F479637
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 762 | 331 | 1524 | 86 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_101317210|Ga0307416_1013172102 |
| Length | 97 |
| Sequence | MARITMREIRPGEVPPDGGTALQEDPDRPVFRGHGPNDYVCVQCGNVLAASMDPDYMTKKVRVKCGRCRTVNVAITDESPAGDPRLKRRPGFGGPGP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 169 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 177 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 178 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 179 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 180 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 207 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 208 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 209 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 210 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 213 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 214 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 215 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 314 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 315 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 316 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 328 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 331 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.44 |
| Nodule | 0 |
| Rhizoplane | 9.45 |
| Rhizosphere | 83.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307416_101317210 | 3300032002 | Bacteria | 828 |
| 2 | Ga0070676_10180947 | 3300005328 | Unclassified | 1370 |
| 3 | Ga0070683_100915640 | 3300005329 | Unclassified | 841 |
| 4 | Ga0070690_100402211 | 3300005330 | Bacteria | 1006 |
| 5 | Ga0068869_100039228 | 3300005334 | Bacteria | 3380 |
| 6 | Ga0068869_100096015 | 3300005334 | Unclassified | 2237 |
| 7 | Ga0070666_10396223 | 3300005335 | Bacteria | 992 |
| 8 | Ga0070666_11084880 | 3300005335 | Unclassified | 595 |
| 9 | Ga0070666_11460413 | 3300005335 | Unclassified | 511 |
| 10 | Ga0070680_100354813 | 3300005336 | Bacteria | 1247 |
| 11 | Ga0070680_100654196 | 3300005336 | Unclassified | 903 |
| 12 | Ga0070682_100067762 | 3300005337 | Bacteria | 2274 |
| 13 | Ga0070682_100670740 | 3300005337 | Bacteria | 828 |
| 14 | Ga0070682_100792793 | 3300005337 | Bacteria | 769 |
| 15 | Ga0068868_100001984 | 3300005338 | Bacteria | 14061 |
| 16 | Ga0068868_100356156 | 3300005338 | Unclassified | 1254 |
| 17 | Ga0068868_100385962 | 3300005338 | Bacteria | 1206 |
| 18 | Ga0070660_100065011 | 3300005339 | Bacteria | 2839 |
| 19 | Ga0070689_100806312 | 3300005340 | Bacteria | 826 |
| 20 | Ga0070691_10005696 | 3300005341 | Bacteria | 5682 |
| 21 | Ga0070691_10021585 | 3300005341 | Bacteria | 2980 |
| 22 | Ga0070668_100032709 | 3300005347 | Bacteria | 3957 |
| 23 | Ga0070668_100057906 | 3300005347 | Bacteria | 2996 |
| 24 | Ga0070669_100892804 | 3300005353 | Unclassified | 759 |
| 25 | Ga0070669_100912922 | 3300005353 | Bacteria | 750 |
| 26 | Ga0070675_100040215 | 3300005354 | Bacteria | 3816 |
| 27 | Ga0070675_100256270 | 3300005354 | Bacteria | 1532 |
| 28 | Ga0070675_100394384 | 3300005354 | Bacteria | 1234 |
| 29 | Ga0070671_100208832 | 3300005355 | Bacteria | 1656 |
| 30 | Ga0070671_100595502 | 3300005355 | Bacteria | 955 |
| 31 | Ga0070671_100648947 | 3300005355 | Bacteria | 914 |
| 32 | Ga0070671_102118797 | 3300005355 | Bacteria | 501 |
| 33 | Ga0070674_100043457 | 3300005356 | Bacteria | 3057 |
| 34 | Ga0070674_100078634 | 3300005356 | Bacteria | 2351 |
| 35 | Ga0070674_100279812 | 3300005356 | Bacteria | 1322 |
| 36 | Ga0070674_100984320 | 3300005356 | Bacteria | 739 |
| 37 | Ga0070674_101316018 | 3300005356 | Bacteria | 645 |
| 38 | Ga0070674_101316258 | 3300005356 | Bacteria | 645 |
| 39 | Ga0070688_100063706 | 3300005365 | Bacteria | 2338 |
| 40 | Ga0070688_100642680 | 3300005365 | Archaea | 816 |
| 41 | Ga0070659_101092600 | 3300005366 | Unclassified | 703 |
| 42 | Ga0070659_101349853 | 3300005366 | Unclassified | 633 |
| 43 | Ga0070667_100114562 | 3300005367 | Bacteria | 2341 |
| 44 | Ga0070667_100487793 | 3300005367 | Unclassified | 1129 |
| 45 | Ga0070667_100969395 | 3300005367 | Bacteria | 793 |
| 46 | Ga0070667_102206448 | 3300005367 | Archaea | 519 |
| 47 | Ga0070714_100072611 | 3300005435 | Bacteria | 2979 |
| 48 | Ga0070714_100304034 | 3300005435 | Unclassified | 1488 |
| 49 | Ga0070714_100634395 | 3300005435 | Unclassified | 1028 |
| 50 | Ga0070713_100519802 | 3300005436 | Bacteria | 1125 |
| 51 | Ga0070710_10040149 | 3300005437 | Bacteria | 2579 |
| 52 | Ga0070710_10231788 | 3300005437 | Unclassified | 1179 |
| 53 | Ga0070710_10315394 | 3300005437 | Bacteria | 1025 |
| 54 | Ga0070710_11175814 | 3300005437 | Unclassified | 566 |
| 55 | Ga0070701_10176785 | 3300005438 | Bacteria | 1247 |
| 56 | Ga0070701_10874033 | 3300005438 | Unclassified | 619 |
| 57 | Ga0070701_11269540 | 3300005438 | Unclassified | 525 |
| 58 | Ga0070711_100025636 | 3300005439 | Bacteria | 3859 |
| 59 | Ga0070711_100181844 | 3300005439 | Bacteria | 1610 |
| 60 | Ga0070711_100220104 | 3300005439 | Unclassified | 1475 |
| 61 | Ga0070711_100304891 | 3300005439 | Bacteria | 1267 |
| 62 | Ga0070711_100957947 | 3300005439 | Bacteria | 733 |
| 63 | Ga0070705_100017337 | 3300005440 | Bacteria | 3759 |
| 64 | Ga0070705_100723618 | 3300005440 | Unclassified | 784 |
| 65 | Ga0070705_101490598 | 3300005440 | Bacteria | 566 |
| 66 | Ga0070700_100001106 | 3300005441 | Bacteria | 13344 |
| 67 | Ga0070700_100132215 | 3300005441 | Unclassified | 1685 |
| 68 | Ga0070700_100277363 | 3300005441 | Bacteria | 1214 |
| 69 | Ga0070694_100657380 | 3300005444 | Unclassified | 849 |
| 70 | Ga0070694_100815468 | 3300005444 | Archaea | 766 |
| 71 | Ga0070694_101864920 | 3300005444 | Bacteria | 513 |
| 72 | Ga0070663_100027740 | 3300005455 | Bacteria | 3849 |
| 73 | Ga0070663_100567010 | 3300005455 | Bacteria | 951 |
| 74 | Ga0070678_101001618 | 3300005456 | Unclassified | 768 |
| 75 | Ga0070662_100054441 | 3300005457 | Bacteria | 2899 |
| 76 | Ga0070681_10147509 | 3300005458 | Bacteria | 2281 |
| 77 | Ga0070681_10386216 | 3300005458 | Bacteria | 1311 |
| 78 | Ga0070681_10859848 | 3300005458 | Bacteria | 825 |
| 79 | Ga0068867_100128251 | 3300005459 | Bacteria | 1968 |
| 80 | Ga0068867_100959832 | 3300005459 | Unclassified | 773 |
| 81 | Ga0068867_101282483 | 3300005459 | Unclassified | 676 |
| 82 | Ga0070685_11540947 | 3300005466 | Unclassified | 513 |
| 83 | Ga0070699_101438911 | 3300005518 | Bacteria | 632 |
| 84 | Ga0070679_100265327 | 3300005530 | Bacteria | 1672 |
| 85 | Ga0070679_100286282 | 3300005530 | Unclassified | 1600 |
| 86 | Ga0070679_101760047 | 3300005530 | Bacteria | 568 |
| 87 | Ga0070684_100006386 | 3300005535 | Bacteria | 9116 |
| 88 | Ga0070684_100054473 | 3300005535 | Bacteria | 3485 |
| 89 | Ga0070684_100595658 | 3300005535 | Bacteria | 1028 |
| 90 | Ga0070684_100934842 | 3300005535 | Unclassified | 813 |
| 91 | Ga0070684_102337487 | 3300005535 | Bacteria | 504 |
| 92 | Ga0068853_100378902 | 3300005539 | Archaea | 1321 |
| 93 | Ga0070672_100120278 | 3300005543 | Bacteria | 2149 |
| 94 | Ga0070672_100148224 | 3300005543 | Unclassified | 1940 |
| 95 | Ga0070672_100784067 | 3300005543 | Bacteria | 838 |
| 96 | Ga0070686_100050418 | 3300005544 | Bacteria | 2645 |
| 97 | Ga0070686_100177040 | 3300005544 | Bacteria | 1513 |
| 98 | Ga0070686_100385240 | 3300005544 | Unclassified | 1062 |
| 99 | Ga0070695_100595309 | 3300005545 | Unclassified | 867 |
| 100 | Ga0070696_100047166 | 3300005546 | Bacteria | 2989 |
| 101 | Ga0070696_101954914 | 3300005546 | Bacteria | 509 |
| 102 | Ga0070693_100119616 | 3300005547 | Unclassified | 1632 |
| 103 | Ga0070693_100246567 | 3300005547 | Bacteria | 1182 |
| 104 | Ga0070693_100287603 | 3300005547 | Bacteria | 1103 |
| 105 | Ga0070665_100153705 | 3300005548 | Bacteria | 2303 |
| 106 | Ga0068855_100284083 | 3300005563 | Unclassified | 1837 |
| 107 | Ga0068855_101012266 | 3300005563 | Unclassified | 872 |
| 108 | Ga0070664_100028477 | 3300005564 | Bacteria | 4647 |
| 109 | Ga0070664_101607493 | 3300005564 | Bacteria | 616 |
| 110 | Ga0068854_100037103 | 3300005578 | Bacteria | 3419 |
| 111 | Ga0068854_101215480 | 3300005578 | Bacteria | 676 |
| 112 | Ga0068854_101252123 | 3300005578 | Bacteria | 666 |
| 113 | Ga0068856_100064219 | 3300005614 | Bacteria | 3627 |
| 114 | Ga0068856_102032541 | 3300005614 | Bacteria | 585 |
| 115 | Ga0070702_100027315 | 3300005615 | Bacteria | 3077 |
| 116 | Ga0070702_100040550 | 3300005615 | Bacteria | 2605 |
| 117 | Ga0070702_100335458 | 3300005615 | Bacteria | 1059 |
| 118 | Ga0068852_100104417 | 3300005616 | Bacteria | 2565 |
| 119 | Ga0068852_101851370 | 3300005616 | Bacteria | 626 |
| 120 | Ga0068864_100023860 | 3300005618 | Bacteria | 5140 |
| 121 | Ga0068864_101547495 | 3300005618 | Bacteria | 667 |
| 122 | Ga0068866_10038107 | 3300005718 | Bacteria | 2365 |
| 123 | Ga0068866_10134254 | 3300005718 | Unclassified | 1412 |
| 124 | Ga0068866_10941246 | 3300005718 | Bacteria | 610 |
| 125 | Ga0068861_100153614 | 3300005719 | Bacteria | 1891 |
| 126 | Ga0068861_100307988 | 3300005719 | Unclassified | 1374 |
| 127 | Ga0068861_100452299 | 3300005719 | Bacteria | 1151 |
| 128 | Ga0068861_102092368 | 3300005719 | Bacteria | 566 |
| 129 | Ga0068861_102634891 | 3300005719 | Unclassified | 507 |
| 130 | Ga0068851_10655033 | 3300005834 | Unclassified | 643 |
| 131 | Ga0068870_10285777 | 3300005840 | Bacteria | 1036 |
| 132 | Ga0068870_10881091 | 3300005840 | Unclassified | 631 |
| 133 | Ga0068863_100361025 | 3300005841 | Unclassified | 1416 |
| 134 | Ga0068863_100785081 | 3300005841 | Unclassified | 949 |
| 135 | Ga0068863_101030986 | 3300005841 | Unclassified | 826 |
| 136 | Ga0068858_100175146 | 3300005842 | Bacteria | 2024 |
| 137 | Ga0068858_101696643 | 3300005842 | Unclassified | 624 |
| 138 | Ga0068860_100015334 | 3300005843 | Bacteria | 7485 |
| 139 | Ga0068860_102381641 | 3300005843 | Unclassified | 550 |
| 140 | Ga0068862_100928927 | 3300005844 | Bacteria | 857 |
| 141 | Ga0068862_101423028 | 3300005844 | Bacteria | 697 |
| 142 | Ga0081538_10048324 | 3300005981 | Bacteria | 2596 |
| 143 | Ga0081540_1036100 | 3300005983 | Bacteria | 2640 |
| 144 | Ga0081540_1070877 | 3300005983 | Bacteria | 1612 |
| 145 | Ga0081539_10001190 | 3300005985 | Bacteria | 46973 |
| 146 | Ga0070717_10015315 | 3300006028 | Bacteria | 5920 |
| 147 | Ga0070717_10650129 | 3300006028 | Bacteria | 957 |
| 148 | Ga0075365_10259404 | 3300006038 | Bacteria | 1222 |
| 149 | Ga0075365_10667466 | 3300006038 | Bacteria | 735 |
| 150 | Ga0075363_100261627 | 3300006048 | Bacteria | 998 |
| 151 | Ga0075364_10270593 | 3300006051 | Bacteria | 1155 |
| 152 | Ga0070712_100007279 | 3300006175 | Bacteria | 6906 |
| 153 | Ga0070712_100221354 | 3300006175 | Bacteria | 1498 |
| 154 | Ga0070712_100596238 | 3300006175 | Unclassified | 935 |
| 155 | Ga0075362_10008980 | 3300006177 | Bacteria | 3844 |
| 156 | Ga0075427_10007523 | 3300006194 | Bacteria | 1602 |
| 157 | Ga0097621_100009042 | 3300006237 | Bacteria | 7216 |
| 158 | Ga0097621_101308246 | 3300006237 | Bacteria | 685 |
| 159 | Ga0068871_100540665 | 3300006358 | Bacteria | 1054 |
| 160 | Ga0068871_100738813 | 3300006358 | Bacteria | 904 |
| 161 | Ga0075428_100547616 | 3300006844 | Bacteria | 1237 |
| 162 | Ga0075428_101742009 | 3300006844 | Bacteria | 649 |
| 163 | Ga0075428_101770461 | 3300006844 | Archaea | 644 |
| 164 | Ga0075428_101862535 | 3300006844 | Unclassified | 625 |
| 165 | Ga0075430_100228928 | 3300006846 | Bacteria | 1541 |
| 166 | Ga0075430_101545998 | 3300006846 | Bacteria | 545 |
| 167 | Ga0075431_100970738 | 3300006847 | Unclassified | 817 |
| 168 | Ga0075431_101177657 | 3300006847 | Bacteria | 729 |
| 169 | Ga0075433_10086335 | 3300006852 | Bacteria | 2770 |
| 170 | Ga0075433_11332423 | 3300006852 | Bacteria | 622 |
| 171 | Ga0075434_100060563 | 3300006871 | Bacteria | 3765 |
| 172 | Ga0075434_100145958 | 3300006871 | Bacteria | 2386 |
| 173 | Ga0075434_101894207 | 3300006871 | Unclassified | 602 |
| 174 | Ga0075434_102412375 | 3300006871 | Unclassified | 528 |
| 175 | Ga0075429_100111761 | 3300006880 | Bacteria | 2388 |
| 176 | Ga0075429_100233732 | 3300006880 | Bacteria | 1610 |
| 177 | Ga0068865_100266502 | 3300006881 | Unclassified | 1358 |
| 178 | Ga0068865_100761048 | 3300006881 | Bacteria | 833 |
| 179 | Ga0068865_101750788 | 3300006881 | Bacteria | 561 |
| 180 | Ga0075436_100158587 | 3300006914 | Bacteria | 1594 |
| 181 | Ga0075436_100176028 | 3300006914 | Unclassified | 1511 |
| 182 | Ga0075436_100429604 | 3300006914 | Bacteria | 960 |
| 183 | Ga0075435_100134076 | 3300007076 | Bacteria | 2074 |
| 184 | Ga0105251_10517116 | 3300009011 | Bacteria | 559 |
| 185 | Ga0105240_10307341 | 3300009093 | Bacteria | 1812 |
| 186 | Ga0111539_10029819 | 3300009094 | Bacteria | 6639 |
| 187 | Ga0111539_10159693 | 3300009094 | Bacteria | 2637 |
| 188 | Ga0111539_10401659 | 3300009094 | Bacteria | 1596 |
| 189 | Ga0111539_10742690 | 3300009094 | Bacteria | 1142 |
| 190 | Ga0111539_10791102 | 3300009094 | Bacteria | 1104 |
| 191 | Ga0111539_10856862 | 3300009094 | Bacteria | 1057 |
| 192 | Ga0111539_12169618 | 3300009094 | Bacteria | 644 |
| 193 | Ga0105245_10002929 | 3300009098 | Bacteria | 15319 |
| 194 | Ga0105245_10078973 | 3300009098 | Bacteria | 3004 |
| 195 | Ga0105245_10247081 | 3300009098 | Bacteria | 1732 |
| 196 | Ga0105245_10492208 | 3300009098 | Unclassified | 1241 |
| 197 | Ga0105245_12483293 | 3300009098 | Bacteria | 572 |
| 198 | Ga0105247_10048222 | 3300009101 | Bacteria | 2616 |
| 199 | Ga0114129_11961072 | 3300009147 | Unclassified | 709 |
| 200 | Ga0114129_12078922 | 3300009147 | Unclassified | 685 |
| 201 | Ga0105243_10013864 | 3300009148 | Bacteria | 6101 |
| 202 | Ga0105243_10045020 | 3300009148 | Bacteria | 3466 |
| 203 | Ga0105243_10092076 | 3300009148 | Bacteria | 2498 |
| 204 | Ga0105243_11196581 | 3300009148 | Unclassified | 773 |
| 205 | Ga0105241_10114948 | 3300009174 | Bacteria | 2159 |
| 206 | Ga0105241_10222526 | 3300009174 | Unclassified | 1587 |
| 207 | Ga0105241_11380690 | 3300009174 | Bacteria | 674 |
| 208 | Ga0105242_10010591 | 3300009176 | Bacteria | 7080 |
| 209 | Ga0105242_10582622 | 3300009176 | Bacteria | 1078 |
| 210 | Ga0105242_10623809 | 3300009176 | Unclassified | 1045 |
| 211 | Ga0105242_10747799 | 3300009176 | Unclassified | 962 |
| 212 | Ga0105242_10983994 | 3300009176 | Bacteria | 850 |
| 213 | Ga0105242_12278231 | 3300009176 | Unclassified | 588 |
| 214 | Ga0105237_10449032 | 3300009545 | Unclassified | 1295 |
| 215 | Ga0105237_11597223 | 3300009545 | Bacteria | 659 |
| 216 | Ga0105237_12325517 | 3300009545 | Unclassified | 546 |
| 217 | Ga0105238_10006448 | 3300009551 | Bacteria | 11667 |
| 218 | Ga0105238_11408480 | 3300009551 | Bacteria | 724 |
| 219 | Ga0105238_11853344 | 3300009551 | Unclassified | 636 |
| 220 | Ga0105249_10062351 | 3300009553 | Bacteria | 3423 |
| 221 | Ga0105249_10157726 | 3300009553 | Bacteria | 2190 |
| 222 | Ga0105249_10188336 | 3300009553 | Unclassified | 2012 |
| 223 | Ga0105239_10008213 | 3300010375 | Bacteria | 11907 |
| 224 | Ga0105239_10012054 | 3300010375 | Bacteria | 9640 |
| 225 | Ga0105239_10197722 | 3300010375 | Bacteria | 2252 |
| 226 | Ga0105239_11477305 | 3300010375 | Unclassified | 785 |
| 227 | Ga0105246_10077093 | 3300011119 | Unclassified | 2363 |
| 228 | Ga0105246_10167886 | 3300011119 | Bacteria | 1678 |
| 229 | Ga0105246_10679389 | 3300011119 | Archaea | 900 |
| 230 | Ga0157374_10047947 | 3300013296 | Bacteria | 3962 |
| 231 | Ga0157374_10052475 | 3300013296 | Bacteria | 3798 |
| 232 | Ga0157378_10013326 | 3300013297 | Bacteria | 7186 |
| 233 | Ga0157378_10250461 | 3300013297 | Bacteria | 1695 |
| 234 | Ga0163162_10689585 | 3300013306 | Bacteria | 1144 |
| 235 | Ga0157372_10038710 | 3300013307 | Bacteria | 5262 |
| 236 | Ga0157372_10240773 | 3300013307 | Unclassified | 2099 |
| 237 | Ga0157372_12286956 | 3300013307 | Bacteria | 621 |
| 238 | Ga0157372_12533317 | 3300013307 | Unclassified | 589 |
| 239 | Ga0157375_10051006 | 3300013308 | Bacteria | 4061 |
| 240 | Ga0157375_10114706 | 3300013308 | Bacteria | 2796 |
| 241 | Ga0157375_11097328 | 3300013308 | Unclassified | 931 |
| 242 | Ga0157375_11263875 | 3300013308 | Bacteria | 867 |
| 243 | Ga0157375_12264909 | 3300013308 | Bacteria | 648 |
| 244 | Ga0163163_10011750 | 3300014325 | Bacteria | 7956 |
| 245 | Ga0163163_10053752 | 3300014325 | Bacteria | 3977 |
| 246 | Ga0163163_12463218 | 3300014325 | Bacteria | 578 |
| 247 | Ga0163163_12835665 | 3300014325 | Unclassified | 541 |
| 248 | Ga0157380_10730259 | 3300014326 | Bacteria | 999 |
| 249 | Ga0157380_10789565 | 3300014326 | Unclassified | 965 |
| 250 | Ga0157380_11506914 | 3300014326 | Unclassified | 726 |
| 251 | Ga0157380_12813541 | 3300014326 | Bacteria | 553 |
| 252 | Ga0157380_13431259 | 3300014326 | Bacteria | 507 |
| 253 | Ga0157377_10001428 | 3300014745 | Bacteria | 10306 |
| 254 | Ga0157377_10009705 | 3300014745 | Bacteria | 4735 |
| 255 | Ga0157377_11405901 | 3300014745 | Bacteria | 550 |
| 256 | Ga0157379_10003614 | 3300014968 | Bacteria | 13125 |
| 257 | Ga0157379_10164221 | 3300014968 | Bacteria | 2004 |
| 258 | Ga0157376_10073372 | 3300014969 | Unclassified | 2914 |
| 259 | Ga0157376_10209645 | 3300014969 | Bacteria | 1798 |
| 260 | Ga0163161_10608507 | 3300017792 | Bacteria | 902 |
| 261 | Ga0163161_10981831 | 3300017792 | Bacteria | 720 |
| 262 | Ga0163161_11234241 | 3300017792 | Bacteria | 647 |
| 263 | Ga0206353_11318564 | 3300020082 | Bacteria | 685 |
| 264 | Ga0213874_10008924 | 3300021377 | Bacteria | 2462 |
| 265 | Ga0213874_10018406 | 3300021377 | Bacteria | 1887 |
| 266 | Ga0213874_10032377 | 3300021377 | Unclassified | 1518 |
| 267 | Ga0213874_10125995 | 3300021377 | Bacteria | 875 |
| 268 | Ga0213876_10005125 | 3300021384 | Bacteria | 7227 |
| 269 | Ga0213876_10014095 | 3300021384 | Bacteria | 4239 |
| 270 | Ga0213876_10014320 | 3300021384 | Bacteria | 4204 |
| 271 | Ga0213876_10183150 | 3300021384 | Bacteria | 1114 |
| 272 | Ga0213875_10000432 | 3300021388 | Bacteria | 36597 |
| 273 | Ga0213875_10024011 | 3300021388 | Bacteria | 2909 |
| 274 | Ga0213875_10039358 | 3300021388 | Unclassified | 2227 |
| 275 | Ga0213875_10271764 | 3300021388 | Unclassified | 800 |
| 276 | Ga0213875_10511500 | 3300021388 | Bacteria | 577 |
| 277 | Ga0207426_1034212 | 3300025302 | Bacteria | 1632 |
| 278 | Ga0207692_10220643 | 3300025898 | Unclassified | 1124 |
| 279 | Ga0207692_10607901 | 3300025898 | Bacteria | 703 |
| 280 | Ga0207692_11168621 | 3300025898 | Unclassified | 511 |
| 281 | Ga0207642_10467265 | 3300025899 | Unclassified | 767 |
| 282 | Ga0207710_10038277 | 3300025900 | Bacteria | 2120 |
| 283 | Ga0207688_10013672 | 3300025901 | Bacteria | 4412 |
| 284 | Ga0207688_10048070 | 3300025901 | Bacteria | 2383 |
| 285 | Ga0207688_10073720 | 3300025901 | Bacteria | 1941 |
| 286 | Ga0207688_10104140 | 3300025901 | Unclassified | 1642 |
| 287 | Ga0207688_10989157 | 3300025901 | Bacteria | 532 |
| 288 | Ga0207680_10100758 | 3300025903 | Bacteria | 1855 |
| 289 | Ga0207685_10594401 | 3300025905 | Bacteria | 593 |
| 290 | Ga0207699_11123622 | 3300025906 | Unclassified | 582 |
| 291 | Ga0207699_11289066 | 3300025906 | Unclassified | 541 |
| 292 | Ga0207645_10306527 | 3300025907 | Bacteria | 1058 |
| 293 | Ga0207643_10420899 | 3300025908 | Bacteria | 847 |
| 294 | Ga0207705_11247687 | 3300025909 | Unclassified | 569 |
| 295 | Ga0207705_11315002 | 3300025909 | Bacteria | 552 |
| 296 | Ga0207654_10077750 | 3300025911 | Bacteria | 1990 |
| 297 | Ga0207654_10416436 | 3300025911 | Bacteria | 937 |
| 298 | Ga0207707_10283948 | 3300025912 | Bacteria | 1433 |
| 299 | Ga0207707_10464570 | 3300025912 | Bacteria | 1082 |
| 300 | Ga0207707_10681848 | 3300025912 | Bacteria | 864 |
| 301 | Ga0207707_11349552 | 3300025912 | Unclassified | 571 |
| 302 | Ga0207695_10834626 | 3300025913 | Bacteria | 802 |
| 303 | Ga0207671_10903311 | 3300025914 | Bacteria | 698 |
| 304 | Ga0207671_11080949 | 3300025914 | Bacteria | 630 |
| 305 | Ga0207693_10011778 | 3300025915 | Bacteria | 7069 |
| 306 | Ga0207693_10044509 | 3300025915 | Bacteria | 3489 |
| 307 | Ga0207693_10122284 | 3300025915 | Bacteria | 2044 |
| 308 | Ga0207693_10180155 | 3300025915 | Bacteria | 1663 |
| 309 | Ga0207693_11353893 | 3300025915 | Bacteria | 530 |
| 310 | Ga0207663_10052119 | 3300025916 | Unclassified | 2551 |
| 311 | Ga0207663_10283902 | 3300025916 | Bacteria | 1231 |
| 312 | Ga0207663_10366887 | 3300025916 | Unclassified | 1094 |
| 313 | Ga0207663_10440732 | 3300025916 | Bacteria | 1003 |
| 314 | Ga0207657_10078110 | 3300025919 | Bacteria | 2788 |
| 315 | Ga0207652_10049357 | 3300025921 | Bacteria | 3602 |
| 316 | Ga0207652_10993903 | 3300025921 | Bacteria | 738 |
| 317 | Ga0207681_10095571 | 3300025923 | Bacteria | 2132 |
| 318 | Ga0207681_11064503 | 3300025923 | Bacteria | 679 |
| 319 | Ga0207694_11219918 | 3300025924 | Bacteria | 636 |
| 320 | Ga0207659_10103589 | 3300025926 | Bacteria | 2150 |
| 321 | Ga0207659_10213745 | 3300025926 | Bacteria | 1547 |
| 322 | Ga0207687_10007786 | 3300025927 | Bacteria | 7027 |
| 323 | Ga0207687_10021995 | 3300025927 | Bacteria | 4241 |
| 324 | Ga0207687_10081684 | 3300025927 | Unclassified | 2336 |
| 325 | Ga0207687_10095941 | 3300025927 | Bacteria | 2172 |
| 326 | Ga0207687_10118312 | 3300025927 | Bacteria | 1978 |
| 327 | Ga0207664_10141256 | 3300025929 | Unclassified | 2037 |
| 328 | Ga0207664_10163194 | 3300025929 | Unclassified | 1902 |
| 329 | Ga0207664_10314289 | 3300025929 | Bacteria | 1381 |
| 330 | Ga0207644_10314449 | 3300025931 | Unclassified | 1265 |
| 331 | Ga0207644_10350096 | 3300025931 | Bacteria | 1199 |
| 332 | Ga0207690_10089300 | 3300025932 | Bacteria | 2173 |
| 333 | Ga0207690_10129902 | 3300025932 | Bacteria | 1842 |
| 334 | Ga0207690_11042814 | 3300025932 | Unclassified | 681 |
| 335 | Ga0207706_10009700 | 3300025933 | Bacteria | 8836 |
| 336 | Ga0207706_10266200 | 3300025933 | Bacteria | 1496 |
| 337 | Ga0207686_10016674 | 3300025934 | Bacteria | 4125 |
| 338 | Ga0207686_11104761 | 3300025934 | Unclassified | 646 |
| 339 | Ga0207686_11635451 | 3300025934 | Bacteria | 532 |
| 340 | Ga0207709_10028119 | 3300025935 | Bacteria | 3248 |
| 341 | Ga0207709_10312331 | 3300025935 | Unclassified | 1173 |
| 342 | Ga0207709_10401220 | 3300025935 | Bacteria | 1048 |
| 343 | Ga0207709_10646343 | 3300025935 | Unclassified | 842 |
| 344 | Ga0207709_11251944 | 3300025935 | Bacteria | 612 |
| 345 | Ga0207709_11364373 | 3300025935 | Unclassified | 587 |
| 346 | Ga0207670_10578838 | 3300025936 | Bacteria | 920 |
| 347 | Ga0207670_11620002 | 3300025936 | Bacteria | 551 |
| 348 | Ga0207669_10094942 | 3300025937 | Bacteria | 1953 |
| 349 | Ga0207669_10447509 | 3300025937 | Bacteria | 1023 |
| 350 | Ga0207669_10493681 | 3300025937 | Bacteria | 978 |
| 351 | Ga0207669_11007778 | 3300025937 | Bacteria | 700 |
| 352 | Ga0207704_10083960 | 3300025938 | Bacteria | 2069 |
| 353 | Ga0207704_10672675 | 3300025938 | Bacteria | 854 |
| 354 | Ga0207704_11314883 | 3300025938 | Unclassified | 618 |
| 355 | Ga0207665_11545093 | 3300025939 | Unclassified | 527 |
| 356 | Ga0207691_10202826 | 3300025940 | Bacteria | 1725 |
| 357 | Ga0207689_10148935 | 3300025942 | Unclassified | 1929 |
| 358 | Ga0207689_10361140 | 3300025942 | Bacteria | 1208 |
| 359 | Ga0207661_10031697 | 3300025944 | Bacteria | 4088 |
| 360 | Ga0207661_10035686 | 3300025944 | Bacteria | 3877 |
| 361 | Ga0207661_11579494 | 3300025944 | Bacteria | 600 |
| 362 | Ga0207679_10288410 | 3300025945 | Bacteria | 1410 |
| 363 | Ga0207679_11246697 | 3300025945 | Bacteria | 682 |
| 364 | Ga0207667_10026920 | 3300025949 | Bacteria | 6273 |
| 365 | Ga0207712_10333079 | 3300025961 | Unclassified | 1256 |
| 366 | Ga0207712_10377281 | 3300025961 | Bacteria | 1186 |
| 367 | Ga0207668_10052405 | 3300025972 | Bacteria | 2823 |
| 368 | Ga0207668_10508383 | 3300025972 | Bacteria | 1038 |
| 369 | Ga0207668_11311972 | 3300025972 | Unclassified | 652 |
| 370 | Ga0207640_10225657 | 3300025981 | Unclassified | 1437 |
| 371 | Ga0207640_10248085 | 3300025981 | Bacteria | 1380 |
| 372 | Ga0207640_10797168 | 3300025981 | Bacteria | 818 |
| 373 | Ga0207640_10944908 | 3300025981 | Bacteria | 755 |
| 374 | Ga0207640_10979692 | 3300025981 | Bacteria | 743 |
| 375 | Ga0207640_11154525 | 3300025981 | Unclassified | 687 |
| 376 | Ga0207658_10538385 | 3300025986 | Bacteria | 1044 |
| 377 | Ga0207658_11168554 | 3300025986 | Unclassified | 703 |
| 378 | Ga0207677_10183081 | 3300026023 | Bacteria | 1649 |
| 379 | Ga0207703_10571599 | 3300026035 | Unclassified | 1067 |
| 380 | Ga0207678_10094927 | 3300026067 | Bacteria | 2549 |
| 381 | Ga0207678_10112290 | 3300026067 | Bacteria | 2325 |
| 382 | Ga0207678_10213794 | 3300026067 | Bacteria | 1650 |
| 383 | Ga0207708_10000610 | 3300026075 | Bacteria | 27534 |
| 384 | Ga0207708_10086493 | 3300026075 | Bacteria | 2412 |
| 385 | Ga0207708_10403899 | 3300026075 | Unclassified | 1130 |
| 386 | Ga0207708_10862677 | 3300026075 | Unclassified | 782 |
| 387 | Ga0207702_10040691 | 3300026078 | Bacteria | 3896 |
| 388 | Ga0207702_11121145 | 3300026078 | Bacteria | 781 |
| 389 | Ga0207641_10341980 | 3300026088 | Unclassified | 1424 |
| 390 | Ga0207641_10877107 | 3300026088 | Unclassified | 890 |
| 391 | Ga0207648_10022027 | 3300026089 | Bacteria | 5724 |
| 392 | Ga0207648_10044516 | 3300026089 | Bacteria | 3894 |
| 393 | Ga0207648_11760412 | 3300026089 | Unclassified | 581 |
| 394 | Ga0207676_10953831 | 3300026095 | Unclassified | 843 |
| 395 | Ga0207676_11442329 | 3300026095 | Bacteria | 685 |
| 396 | Ga0207674_10726439 | 3300026116 | Unclassified | 959 |
| 397 | Ga0207675_100017563 | 3300026118 | Bacteria | 6676 |
| 398 | Ga0207675_100236685 | 3300026118 | Bacteria | 1763 |
| 399 | Ga0207683_10000098 | 3300026121 | Bacteria | 71739 |
| 400 | Ga0207683_10540852 | 3300026121 | Unclassified | 1077 |
| 401 | Ga0207683_10583410 | 3300026121 | Bacteria | 1034 |
| 402 | Ga0207683_10956544 | 3300026121 | Unclassified | 795 |
| 403 | Ga0207698_10009641 | 3300026142 | Bacteria | 6165 |
| 404 | Ga0207698_10157041 | 3300026142 | Bacteria | 1983 |
| 405 | Ga0207698_10164235 | 3300026142 | Bacteria | 1946 |
| 406 | Ga0207698_11225695 | 3300026142 | Unclassified | 764 |
| 407 | Ga0207428_10041841 | 3300027907 | Bacteria | 3708 |
| 408 | Ga0207428_10138277 | 3300027907 | Bacteria | 1861 |
| 409 | Ga0207428_10803476 | 3300027907 | Unclassified | 668 |
| 410 | Ga0207428_10999354 | 3300027907 | Bacteria | 588 |
| 411 | Ga0268266_10041473 | 3300028379 | Bacteria | 3928 |
| 412 | Ga0268265_10542184 | 3300028380 | Bacteria | 1103 |
| 413 | Ga0268265_11613000 | 3300028380 | Unclassified | 654 |
| 414 | Ga0268264_10093314 | 3300028381 | Bacteria | 2600 |
| 415 | Ga0268264_10262669 | 3300028381 | Bacteria | 1609 |
| 416 | Ga0265319_1025981 | 3300028563 | Bacteria | 2090 |
| 417 | Ga0265318_10026778 | 3300028577 | Bacteria | 2269 |
| 418 | Ga0265318_10239141 | 3300028577 | Bacteria | 663 |
| 419 | Ga0265338_10051655 | 3300028800 | Bacteria | 3698 |
| 420 | Ga0265320_10369575 | 3300031240 | Bacteria | 633 |
| 421 | Ga0265327_10004579 | 3300031251 | Bacteria | 12173 |
| 422 | Ga0307408_101685073 | 3300031548 | Bacteria | 604 |
| 423 | Ga0265314_10130962 | 3300031711 | Bacteria | 1565 |
| 424 | Ga0265314_10299512 | 3300031711 | Bacteria | 903 |
| 425 | Ga0307405_10367479 | 3300031731 | Bacteria | 1115 |
| 426 | Ga0307413_10286347 | 3300031824 | Bacteria | 1242 |
| 427 | Ga0307413_10302156 | 3300031824 | Bacteria | 1214 |
| 428 | Ga0307410_10261617 | 3300031852 | Bacteria | 1349 |
| 429 | Ga0307410_10460621 | 3300031852 | Bacteria | 1039 |
| 430 | Ga0307410_11792190 | 3300031852 | Bacteria | 545 |
| 431 | Ga0307406_10105101 | 3300031901 | Bacteria | 1931 |
| 432 | Ga0307406_10664910 | 3300031901 | Bacteria | 866 |
| 433 | Ga0307406_10935081 | 3300031901 | Bacteria | 740 |
| 434 | Ga0307407_10084949 | 3300031903 | Unclassified | 1925 |
| 435 | Ga0307412_10151690 | 3300031911 | Bacteria | 1711 |
| 436 | Ga0307412_10652625 | 3300031911 | Bacteria | 898 |
| 437 | Ga0307412_12086522 | 3300031911 | Unclassified | 526 |
| 438 | Ga0307409_100054075 | 3300031995 | Bacteria | 3089 |
| 439 | Ga0307409_102173929 | 3300031995 | Unclassified | 584 |
| 440 | Ga0307416_100665094 | 3300032002 | Unclassified | 1128 |
| 441 | Ga0307416_102828370 | 3300032002 | Bacteria | 580 |
| 442 | Ga0307416_103154026 | 3300032002 | Bacteria | 552 |
| 443 | Ga0307414_10193932 | 3300032004 | Bacteria | 1646 |
| 444 | Ga0307411_11710960 | 3300032005 | Unclassified | 582 |
| 445 | Ga0307415_100548007 | 3300032126 | Bacteria | 1020 |
| 446 | Ga0307415_101314320 | 3300032126 | Bacteria | 685 |
| 447 | Ga0307415_101349521 | 3300032126 | Bacteria | 677 |
| 448 | Ga0373944_0186769 | 3300035089 | Bacteria | 745 |
| 449 | Ga0373923_0004844 | 3300035111 | Bacteria | 4508 |
| 450 | Ga0373936_0033654 | 3300035113 | Bacteria | 2032 |
| 451 | Ga0373945_0264992 | 3300035116 | Bacteria | 729 |
| 452 | Ga0373945_0302440 | 3300035116 | Bacteria | 685 |
| 453 | Ga0373953_0437267 | 3300035117 | Unclassified | 577 |
| 454 | Ga0373954_0083557 | 3300035118 | Bacteria | 1528 |
| 455 | Ga0373956_0217075 | 3300035119 | Bacteria | 908 |
| 456 | Ga0373957_0213503 | 3300035120 | Bacteria | 806 |
| 457 | Ga0373943_0049653 | 3300035170 | Bacteria | 2059 |
| 458 | Ga0373943_0227841 | 3300035170 | Bacteria | 1040 |
| 459 | Ga0373946_0640759 | 3300035171 | Bacteria | 553 |
| 460 | Ga0373955_0077652 | 3300035172 | Bacteria | 1870 |
| 461 | Ga0373924_0049465 | 3300035410 | Bacteria | 1739 |
| 462 | Ga0373935_0160600 | 3300035692 | Unclassified | 1531 |
| 463 | Ga0373927_0134354 | 3300035695 | Bacteria | 1617 |
| 464 | Ga0373927_0139102 | 3300035695 | Bacteria | 1587 |
| 465 | Ga0373927_0328376 | 3300035695 | Bacteria | 1008 |
| 466 | Ga0373933_0043773 | 3300035724 | Bacteria | 2650 |
| 467 | Ga0373947_0048843 | 3300035725 | Bacteria | 2539 |
| 468 | Ga0373947_0310619 | 3300035725 | Bacteria | 1053 |
| 469 | Ga0373937_0346631 | 3300036401 | Bacteria | 1406 |
| 470 | Ga0373925_0108455 | 3300037068 | Bacteria | 2142 |
| 471 | Ga0373925_0204130 | 3300037068 | Bacteria | 1573 |
| 472 | Ga0395898_0342978 | 3300037466 | Bacteria | 1425 |
| 473 | Ga0436364_0334055 | 3300037853 | Unclassified | 983 |
| 474 | Ga0436364_0635347 | 3300037853 | Bacteria | 5851 |
| 475 | Ga0436364_0649140 | 3300037853 | Bacteria | 6357 |
| 476 | Ga0436364_0731868 | 3300037853 | Unclassified | 614 |
| 477 | Ga0436364_1031907 | 3300037853 | Bacteria | 102112 |
| 478 | Ga0436364_1102629 | 3300037853 | Bacteria | 6181 |
| 479 | Ga0436364_1427363 | 3300037853 | Bacteria | 3698 |
| 480 | Ga0436364_1441737 | 3300037853 | Bacteria | 1567 |
| 481 | Ga0436365_0237483 | 3300039437 | Bacteria | 749 |
| 482 | Ga0436365_0401331 | 3300039437 | Bacteria | 6190 |
| 483 | Ga0436365_0904996 | 3300039437 | Bacteria | 14294 |
| 484 | Ga0436365_1066112 | 3300039437 | Bacteria | 4477 |
| 485 | Ga0436365_1258992 | 3300039437 | Bacteria | 1785 |
| 486 | Ga0436365_1650091 | 3300039437 | Bacteria | 13373 |
| 487 | Ga0436360_0936914 | 3300039438 | Unclassified | 894 |
| 488 | Ga0436361_0474887 | 3300039447 | Unclassified | 823 |
| 489 | Ga0436363_0142574 | 3300039450 | Bacteria | 1430 |
| 490 | Ga0436363_0445240 | 3300039450 | Bacteria | 1021 |
| 491 | Ga0436363_0709244 | 3300039450 | Unclassified | 757 |
| 492 | Ga0436363_0793499 | 3300039450 | Unclassified | 836 |
| 493 | Ga0436363_1050794 | 3300039450 | Unclassified | 569 |
| 494 | Ga0436363_1089750 | 3300039450 | Bacteria | 10440 |
| 495 | Ga0436363_1106810 | 3300039450 | Bacteria | 5353 |
| 496 | Ga0436363_1357287 | 3300039450 | Bacteria | 1076 |
| 497 | Ga0436363_1644680 | 3300039450 | Bacteria | 1284 |
| 498 | Ga0436363_1705603 | 3300039450 | Bacteria | 5301 |
| 499 | Ga0436362_0310761 | 3300039453 | Unclassified | 1607 |
| 500 | Ga0436362_0626285 | 3300039453 | Bacteria | 773 |
| 501 | Ga0436362_0906932 | 3300039453 | Unclassified | 1445 |
| 502 | Ga0451789_0720585 | 3300041443 | Bacteria | 686 |
| 503 | Ga0451853_0030295 | 3300041512 | Unclassified | 578 |
| 504 | Ga0451853_0468880 | 3300041512 | Unclassified | 603 |
| 505 | Ga0439448_0226952 | 3300042005 | Unclassified | 657 |
| 506 | Ga0450915_005259 | 3300042119 | Bacteria | 793 |
| 507 | Ga0450888_003572 | 3300042126 | Bacteria | 1583 |
| 508 | Ga0466966_0220968 | 3300044684 | Bacteria | 1144 |
| 509 | Ga0466964_0423154 | 3300044706 | Unclassified | 701 |
| 510 | Ga0466968_0034907 | 3300044735 | Bacteria | 2102 |
| 511 | Ga0466959_0199329 | 3300045049 | Unclassified | 1394 |
| 512 | Ga0466959_0298225 | 3300045049 | Unclassified | 1104 |
| 513 | Ga0466958_0108445 | 3300045836 | Unclassified | 1732 |
| 514 | Ga0466958_0311555 | 3300045836 | Unclassified | 1011 |
| 515 | Ga0466967_0027714 | 3300045976 | Bacteria | 4716 |
| 516 | Ga0466967_0050202 | 3300045976 | Bacteria | 3652 |
| 517 | Ga0466967_0414128 | 3300045976 | Bacteria | 1313 |
| 518 | Ga0466967_0423638 | 3300045976 | Bacteria | 1298 |
| 519 | Ga0466967_0467108 | 3300045976 | Bacteria | 1235 |
| 520 | Ga0466967_0722272 | 3300045976 | Bacteria | 987 |
| 521 | Ga0466967_1351463 | 3300045976 | Bacteria | 710 |
| 522 | Ga0466967_2058120 | 3300045976 | Unclassified | 567 |
| 523 | Ga0495592_0294649 | 3300046454 | Unclassified | 1056 |
| 524 | Ga0495592_0864191 | 3300046454 | Unclassified | 534 |
| 525 | Ga0495603_0065347 | 3300046455 | Bacteria | 2144 |
| 526 | Ga0495603_0159578 | 3300046455 | Bacteria | 1308 |
| 527 | Ga0495603_0476065 | 3300046455 | Bacteria | 715 |
| 528 | Ga0495629_0052587 | 3300046459 | Bacteria | 2850 |
| 529 | Ga0495641_0048719 | 3300046461 | Bacteria | 1942 |
| 530 | Ga0495641_0063736 | 3300046461 | Bacteria | 1660 |
| 531 | Ga0495641_0212455 | 3300046461 | Bacteria | 867 |
| 532 | Ga0495651_0097342 | 3300046462 | Bacteria | 2197 |
| 533 | Ga0495653_0010293 | 3300046463 | Bacteria | 7653 |
| 534 | Ga0495653_0331423 | 3300046463 | Unclassified | 984 |
| 535 | Ga0495653_0495249 | 3300046463 | Unclassified | 763 |
| 536 | Ga0495580_0131021 | 3300046472 | Bacteria | 1739 |
| 537 | Ga0495582_0017805 | 3300046473 | Bacteria | 3883 |
| 538 | Ga0495582_0433986 | 3300046473 | Bacteria | 758 |
| 539 | Ga0495582_0528047 | 3300046473 | Bacteria | 682 |
| 540 | Ga0495639_0002417 | 3300046475 | Bacteria | 8156 |
| 541 | Ga0495639_0112290 | 3300046475 | Bacteria | 1294 |
| 542 | Ga0495662_0002132 | 3300046476 | Bacteria | 9924 |
| 543 | Ga0495662_0395879 | 3300046476 | Bacteria | 678 |
| 544 | Ga0495664_0376426 | 3300046477 | Bacteria | 854 |
| 545 | Ga0495585_0220687 | 3300046492 | Unclassified | 957 |
| 546 | Ga0495594_0008788 | 3300046499 | Bacteria | 5208 |
| 547 | Ga0495608_0049917 | 3300046511 | Bacteria | 2776 |
| 548 | Ga0495608_0675439 | 3300046511 | Bacteria | 616 |
| 549 | Ga0495618_0022487 | 3300046514 | Bacteria | 3894 |
| 550 | Ga0495618_0429057 | 3300046514 | Bacteria | 805 |
| 551 | Ga0495620_0321827 | 3300046515 | Bacteria | 587 |
| 552 | Ga0495628_0577172 | 3300046516 | Bacteria | 805 |
| 553 | Ga0495630_0054473 | 3300046517 | Bacteria | 2996 |
| 554 | Ga0495666_0010114 | 3300046526 | Bacteria | 4706 |
| 555 | Ga0495652_0097601 | 3300046529 | Bacteria | 2390 |
| 556 | Ga0495652_0136672 | 3300046529 | Bacteria | 1933 |
| 557 | Ga0495665_0001629 | 3300046531 | Bacteria | 12014 |
| 558 | Ga0495640_0519470 | 3300046533 | Bacteria | 723 |
| 559 | Ga0495640_0607476 | 3300046533 | Bacteria | 660 |
| 560 | Ga0495587_0563144 | 3300046536 | Unclassified | 628 |
| 561 | Ga0495667_0009327 | 3300046559 | Bacteria | 6650 |
| 562 | Ga0495656_0327837 | 3300046615 | Bacteria | 790 |
| 563 | Ga0495656_0492103 | 3300046615 | Bacteria | 650 |
| 564 | Ga0495668_0437180 | 3300046616 | Unclassified | 720 |
| 565 | Ga0495634_0012006 | 3300046642 | Bacteria | 6279 |
| 566 | Ga0495635_0022073 | 3300046663 | Bacteria | 4435 |
| 567 | Ga0495588_0075512 | 3300046674 | Bacteria | 1756 |
| 568 | Ga0495657_0013747 | 3300046675 | Bacteria | 5959 |
| 569 | Ga0495599_0375291 | 3300046678 | Unclassified | 850 |
| 570 | Ga0495599_0879588 | 3300046678 | Unclassified | 508 |
| 571 | Ga0495623_0098773 | 3300046679 | Bacteria | 1781 |
| 572 | Ga0495646_0564020 | 3300046680 | Bacteria | 580 |
| 573 | Ga0495646_0577311 | 3300046680 | Bacteria | 572 |
| 574 | Ga0495647_0000590 | 3300046681 | Bacteria | 10755 |
| 575 | Ga0495658_0279153 | 3300046683 | Bacteria | 1054 |
| 576 | Ga0495613_0015895 | 3300046689 | Bacteria | 5603 |
| 577 | Ga0495624_0023602 | 3300046690 | Bacteria | 4054 |
| 578 | Ga0495624_0895062 | 3300046690 | Bacteria | 523 |
| 579 | Ga0495624_0953726 | 3300046690 | Unclassified | 504 |
| 580 | Ga0495670_0533288 | 3300046691 | Bacteria | 638 |
| 581 | Ga0495589_0459147 | 3300046794 | Bacteria | 583 |
| 582 | Ga0495600_0043352 | 3300046809 | Bacteria | 2934 |
| 583 | Ga0495600_0045946 | 3300046809 | Bacteria | 2849 |
| 584 | Ga0495581_0005143 | 3300047315 | Bacteria | 7569 |
| 585 | Ga0495581_0663290 | 3300047315 | Unclassified | 602 |
| 586 | Ga0495604_0052658 | 3300047317 | Bacteria | 3150 |
| 587 | Ga0495674_0003550 | 3300047319 | Bacteria | 15161 |
| 588 | Ga0495674_1451571 | 3300047319 | Bacteria | 509 |
| 589 | Ga0495676_0030243 | 3300047321 | Bacteria | 4601 |
| 590 | Ga0495676_0158256 | 3300047321 | Bacteria | 1605 |
| 591 | Ga0495680_0017614 | 3300047322 | Bacteria | 6089 |
| 592 | Ga0495675_0016700 | 3300047444 | Bacteria | 4642 |
| 593 | Ga0495684_0006150 | 3300047471 | Bacteria | 9344 |
| 594 | Ga0495593_0025452 | 3300047673 | Bacteria | 3275 |
| 595 | Ga0495593_0261004 | 3300047673 | Bacteria | 867 |
| 596 | Ga0495602_1028565 | 3300048088 | Bacteria | 543 |
| 597 | Ga0495614_0021631 | 3300048089 | Bacteria | 2776 |
| 598 | Ga0495615_0162911 | 3300048090 | Bacteria | 671 |
| 599 | Ga0496100_0002592 | 3300048903 | Bacteria | 9215 |
| 600 | Ga0496100_0124538 | 3300048903 | Bacteria | 1807 |
| 601 | Ga0496100_0204058 | 3300048903 | Unclassified | 1442 |
| 602 | Ga0496100_0346083 | 3300048903 | Bacteria | 1122 |
| 603 | Ga0496100_0583548 | 3300048903 | Unclassified | 867 |
| 604 | Ga0496100_1352830 | 3300048903 | Unclassified | 562 |
| 605 | Ga0496101_0006496 | 3300048904 | Bacteria | 7528 |
| 606 | Ga0496101_0018561 | 3300048904 | Bacteria | 4731 |
| 607 | Ga0496101_0060214 | 3300048904 | Bacteria | 2754 |
| 608 | Ga0496101_0187915 | 3300048904 | Bacteria | 1593 |
| 609 | Ga0496102_0002361 | 3300048905 | Bacteria | 16111 |
| 610 | Ga0496102_0004122 | 3300048905 | Bacteria | 12319 |
| 611 | Ga0496102_0053118 | 3300048905 | Bacteria | 3694 |
| 612 | Ga0496102_0179746 | 3300048905 | Bacteria | 1993 |
| 613 | Ga0496102_0186797 | 3300048905 | Bacteria | 1953 |
| 614 | Ga0496102_0202924 | 3300048905 | Bacteria | 1869 |
| 615 | Ga0496102_0700877 | 3300048905 | Bacteria | 935 |
| 616 | Ga0496102_1163889 | 3300048905 | Unclassified | 691 |
| 617 | Ga0496102_1803528 | 3300048905 | Bacteria | 529 |
| 618 | Ga0496103_0000900 | 3300048906 | Bacteria | 21361 |
| 619 | Ga0496103_0261985 | 3300048906 | Bacteria | 1112 |
| 620 | Ga0496103_0519329 | 3300048906 | Bacteria | 761 |
| 621 | Ga0496103_0700006 | 3300048906 | Bacteria | 642 |
| 622 | Ga0496103_0793104 | 3300048906 | Unclassified | 598 |
| 623 | Ga0496104_0002813 | 3300048907 | Bacteria | 15001 |
| 624 | Ga0496104_0016977 | 3300048907 | Bacteria | 6622 |
| 625 | Ga0496104_0035622 | 3300048907 | Bacteria | 4647 |
| 626 | Ga0496104_0039310 | 3300048907 | Bacteria | 4430 |
| 627 | Ga0496104_0516501 | 3300048907 | Bacteria | 1106 |
| 628 | Ga0496104_1693459 | 3300048907 | Bacteria | 535 |
| 629 | Ga0496105_0009674 | 3300048908 | Bacteria | 7546 |
| 630 | Ga0496105_0033357 | 3300048908 | Bacteria | 4227 |
| 631 | Ga0496105_0675332 | 3300048908 | Bacteria | 795 |
| 632 | Ga0496106_0004546 | 3300048909 | Bacteria | 10281 |
| 633 | Ga0496106_0046292 | 3300048909 | Bacteria | 3269 |
| 634 | Ga0496106_0052832 | 3300048909 | Bacteria | 3067 |
| 635 | Ga0496107_0004168 | 3300048910 | Bacteria | 9760 |
| 636 | Ga0496107_0028545 | 3300048910 | Bacteria | 3966 |
| 637 | Ga0496107_0036418 | 3300048910 | Bacteria | 3529 |
| 638 | Ga0496108_0025064 | 3300048911 | Bacteria | 4914 |
| 639 | Ga0496108_0095159 | 3300048911 | Bacteria | 2535 |
| 640 | Ga0496108_0332200 | 3300048911 | Unclassified | 1326 |
| 641 | Ga0496109_0000999 | 3300048912 | Bacteria | 23362 |
| 642 | Ga0496109_0050806 | 3300048912 | Bacteria | 3775 |
| 643 | Ga0496109_0063573 | 3300048912 | Bacteria | 3376 |
| 644 | Ga0496109_0338547 | 3300048912 | Unclassified | 1421 |
| 645 | Ga0496109_1084782 | 3300048912 | Bacteria | 738 |
| 646 | Ga0496110_0001024 | 3300048913 | Bacteria | 19667 |
| 647 | Ga0496110_0027449 | 3300048913 | Bacteria | 4881 |
| 648 | Ga0496110_0621833 | 3300048913 | Unclassified | 979 |
| 649 | Ga0496110_1369135 | 3300048913 | Unclassified | 617 |
| 650 | Ga0496111_0005422 | 3300048914 | Bacteria | 8174 |
| 651 | Ga0496111_0027704 | 3300048914 | Bacteria | 4012 |
| 652 | Ga0496111_0532315 | 3300048914 | Unclassified | 863 |
| 653 | Ga0496112_0021398 | 3300048915 | Bacteria | 6150 |
| 654 | Ga0496112_0101937 | 3300048915 | Unclassified | 2840 |
| 655 | Ga0496112_0482719 | 3300048915 | Bacteria | 1176 |
| 656 | Ga0496112_1736120 | 3300048915 | Unclassified | 536 |
| 657 | Ga0496113_0010790 | 3300048916 | Bacteria | 6059 |
| 658 | Ga0496113_0925846 | 3300048916 | Bacteria | 689 |
| 659 | Ga0496113_1187655 | 3300048916 | Unclassified | 596 |
| 660 | Ga0496114_0020808 | 3300048917 | Bacteria | 5326 |
| 661 | Ga0496114_0045492 | 3300048917 | Bacteria | 3646 |
| 662 | Ga0496114_0046951 | 3300048917 | Bacteria | 3590 |
| 663 | Ga0496114_0380887 | 3300048917 | Unclassified | 1249 |
| 664 | Ga0496114_1145004 | 3300048917 | Unclassified | 663 |
| 665 | Ga0496115_0009605 | 3300048918 | Bacteria | 7193 |
| 666 | Ga0496115_0011122 | 3300048918 | Bacteria | 6743 |
| 667 | Ga0496115_0028400 | 3300048918 | Bacteria | 4384 |
| 668 | Ga0496115_0056933 | 3300048918 | Bacteria | 3143 |
| 669 | Ga0496115_0978589 | 3300048918 | Bacteria | 648 |
| 670 | Ga0501031_0098080 | 3300049568 | Bacteria | 1912 |
| 671 | Ga0501033_0178223 | 3300049570 | Bacteria | 1524 |
| 672 | Ga0501034_0374862 | 3300049571 | Bacteria | 1349 |
| 673 | Ga0501036_0088604 | 3300049572 | Bacteria | 2615 |
| 674 | Ga0501036_0270575 | 3300049572 | Bacteria | 1422 |
| 675 | Ga0501037_0221816 | 3300049573 | Bacteria | 1330 |
| 676 | Ga0501039_0257285 | 3300049575 | Bacteria | 1372 |
| 677 | Ga0501040_0091518 | 3300049576 | Bacteria | 2114 |
| 678 | Ga0501040_0494696 | 3300049576 | Bacteria | 881 |
| 679 | Ga0501041_0014031 | 3300049577 | Bacteria | 4754 |
| 680 | Ga0501041_0258216 | 3300049577 | Bacteria | 1095 |
| 681 | Ga0501042_0095351 | 3300049578 | Bacteria | 2137 |
| 682 | Ga0501042_0110522 | 3300049578 | Bacteria | 1979 |
| 683 | Ga0501042_1073303 | 3300049578 | Bacteria | 587 |
| 684 | Ga0501046_0140512 | 3300049580 | Bacteria | 1828 |
| 685 | Ga0501046_0235187 | 3300049580 | Unclassified | 1353 |
| 686 | Ga0501046_0527766 | 3300049580 | Bacteria | 843 |
| 687 | Ga0501048_0078076 | 3300049582 | Bacteria | 2336 |
| 688 | Ga0501048_0110944 | 3300049582 | Bacteria | 1937 |
| 689 | Ga0501048_0227513 | 3300049582 | Bacteria | 1323 |
| 690 | Ga0501048_0312538 | 3300049582 | Unclassified | 1119 |
| 691 | Ga0501068_0482102 | 3300049584 | Bacteria | 804 |
| 692 | Ga0501068_1059695 | 3300049584 | Bacteria | 536 |
| 693 | Ga0501069_0604575 | 3300049585 | Bacteria | 658 |
| 694 | Ga0501070_0238078 | 3300049586 | Bacteria | 1490 |
| 695 | Ga0501071_0051006 | 3300049587 | Bacteria | 2981 |
| 696 | Ga0501071_0073172 | 3300049587 | Bacteria | 2499 |
| 697 | Ga0501071_0826770 | 3300049587 | Unclassified | 714 |
| 698 | Ga0501071_1093476 | 3300049587 | Bacteria | 616 |
| 699 | Ga0501072_0180744 | 3300049588 | Bacteria | 1682 |
| 700 | Ga0501072_0376088 | 3300049588 | Unclassified | 1127 |
| 701 | Ga0501072_0408109 | 3300049588 | Unclassified | 1077 |
| 702 | Ga0501074_0043550 | 3300049590 | Bacteria | 3249 |
| 703 | Ga0501074_0230281 | 3300049590 | Bacteria | 1319 |
| 704 | Ga0501074_0587014 | 3300049590 | Unclassified | 788 |
| 705 | Ga0501075_0043708 | 3300049591 | Bacteria | 3360 |
| 706 | Ga0501076_0019050 | 3300049592 | Bacteria | 5236 |
| 707 | Ga0501076_0121921 | 3300049592 | Bacteria | 2111 |
| 708 | Ga0501076_0621237 | 3300049592 | Unclassified | 891 |
| 709 | Ga0501077_0111146 | 3300049593 | Bacteria | 1737 |
| 710 | Ga0501077_0423794 | 3300049593 | Unclassified | 851 |
| 711 | Ga0501079_0198164 | 3300049741 | Unclassified | 1568 |
| 712 | Ga0501079_0711593 | 3300049741 | Unclassified | 790 |
| 713 | Ga0501080_0226217 | 3300049742 | Unclassified | 1711 |
| 714 | Ga0501080_0346554 | 3300049742 | Unclassified | 1342 |
| 715 | Ga0501081_0064875 | 3300049743 | Bacteria | 2537 |
| 716 | Ga0501081_0290905 | 3300049743 | Bacteria | 1197 |
| 717 | Ga0501081_0291723 | 3300049743 | Unclassified | 1196 |
| 718 | Ga0501081_1080571 | 3300049743 | Unclassified | 607 |
| 719 | Ga0501083_0137141 | 3300049744 | Bacteria | 1603 |
| 720 | Ga0501045_0114345 | 3300049824 | Bacteria | 2001 |
| 721 | Ga0501045_0279007 | 3300049824 | Unclassified | 1244 |
| 722 | nmdc:mga03683_8898_c1 | 3300050489 | Bacteria | 3550 |
| 723 | nmdc:mga03n38_194074_c1 | 3300050490 | Bacteria | 1047 |
| 724 | nmdc:mga03n38_789519_c1 | 3300050490 | Unclassified | 552 |
| 725 | nmdc:mga00v17_14620_c1 | 3300050491 | Bacteria | 4387 |
| 726 | nmdc:mga05p37_1203412_c1 | 3300050507 | Bacteria | 782 |
| 727 | nmdc:mga05p37_1393678_c1 | 3300050507 | Bacteria | 707 |
| 728 | nmdc:mga05p37_2045321_c1 | 3300050507 | Unclassified | 540 |
| 729 | nmdc:mga05p37_873857_c1 | 3300050507 | Unclassified | 973 |
| 730 | nmdc:mga09592_126603_c1 | 3300050508 | Bacteria | 2196 |
| 731 | nmdc:mga09592_874732_c1 | 3300050508 | Bacteria | 757 |
| 732 | nmdc:mga06r32_10365_c1 | 3300050510 | Bacteria | 8408 |
| 733 | nmdc:mga06r32_131044_c1 | 3300050510 | Bacteria | 2479 |
| 734 | nmdc:mga06r32_190835_c1 | 3300050510 | Bacteria | 2037 |
| 735 | nmdc:mga08y16_1073349_c1 | 3300050511 | Bacteria | 781 |
| 736 | nmdc:mga08y16_147968_c1 | 3300050511 | Bacteria | 2441 |
| 737 | nmdc:mga08y16_21380_c1 | 3300050511 | Bacteria | 6833 |
| 738 | nmdc:mga08y16_60559_c1 | 3300050511 | Bacteria | 3954 |
| 739 | nmdc:mga08y16_723813_c1 | 3300050511 | Bacteria | 993 |
| 740 | nmdc:mga0n895_2012500_c1 | 3300050512 | Bacteria | 535 |
| 741 | nmdc:mga0n895_468166_c1 | 3300050512 | Bacteria | 1271 |
| 742 | nmdc:mga0n895_74928_c1 | 3300050512 | Bacteria | 3363 |
| 743 | nmdc:mga0rr50_1498909_c1 | 3300050513 | Unclassified | 570 |
| 744 | nmdc:mga0rr50_1712788_c1 | 3300050513 | Bacteria | 530 |
| 745 | nmdc:mga08x19_161378_c1 | 3300050514 | Unclassified | 1522 |
| 746 | nmdc:mga08x19_899529_c1 | 3300050514 | Bacteria | 629 |
| 747 | Ga0495601_0147897 | 3300053077 | Bacteria | 1533 |
| 748 | Ga0495612_0200639 | 3300053078 | Bacteria | 880 |
| 749 | Ga0495595_0005295 | 3300053084 | Bacteria | 5216 |
| 750 | Ga0495595_0276020 | 3300053084 | Bacteria | 843 |
| 751 | Ga0495619_0003931 | 3300053085 | Bacteria | 9549 |
| 752 | Ga0500616_0096673 | 3300053153 | Bacteria | 1451 |
| 753 | Ga0501084_0017709 | 3300054114 | Bacteria | 5927 |
| 754 | Ga0501084_0207082 | 3300054114 | Bacteria | 1655 |
| 755 | Ga0501084_0212016 | 3300054114 | Bacteria | 1634 |
| 756 | Ga0501082_0050508 | 3300060353 | Bacteria | 3586 |
| 757 | Ga0501082_0124883 | 3300060353 | Bacteria | 2232 |
| 758 | Ga0501082_0461896 | 3300060353 | Bacteria | 1109 |
| 759 | Ga0466962_0631453 | 3300061719 | Unclassified | 547 |
| 760 | Ga0530510_0011028 | 3300061734 | Bacteria | 6339 |
| 761 | Ga0530510_0115082 | 3300061734 | Unclassified | 1971 |
| 762 | Ga0530510_0393201 | 3300061734 | Unclassified | 1044 |
| 763 | Ga0307416_101317210 | |||
| 764 | Ga0070676_10180947 | |||
| 765 | Ga0070683_100915640 | |||
| 766 | Ga0070690_100402211 | |||
| 767 | Ga0068869_100039228 | |||
| 768 | Ga0068869_100096015 | |||
| 769 | Ga0070666_10396223 | |||
| 770 | Ga0070666_11084880 | |||
| 771 | Ga0070666_11460413 | |||
| 772 | Ga0070680_100354813 | |||
| 773 | Ga0070680_100654196 | |||
| 774 | Ga0070682_100067762 | |||
| 775 | Ga0070682_100670740 | |||
| 776 | Ga0070682_100792793 | |||
| 777 | Ga0068868_100001984 | |||
| 778 | Ga0068868_100356156 | |||
| 779 | Ga0068868_100385962 | |||
| 780 | Ga0070660_100065011 | |||
| 781 | Ga0070689_100806312 | |||
| 782 | Ga0070691_10005696 | |||
| 783 | Ga0070691_10021585 | |||
| 784 | Ga0070668_100032709 | |||
| 785 | Ga0070668_100057906 | |||
| 786 | Ga0070669_100892804 | |||
| 787 | Ga0070669_100912922 | |||
| 788 | Ga0070675_100040215 | |||
| 789 | Ga0070675_100256270 | |||
| 790 | Ga0070675_100394384 | |||
| 791 | Ga0070671_100208832 | |||
| 792 | Ga0070671_100595502 | |||
| 793 | Ga0070671_100648947 | |||
| 794 | Ga0070671_102118797 | |||
| 795 | Ga0070674_100043457 | |||
| 796 | Ga0070674_100078634 | |||
| 797 | Ga0070674_100279812 | |||
| 798 | Ga0070674_100984320 | |||
| 799 | Ga0070674_101316018 | |||
| 800 | Ga0070674_101316258 | |||
| 801 | Ga0070688_100063706 | |||
| 802 | Ga0070688_100642680 | |||
| 803 | Ga0070659_101092600 | |||
| 804 | Ga0070659_101349853 | |||
| 805 | Ga0070667_100114562 | |||
| 806 | Ga0070667_100487793 | |||
| 807 | Ga0070667_100969395 | |||
| 808 | Ga0070667_102206448 | |||
| 809 | Ga0070714_100072611 | |||
| 810 | Ga0070714_100304034 | |||
| 811 | Ga0070714_100634395 | |||
| 812 | Ga0070713_100519802 | |||
| 813 | Ga0070710_10040149 | |||
| 814 | Ga0070710_10231788 | |||
| 815 | Ga0070710_10315394 | |||
| 816 | Ga0070710_11175814 | |||
| 817 | Ga0070701_10176785 | |||
| 818 | Ga0070701_10874033 | |||
| 819 | Ga0070701_11269540 | |||
| 820 | Ga0070711_100025636 | |||
| 821 | Ga0070711_100181844 | |||
| 822 | Ga0070711_100220104 | |||
| 823 | Ga0070711_100304891 | |||
| 824 | Ga0070711_100957947 | |||
| 825 | Ga0070705_100017337 | |||
| 826 | Ga0070705_100723618 | |||
| 827 | Ga0070705_101490598 | |||
| 828 | Ga0070700_100001106 | |||
| 829 | Ga0070700_100132215 | |||
| 830 | Ga0070700_100277363 | |||
| 831 | Ga0070694_100657380 | |||
| 832 | Ga0070694_100815468 | |||
| 833 | Ga0070694_101864920 | |||
| 834 | Ga0070663_100027740 | |||
| 835 | Ga0070663_100567010 | |||
| 836 | Ga0070678_101001618 | |||
| 837 | Ga0070662_100054441 | |||
| 838 | Ga0070681_10147509 | |||
| 839 | Ga0070681_10386216 | |||
| 840 | Ga0070681_10859848 | |||
| 841 | Ga0068867_100128251 | |||
| 842 | Ga0068867_100959832 | |||
| 843 | Ga0068867_101282483 | |||
| 844 | Ga0070685_11540947 | |||
| 845 | Ga0070699_101438911 | |||
| 846 | Ga0070679_100265327 | |||
| 847 | Ga0070679_100286282 | |||
| 848 | Ga0070679_101760047 | |||
| 849 | Ga0070684_100006386 | |||
| 850 | Ga0070684_100054473 | |||
| 851 | Ga0070684_100595658 | |||
| 852 | Ga0070684_100934842 | |||
| 853 | Ga0070684_102337487 | |||
| 854 | Ga0068853_100378902 | |||
| 855 | Ga0070672_100120278 | |||
| 856 | Ga0070672_100148224 | |||
| 857 | Ga0070672_100784067 | |||
| 858 | Ga0070686_100050418 | |||
| 859 | Ga0070686_100177040 | |||
| 860 | Ga0070686_100385240 | |||
| 861 | Ga0070695_100595309 | |||
| 862 | Ga0070696_100047166 | |||
| 863 | Ga0070696_101954914 | |||
| 864 | Ga0070693_100119616 | |||
| 865 | Ga0070693_100246567 | |||
| 866 | Ga0070693_100287603 | |||
| 867 | Ga0070665_100153705 | |||
| 868 | Ga0068855_100284083 | |||
| 869 | Ga0068855_101012266 | |||
| 870 | Ga0070664_100028477 | |||
| 871 | Ga0070664_101607493 | |||
| 872 | Ga0068854_100037103 | |||
| 873 | Ga0068854_101215480 | |||
| 874 | Ga0068854_101252123 | |||
| 875 | Ga0068856_100064219 | |||
| 876 | Ga0068856_102032541 | |||
| 877 | Ga0070702_100027315 | |||
| 878 | Ga0070702_100040550 | |||
| 879 | Ga0070702_100335458 | |||
| 880 | Ga0068852_100104417 | |||
| 881 | Ga0068852_101851370 | |||
| 882 | Ga0068864_100023860 | |||
| 883 | Ga0068864_101547495 | |||
| 884 | Ga0068866_10038107 | |||
| 885 | Ga0068866_10134254 | |||
| 886 | Ga0068866_10941246 | |||
| 887 | Ga0068861_100153614 | |||
| 888 | Ga0068861_100307988 | |||
| 889 | Ga0068861_100452299 | |||
| 890 | Ga0068861_102092368 | |||
| 891 | Ga0068861_102634891 | |||
| 892 | Ga0068851_10655033 | |||
| 893 | Ga0068870_10285777 | |||
| 894 | Ga0068870_10881091 | |||
| 895 | Ga0068863_100361025 | |||
| 896 | Ga0068863_100785081 | |||
| 897 | Ga0068863_101030986 | |||
| 898 | Ga0068858_100175146 | |||
| 899 | Ga0068858_101696643 | |||
| 900 | Ga0068860_100015334 | |||
| 901 | Ga0068860_102381641 | |||
| 902 | Ga0068862_100928927 | |||
| 903 | Ga0068862_101423028 | |||
| 904 | Ga0081538_10048324 | |||
| 905 | Ga0081540_1036100 | |||
| 906 | Ga0081540_1070877 | |||
| 907 | Ga0081539_10001190 | |||
| 908 | Ga0070717_10015315 | |||
| 909 | Ga0070717_10650129 | |||
| 910 | Ga0075365_10259404 | |||
| 911 | Ga0075365_10667466 | |||
| 912 | Ga0075363_100261627 | |||
| 913 | Ga0075364_10270593 | |||
| 914 | Ga0070712_100007279 | |||
| 915 | Ga0070712_100221354 | |||
| 916 | Ga0070712_100596238 | |||
| 917 | Ga0075362_10008980 | |||
| 918 | Ga0075427_10007523 | |||
| 919 | Ga0097621_100009042 | |||
| 920 | Ga0097621_101308246 | |||
| 921 | Ga0068871_100540665 | |||
| 922 | Ga0068871_100738813 | |||
| 923 | Ga0075428_100547616 | |||
| 924 | Ga0075428_101742009 | |||
| 925 | Ga0075428_101770461 | |||
| 926 | Ga0075428_101862535 | |||
| 927 | Ga0075430_100228928 | |||
| 928 | Ga0075430_101545998 | |||
| 929 | Ga0075431_100970738 | |||
| 930 | Ga0075431_101177657 | |||
| 931 | Ga0075433_10086335 | |||
| 932 | Ga0075433_11332423 | |||
| 933 | Ga0075434_100060563 | |||
| 934 | Ga0075434_100145958 | |||
| 935 | Ga0075434_101894207 | |||
| 936 | Ga0075434_102412375 | |||
| 937 | Ga0075429_100111761 | |||
| 938 | Ga0075429_100233732 | |||
| 939 | Ga0068865_100266502 | |||
| 940 | Ga0068865_100761048 | |||
| 941 | Ga0068865_101750788 | |||
| 942 | Ga0075436_100158587 | |||
| 943 | Ga0075436_100176028 | |||
| 944 | Ga0075436_100429604 | |||
| 945 | Ga0075435_100134076 | |||
| 946 | Ga0105251_10517116 | |||
| 947 | Ga0105240_10307341 | |||
| 948 | Ga0111539_10029819 | |||
| 949 | Ga0111539_10159693 | |||
| 950 | Ga0111539_10401659 | |||
| 951 | Ga0111539_10742690 | |||
| 952 | Ga0111539_10791102 | |||
| 953 | Ga0111539_10856862 | |||
| 954 | Ga0111539_12169618 | |||
| 955 | Ga0105245_10002929 | |||
| 956 | Ga0105245_10078973 | |||
| 957 | Ga0105245_10247081 | |||
| 958 | Ga0105245_10492208 | |||
| 959 | Ga0105245_12483293 | |||
| 960 | Ga0105247_10048222 | |||
| 961 | Ga0114129_11961072 | |||
| 962 | Ga0114129_12078922 | |||
| 963 | Ga0105243_10013864 | |||
| 964 | Ga0105243_10045020 | |||
| 965 | Ga0105243_10092076 | |||
| 966 | Ga0105243_11196581 | |||
| 967 | Ga0105241_10114948 | |||
| 968 | Ga0105241_10222526 | |||
| 969 | Ga0105241_11380690 | |||
| 970 | Ga0105242_10010591 | |||
| 971 | Ga0105242_10582622 | |||
| 972 | Ga0105242_10623809 | |||
| 973 | Ga0105242_10747799 | |||
| 974 | Ga0105242_10983994 | |||
| 975 | Ga0105242_12278231 | |||
| 976 | Ga0105237_10449032 | |||
| 977 | Ga0105237_11597223 | |||
| 978 | Ga0105237_12325517 | |||
| 979 | Ga0105238_10006448 | |||
| 980 | Ga0105238_11408480 | |||
| 981 | Ga0105238_11853344 | |||
| 982 | Ga0105249_10062351 | |||
| 983 | Ga0105249_10157726 | |||
| 984 | Ga0105249_10188336 | |||
| 985 | Ga0105239_10008213 | |||
| 986 | Ga0105239_10012054 | |||
| 987 | Ga0105239_10197722 | |||
| 988 | Ga0105239_11477305 | |||
| 989 | Ga0105246_10077093 | |||
| 990 | Ga0105246_10167886 | |||
| 991 | Ga0105246_10679389 | |||
| 992 | Ga0157374_10047947 | |||
| 993 | Ga0157374_10052475 | |||
| 994 | Ga0157378_10013326 | |||
| 995 | Ga0157378_10250461 | |||
| 996 | Ga0163162_10689585 | |||
| 997 | Ga0157372_10038710 | |||
| 998 | Ga0157372_10240773 | |||
| 999 | Ga0157372_12286956 | |||
| 1000 | Ga0157372_12533317 | |||
| 1001 | Ga0157375_10051006 | |||
| 1002 | Ga0157375_10114706 | |||
| 1003 | Ga0157375_11097328 | |||
| 1004 | Ga0157375_11263875 | |||
| 1005 | Ga0157375_12264909 | |||
| 1006 | Ga0163163_10011750 | |||
| 1007 | Ga0163163_10053752 | |||
| 1008 | Ga0163163_12463218 | |||
| 1009 | Ga0163163_12835665 | |||
| 1010 | Ga0157380_10730259 | |||
| 1011 | Ga0157380_10789565 | |||
| 1012 | Ga0157380_11506914 | |||
| 1013 | Ga0157380_12813541 | |||
| 1014 | Ga0157380_13431259 | |||
| 1015 | Ga0157377_10001428 | |||
| 1016 | Ga0157377_10009705 | |||
| 1017 | Ga0157377_11405901 | |||
| 1018 | Ga0157379_10003614 | |||
| 1019 | Ga0157379_10164221 | |||
| 1020 | Ga0157376_10073372 | |||
| 1021 | Ga0157376_10209645 | |||
| 1022 | Ga0163161_10608507 | |||
| 1023 | Ga0163161_10981831 | |||
| 1024 | Ga0163161_11234241 | |||
| 1025 | Ga0206353_11318564 | |||
| 1026 | Ga0213874_10008924 | |||
| 1027 | Ga0213874_10018406 | |||
| 1028 | Ga0213874_10032377 | |||
| 1029 | Ga0213874_10125995 | |||
| 1030 | Ga0213876_10005125 | |||
| 1031 | Ga0213876_10014095 | |||
| 1032 | Ga0213876_10014320 | |||
| 1033 | Ga0213876_10183150 | |||
| 1034 | Ga0213875_10000432 | |||
| 1035 | Ga0213875_10024011 | |||
| 1036 | Ga0213875_10039358 | |||
| 1037 | Ga0213875_10271764 | |||
| 1038 | Ga0213875_10511500 | |||
| 1039 | Ga0207426_1034212 | |||
| 1040 | Ga0207692_10220643 | |||
| 1041 | Ga0207692_10607901 | |||
| 1042 | Ga0207692_11168621 | |||
| 1043 | Ga0207642_10467265 | |||
| 1044 | Ga0207710_10038277 | |||
| 1045 | Ga0207688_10013672 | |||
| 1046 | Ga0207688_10048070 | |||
| 1047 | Ga0207688_10073720 | |||
| 1048 | Ga0207688_10104140 | |||
| 1049 | Ga0207688_10989157 | |||
| 1050 | Ga0207680_10100758 | |||
| 1051 | Ga0207685_10594401 | |||
| 1052 | Ga0207699_11123622 | |||
| 1053 | Ga0207699_11289066 | |||
| 1054 | Ga0207645_10306527 | |||
| 1055 | Ga0207643_10420899 | |||
| 1056 | Ga0207705_11247687 | |||
| 1057 | Ga0207705_11315002 | |||
| 1058 | Ga0207654_10077750 | |||
| 1059 | Ga0207654_10416436 | |||
| 1060 | Ga0207707_10283948 | |||
| 1061 | Ga0207707_10464570 | |||
| 1062 | Ga0207707_10681848 | |||
| 1063 | Ga0207707_11349552 | |||
| 1064 | Ga0207695_10834626 | |||
| 1065 | Ga0207671_10903311 | |||
| 1066 | Ga0207671_11080949 | |||
| 1067 | Ga0207693_10011778 | |||
| 1068 | Ga0207693_10044509 | |||
| 1069 | Ga0207693_10122284 | |||
| 1070 | Ga0207693_10180155 | |||
| 1071 | Ga0207693_11353893 | |||
| 1072 | Ga0207663_10052119 | |||
| 1073 | Ga0207663_10283902 | |||
| 1074 | Ga0207663_10366887 | |||
| 1075 | Ga0207663_10440732 | |||
| 1076 | Ga0207657_10078110 | |||
| 1077 | Ga0207652_10049357 | |||
| 1078 | Ga0207652_10993903 | |||
| 1079 | Ga0207681_10095571 | |||
| 1080 | Ga0207681_11064503 | |||
| 1081 | Ga0207694_11219918 | |||
| 1082 | Ga0207659_10103589 | |||
| 1083 | Ga0207659_10213745 | |||
| 1084 | Ga0207687_10007786 | |||
| 1085 | Ga0207687_10021995 | |||
| 1086 | Ga0207687_10081684 | |||
| 1087 | Ga0207687_10095941 | |||
| 1088 | Ga0207687_10118312 | |||
| 1089 | Ga0207664_10141256 | |||
| 1090 | Ga0207664_10163194 | |||
| 1091 | Ga0207664_10314289 | |||
| 1092 | Ga0207644_10314449 | |||
| 1093 | Ga0207644_10350096 | |||
| 1094 | Ga0207690_10089300 | |||
| 1095 | Ga0207690_10129902 | |||
| 1096 | Ga0207690_11042814 | |||
| 1097 | Ga0207706_10009700 | |||
| 1098 | Ga0207706_10266200 | |||
| 1099 | Ga0207686_10016674 | |||
| 1100 | Ga0207686_11104761 | |||
| 1101 | Ga0207686_11635451 | |||
| 1102 | Ga0207709_10028119 | |||
| 1103 | Ga0207709_10312331 | |||
| 1104 | Ga0207709_10401220 | |||
| 1105 | Ga0207709_10646343 | |||
| 1106 | Ga0207709_11251944 | |||
| 1107 | Ga0207709_11364373 | |||
| 1108 | Ga0207670_10578838 | |||
| 1109 | Ga0207670_11620002 | |||
| 1110 | Ga0207669_10094942 | |||
| 1111 | Ga0207669_10447509 | |||
| 1112 | Ga0207669_10493681 | |||
| 1113 | Ga0207669_11007778 | |||
| 1114 | Ga0207704_10083960 | |||
| 1115 | Ga0207704_10672675 | |||
| 1116 | Ga0207704_11314883 | |||
| 1117 | Ga0207665_11545093 | |||
| 1118 | Ga0207691_10202826 | |||
| 1119 | Ga0207689_10148935 | |||
| 1120 | Ga0207689_10361140 | |||
| 1121 | Ga0207661_10031697 | |||
| 1122 | Ga0207661_10035686 | |||
| 1123 | Ga0207661_11579494 | |||
| 1124 | Ga0207679_10288410 | |||
| 1125 | Ga0207679_11246697 | |||
| 1126 | Ga0207667_10026920 | |||
| 1127 | Ga0207712_10333079 | |||
| 1128 | Ga0207712_10377281 | |||
| 1129 | Ga0207668_10052405 | |||
| 1130 | Ga0207668_10508383 | |||
| 1131 | Ga0207668_11311972 | |||
| 1132 | Ga0207640_10225657 | |||
| 1133 | Ga0207640_10248085 | |||
| 1134 | Ga0207640_10797168 | |||
| 1135 | Ga0207640_10944908 | |||
| 1136 | Ga0207640_10979692 | |||
| 1137 | Ga0207640_11154525 | |||
| 1138 | Ga0207658_10538385 | |||
| 1139 | Ga0207658_11168554 | |||
| 1140 | Ga0207677_10183081 | |||
| 1141 | Ga0207703_10571599 | |||
| 1142 | Ga0207678_10094927 | |||
| 1143 | Ga0207678_10112290 | |||
| 1144 | Ga0207678_10213794 | |||
| 1145 | Ga0207708_10000610 | |||
| 1146 | Ga0207708_10086493 | |||
| 1147 | Ga0207708_10403899 | |||
| 1148 | Ga0207708_10862677 | |||
| 1149 | Ga0207702_10040691 | |||
| 1150 | Ga0207702_11121145 | |||
| 1151 | Ga0207641_10341980 | |||
| 1152 | Ga0207641_10877107 | |||
| 1153 | Ga0207648_10022027 | |||
| 1154 | Ga0207648_10044516 | |||
| 1155 | Ga0207648_11760412 | |||
| 1156 | Ga0207676_10953831 | |||
| 1157 | Ga0207676_11442329 | |||
| 1158 | Ga0207674_10726439 | |||
| 1159 | Ga0207675_100017563 | |||
| 1160 | Ga0207675_100236685 | |||
| 1161 | Ga0207683_10000098 | |||
| 1162 | Ga0207683_10540852 | |||
| 1163 | Ga0207683_10583410 | |||
| 1164 | Ga0207683_10956544 | |||
| 1165 | Ga0207698_10009641 | |||
| 1166 | Ga0207698_10157041 | |||
| 1167 | Ga0207698_10164235 | |||
| 1168 | Ga0207698_11225695 | |||
| 1169 | Ga0207428_10041841 | |||
| 1170 | Ga0207428_10138277 | |||
| 1171 | Ga0207428_10803476 | |||
| 1172 | Ga0207428_10999354 | |||
| 1173 | Ga0268266_10041473 | |||
| 1174 | Ga0268265_10542184 | |||
| 1175 | Ga0268265_11613000 | |||
| 1176 | Ga0268264_10093314 | |||
| 1177 | Ga0268264_10262669 | |||
| 1178 | Ga0265319_1025981 | |||
| 1179 | Ga0265318_10026778 | |||
| 1180 | Ga0265318_10239141 | |||
| 1181 | Ga0265338_10051655 | |||
| 1182 | Ga0265320_10369575 | |||
| 1183 | Ga0265327_10004579 | |||
| 1184 | Ga0307408_101685073 | |||
| 1185 | Ga0265314_10130962 | |||
| 1186 | Ga0265314_10299512 | |||
| 1187 | Ga0307405_10367479 | |||
| 1188 | Ga0307413_10286347 | |||
| 1189 | Ga0307413_10302156 | |||
| 1190 | Ga0307410_10261617 | |||
| 1191 | Ga0307410_10460621 | |||
| 1192 | Ga0307410_11792190 | |||
| 1193 | Ga0307406_10105101 | |||
| 1194 | Ga0307406_10664910 | |||
| 1195 | Ga0307406_10935081 | |||
| 1196 | Ga0307407_10084949 | |||
| 1197 | Ga0307412_10151690 | |||
| 1198 | Ga0307412_10652625 | |||
| 1199 | Ga0307412_12086522 | |||
| 1200 | Ga0307409_100054075 | |||
| 1201 | Ga0307409_102173929 | |||
| 1202 | Ga0307416_100665094 | |||
| 1203 | Ga0307416_102828370 | |||
| 1204 | Ga0307416_103154026 | |||
| 1205 | Ga0307414_10193932 | |||
| 1206 | Ga0307411_11710960 | |||
| 1207 | Ga0307415_100548007 | |||
| 1208 | Ga0307415_101314320 | |||
| 1209 | Ga0307415_101349521 | |||
| 1210 | Ga0373944_0186769 | |||
| 1211 | Ga0373923_0004844 | |||
| 1212 | Ga0373936_0033654 | |||
| 1213 | Ga0373945_0264992 | |||
| 1214 | Ga0373945_0302440 | |||
| 1215 | Ga0373953_0437267 | |||
| 1216 | Ga0373954_0083557 | |||
| 1217 | Ga0373956_0217075 | |||
| 1218 | Ga0373957_0213503 | |||
| 1219 | Ga0373943_0049653 | |||
| 1220 | Ga0373943_0227841 | |||
| 1221 | Ga0373946_0640759 | |||
| 1222 | Ga0373955_0077652 | |||
| 1223 | Ga0373924_0049465 | |||
| 1224 | Ga0373935_0160600 | |||
| 1225 | Ga0373927_0134354 | |||
| 1226 | Ga0373927_0139102 | |||
| 1227 | Ga0373927_0328376 | |||
| 1228 | Ga0373933_0043773 | |||
| 1229 | Ga0373947_0048843 | |||
| 1230 | Ga0373947_0310619 | |||
| 1231 | Ga0373937_0346631 | |||
| 1232 | Ga0373925_0108455 | |||
| 1233 | Ga0373925_0204130 | |||
| 1234 | Ga0395898_0342978 | |||
| 1235 | Ga0436364_0334055 | |||
| 1236 | Ga0436364_0635347 | |||
| 1237 | Ga0436364_0649140 | |||
| 1238 | Ga0436364_0731868 | |||
| 1239 | Ga0436364_1031907 | |||
| 1240 | Ga0436364_1102629 | |||
| 1241 | Ga0436364_1427363 | |||
| 1242 | Ga0436364_1441737 | |||
| 1243 | Ga0436365_0237483 | |||
| 1244 | Ga0436365_0401331 | |||
| 1245 | Ga0436365_0904996 | |||
| 1246 | Ga0436365_1066112 | |||
| 1247 | Ga0436365_1258992 | |||
| 1248 | Ga0436365_1650091 | |||
| 1249 | Ga0436360_0936914 | |||
| 1250 | Ga0436361_0474887 | |||
| 1251 | Ga0436363_0142574 | |||
| 1252 | Ga0436363_0445240 | |||
| 1253 | Ga0436363_0709244 | |||
| 1254 | Ga0436363_0793499 | |||
| 1255 | Ga0436363_1050794 | |||
| 1256 | Ga0436363_1089750 | |||
| 1257 | Ga0436363_1106810 | |||
| 1258 | Ga0436363_1357287 | |||
| 1259 | Ga0436363_1644680 | |||
| 1260 | Ga0436363_1705603 | |||
| 1261 | Ga0436362_0310761 | |||
| 1262 | Ga0436362_0626285 | |||
| 1263 | Ga0436362_0906932 | |||
| 1264 | Ga0451789_0720585 | |||
| 1265 | Ga0451853_0030295 | |||
| 1266 | Ga0451853_0468880 | |||
| 1267 | Ga0439448_0226952 | |||
| 1268 | Ga0450915_005259 | |||
| 1269 | Ga0450888_003572 | |||
| 1270 | Ga0466966_0220968 | |||
| 1271 | Ga0466964_0423154 | |||
| 1272 | Ga0466968_0034907 | |||
| 1273 | Ga0466959_0199329 | |||
| 1274 | Ga0466959_0298225 | |||
| 1275 | Ga0466958_0108445 | |||
| 1276 | Ga0466958_0311555 | |||
| 1277 | Ga0466967_0027714 | |||
| 1278 | Ga0466967_0050202 | |||
| 1279 | Ga0466967_0414128 | |||
| 1280 | Ga0466967_0423638 | |||
| 1281 | Ga0466967_0467108 | |||
| 1282 | Ga0466967_0722272 | |||
| 1283 | Ga0466967_1351463 | |||
| 1284 | Ga0466967_2058120 | |||
| 1285 | Ga0495592_0294649 | |||
| 1286 | Ga0495592_0864191 | |||
| 1287 | Ga0495603_0065347 | |||
| 1288 | Ga0495603_0159578 | |||
| 1289 | Ga0495603_0476065 | |||
| 1290 | Ga0495629_0052587 | |||
| 1291 | Ga0495641_0048719 | |||
| 1292 | Ga0495641_0063736 | |||
| 1293 | Ga0495641_0212455 | |||
| 1294 | Ga0495651_0097342 | |||
| 1295 | Ga0495653_0010293 | |||
| 1296 | Ga0495653_0331423 | |||
| 1297 | Ga0495653_0495249 | |||
| 1298 | Ga0495580_0131021 | |||
| 1299 | Ga0495582_0017805 | |||
| 1300 | Ga0495582_0433986 | |||
| 1301 | Ga0495582_0528047 | |||
| 1302 | Ga0495639_0002417 | |||
| 1303 | Ga0495639_0112290 | |||
| 1304 | Ga0495662_0002132 | |||
| 1305 | Ga0495662_0395879 | |||
| 1306 | Ga0495664_0376426 | |||
| 1307 | Ga0495585_0220687 | |||
| 1308 | Ga0495594_0008788 | |||
| 1309 | Ga0495608_0049917 | |||
| 1310 | Ga0495608_0675439 | |||
| 1311 | Ga0495618_0022487 | |||
| 1312 | Ga0495618_0429057 | |||
| 1313 | Ga0495620_0321827 | |||
| 1314 | Ga0495628_0577172 | |||
| 1315 | Ga0495630_0054473 | |||
| 1316 | Ga0495666_0010114 | |||
| 1317 | Ga0495652_0097601 | |||
| 1318 | Ga0495652_0136672 | |||
| 1319 | Ga0495665_0001629 | |||
| 1320 | Ga0495640_0519470 | |||
| 1321 | Ga0495640_0607476 | |||
| 1322 | Ga0495587_0563144 | |||
| 1323 | Ga0495667_0009327 | |||
| 1324 | Ga0495656_0327837 | |||
| 1325 | Ga0495656_0492103 | |||
| 1326 | Ga0495668_0437180 | |||
| 1327 | Ga0495634_0012006 | |||
| 1328 | Ga0495635_0022073 | |||
| 1329 | Ga0495588_0075512 | |||
| 1330 | Ga0495657_0013747 | |||
| 1331 | Ga0495599_0375291 | |||
| 1332 | Ga0495599_0879588 | |||
| 1333 | Ga0495623_0098773 | |||
| 1334 | Ga0495646_0564020 | |||
| 1335 | Ga0495646_0577311 | |||
| 1336 | Ga0495647_0000590 | |||
| 1337 | Ga0495658_0279153 | |||
| 1338 | Ga0495613_0015895 | |||
| 1339 | Ga0495624_0023602 | |||
| 1340 | Ga0495624_0895062 | |||
| 1341 | Ga0495624_0953726 | |||
| 1342 | Ga0495670_0533288 | |||
| 1343 | Ga0495589_0459147 | |||
| 1344 | Ga0495600_0043352 | |||
| 1345 | Ga0495600_0045946 | |||
| 1346 | Ga0495581_0005143 | |||
| 1347 | Ga0495581_0663290 | |||
| 1348 | Ga0495604_0052658 | |||
| 1349 | Ga0495674_0003550 | |||
| 1350 | Ga0495674_1451571 | |||
| 1351 | Ga0495676_0030243 | |||
| 1352 | Ga0495676_0158256 | |||
| 1353 | Ga0495680_0017614 | |||
| 1354 | Ga0495675_0016700 | |||
| 1355 | Ga0495684_0006150 | |||
| 1356 | Ga0495593_0025452 | |||
| 1357 | Ga0495593_0261004 | |||
| 1358 | Ga0495602_1028565 | |||
| 1359 | Ga0495614_0021631 | |||
| 1360 | Ga0495615_0162911 | |||
| 1361 | Ga0496100_0002592 | |||
| 1362 | Ga0496100_0124538 | |||
| 1363 | Ga0496100_0204058 | |||
| 1364 | Ga0496100_0346083 | |||
| 1365 | Ga0496100_0583548 | |||
| 1366 | Ga0496100_1352830 | |||
| 1367 | Ga0496101_0006496 | |||
| 1368 | Ga0496101_0018561 | |||
| 1369 | Ga0496101_0060214 | |||
| 1370 | Ga0496101_0187915 | |||
| 1371 | Ga0496102_0002361 | |||
| 1372 | Ga0496102_0004122 | |||
| 1373 | Ga0496102_0053118 | |||
| 1374 | Ga0496102_0179746 | |||
| 1375 | Ga0496102_0186797 | |||
| 1376 | Ga0496102_0202924 | |||
| 1377 | Ga0496102_0700877 | |||
| 1378 | Ga0496102_1163889 | |||
| 1379 | Ga0496102_1803528 | |||
| 1380 | Ga0496103_0000900 | |||
| 1381 | Ga0496103_0261985 | |||
| 1382 | Ga0496103_0519329 | |||
| 1383 | Ga0496103_0700006 | |||
| 1384 | Ga0496103_0793104 | |||
| 1385 | Ga0496104_0002813 | |||
| 1386 | Ga0496104_0016977 | |||
| 1387 | Ga0496104_0035622 | |||
| 1388 | Ga0496104_0039310 | |||
| 1389 | Ga0496104_0516501 | |||
| 1390 | Ga0496104_1693459 | |||
| 1391 | Ga0496105_0009674 | |||
| 1392 | Ga0496105_0033357 | |||
| 1393 | Ga0496105_0675332 | |||
| 1394 | Ga0496106_0004546 | |||
| 1395 | Ga0496106_0046292 | |||
| 1396 | Ga0496106_0052832 | |||
| 1397 | Ga0496107_0004168 | |||
| 1398 | Ga0496107_0028545 | |||
| 1399 | Ga0496107_0036418 | |||
| 1400 | Ga0496108_0025064 | |||
| 1401 | Ga0496108_0095159 | |||
| 1402 | Ga0496108_0332200 | |||
| 1403 | Ga0496109_0000999 | |||
| 1404 | Ga0496109_0050806 | |||
| 1405 | Ga0496109_0063573 | |||
| 1406 | Ga0496109_0338547 | |||
| 1407 | Ga0496109_1084782 | |||
| 1408 | Ga0496110_0001024 | |||
| 1409 | Ga0496110_0027449 | |||
| 1410 | Ga0496110_0621833 | |||
| 1411 | Ga0496110_1369135 | |||
| 1412 | Ga0496111_0005422 | |||
| 1413 | Ga0496111_0027704 | |||
| 1414 | Ga0496111_0532315 | |||
| 1415 | Ga0496112_0021398 | |||
| 1416 | Ga0496112_0101937 | |||
| 1417 | Ga0496112_0482719 | |||
| 1418 | Ga0496112_1736120 | |||
| 1419 | Ga0496113_0010790 | |||
| 1420 | Ga0496113_0925846 | |||
| 1421 | Ga0496113_1187655 | |||
| 1422 | Ga0496114_0020808 | |||
| 1423 | Ga0496114_0045492 | |||
| 1424 | Ga0496114_0046951 | |||
| 1425 | Ga0496114_0380887 | |||
| 1426 | Ga0496114_1145004 | |||
| 1427 | Ga0496115_0009605 | |||
| 1428 | Ga0496115_0011122 | |||
| 1429 | Ga0496115_0028400 | |||
| 1430 | Ga0496115_0056933 | |||
| 1431 | Ga0496115_0978589 | |||
| 1432 | Ga0501031_0098080 | |||
| 1433 | Ga0501033_0178223 | |||
| 1434 | Ga0501034_0374862 | |||
| 1435 | Ga0501036_0088604 | |||
| 1436 | Ga0501036_0270575 | |||
| 1437 | Ga0501037_0221816 | |||
| 1438 | Ga0501039_0257285 | |||
| 1439 | Ga0501040_0091518 | |||
| 1440 | Ga0501040_0494696 | |||
| 1441 | Ga0501041_0014031 | |||
| 1442 | Ga0501041_0258216 | |||
| 1443 | Ga0501042_0095351 | |||
| 1444 | Ga0501042_0110522 | |||
| 1445 | Ga0501042_1073303 | |||
| 1446 | Ga0501046_0140512 | |||
| 1447 | Ga0501046_0235187 | |||
| 1448 | Ga0501046_0527766 | |||
| 1449 | Ga0501048_0078076 | |||
| 1450 | Ga0501048_0110944 | |||
| 1451 | Ga0501048_0227513 | |||
| 1452 | Ga0501048_0312538 | |||
| 1453 | Ga0501068_0482102 | |||
| 1454 | Ga0501068_1059695 | |||
| 1455 | Ga0501069_0604575 | |||
| 1456 | Ga0501070_0238078 | |||
| 1457 | Ga0501071_0051006 | |||
| 1458 | Ga0501071_0073172 | |||
| 1459 | Ga0501071_0826770 | |||
| 1460 | Ga0501071_1093476 | |||
| 1461 | Ga0501072_0180744 | |||
| 1462 | Ga0501072_0376088 | |||
| 1463 | Ga0501072_0408109 | |||
| 1464 | Ga0501074_0043550 | |||
| 1465 | Ga0501074_0230281 | |||
| 1466 | Ga0501074_0587014 | |||
| 1467 | Ga0501075_0043708 | |||
| 1468 | Ga0501076_0019050 | |||
| 1469 | Ga0501076_0121921 | |||
| 1470 | Ga0501076_0621237 | |||
| 1471 | Ga0501077_0111146 | |||
| 1472 | Ga0501077_0423794 | |||
| 1473 | Ga0501079_0198164 | |||
| 1474 | Ga0501079_0711593 | |||
| 1475 | Ga0501080_0226217 | |||
| 1476 | Ga0501080_0346554 | |||
| 1477 | Ga0501081_0064875 | |||
| 1478 | Ga0501081_0290905 | |||
| 1479 | Ga0501081_0291723 | |||
| 1480 | Ga0501081_1080571 | |||
| 1481 | Ga0501083_0137141 | |||
| 1482 | Ga0501045_0114345 | |||
| 1483 | Ga0501045_0279007 | |||
| 1484 | nmdc:mga03683_8898_c1 | |||
| 1485 | nmdc:mga03n38_194074_c1 | |||
| 1486 | nmdc:mga03n38_789519_c1 | |||
| 1487 | nmdc:mga00v17_14620_c1 | |||
| 1488 | nmdc:mga05p37_1203412_c1 | |||
| 1489 | nmdc:mga05p37_1393678_c1 | |||
| 1490 | nmdc:mga05p37_2045321_c1 | |||
| 1491 | nmdc:mga05p37_873857_c1 | |||
| 1492 | nmdc:mga09592_126603_c1 | |||
| 1493 | nmdc:mga09592_874732_c1 | |||
| 1494 | nmdc:mga06r32_10365_c1 | |||
| 1495 | nmdc:mga06r32_131044_c1 | |||
| 1496 | nmdc:mga06r32_190835_c1 | |||
| 1497 | nmdc:mga08y16_1073349_c1 | |||
| 1498 | nmdc:mga08y16_147968_c1 | |||
| 1499 | nmdc:mga08y16_21380_c1 | |||
| 1500 | nmdc:mga08y16_60559_c1 | |||
| 1501 | nmdc:mga08y16_723813_c1 | |||
| 1502 | nmdc:mga0n895_2012500_c1 | |||
| 1503 | nmdc:mga0n895_468166_c1 | |||
| 1504 | nmdc:mga0n895_74928_c1 | |||
| 1505 | nmdc:mga0rr50_1498909_c1 | |||
| 1506 | nmdc:mga0rr50_1712788_c1 | |||
| 1507 | nmdc:mga08x19_161378_c1 | |||
| 1508 | nmdc:mga08x19_899529_c1 | |||
| 1509 | Ga0495601_0147897 | |||
| 1510 | Ga0495612_0200639 | |||
| 1511 | Ga0495595_0005295 | |||
| 1512 | Ga0495595_0276020 | |||
| 1513 | Ga0495619_0003931 | |||
| 1514 | Ga0500616_0096673 | |||
| 1515 | Ga0501084_0017709 | |||
| 1516 | Ga0501084_0207082 | |||
| 1517 | Ga0501084_0212016 | |||
| 1518 | Ga0501082_0050508 | |||
| 1519 | Ga0501082_0124883 | |||
| 1520 | Ga0501082_0461896 | |||
| 1521 | Ga0466962_0631453 | |||
| 1522 | Ga0530510_0011028 | |||
| 1523 | Ga0530510_0115082 | |||
| 1524 | Ga0530510_0393201 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5j8f-assembly1.cif.gz_A | human mof k274p crystal structure | 0.3687 | 33 | 56 |
| 1ggj-assembly1.cif.gz_C | crystal structure of catalase hpii from escherichia coli, asn201ala variant. | 0.2832 | 32 | 67 |
| 6ks5-assembly1.cif.gz_A | crystal structure of legionella pneumophila deubiquitinase ceg23 | 0.187 | 20 | 56 |
| 5j8f-assembly1.cif.gz_A | human mof k274p crystal structure | 0.1684 | 33 | 56 |
| 1ggj-assembly1.cif.gz_C | crystal structure of catalase hpii from escherichia coli, asn201ala variant. | 0.1625 | 32 | 67 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5SVQ0_329_390_3.30.60.60 | Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;N-acetyl transferase-like | 0.671 | 37 | 48 | 3.30.60.60 |
| af_Q5ACY2_33_127_3.30.60.60 | Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;N-acetyl transferase-like | 0.6276 | 35 | 48 | 3.30.60.60 |
| af_Q8III2_323_384_3.30.60.60 | Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;N-acetyl transferase-like | 0.4917 | 33 | 48 | 3.30.60.60 |
| 4dncB01 | Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;N-acetyl transferase-like | 0.3168 | 20 | 56 | 3.30.60.60 |
| af_U4PRX5_195_303_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.2672 | 17 | 78 | 2.60.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838PHD1-F1-model_v4 | Zinc finger/thioredoxin putative domain-containing protein | 0.9575 | 1 | 80 |
|
| AF-A0A7Y5X0S9-F1-model_v4 | Uncharacterized protein | 0.9574 | 1 | 75 |
|
| AF-A0A1M3BK64-F1-model_v4 | Uncharacterized protein | 0.9047 | 6 | 79 |
|
| AF-A0A838PHD1-F1-model_v4 | Zinc finger/thioredoxin putative domain-containing protein | 0.9021 | 1 | 80 |
|
| AF-A0A062U2Q4-F1-model_v4 | C2H2-type domain-containing protein | 0.8725 | 1 | 75 |
|