860_100275023 3300005843 Bacteria 1644
250 Ga0068860_100411901 3300005843 Bacteria 1339
251 Ga0068862_100021125 3300005844 Bacteria 5442
252 Ga0068862_100021377 3300005844 Bacteria 5406
253 Ga0068862_100071220 3300005844 Unclassified 3002
254 Ga0068862_100081193 3300005844 Bacteria 2812
255 Ga0068862_100096672 3300005844 Bacteria 2578
256 Ga0068862_100432749 3300005844 Bacteria 1237
257 Ga0081455_10004446 3300005937 Bacteria 15723
258 Ga0081455_10102752 3300005937 Bacteria 2291
259 Ga0081539_10000490 3300005985 Bacteria 83577
260 Ga0081539_10000545 3300005985 Bacteria 77830
261 Ga0081539_10002137 3300005985 Bacteria 29184
262 Ga0081539_10023541 3300005985 Bacteria 4031
263 Ga0081539_10076396 3300005985 Bacteria 1775
264 Ga0075366_10053000 3300006195 Bacteria 2410
265 Ga0097621_100067061 3300006237 Bacteria 2957
266 Ga0097621_100085463 3300006237 Bacteria 2631
267 Ga0097621_100090576 3300006237 Unclassified 2559
268 Ga0097621_100176635 3300006237 Bacteria 1843
269 Ga0097621_100261734 3300006237 Bacteria 1518
270 Ga0068871_100025464 3300006358 Bacteria 4604
271 Ga0068871_100258257 3300006358 Bacteria 1519
272 Ga0075428_100035990 3300006844 Bacteria 5456
273 Ga0075428_100045297 3300006844 Unclassified 4833
274 Ga0075428_100099939 3300006844 Bacteria 3164
275 Ga0075428_100216910 3300006844 Bacteria 2067
276 Ga0075428_100255838 3300006844 Bacteria 1886
277 Ga0075428_100279128 3300006844 Bacteria 1798
278 Ga0075430_100011816 3300006846 Bacteria 7430
279 Ga0075431_100002148 3300006847 Bacteria 18850
280 Ga0075431_100038492 3300006847 Bacteria 4924
281 Ga0075431_100044158 3300006847 Bacteria 4597
282 Ga0075431_100068681 3300006847 Bacteria 3657
283 Ga0075431_100139769 3300006847 Bacteria 2496
284 Ga0075431_100228762 3300006847 Bacteria 1895
285 Ga0075431_100240128 3300006847 Bacteria 1843
286 Ga0075433_10005373 3300006852 Bacteria 10063
287 Ga0075433_10007471 3300006852 Bacteria 8676
288 Ga0075433_10042436 3300006852 Bacteria 3946
289 Ga0075433_10146616 3300006852 Bacteria 2098
290 Ga0075433_10181304 3300006852 Bacteria 1874
291 Ga0075434_100052267 3300006871 Bacteria 4060
292 Ga0075434_100063600 3300006871 Bacteria 3673
293 Ga0075434_100088613 3300006871 Bacteria 3096
294 Ga0075434_100096004 3300006871 Bacteria 2969
295 Ga0075434_100175187 3300006871 Bacteria 2165
296 Ga0075434_100206624 3300006871 Bacteria 1984
297 Ga0075429_100002863 3300006880 Bacteria 14603
298 Ga0075429_100020828 3300006880 Bacteria 5690
299 Ga0075429_100184635 3300006880 Bacteria 1827
300 Ga0075429_100187004 3300006880 Bacteria 1815
301 Ga0075429_100215619 3300006880 Bacteria 1681
302 Ga0068865_100067982 3300006881 Bacteria 2518
303 Ga0068865_100068227 3300006881 Bacteria 2514
304 Ga0068865_100225566 3300006881 Unclassified 1467
305 Ga0068865_100227294 3300006881 Unclassified 1462
306 Ga0075436_100015645 3300006914 Bacteria 5193
307 Ga0097620_100009476 3300006931 Bacteria 9834
308 Ga0097620_100010769 3300006931 Bacteria 9203
309 Ga0097620_100025185 3300006931 Bacteria 5970
310 Ga0097620_100025297 3300006931 Bacteria 5955
311 Ga0097620_100027605 3300006931 Bacteria 5693
312 Ga0097620_100038736 3300006931 Bacteria 4782
313 Ga0097620_100050938 3300006931 Bacteria 4161
314 Ga0097620_100054789 3300006931 Bacteria 4012
315 Ga0097620_100106061 3300006931 Bacteria 2869
316 Ga0097620_100110329 3300006931 Bacteria 2813
317 Ga0097620_100152459 3300006931 Bacteria 2387
318 Ga0097620_100166558 3300006931 Bacteria 2284
319 Ga0097620_100218205 3300006931 Bacteria 1995
320 Ga0097620_100261653 3300006931 Bacteria 1821
321 Ga0097620_100274158 3300006931 Bacteria 1779
322 Ga0097620_100310401 3300006931 Bacteria 1671
323 Ga0097620_100332966 3300006931 Bacteria 1612
324 Ga0097620_100361556 3300006931 Unclassified 1546
325 Ga0075435_100000087 3300007076 Bacteria 48995
326 Ga0075435_100024324 3300007076 Bacteria 4698
327 Ga0075435_100155874 3300007076 Bacteria 1921
328 Ga0075435_100264828 3300007076 Bacteria 1465
329 Ga0099794_10000677 3300007265 Bacteria 11399
330 Ga0105240_10013484 3300009093 Bacteria 11227
331 Ga0105240_10087156 3300009093 Bacteria 3824
332 Ga0105240_10097795 3300009093 Bacteria 3576
333 Ga0111539_10005636 3300009094 Bacteria 16190
334 Ga0111539_10020231 3300009094 Bacteria 8202
335 Ga0111539_10066534 3300009094 Bacteria 4256
336 Ga0111539_10069740 3300009094 Bacteria 4151
337 Ga0111539_10122332 3300009094 Unclassified 3050
338 Ga0111539_10180196 3300009094 Unclassified 2468
339 Ga0111539_10346310 3300009094 Bacteria 1729
340 Ga0111539_10360738 3300009094 Bacteria 1691
341 Ga0111539_10390353 3300009094 Bacteria 1621
342 Ga0105245_10115157 3300009098 Bacteria 2505
343 Ga0105245_10137098 3300009098 Bacteria 2301
344 Ga0105247_10136012 3300009101 Bacteria 1606
345 Ga0114129_10024214 3300009147 Bacteria 8603
346 Ga0114129_10036196 3300009147 Bacteria 6971
347 Ga0114129_10051262 3300009147 Bacteria 5795
348 Ga0114129_10118205 3300009147 Bacteria 3652
349 Ga0114129_10177440 3300009147 Bacteria 2901
350 Ga0114129_10188107 3300009147 Bacteria 2805
351 Ga0114129_10258554 3300009147 Unclassified 2335
352 Ga0114129_10275762 3300009147 Bacteria 2248
353 Ga0114129_10310193 3300009147 Unclassified 2100
354 Ga0114129_10440233 3300009147 Bacteria 1711
355 Ga0114129_10444948 3300009147 Bacteria 1700
356 Ga0114129_10513349 3300009147 Bacteria 1563
357 Ga0114129_10686208 3300009147 Bacteria 1318
358 Ga0105243_10000051 3300009148 Bacteria 139849
359 Ga0105243_10009589 3300009148 Bacteria 7373
360 Ga0105243_10150720 3300009148 Bacteria 1994
361 Ga0105243_10340076 3300009148 Unclassified 1374
362 Ga0105241_10061261 3300009174 Bacteria 2897
363 Ga0105241_10071251 3300009174 Bacteria 2698
364 Ga0105241_10320408 3300009174 Unclassified 1336
365 Ga0105242_10001757 3300009176 Bacteria 17104
366 Ga0105242_10007183 3300009176 Bacteria 8590
367 Ga0105242_10012447 3300009176 Bacteria 6550
368 Ga0105242_10021916 3300009176 Bacteria 5020
369 Ga0105242_10057517 3300009176 Unclassified 3185
370 Ga0105242_10347255 3300009176 Unclassified 1369
371 Ga0105242_10409016 3300009176 Unclassified 1268
372 Ga0105248_10001657 3300009177 Bacteria 24787
373 Ga0105248_10017077 3300009177 Bacteria 7993
374 Ga0105248_10029605 3300009177 Bacteria 6109
375 Ga0105248_10030797 3300009177 Bacteria 5994
376 Ga0105248_10030942 3300009177 Bacteria 5979
377 Ga0105248_10086179 3300009177 Bacteria 3534
378 Ga0105248_10132647 3300009177 Bacteria 2810
379 Ga0105248_10155251 3300009177 Bacteria 2582
380 Ga0105248_10175976 3300009177 Unclassified 2412
381 Ga0105248_10211933 3300009177 Bacteria 2183
382 Ga0105237_10005597 3300009545 Bacteria 14159
383 Ga0105237_10030667 3300009545 Bacteria 5460
384 Ga0105237_10075010 3300009545 Bacteria 3374
385 Ga0105238_10028929 3300009551 Bacteria 5645
386 Ga0105249_10009161 3300009553 Bacteria 8656
387 Ga0105249_10028859 3300009553 Bacteria 5008
388 Ga0105239_10025031 3300010375 Bacteria 6576
389 Ga0105239_10041322 3300010375 Bacteria 5054
390 Ga0105239_10745736 3300010375 Bacteria 1121
391 Ga0105246_10100434 3300011119 Bacteria 2105
392 Ga0157373_10025517 3300013100 Bacteria 4274
393 Ga0157373_10067953 3300013100 Bacteria 2520
394 Ga0157370_10023205 3300013104 Bacteria 6163
395 Ga0157374_10149258 3300013296 Bacteria 2272
396 Ga0157374_10272680 3300013296 Bacteria 1669
397 Ga0157378_10013955 3300013297 Bacteria 7028
398 Ga0157378_10045015 3300013297 Bacteria 3920
399 Ga0157378_10139524 3300013297 Bacteria 2250
400 Ga0157378_10142120 3300013297 Bacteria 2229
401 Ga0157378_10168070 3300013297 Bacteria 2055
402 Ga0157378_10211054 3300013297 Bacteria 1841
403 Ga0157378_10238614 3300013297 Bacteria 1736
404 Ga0157378_10249364 3300013297 Unclassified 1699
405 Ga0157378_10588815 3300013297 Bacteria 1122
406 Ga0163162_10002317 3300013306 Bacteria 17858
407 Ga0163162_10010881 3300013306 Bacteria 8856
408 Ga0163162_10018793 3300013306 Bacteria 6775
409 Ga0163162_10098546 3300013306 Bacteria 3012
410 Ga0163162_10261555 3300013306 Bacteria 1862
411 Ga0163162_10646005 3300013306 Bacteria 1182
412 Ga0157372_10135366 3300013307 Bacteria 2837
413 Ga0157372_10458535 3300013307 Bacteria 1485
414 Ga0157375_10084869 3300013308 Bacteria 3216
415 Ga0157375_10174322 3300013308 Bacteria 2299
416 Ga0157375_10189072 3300013308 Bacteria 2213
417 Ga0157375_10266263 3300013308 Bacteria 1875
418 Ga0157375_10350015 3300013308 Bacteria 1643
419 Ga0157375_10383852 3300013308 Unclassified 1571
420 Ga0157375_10459595 3300013308 Bacteria 1438
421 Ga0157375_10486444 3300013308 Bacteria 1399
422 Ga0163163_10005745 3300014325 Bacteria 10768
423 Ga0163163_10006209 3300014325 Bacteria 10422
424 Ga0163163_10035144 3300014325 Bacteria 4860
425 Ga0163163_10041812 3300014325 Bacteria 4485
426 Ga0163163_10063135 3300014325 Bacteria 3672
427 Ga0163163_10071236 3300014325 Bacteria 3463
428 Ga0163163_10073522 3300014325 Bacteria 3410
429 Ga0163163_10117879 3300014325 Unclassified 2687
430 Ga0163163_10125775 3300014325 Bacteria 2601
431 Ga0163163_10228850 3300014325 Bacteria 1908
432 Ga0163163_10418881 3300014325 Bacteria 1398
433 Ga0163163_10532706 3300014325 Bacteria 1237
434 Ga0157380_10002651 3300014326 Bacteria 12128
435 Ga0157380_10006530 3300014326 Bacteria 8222
436 Ga0157380_10023207 3300014326 Unclassified 4679
437 Ga0157380_10119988 3300014326 Bacteria 2226
438 Ga0157380_10150298 3300014326 Bacteria 2012
439 Ga0157380_10176706 3300014326 Bacteria 1872
440 Ga0157380_10219398 3300014326 Bacteria 1700
441 Ga0157379_10030421 3300014968 Bacteria 4806
442 Ga0157379_10060238 3300014968 Bacteria 3393
443 Ga0157379_10123240 3300014968 Bacteria 2333
444 Ga0157379_10165712 3300014968 Bacteria 1994
445 Ga0157379_10237765 3300014968 Bacteria 1652
446 Ga0157376_10089101 3300014969 Bacteria 2667
447 Ga0157376_10225102 3300014969 Bacteria 1739
448 Ga0163161_10099982 3300017792 Bacteria 2158
449 Ga0163161_10121032 3300017792 Bacteria 1967
450 Ga0163161_10140861 3300017792 Bacteria 1826
451 Ga0213876_10016055 3300021384 Bacteria 3960
452 Ga0207697_10007027 3300025315 Bacteria 5041
453 Ga0207656_10014154 3300025321 Bacteria 3068
454 Ga0207653_10019983 3300025885 Bacteria 2116
455 Ga0207682_10009933 3300025893 Bacteria 3740
456 Ga0207682_10050379 3300025893 Bacteria 1721
457 Ga0207642_10003588 3300025899 Bacteria 4921
458 Ga0207642_10006285 3300025899 Bacteria 3942
459 Ga0207642_10065425 3300025899 Bacteria 1708
460 Ga0207710_10001377 3300025900 Bacteria 12175
461 Ga0207710_10010970 3300025900 Bacteria 3817
462 Ga0207688_10022396 3300025901 Bacteria 3458
463 Ga0207688_10202172 3300025901 Bacteria 1191
464 Ga0207680_10052408 3300025903 Bacteria 2445
465 Ga0207647_10011279 3300025904 Bacteria 6271
466 Ga0207699_10000014 3300025906 Bacteria 260521
467 Ga0207645_10144202 3300025907 Bacteria 1552
468 Ga0207643_10004192 3300025908 Bacteria 7771
469 Ga0207643_10013915 3300025908 Bacteria 4365
470 Ga0207643_10015235 3300025908 Bacteria 4182
471 Ga0207643_10015832 3300025908 Bacteria 4106
472 Ga0207643_10035126 3300025908 Bacteria 2810
473 Ga0207643_10043670 3300025908 Unclassified 2530
474 Ga0207684_10000091 3300025910 Bacteria 170468
475 Ga0207684_10028778 3300025910 Bacteria 4733
476 Ga0207654_10281365 3300025911 Unclassified 1125
477 Ga0207707_10017411 3300025912 Bacteria 6265
478 Ga0207707_10036222 3300025912 Bacteria 4315
479 Ga0207707_10038411 3300025912 Bacteria 4183
480 Ga0207695_10057037 3300025913 Bacteria 4061
481 Ga0207695_10260866 3300025913 Bacteria 1630
482 Ga0207671_10003243 3300025914 Bacteria 16369
483 Ga0207671_10017259 3300025914 Bacteria 5573
484 Ga0207660_10293368 3300025917 Unclassified 1293
485 Ga0207662_10013885 3300025918 Bacteria 4508
486 Ga0207662_10273076 3300025918 Unclassified 1116
487 Ga0207657_10037034 3300025919 Bacteria 4361
488 Ga0207649_10050583 3300025920 Bacteria 2571
489 Ga0207652_10023696 3300025921 Bacteria 5087
490 Ga0207652_10083662 3300025921 Bacteria 2794
491 Ga0207646_10006452 3300025922 Bacteria 12108
492 Ga0207646_10057935 3300025922 Bacteria 3461
493 Ga0207646_10190366 3300025922 Unclassified 1853
494 Ga0207646_10207152 3300025922 Unclassified 1771
495 Ga0207646_10395617 3300025922 Bacteria 1248
496 Ga0207681_10028290 3300025923 Bacteria 3630
497 Ga0207681_10041915 3300025923 Bacteria 3054
498 Ga0207681_10069024 3300025923 Bacteria 2457
499 Ga0207694_10221163 3300025924 Bacteria 1545
500 Ga0207650_10002063 3300025925 Bacteria 14046
501 Ga0207650_10005174 3300025925 Bacteria 8901
502 Ga0207650_10034590 3300025925 Bacteria 3665
503 Ga0207650_10049644 3300025925 Bacteria 3099
504 Ga0207650_10058924 3300025925 Bacteria 2860
505 Ga0207650_10068102 3300025925 Unclassified 2672
506 Ga0207650_10106526 3300025925 Bacteria 2165
507 Ga0207650_10216683 3300025925 Bacteria 1539
508 Ga0207650_10290616 3300025925 Unclassified 1333
509 Ga0207659_10005275 3300025926 Bacteria 7832
510 Ga0207659_10006348 3300025926 Bacteria 7238
511 Ga0207659_10006772 3300025926 Bacteria 7041
512 Ga0207659_10009002 3300025926 Bacteria 6226
513 Ga0207659_10049065 3300025926 Bacteria 2992
514 Ga0207659_10119379 3300025926 Bacteria 2018
515 Ga0207659_10175468 3300025926 Bacteria 1693
516 Ga0207659_10293793 3300025926 Unclassified 1332
517 Ga0207659_10446734 3300025926 Bacteria 1088
518 Ga0207687_10028795 3300025927 Bacteria 3732
519 Ga0207644_10032307 3300025931 Bacteria 3651
520 Ga0207644_10219990 3300025931 Archaea 1505
521 Ga0207690_10018757 3300025932 Bacteria 4246
522 Ga0207690_10218253 3300025932 Bacteria 1458
523 Ga0207706_10054869 3300025933 Bacteria 3516
524 Ga0207706_10060630 3300025933 Bacteria 3332
525 Ga0207706_10350191 3300025933 Bacteria 1284
526 Ga0207686_10000022 3300025934 Bacteria 174346
527 Ga0207686_10000141 3300025934 Bacteria 56428
528 Ga0207686_10010234 3300025934 Bacteria 5101
529 Ga0207686_10030721 3300025934 Unclassified 3184
530 Ga0207686_10154711 3300025934 Unclassified 1600
531 Ga0207709_10000056 3300025935 Bacteria 221962
532 Ga0207709_10003702 3300025935 Bacteria 9002
533 Ga0207709_10015049 3300025935 Bacteria 4284
534 Ga0207709_10182572 3300025935 Bacteria 1483
535 Ga0207669_10045031 3300025937 Bacteria 2597
536 Ga0207669_10161064 3300025937 Bacteria 1585
537 Ga0207704_10028150 3300025938 Bacteria 3113
538 Ga0207704_10248144 3300025938 Unclassified 1334
539 Ga0207704_10366695 3300025938 Bacteria 1126
540 Ga0207691_10014886 3300025940 Bacteria 7413
541 Ga0207691_10017259 3300025940 Bacteria 6847
542 Ga0207691_10019674 3300025940 Bacteria 6386
543 Ga0207691_10029772 3300025940 Bacteria 5106
544 Ga0207691_10152904 3300025940 Bacteria 2028
545 Ga0207691_10194837 3300025940 Unclassified 1766
546 Ga0207691_10199570 3300025940 Bacteria 1742
547 Ga0207691_10338229 3300025940 Bacteria 1289
548 Ga0207691_10393206 3300025940 Bacteria 1183
549 Ga0207711_10015202 3300025941 Bacteria 6391
550 Ga0207711_10034773 3300025941 Bacteria 4267
551 Ga0207689_10000692 3300025942 Bacteria 32300
552 Ga0207689_10000819 3300025942 Bacteria 29949
553 Ga0207689_10002656 3300025942 Bacteria 16531
554 Ga0207689_10027608 3300025942 Bacteria 4750
555 Ga0207689_10123421 3300025942 Bacteria 2130
556 Ga0207689_10139833 3300025942 Bacteria 1994
557 Ga0207689_10240353 3300025942 Unclassified 1497
558 Ga0207689_10370969 3300025942 Bacteria 1191
559 Ga0207661_10015473 3300025944 Bacteria 5614
560 Ga0207679_10008795 3300025945 Bacteria 6439
561 Ga0207679_10022469 3300025945 Bacteria 4296
562 Ga0207679_10028975 3300025945 Bacteria 3850
563 Ga0207679_10033726 3300025945 Bacteria 3605
564 Ga0207679_10077137 3300025945 Bacteria 2534
565 Ga0207679_10233176 3300025945 Bacteria 1555
566 Ga0207651_10046437 3300025960 Bacteria 2920
567 Ga0207651_10087050 3300025960 Bacteria 2273
568 Ga0207651_10317887 3300025960 Bacteria 1300
569 Ga0207668_10247781 3300025972 Unclassified 1445
570 Ga0207640_10016070 3300025981 Bacteria 4345
571 Ga0207640_10063861 3300025981 Bacteria 2449
572 Ga0207640_10063953 3300025981 Bacteria 2447
573 Ga0207658_10091540 3300025986 Unclassified 2360
574 Ga0207658_10268091 3300025986 Unclassified 1458
575 Ga0207677_10200632 3300026023 Bacteria 1585
576 Ga0207703_10021476 3300026035 Bacteria 5054
577 Ga0207703_10035659 3300026035 Bacteria 3953
578 Ga0207703_10039806 3300026035 Bacteria 3759
579 Ga0207703_10096570 3300026035 Bacteria 2495
580 Ga0207703_10112570 3300026035 Unclassified 2325
581 Ga0207703_10135061 3300026035 Bacteria 2135
582 Ga0207703_10144158 3300026035 Bacteria 2070
583 Ga0207703_10149910 3300026035 Bacteria 2032
584 Ga0207703_10248998 3300026035 Bacteria 1600
585 Ga0207703_10382107 3300026035 Bacteria 1303
586 Ga0207639_10014034 3300026041 Bacteria 5623
587 Ga0207639_10408687 3300026041 Unclassified 1224
588 Ga0207708_10000017 3300026075 Bacteria 190414
589 Ga0207708_10111408 3300026075 Bacteria 2125
590 Ga0207708_10124412 3300026075 Bacteria 2012
591 Ga0207708_10202659 3300026075 Bacteria 1583
592 Ga0207641_10049752 3300026088 Bacteria 3543
593 Ga0207641_10094831 3300026088 Bacteria 2618
594 Ga0207641_10099028 3300026088 Bacteria 2564
595 Ga0207641_10106103 3300026088 Bacteria 2483
596 Ga0207641_10172219 3300026088 Bacteria 1977
597 Ga0207641_10173880 3300026088 Bacteria 1968
598 Ga0207641_10341502 3300026088 Bacteria 1425
599 Ga0207648_10012820 3300026089 Bacteria 7831
600 Ga0207648_10032130 3300026089 Bacteria 4637
601 Ga0207648_10041509 3300026089 Bacteria 4039
602 Ga0207648_10063683 3300026089 Bacteria 3213
603 Ga0207648_10084904 3300026089 Bacteria 2761
604 Ga0207648_10097566 3300026089 Bacteria 2572
605 Ga0207648_10118730 3300026089 Bacteria 2324
606 Ga0207648_10300002 3300026089 Unclassified 1441
607 Ga0207676_10013132 3300026095 Bacteria 5946
608 Ga0207676_10034969 3300026095 Bacteria 3808
609 Ga0207676_10044053 3300026095 Bacteria 3440
610 Ga0207676_10065347 3300026095 Bacteria 2896
611 Ga0207676_10065798 3300026095 Bacteria 2888
612 Ga0207676_10090519 3300026095 Bacteria 2511
613 Ga0207676_10124315 3300026095 Unclassified 2181
614 Ga0207676_10198402 3300026095 Bacteria 1771
615 Ga0207674_10000469 3300026116 Bacteria 52895
616 Ga0207674_10048051 3300026116 Bacteria 4371
617 Ga0207674_10067537 3300026116 Bacteria 3599
618 Ga0207674_10228806 3300026116 Bacteria 1807
619 Ga0207675_100008562 3300026118 Bacteria 9623
620 Ga0207675_100034849 3300026118 Bacteria 4694
621 Ga0207675_100037351 3300026118 Bacteria 4530
622 Ga0207675_100047475 3300026118 Bacteria 4009
623 Ga0207675_100079445 3300026118 Bacteria 3074
624 Ga0207683_10026677 3300026121 Bacteria 4989
625 Ga0207683_10032448 3300026121 Bacteria 4537
626 Ga0207683_10065407 3300026121 Unclassified 3206
627 Ga0207683_10111071 3300026121 Bacteria 2454
628 Ga0207428_10003443 3300027907 Bacteria 15366
629 Ga0207428_10004084 3300027907 Bacteria 13985
630 Ga0207428_10008705 3300027907 Bacteria 9157
631 Ga0207428_10013729 3300027907 Bacteria 7061
632 Ga0207428_10020687 3300027907 Bacteria 5583
633 Ga0207428_10118998 3300027907 Bacteria 2027
634 Ga0268266_10217186 3300028379 Unclassified 1756
635 Ga0268265_10121118 3300028380 Bacteria 2155
636 Ga0268265_10346451 3300028380 Bacteria 1355
637 Ga0268264_10021000 3300028381 Bacteria 5335
638 Ga0268264_10030294 3300028381 Bacteria 4435
639 Ga0268264_10072467 3300028381 Bacteria 2921
640 Ga0268264_10107608 3300028381 Bacteria 2436
641 Ga0268264_10263388 3300028381 Bacteria 1607
642 Ga0268264_10318922 3300028381 Bacteria 1469
643 Ga0307513_10138530 3300031456 Bacteria 2364
644 Ga0307408_100005635 3300031548 Bacteria 8371
645 Ga0307405_10008437 3300031731 Bacteria 5223
646 Ga0307405_10125948 3300031731 Bacteria 1761
647 Ga0307413_10050733 3300031824 Bacteria 2495
648 Ga0307410_10015790 3300031852 Bacteria 4487
649 Ga0307410_10034733 3300031852 Unclassified 3269
650 Ga0307410_10204744 3300031852 Bacteria 1509
651 Ga0307406_10017759 3300031901 Bacteria 4148
652 Ga0307406_10023120 3300031901 Bacteria 3696
653 Ga0307406_10073444 3300031901 Bacteria 2249
654 Ga0307407_10000549 3300031903 Bacteria 11742
655 Ga0307416_100001556 3300032002 Bacteria 12557
656 Ga0307416_100018719 3300032002 Bacteria 4889
657 Ga0307414_10021057 3300032004 Bacteria 4080
658 Ga0307414_10025997 3300032004 Bacteria 3761
659 Ga0307414_10235055 3300032004 Bacteria 1514
660 Ga0307411_10001978 3300032005 Bacteria 8793
661 Ga0307411_10011611 3300032005 Bacteria 4765
662 Ga0307411_10319671 3300032005 Bacteria 1253
663 Ga0307415_100004046 3300032126 Bacteria 7561
664 Ga0307415_100138816 3300032126 Unclassified 1853
665 Ga0373951_0001069 3300035091 Bacteria 7339
666 Ga0373931_0104370 3300035691 Bacteria 1599
667 Ga0373937_0019953 3300036401 Bacteria 6003
668 Ga0395905_0072438 3300037471 Bacteria 3230
669 Ga0395901_0164196 3300038443 Bacteria 2332
670 Ga0436365_0773551 3300039437 Bacteria 52669
671 Ga0439448_0036755 3300042005 Bacteria 1571
672 Ga0439455_0005344 3300042012 Bacteria 2603
673 Ga0439458_0000686 3300042157 Bacteria 8756
674 Ga0495662_0037031 3300046476 Bacteria 2356
675 Ga0495594_0020972 3300046499 Bacteria 3486
676 Ga0495594_0192276 3300046499 Unclassified 1163
677 Ga0495598_0003878 3300046537 Bacteria 3205
678 Ga0495598_0034844 3300046537 Bacteria 1437
679 Ga0495621_0021608 3300046539 Bacteria 2123
680 Ga0495621_0094137 3300046539 Unclassified 1133
681 Ga0495645_0216918 3300046543 Bacteria 1289
682 Ga0495667_0027137 3300046559 Bacteria 3860
683 Ga0495658_0020052 3300046683 Unclassified 3501
684 Ga0495613_0001869 3300046689 Bacteria 15999
685 Ga0495613_0224039 3300046689 Bacteria 1319
686 Ga0495680_0101277 3300047322 Bacteria 2146
687 Ga0496103_0096362 3300048906 Bacteria 1870
688 Ga0496104_0061528 3300048907 Bacteria 3560
689 Ga0496107_0055070 3300048910 Bacteria 2873
690 Ga0496109_0002378 3300048912 Bacteria 15718
691 Ga0496109_0059436 3300048912 Bacteria 3492
692 Ga0496112_0095411 3300048915 Bacteria 2945
693 Ga0496112_0253186 3300048915 Bacteria 1712
694 Ga0496113_0142704 3300048916 Bacteria 1885
695 Ga0501298_002422 3300049521 Bacteria 2819
696 Ga0501034_0005352 3300049571 Bacteria 14050
697 Ga0501041_0092640 3300049577 Bacteria 1866
698 Ga0501042_0112972 3300049578 Bacteria 1956
699 Ga0501048_0100010 3300049582 Bacteria 2046
700 Ga0501071_0215722 3300049587 Bacteria 1444
701 Ga0501075_0055284 3300049591 Bacteria 2987
702 Ga0501076_0422846 3300049592 Bacteria 1096
703 Ga0501202_001083 3300049652 Bacteria 4239
704 Ga0501209_001419 3300049656 Bacteria 3382
705 Ga0501217_000266 3300049661 Bacteria 8143
706 Ga0501224_001645 3300049664 Bacteria 2992
707 Ga0501227_000204 3300049665 Bacteria 11880
708 Ga0501227_015355 3300049665 Bacteria 1710
709 Ga0501230_004593 3300049667 Unclassified 1906
710 Ga0501233_000916 3300049668 Bacteria 4991
711 Ga0501235_000632 3300049669 Bacteria 7076
712 Ga0501243_002143 3300049675 Bacteria 2874
713 Ga0501249_012166 3300049679 Bacteria 1816
714 Ga0501257_006833 3300049686 Bacteria 2539
715 Ga0501225_0001412 3300049705 Bacteria 7502
716 Ga0501225_0009480 3300049705 Bacteria 2770
717 Ga0501234_000423 3300049707 Bacteria 6322
718 Ga0501080_0022703 3300049742 Bacteria 5813
719 Ga0501266_008961 3300049763 Bacteria 1262
720 Ga0501270_008493 3300049767 Bacteria 1301
721 Ga0501044_0001307 3300049823 Bacteria 29369
722 Ga0501226_003192 3300049853 Bacteria 1952
723 nmdc:mga05p37_149162_c1 3300050507 Bacteria 2862
724 nmdc:mga05p37_220049_c1 3300050507 Bacteria 2292
725 nmdc:mga05p37_232335_c1 3300050507 Bacteria 2221
726 nmdc:mga05p37_24494_c2 3300050507 Bacteria 5911
727 nmdc:mga05p37_383859_c1 3300050507 Bacteria 1645
728 nmdc:mga05p37_456890_c1 3300050507 Unclassified 1477
729 nmdc:mga05p37_463428_c1 3300050507 Unclassified 1464
730 nmdc:mga09592_23587_c1 3300050508 Bacteria 5082
731 nmdc:mga09592_271507_c1 3300050508 Bacteria 1471
732 nmdc:mga09592_385458_c1 3300050508 Bacteria 1212
733 nmdc:mga0qj67_27623_c1 3300050509 Bacteria 4400
734 nmdc:mga06r32_136433_c1 3300050510 Bacteria 2428
735 nmdc:mga06r32_173830_c1 3300050510 Bacteria 2138
736 nmdc:mga06r32_3388_c1 3300050510 Bacteria 14254
737 nmdc:mga08y16_21320_c1 3300050511 Bacteria 6842
738 nmdc:mga08y16_23307_c1 3300050511 Bacteria 6538
739 nmdc:mga08y16_332501_c1 3300050511 Bacteria 1563
740 nmdc:mga08y16_36743_c1 3300050511 Bacteria 5144
741 nmdc:mga08y16_465675_c1 3300050511 Unclassified 1287
742 nmdc:mga08y16_4969_c1 3300050511 Bacteria 13899
743 nmdc:mga08y16_969_c1 3300050511 Bacteria 27918
744 nmdc:mga0n895_2054_c1 3300050512 Bacteria 15499
745 nmdc:mga0n895_231594_c1 3300050512 Bacteria 1875
746 nmdc:mga0n895_283499_c1 3300050512 Bacteria 1680
747 nmdc:mga0n895_408324_c1 3300050512 Bacteria 1373
748 nmdc:mga0n895_46273_c1 3300050512 Bacteria 3424
749 nmdc:mga0n895_51478_c1 3300050512 Bacteria 4040
750 nmdc:mga0n895_9293_c1 3300050512 Bacteria 8589
751 nmdc:mga0rr50_111041_c1 3300050513 Bacteria 2169
752 nmdc:mga0rr50_35286_c1 3300050513 Bacteria 3590
753 nmdc:mga0rr50_66_c1 3300050513 Bacteria 62784
754 nmdc:mga08x19_1498_c1 3300050514 Bacteria 14462
755 nmdc:mga0a205_100202_c1 3300050515 Bacteria 2796
756 nmdc:mga0a205_155057_c1 3300050515 Bacteria 2189
757 nmdc:mga0a205_15832_c1 3300050515 Bacteria 7052
758 nmdc:mga0a205_198376_c1 3300050515 Unclassified 1898
759 nmdc:mga0a205_242826_c1 3300050515 Bacteria 1682
760 nmdc:mga0a205_318317_c1 3300050515 Bacteria 1427
761 nmdc:mga0a205_38997_c1 3300050515 Bacteria 4571
762 nmdc:mga0a205_426239_c1 3300050515 Bacteria 1188
763 Ga0495619_0291237 3300053085 Unclassified 1131
764 Ga0500577_0003008 3300053142 Bacteria 4349
765 Ga0207659_10023766
766 SwRhRL2b_contig_3850439
767 MRS1b_contig_1683322
768 CNAas_1000550
769 JGI25406J46586_10007918
770 JGI25406J46586_10022904
771 rootL2_10268796
772 Ga0065714_10064443
773 Ga0065712_10005645
774 Ga0065712_10019905
775 Ga0065712_10067735
776 Ga0065712_10069675
777 Ga0065712_10152710
778 Ga0065715_10099289
779 Ga0065715_10105530
780 Ga0065715_10133163
781 Ga0065715_10139141
782 Ga0065715_10237905
783 Ga0065707_10000758
784 Ga0065707_10004571
785 Ga0065707_10093675
786 Ga0065707_10112754
787 Ga0070676_10008068
788 Ga0070676_10150913
789 Ga0070683_100039366
790 Ga0070683_100050657
791 Ga0070690_100015827
792 Ga0070690_100017961
793 Ga0070690_100029467
794 Ga0070670_100005403
795 Ga0070670_100063427
796 Ga0070670_100070241
797 Ga0070670_100076610
798 Ga0070670_100128011
799 Ga0070670_100194853
800 Ga0070677_10019563
801 Ga0068869_100002240
802 Ga0068869_100056380
803 Ga0068869_100073683
804 Ga0068869_100190510
805 Ga0068869_100242791
806 Ga0070666_10009119
807 Ga0070666_10042742
808 Ga0070666_10063771
809 Ga0070680_100031524
810 Ga0070680_100363526
811 Ga0070682_100007279
812 Ga0068868_100014059
813 Ga0068868_100076074
814 Ga0068868_100316847
815 Ga0068868_100325116
816 Ga0070660_100070853
817 Ga0070689_100217775
818 Ga0070687_100006287
819 Ga0070687_100161843
820 Ga0070687_100190376
821 Ga0070692_10013072
822 Ga0070692_10062316
823 Ga0070668_100044653
824 Ga0070668_100140012
825 Ga0070668_100179887
826 Ga0070669_100000513
827 Ga0070669_100001394
828 Ga0070669_100058375
829 Ga0070669_100196335
830 Ga0070669_100299662
831 Ga0070675_100013812
832 Ga0070675_100027342
833 Ga0070675_100033962
834 Ga0070675_100076062
835 Ga0070675_100077372
836 Ga0070675_100079099
837 Ga0070671_100009426
838 Ga0070671_100009746
839 Ga0070671_100143439
840 Ga0070671_100189357
841 Ga0070671_100209846
842 Ga0070674_100148102
843 Ga0070674_100150963
844 Ga0070673_100001658
845 Ga0070673_100038051
846 Ga0070673_100056950
847 Ga0070673_100089380
848 Ga0070673_100156022
849 Ga0070673_100365919
850 Ga0070688_100131684
851 Ga0070688_100251070
852 Ga0070659_100013438
853 Ga0070667_100025214
854 Ga0070667_100197954
855 Ga0070667_100463563
856 Ga0070709_10000007
857 Ga0070709_10175762
858 Ga0070701_10025660
859 Ga0070705_100002331
860 Ga0070705_100045085
861 Ga0070705_100200877
862 Ga0070700_100000005
863 Ga0070700_100100339
864 Ga0070700_100137802
865 Ga0070694_100009478
866 Ga0070694_100012281
867 Ga0070694_100025089
868 Ga0070694_100030684
869 Ga0070694_100099718
870 Ga0070694_100146834
871 Ga0070694_100189868
872 Ga0070694_100239552
873 Ga0070694_100286455
874 Ga0070708_100001306
875 Ga0070708_100002323
876 Ga0070708_100576863
877 Ga0070678_100053899
878 Ga0070681_10011804
879 Ga0070681_10015413
880 Ga0068867_100036440
881 Ga0068867_100199297
882 Ga0068867_100254007
883 Ga0068867_100347500
884 Ga0068867_100363599
885 Ga0070685_10258886
886 Ga0070706_100000085
887 Ga0070706_100005555
888 Ga0070706_100009600
889 Ga0070706_100209888
890 Ga0070706_100304035
891 Ga0070707_100005286
892 Ga0070707_100054650
893 Ga0070707_100060889
894 Ga0070707_100085498
895 Ga0070707_100102046
896 Ga0070698_100002308
897 Ga0070698_100029830
898 Ga0070698_100066562
899 Ga0070698_100102638
900 Ga0070698_100151008
901 Ga0070698_100190077
902 Ga0070699_100000642
903 Ga0070699_100006443
904 Ga0070699_100014525
905 Ga0070699_100137918
906 Ga0070699_100240732
907 Ga0070699_100309628
908 Ga0070679_100046874
909 Ga0070679_100064443
910 Ga0070684_100039859
911 Ga0070684_100040634
912 Ga0070684_100090316
913 Ga0070684_100201850
914 Ga0070697_100000174
915 Ga0070697_100021533
916 Ga0070697_100336170
917 Ga0070697_100494375
918 Ga0070697_100538822
919 Ga0068853_100117012
920 Ga0068853_100129910
921 Ga0070672_100037329
922 Ga0070672_100045454
923 Ga0070672_100122778
924 Ga0070672_100201275
925 Ga0070672_100262261
926 Ga0070686_100000360
927 Ga0070686_100023369
928 Ga0070686_100143302
929 Ga0070695_100063591
930 Ga0070695_100430432
931 Ga0070696_100056368
932 Ga0070696_100057506
933 Ga0070696_100071761
934 Ga0070696_100235191
935 Ga0070693_100005591
936 Ga0070693_100082415
937 Ga0070665_100004134
938 Ga0070665_100028955
939 Ga0070665_100269695
940 Ga0070704_100006585
941 Ga0070704_100287562
942 Ga0070704_100391859
943 Ga0070704_100485281
944 Ga0070664_100007698
945 Ga0070664_100008545
946 Ga0070664_100016573
947 Ga0070664_100056083
948 Ga0070664_100076714
949 Ga0070664_100093221
950 Ga0070664_100335710
951 Ga0068857_100019110
952 Ga0068857_100059476
953 Ga0068857_100349617
954 Ga0068854_100024092
955 Ga0068854_100026750
956 Ga0068854_100076171
957 Ga0068854_100157737
958 Ga0070702_100044234
959 Ga0070702_100128171
960 Ga0068852_100114564
961 Ga0068859_100009476
962 Ga0068859_100025185
963 Ga0068859_100025298
964 Ga0068859_100027605
965 Ga0068859_100050938
966 Ga0068859_100054790
967 Ga0068859_100106060
968 Ga0068859_100110333
969 Ga0068859_100152452
970 Ga0068859_100166549
971 Ga0068859_100218194
972 Ga0068859_100261660
973 Ga0068859_100274147
974 Ga0068859_100361572
975 Ga0068864_100000940
976 Ga0068864_100015209
977 Ga0068864_100027228
978 Ga0068864_100131132
979 Ga0068864_100139794
980 Ga0068864_100321612
981 Ga0068866_10007596
982 Ga0068866_10070267
983 Ga0068866_10091671
984 Ga0068861_100006960
985 Ga0068861_100078825
986 Ga0068861_100104268
987 Ga0068861_100141903
988 Ga0068861_100239903
989 Ga0068851_10002299
990 Ga0068870_10012545
991 Ga0068870_10070940
992 Ga0068863_100105166
993 Ga0068863_100134069
994 Ga0068863_100155775
995 Ga0068863_100192572
996 Ga0068863_100237913
997 Ga0068863_100408744
998 Ga0068858_100006092
999 Ga0068858_100032810
1000 Ga0068858_100040582
1001 Ga0068858_100188885
1002 Ga0068858_100279165
1003 Ga0068858_100489206
1004 Ga0068860_100003772
1005 Ga0068860_100020149
1006 Ga0068860_100031053
1007 Ga0068860_100032002
1008 Ga0068860_100033059
1009 Ga0068860_100078078
1010 Ga0068860_100117020
1011 Ga0068860_100120434
1012 Ga0068860_100139428
1013 Ga0068860_100275023
1014 Ga0068860_100411901
1015 Ga0068862_100021125
1016 Ga0068862_100021377
1017 Ga0068862_100071220
1018 Ga0068862_100081193
1019 Ga0068862_100096672
1020 Ga0068862_100432749
1021 Ga0081455_10004446
1022 Ga0081455_10102752
1023 Ga0081539_10000490
1024 Ga0081539_10000545
1025 Ga0081539_10002137
1026 Ga0081539_10023541
1027 Ga0081539_10076396
1028 Ga0075366_10053000
1029 Ga0097621_100067061
1030 Ga0097621_100085463
1031 Ga0097621_100090576
1032 Ga0097621_100176635
1033 Ga0097621_100261734
1034 Ga0068871_100025464
1035 Ga0068871_100258257
1036 Ga0075428_100035990
1037 Ga0075428_100045297
1038 Ga0075428_100099939
1039 Ga0075428_100216910
1040 Ga0075428_100255838
1041 Ga0075428_100279128
1042 Ga0075430_100011816
1043 Ga0075431_100002148
1044 Ga0075431_100038492
1045 Ga0075431_100044158
1046 Ga0075431_100068681
1047 Ga0075431_100139769
1048 Ga0075431_100228762
1049 Ga0075431_100240128
1050 Ga0075433_10005373
1051 Ga0075433_10007471
1052 Ga0075433_10042436
1053 Ga0075433_10146616
1054 Ga0075433_10181304
1055 Ga0075434_100052267
1056 Ga0075434_100063600
1057 Ga0075434_100088613
1058 Ga0075434_100096004
1059 Ga0075434_100175187
1060 Ga0075434_100206624
1061 Ga0075429_100002863
1062 Ga0075429_100020828
1063 Ga0075429_100184635
1064 Ga0075429_100187004
1065 Ga0075429_100215619
1066 Ga0068865_100067982
1067 Ga0068865_100068227
1068 Ga0068865_100225566
1069 Ga0068865_100227294
1070 Ga0075436_100015645
1071 Ga0097620_100009476
1072 Ga0097620_100010769
1073 Ga0097620_100025185
1074 Ga0097620_100025297
1075 Ga0097620_100027605
1076 Ga0097620_100038736
1077 Ga0097620_100050938
1078 Ga0097620_100054789
1079 Ga0097620_100106061
1080 Ga0097620_100110329
1081 Ga0097620_100152459
1082 Ga0097620_100166558
1083 Ga0097620_100218205
1084 Ga0097620_100261653
1085 Ga0097620_100274158
1086 Ga0097620_100310401
1087 Ga0097620_100332966
1088 Ga0097620_100361556
1089 Ga0075435_100000087
1090 Ga0075435_100024324
1091 Ga0075435_100155874
1092 Ga0075435_100264828
1093 Ga0099794_10000677
1094 Ga0105240_10013484
1095 Ga0105240_10087156
1096 Ga0105240_10097795
1097 Ga0111539_10005636
1098 Ga0111539_10020231
1099 Ga0111539_10066534
1100 Ga0111539_10069740
1101 Ga0111539_10122332
1102 Ga0111539_10180196
1103 Ga0111539_10346310
1104 Ga0111539_10360738
1105 Ga0111539_10390353
1106 Ga0105245_10115157
1107 Ga0105245_10137098
1108 Ga0105247_10136012
1109 Ga0114129_10024214
1110 Ga0114129_10036196
1111 Ga0114129_10051262
1112 Ga0114129_10118205
1113 Ga0114129_10177440
1114 Ga0114129_10188107
1115 Ga0114129_10258554
1116 Ga0114129_10275762
1117 Ga0114129_10310193
1118 Ga0114129_10440233
1119 Ga0114129_10444948
1120 Ga0114129_10513349
1121 Ga0114129_10686208
1122 Ga0105243_10000051
1123 Ga0105243_10009589
1124 Ga0105243_10150720
1125 Ga0105243_10340076
1126 Ga0105241_10061261
1127 Ga0105241_10071251
1128 Ga0105241_10320408
1129 Ga0105242_10001757
1130 Ga0105242_10007183
1131 Ga0105242_10012447
1132 Ga0105242_10021916
1133 Ga0105242_10057517
1134 Ga0105242_10347255
1135 Ga0105242_10409016
1136 Ga0105248_10001657
1137 Ga0105248_10017077
1138 Ga0105248_10029605
1139 Ga0105248_10030797
1140 Ga0105248_10030942
1141 Ga0105248_10086179
1142 Ga0105248_10132647
1143 Ga0105248_10155251
1144 Ga0105248_10175976
1145 Ga0105248_10211933
1146 Ga0105237_10005597
1147 Ga0105237_10030667
1148 Ga0105237_10075010
1149 Ga0105238_10028929
1150 Ga0105249_10009161
1151 Ga0105249_10028859
1152 Ga0105239_10025031
1153 Ga0105239_10041322
1154 Ga0105239_10745736
1155 Ga0105246_10100434
1156 Ga0157373_10025517
1157 Ga0157373_10067953
1158 Ga0157370_10023205
1159 Ga0157374_10149258
1160 Ga0157374_10272680
1161 Ga0157378_10013955
1162 Ga0157378_10045015
1163 Ga0157378_10139524
1164 Ga0157378_10142120
1165 Ga0157378_10168070
1166 Ga0157378_10211054
1167 Ga0157378_10238614
1168 Ga0157378_10249364
1169 Ga0157378_10588815
1170 Ga0163162_10002317
1171 Ga0163162_10010881
1172 Ga0163162_10018793
1173 Ga0163162_10098546
1174 Ga0163162_10261555
1175 Ga0163162_10646005
1176 Ga0157372_10135366
1177 Ga0157372_10458535
1178 Ga0157375_10084869
1179 Ga0157375_10174322
1180 Ga0157375_10189072
1181 Ga0157375_10266263
1182 Ga0157375_10350015
1183 Ga0157375_10383852
1184 Ga0157375_10459595
1185 Ga0157375_10486444
1186 Ga0163163_10005745
1187 Ga0163163_10006209
1188 Ga0163163_10035144
1189 Ga0163163_10041812
1190 Ga0163163_10063135
1191 Ga0163163_10071236
1192 Ga0163163_10073522
1193 Ga0163163_10117879
1194 Ga0163163_10125775
1195 Ga0163163_10228850
1196 Ga0163163_10418881
1197 Ga0163163_10532706
1198 Ga0157380_10002651
1199 Ga0157380_10006530
1200 Ga0157380_10023207
1201 Ga0157380_10119988
1202 Ga0157380_10150298
1203 Ga0157380_10176706
1204 Ga0157380_10219398
1205 Ga0157379_10030421
1206 Ga0157379_10060238
1207 Ga0157379_10123240
1208 Ga0157379_10165712
1209 Ga0157379_10237765
1210 Ga0157376_10089101
1211 Ga0157376_10225102
1212 Ga0163161_10099982
1213 Ga0163161_10121032
1214 Ga0163161_10140861
1215 Ga0213876_10016055
1216 Ga0207697_10007027
1217 Ga0207656_10014154
1218 Ga0207653_10019983
1219 Ga0207682_10009933
1220 Ga0207682_10050379
1221 Ga0207642_10003588
1222 Ga0207642_10006285
1223 Ga0207642_10065425
1224 Ga0207710_10001377
1225 Ga0207710_10010970
1226 Ga0207688_10022396
1227 Ga0207688_10202172
1228 Ga0207680_10052408
1229 Ga0207647_10011279
1230 Ga0207699_10000014
1231 Ga0207645_10144202
1232 Ga0207643_10004192
1233 Ga0207643_10013915
1234 Ga0207643_10015235
1235 Ga0207643_10015832
1236 Ga0207643_10035126
1237 Ga0207643_10043670
1238 Ga0207684_10000091
1239 Ga0207684_10028778
1240 Ga0207654_10281365
1241 Ga0207707_10017411
1242 Ga0207707_10036222
1243 Ga0207707_10038411
1244 Ga0207695_10057037
1245 Ga0207695_10260866
1246 Ga0207671_10003243
1247 Ga0207671_10017259
1248 Ga0207660_10293368
1249 Ga0207662_10013885
1250 Ga0207662_10273076
1251 Ga0207657_10037034
1252 Ga0207649_10050583
1253 Ga0207652_10023696
1254 Ga0207652_10083662
1255 Ga0207646_10006452
1256 Ga0207646_10057935
1257 Ga0207646_10190366
1258 Ga0207646_10207152
1259 Ga0207646_10395617
1260 Ga0207681_10028290
1261 Ga0207681_10041915
1262 Ga0207681_10069024
1263 Ga0207694_10221163
1264 Ga0207650_10002063
1265 Ga0207650_10005174
1266 Ga0207650_10034590
1267 Ga0207650_10049644
1268 Ga0207650_10058924
1269 Ga0207650_10068102
1270 Ga0207650_10106526
1271 Ga0207650_10216683
1272 Ga0207650_10290616
1273 Ga0207659_10005275
1274 Ga0207659_10006348
1275 Ga0207659_10006772
1276 Ga0207659_10009002
1277 Ga0207659_10049065
1278 Ga0207659_10119379
1279 Ga0207659_10175468
1280 Ga0207659_10293793
1281 Ga0207659_10446734
1282 Ga0207687_10028795
1283 Ga0207644_10032307
1284 Ga0207644_10219990
1285 Ga0207690_10018757
1286 Ga0207690_10218253
1287 Ga0207706_10054869
1288 Ga0207706_10060630
1289 Ga0207706_10350191
1290 Ga0207686_10000022
1291 Ga0207686_10000141
1292 Ga0207686_10010234
1293 Ga0207686_10030721
1294 Ga0207686_10154711
1295 Ga0207709_10000056
1296 Ga0207709_10003702
1297 Ga0207709_10015049
1298 Ga0207709_10182572
1299 Ga0207669_10045031
1300 Ga0207669_10161064
1301 Ga0207704_10028150
1302 Ga0207704_10248144
1303 Ga0207704_10366695
1304 Ga0207691_10014886
1305 Ga0207691_10017259
1306 Ga0207691_10019674
1307 Ga0207691_10029772
1308 Ga0207691_10152904
1309 Ga0207691_10194837
1310 Ga0207691_10199570
1311 Ga0207691_10338229
1312 Ga0207691_10393206
1313 Ga0207711_10015202
1314 Ga0207711_10034773
1315 Ga0207689_10000692
1316 Ga0207689_10000819
1317 Ga0207689_10002656
1318 Ga0207689_10027608
1319 Ga0207689_10123421
1320 Ga0207689_10139833
1321 Ga0207689_10240353
1322 Ga0207689_10370969
1323 Ga0207661_10015473
1324 Ga0207679_10008795
1325 Ga0207679_10022469
1326 Ga0207679_10028975
1327 Ga0207679_10033726
1328 Ga0207679_10077137
1329 Ga0207679_10233176
1330 Ga0207651_10046437
1331 Ga0207651_10087050
1332 Ga0207651_10317887
1333 Ga0207668_10247781
1334 Ga0207640_10016070
1335 Ga0207640_10063861
1336 Ga0207640_10063953
1337 Ga0207658_10091540
1338 Ga0207658_10268091
1339 Ga0207677_10200632
1340 Ga0207703_10021476
1341 Ga0207703_10035659
1342 Ga0207703_10039806
1343 Ga0207703_10096570
1344 Ga0207703_10112570
1345 Ga0207703_10135061
1346 Ga0207703_10144158
1347 Ga0207703_10149910
1348 Ga0207703_10248998
1349 Ga0207703_10382107
1350 Ga0207639_10014034
1351 Ga0207639_10408687
1352 Ga0207708_10000017
1353 Ga0207708_10111408
1354 Ga0207708_10124412
1355 Ga0207708_10202659
1356 Ga0207641_10049752
1357 Ga0207641_10094831
1358 Ga0207641_10099028
1359 Ga0207641_10106103
1360 Ga0207641_10172219
1361 Ga0207641_10173880
1362 Ga0207641_10341502
1363 Ga0207648_10012820
1364 Ga0207648_10032130
1365 Ga0207648_10041509
1366 Ga0207648_10063683
1367 Ga0207648_10084904
1368 Ga0207648_10097566
1369 Ga0207648_10118730
1370 Ga0207648_10300002
1371 Ga0207676_10013132
1372 Ga0207676_10034969
1373 Ga0207676_10044053
1374 Ga0207676_10065347
1375 Ga0207676_10065798
1376 Ga0207676_10090519
1377 Ga0207676_10124315
1378 Ga0207676_10198402
1379 Ga0207674_10000469
1380 Ga0207674_10048051
1381 Ga0207674_10067537
1382 Ga0207674_10228806
1383 Ga0207675_100008562
1384 Ga0207675_100034849
1385 Ga0207675_100037351
1386 Ga0207675_100047475
1387 Ga0207675_100079445
1388 Ga0207683_10026677
1389 Ga0207683_10032448
1390 Ga0207683_10065407
1391 Ga0207683_10111071
1392 Ga0207428_10003443
1393 Ga0207428_10004084
1394 Ga0207428_10008705
1395 Ga0207428_10013729
1396 Ga0207428_10020687
1397 Ga0207428_10118998
1398 Ga0268266_10217186
1399 Ga0268265_10121118
1400 Ga0268265_10346451
1401 Ga0268264_10021000
1402 Ga0268264_10030294
1403 Ga0268264_10072467
1404 Ga0268264_10107608
1405 Ga0268264_10263388
1406 Ga0268264_10318922
1407 Ga0307513_10138530
1408 Ga0307408_100005635
1409 Ga0307405_10008437
1410 Ga0307405_10125948
1411 Ga0307413_10050733
1412 Ga0307410_10015790
1413 Ga0307410_10034733
1414 Ga0307410_10204744
1415 Ga0307406_10017759
1416 Ga0307406_10023120
1417 Ga0307406_10073444
1418 Ga0307407_10000549
1419 Ga0307416_100001556
1420 Ga0307416_100018719
1421 Ga0307414_10021057
1422 Ga0307414_10025997
1423 Ga0307414_10235055
1424 Ga0307411_10001978
1425 Ga0307411_10011611
1426 Ga0307411_10319671
1427 Ga0307415_100004046
1428 Ga0307415_100138816
1429 Ga0373951_0001069
1430 Ga0373931_0104370
1431 Ga0373937_0019953
1432 Ga0395905_0072438
1433 Ga0395901_0164196
1434 Ga0436365_0773551
1435 Ga0439448_0036755
1436 Ga0439455_0005344
1437 Ga0439458_0000686
1438 Ga0495662_0037031
1439 Ga0495594_0020972
1440 Ga0495594_0192276
1441 Ga0495598_0003878
1442 Ga0495598_0034844
1443 Ga0495621_0021608
1444 Ga0495621_0094137
1445 Ga0495645_0216918
1446 Ga0495667_0027137
1447 Ga0495658_0020052
1448 Ga0495613_0001869
1449 Ga0495613_0224039
1450 Ga0495680_0101277
1451 Ga0496103_0096362
1452 Ga0496104_0061528
1453 Ga0496107_0055070
1454 Ga0496109_0002378
1455 Ga0496109_0059436
1456 Ga0496112_0095411
1457 Ga0496112_0253186
1458 Ga0496113_0142704
1459 Ga0501298_002422
1460 Ga0501034_0005352
1461 Ga0501041_0092640
1462 Ga0501042_0112972
1463 Ga0501048_0100010
1464 Ga0501071_0215722
1465 Ga0501075_0055284
1466 Ga0501076_0422846
1467 Ga0501202_001083
1468 Ga0501209_001419
1469 Ga0501217_000266
1470 Ga0501224_001645
1471 Ga0501227_000204
1472 Ga0501227_015355
1473 Ga0501230_004593
1474 Ga0501233_000916
1475 Ga0501235_000632
1476 Ga0501243_002143
1477 Ga0501249_012166
1478 Ga0501257_006833
1479 Ga0501225_0001412
1480 Ga0501225_0009480
1481 Ga0501234_000423
1482 Ga0501080_0022703
1483 Ga0501266_008961
1484 Ga0501270_008493
1485 Ga0501044_0001307
1486 Ga0501226_003192
1487 nmdc:mga05p37_149162_c1
1488 nmdc:mga05p37_220049_c1
1489 nmdc:mga05p37_232335_c1
1490 nmdc:mga05p37_24494_c2
1491 nmdc:mga05p37_383859_c1
1492 nmdc:mga05p37_456890_c1
1493 nmdc:mga05p37_463428_c1
1494 nmdc:mga09592_23587_c1
1495 nmdc:mga09592_271507_c1
1496 nmdc:mga09592_385458_c1
1497 nmdc:mga0qj67_27623_c1
1498 nmdc:mga06r32_136433_c1
1499 nmdc:mga06r32_173830_c1
1500 nmdc:mga06r32_3388_c1
1501 nmdc:mga08y16_21320_c1
1502 nmdc:mga08y16_23307_c1
1503 nmdc:mga08y16_332501_c1
1504 nmdc:mga08y16_36743_c1
1505 nmdc:mga08y16_465675_c1
1506 nmdc:mga08y16_4969_c1
1507 nmdc:mga08y16_969_c1
1508 nmdc:mga0n895_2054_c1
1509 nmdc:mga0n895_231594_c1
1510 nmdc:mga0n895_283499_c1
1511 nmdc:mga0n895_408324_c1
1512 nmdc:mga0n895_46273_c1
1513 nmdc:mga0n895_51478_c1
1514 nmdc:mga0n895_9293_c1
1515 nmdc:mga0rr50_111041_c1
1516 nmdc:mga0rr50_35286_c1
1517 nmdc:mga0rr50_66_c1
1518 nmdc:mga08x19_1498_c1
1519 nmdc:mga0a205_100202_c1
1520 nmdc:mga0a205_155057_c1
1521 nmdc:mga0a205_15832_c1
1522 nmdc:mga0a205_198376_c1
1523 nmdc:mga0a205_242826_c1
1524 nmdc:mga0a205_318317_c1
1525 nmdc:mga0a205_38997_c1
1526 nmdc:mga0a205_426239_c1
1527 Ga0495619_0291237
1528 Ga0500577_0003008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

33

285

0.94

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

32

304

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g1w-assembly1.cif.gz_A crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans 0.9194 42 322
6gq0-assembly1.cif.gz_A crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus 0.9164 40 318
5hqj-assembly1.cif.gz_A crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose 0.9161 40 318
3g1w-assembly1.cif.gz_B crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans 0.9117 42 322
5dte-assembly3.cif.gz_C crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose 0.9072 42 321
ID Description Score Start End Superfamily
2qvcA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9382 145 328 3.40.50.2300
5ibqA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9342 146 320 3.40.50.2300
2qvcB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9256 44 144 3.40.50.2300
4wutA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.923 145 274 3.40.50.2300
1dbpA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9207 144 279 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A436H095-F1-model_v4 deleted 0.9493 143 322
AF-A0A356E4P5-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9355 139 321 GO:0030246
GO:0030313
AF-A0A7C6JXN6-F1-model_v4 Substrate-binding domain-containing protein 0.9336 39 326 GO:0007165
GO:0016020
AF-A0A435U6B6-F1-model_v4 deleted 0.9319 90 324
AF-A0A149TP35-F1-model_v4 deleted 0.9296 88 320

Map