F479637

General Info

Members Datasets Scaffolds Average Seq Length
762 331 1524 86

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_101317210|Ga0307416_1013172102
Length 97
Sequence MARITMREIRPGEVPPDGGTALQEDPDRPVFRGHGPNDYVCVQCGNVLAASMDPDYMTKKVRVKCGRCRTVNVAITDESPAGDPRLKRRPGFGGPGP

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
169 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
214 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
271 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
300 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
305 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
306 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
307 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
308 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
309 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
310 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
311 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
312 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
313 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
314 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
315 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
324 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
325 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
326 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
327 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
331 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 9.45
Rhizosphere 83.99
Stem 0
Stem Tuber 0
Unclassified 24.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_101317210 3300032002 Bacteria 828
2 Ga0070676_10180947 3300005328 Unclassified 1370
3 Ga0070683_100915640 3300005329 Unclassified 841
4 Ga0070690_100402211 3300005330 Bacteria 1006
5 Ga0068869_100039228 3300005334 Bacteria 3380
6 Ga0068869_100096015 3300005334 Unclassified 2237
7 Ga0070666_10396223 3300005335 Bacteria 992
8 Ga0070666_11084880 3300005335 Unclassified 595
9 Ga0070666_11460413 3300005335 Unclassified 511
10 Ga0070680_100354813 3300005336 Bacteria 1247
11 Ga0070680_100654196 3300005336 Unclassified 903
12 Ga0070682_100067762 3300005337 Bacteria 2274
13 Ga0070682_100670740 3300005337 Bacteria 828
14 Ga0070682_100792793 3300005337 Bacteria 769
15 Ga0068868_100001984 3300005338 Bacteria 14061
16 Ga0068868_100356156 3300005338 Unclassified 1254
17 Ga0068868_100385962 3300005338 Bacteria 1206
18 Ga0070660_100065011 3300005339 Bacteria 2839
19 Ga0070689_100806312 3300005340 Bacteria 826
20 Ga0070691_10005696 3300005341 Bacteria 5682
21 Ga0070691_10021585 3300005341 Bacteria 2980
22 Ga0070668_100032709 3300005347 Bacteria 3957
23 Ga0070668_100057906 3300005347 Bacteria 2996
24 Ga0070669_100892804 3300005353 Unclassified 759
25 Ga0070669_100912922 3300005353 Bacteria 750
26 Ga0070675_100040215 3300005354 Bacteria 3816
27 Ga0070675_100256270 3300005354 Bacteria 1532
28 Ga0070675_100394384 3300005354 Bacteria 1234
29 Ga0070671_100208832 3300005355 Bacteria 1656
30 Ga0070671_100595502 3300005355 Bacteria 955
31 Ga0070671_100648947 3300005355 Bacteria 914
32 Ga0070671_102118797 3300005355 Bacteria 501
33 Ga0070674_100043457 3300005356 Bacteria 3057
34 Ga0070674_100078634 3300005356 Bacteria 2351
35 Ga0070674_100279812 3300005356 Bacteria 1322
36 Ga0070674_100984320 3300005356 Bacteria 739
37 Ga0070674_101316018 3300005356 Bacteria 645
38 Ga0070674_101316258 3300005356 Bacteria 645
39 Ga0070688_100063706 3300005365 Bacteria 2338
40 Ga0070688_100642680 3300005365 Archaea 816
41 Ga0070659_101092600 3300005366 Unclassified 703
42 Ga0070659_101349853 3300005366 Unclassified 633
43 Ga0070667_100114562 3300005367 Bacteria 2341
44 Ga0070667_100487793 3300005367 Unclassified 1129
45 Ga0070667_100969395 3300005367 Bacteria 793
46 Ga0070667_102206448 3300005367 Archaea 519
47 Ga0070714_100072611 3300005435 Bacteria 2979
48 Ga0070714_100304034 3300005435 Unclassified 1488
49 Ga0070714_100634395 3300005435 Unclassified 1028
50 Ga0070713_100519802 3300005436 Bacteria 1125
51 Ga0070710_10040149 3300005437 Bacteria 2579
52 Ga0070710_10231788 3300005437 Unclassified 1179
53 Ga0070710_10315394 3300005437 Bacteria 1025
54 Ga0070710_11175814 3300005437 Unclassified 566
55 Ga0070701_10176785 3300005438 Bacteria 1247
56 Ga0070701_10874033 3300005438 Unclassified 619
57 Ga0070701_11269540 3300005438 Unclassified 525
58 Ga0070711_100025636 3300005439 Bacteria 3859
59 Ga0070711_100181844 3300005439 Bacteria 1610
60 Ga0070711_100220104 3300005439 Unclassified 1475
61 Ga0070711_100304891 3300005439 Bacteria 1267
62 Ga0070711_100957947 3300005439 Bacteria 733
63 Ga0070705_100017337 3300005440 Bacteria 3759
64 Ga0070705_100723618 3300005440 Unclassified 784
65 Ga0070705_101490598 3300005440 Bacteria 566
66 Ga0070700_100001106 3300005441 Bacteria 13344
67 Ga0070700_100132215 3300005441 Unclassified 1685
68 Ga0070700_100277363 3300005441 Bacteria 1214
69 Ga0070694_100657380 3300005444 Unclassified 849
70 Ga0070694_100815468 3300005444 Archaea 766
71 Ga0070694_101864920 3300005444 Bacteria 513
72 Ga0070663_100027740 3300005455 Bacteria 3849
73 Ga0070663_100567010 3300005455 Bacteria 951
74 Ga0070678_101001618 3300005456 Unclassified 768
75 Ga0070662_100054441 3300005457 Bacteria 2899
76 Ga0070681_10147509 3300005458 Bacteria 2281
77 Ga0070681_10386216 3300005458 Bacteria 1311
78 Ga0070681_10859848 3300005458 Bacteria 825
79 Ga0068867_100128251 3300005459 Bacteria 1968
80 Ga0068867_100959832 3300005459 Unclassified 773
81 Ga0068867_101282483 3300005459 Unclassified 676
82 Ga0070685_11540947 3300005466 Unclassified 513
83 Ga0070699_101438911 3300005518 Bacteria 632
84 Ga0070679_100265327 3300005530 Bacteria 1672
85 Ga0070679_100286282 3300005530 Unclassified 1600
86 Ga0070679_101760047 3300005530 Bacteria 568
87 Ga0070684_100006386 3300005535 Bacteria 9116
88 Ga0070684_100054473 3300005535 Bacteria 3485
89 Ga0070684_100595658 3300005535 Bacteria 1028
90 Ga0070684_100934842 3300005535 Unclassified 813
91 Ga0070684_102337487 3300005535 Bacteria 504
92 Ga0068853_100378902 3300005539 Archaea 1321
93 Ga0070672_100120278 3300005543 Bacteria 2149
94 Ga0070672_100148224 3300005543 Unclassified 1940
95 Ga0070672_100784067 3300005543 Bacteria 838
96 Ga0070686_100050418 3300005544 Bacteria 2645
97 Ga0070686_100177040 3300005544 Bacteria 1513
98 Ga0070686_100385240 3300005544 Unclassified 1062
99 Ga0070695_100595309 3300005545 Unclassified 867
100 Ga0070696_100047166 3300005546 Bacteria 2989
101 Ga0070696_101954914 3300005546 Bacteria 509
102 Ga0070693_100119616 3300005547 Unclassified 1632
103 Ga0070693_100246567 3300005547 Bacteria 1182
104 Ga0070693_100287603 3300005547 Bacteria 1103
105 Ga0070665_100153705 3300005548 Bacteria 2303
106 Ga0068855_100284083 3300005563 Unclassified 1837
107 Ga0068855_101012266 3300005563 Unclassified 872
108 Ga0070664_100028477 3300005564 Bacteria 4647
109 Ga0070664_101607493 3300005564 Bacteria 616
110 Ga0068854_100037103 3300005578 Bacteria 3419
111 Ga0068854_101215480 3300005578 Bacteria 676
112 Ga0068854_101252123 3300005578 Bacteria 666
113 Ga0068856_100064219 3300005614 Bacteria 3627
114 Ga0068856_102032541 3300005614 Bacteria 585
115 Ga0070702_100027315 3300005615 Bacteria 3077
116 Ga0070702_100040550 3300005615 Bacteria 2605
117 Ga0070702_100335458 3300005615 Bacteria 1059
118 Ga0068852_100104417 3300005616 Bacteria 2565
119 Ga0068852_101851370 3300005616 Bacteria 626
120 Ga0068864_100023860 3300005618 Bacteria 5140
121 Ga0068864_101547495 3300005618 Bacteria 667
122 Ga0068866_10038107 3300005718 Bacteria 2365
123 Ga0068866_10134254 3300005718 Unclassified 1412
124 Ga0068866_10941246 3300005718 Bacteria 610
125 Ga0068861_100153614 3300005719 Bacteria 1891
126 Ga0068861_100307988 3300005719 Unclassified 1374
127 Ga0068861_100452299 3300005719 Bacteria 1151
128 Ga0068861_102092368 3300005719 Bacteria 566
129 Ga0068861_102634891 3300005719 Unclassified 507
130 Ga0068851_10655033 3300005834 Unclassified 643
131 Ga0068870_10285777 3300005840 Bacteria 1036
132 Ga0068870_10881091 3300005840 Unclassified 631
133 Ga0068863_100361025 3300005841 Unclassified 1416
134 Ga0068863_100785081 3300005841 Unclassified 949
135 Ga0068863_101030986 3300005841 Unclassified 826
136 Ga0068858_100175146 3300005842 Bacteria 2024
137 Ga0068858_101696643 3300005842 Unclassified 624
138 Ga0068860_100015334 3300005843 Bacteria 7485
139 Ga0068860_102381641 3300005843 Unclassified 550
140 Ga0068862_100928927 3300005844 Bacteria 857
141 Ga0068862_101423028 3300005844 Bacteria 697
142 Ga0081538_10048324 3300005981 Bacteria 2596
143 Ga0081540_1036100 3300005983 Bacteria 2640
144 Ga0081540_1070877 3300005983 Bacteria 1612
145 Ga0081539_10001190 3300005985 Bacteria 46973
146 Ga0070717_10015315 3300006028 Bacteria 5920
147 Ga0070717_10650129 3300006028 Bacteria 957
148 Ga0075365_10259404 3300006038 Bacteria 1222
149 Ga0075365_10667466 3300006038 Bacteria 735
150 Ga0075363_100261627 3300006048 Bacteria 998
151 Ga0075364_10270593 3300006051 Bacteria 1155
152 Ga0070712_100007279 3300006175 Bacteria 6906
153 Ga0070712_100221354 3300006175 Bacteria 1498
154 Ga0070712_100596238 3300006175 Unclassified 935
155 Ga0075362_10008980 3300006177 Bacteria 3844
156 Ga0075427_10007523 3300006194 Bacteria 1602
157 Ga0097621_100009042 3300006237 Bacteria 7216
158 Ga0097621_101308246 3300006237 Bacteria 685
159 Ga0068871_100540665 3300006358 Bacteria 1054
160 Ga0068871_100738813 3300006358 Bacteria 904
161 Ga0075428_100547616 3300006844 Bacteria 1237
162 Ga0075428_101742009 3300006844 Bacteria 649
163 Ga0075428_101770461 3300006844 Archaea 644
164 Ga0075428_101862535 3300006844 Unclassified 625
165 Ga0075430_100228928 3300006846 Bacteria 1541
166 Ga0075430_101545998 3300006846 Bacteria 545
167 Ga0075431_100970738 3300006847 Unclassified 817
168 Ga0075431_101177657 3300006847 Bacteria 729
169 Ga0075433_10086335 3300006852 Bacteria 2770
170 Ga0075433_11332423 3300006852 Bacteria 622
171 Ga0075434_100060563 3300006871 Bacteria 3765
172 Ga0075434_100145958 3300006871 Bacteria 2386
173 Ga0075434_101894207 3300006871 Unclassified 602
174 Ga0075434_102412375 3300006871 Unclassified 528
175 Ga0075429_100111761 3300006880 Bacteria 2388
176 Ga0075429_100233732 3300006880 Bacteria 1610
177 Ga0068865_100266502 3300006881 Unclassified 1358
178 Ga0068865_100761048 3300006881 Bacteria 833
179 Ga0068865_101750788 3300006881 Bacteria 561
180 Ga0075436_100158587 3300006914 Bacteria 1594
181 Ga0075436_100176028 3300006914 Unclassified 1511
182 Ga0075436_100429604 3300006914 Bacteria 960
183 Ga0075435_100134076 3300007076 Bacteria 2074
184 Ga0105251_10517116 3300009011 Bacteria 559
185 Ga0105240_10307341 3300009093 Bacteria 1812
186 Ga0111539_10029819 3300009094 Bacteria 6639
187 Ga0111539_10159693 3300009094 Bacteria 2637
188 Ga0111539_10401659 3300009094 Bacteria 1596
189 Ga0111539_10742690 3300009094 Bacteria 1142
190 Ga0111539_10791102 3300009094 Bacteria 1104
191 Ga0111539_10856862 3300009094 Bacteria 1057
192 Ga0111539_12169618 3300009094 Bacteria 644
193 Ga0105245_10002929 3300009098 Bacteria 15319
194 Ga0105245_10078973 3300009098 Bacteria 3004
195 Ga0105245_10247081 3300009098 Bacteria 1732
196 Ga0105245_10492208 3300009098 Unclassified 1241
197 Ga0105245_12483293 3300009098 Bacteria 572
198 Ga0105247_10048222 3300009101 Bacteria 2616
199 Ga0114129_11961072 3300009147 Unclassified 709
200 Ga0114129_12078922 3300009147 Unclassified 685
201 Ga0105243_10013864 3300009148 Bacteria 6101
202 Ga0105243_10045020 3300009148 Bacteria 3466
203 Ga0105243_10092076 3300009148 Bacteria 2498
204 Ga0105243_11196581 3300009148 Unclassified 773
205 Ga0105241_10114948 3300009174 Bacteria 2159
206 Ga0105241_10222526 3300009174 Unclassified 1587
207 Ga0105241_11380690 3300009174 Bacteria 674
208 Ga0105242_10010591 3300009176 Bacteria 7080
209 Ga0105242_10582622 3300009176 Bacteria 1078
210 Ga0105242_10623809 3300009176 Unclassified 1045
211 Ga0105242_10747799 3300009176 Unclassified 962
212 Ga0105242_10983994 3300009176 Bacteria 850
213 Ga0105242_12278231 3300009176 Unclassified 588
214 Ga0105237_10449032 3300009545 Unclassified 1295
215 Ga0105237_11597223 3300009545 Bacteria 659
216 Ga0105237_12325517 3300009545 Unclassified 546
217 Ga0105238_10006448 3300009551 Bacteria 11667
218 Ga0105238_11408480 3300009551 Bacteria 724
219 Ga0105238_11853344 3300009551 Unclassified 636
220 Ga0105249_10062351 3300009553 Bacteria 3423
221 Ga0105249_10157726 3300009553 Bacteria 2190
222 Ga0105249_10188336 3300009553 Unclassified 2012
223 Ga0105239_10008213 3300010375 Bacteria 11907
224 Ga0105239_10012054 3300010375 Bacteria 9640
225 Ga0105239_10197722 3300010375 Bacteria 2252
226 Ga0105239_11477305 3300010375 Unclassified 785
227 Ga0105246_10077093 3300011119 Unclassified 2363
228 Ga0105246_10167886 3300011119 Bacteria 1678
229 Ga0105246_10679389 3300011119 Archaea 900
230 Ga0157374_10047947 3300013296 Bacteria 3962
231 Ga0157374_10052475 3300013296 Bacteria 3798
232 Ga0157378_10013326 3300013297 Bacteria 7186
233 Ga0157378_10250461 3300013297 Bacteria 1695
234 Ga0163162_10689585 3300013306 Bacteria 1144
235 Ga0157372_10038710 3300013307 Bacteria 5262
236 Ga0157372_10240773 3300013307 Unclassified 2099
237 Ga0157372_12286956 3300013307 Bacteria 621
238 Ga0157372_12533317 3300013307 Unclassified 589
239 Ga0157375_10051006 3300013308 Bacteria 4061
240 Ga0157375_10114706 3300013308 Bacteria 2796
241 Ga0157375_11097328 3300013308 Unclassified 931
242 Ga0157375_11263875 3300013308 Bacteria 867
243 Ga0157375_12264909 3300013308 Bacteria 648
244 Ga0163163_10011750 3300014325 Bacteria 7956
245 Ga0163163_10053752 3300014325 Bacteria 3977
246 Ga0163163_12463218 3300014325 Bacteria 578
247 Ga0163163_12835665 3300014325 Unclassified 541
248 Ga0157380_10730259 3300014326 Bacteria 999
249 Ga0157380_10789565 3300014326 Unclassified 965
250 Ga0157380_11506914 3300014326 Unclassified 726
251 Ga0157380_12813541 3300014326 Bacteria 553
252 Ga0157380_13431259 3300014326 Bacteria 507
253 Ga0157377_10001428 3300014745 Bacteria 10306
254 Ga0157377_10009705 3300014745 Bacteria 4735
255 Ga0157377_11405901 3300014745 Bacteria 550
256 Ga0157379_10003614 3300014968 Bacteria 13125
257 Ga0157379_10164221 3300014968 Bacteria 2004
258 Ga0157376_10073372 3300014969 Unclassified 2914
259 Ga0157376_10209645 3300014969 Bacteria 1798
260 Ga0163161_10608507 3300017792 Bacteria 902
261 Ga0163161_10981831 3300017792 Bacteria 720
262 Ga0163161_11234241 3300017792 Bacteria 647
263 Ga0206353_11318564 3300020082 Bacteria 685
264 Ga0213874_10008924 3300021377 Bacteria 2462
265 Ga0213874_10018406 3300021377 Bacteria 1887
266 Ga0213874_10032377 3300021377 Unclassified 1518
267 Ga0213874_10125995 3300021377 Bacteria 875
268 Ga0213876_10005125 3300021384 Bacteria 7227
269 Ga0213876_10014095 3300021384 Bacteria 4239
270 Ga0213876_10014320 3300021384 Bacteria 4204
271 Ga0213876_10183150 3300021384 Bacteria 1114
272 Ga0213875_10000432 3300021388 Bacteria 36597
273 Ga0213875_10024011 3300021388 Bacteria 2909
274 Ga0213875_10039358 3300021388 Unclassified 2227
275 Ga0213875_10271764 3300021388 Unclassified 800
276 Ga0213875_10511500 3300021388 Bacteria 577
277 Ga0207426_1034212 3300025302 Bacteria 1632
278 Ga0207692_10220643 3300025898 Unclassified 1124
279 Ga0207692_10607901 3300025898 Bacteria 703
280 Ga0207692_11168621 3300025898 Unclassified 511
281 Ga0207642_10467265 3300025899 Unclassified 767
282 Ga0207710_10038277 3300025900 Bacteria 2120
283 Ga0207688_10013672 3300025901 Bacteria 4412
284 Ga0207688_10048070 3300025901 Bacteria 2383
285 Ga0207688_10073720 3300025901 Bacteria 1941
286 Ga0207688_10104140 3300025901 Unclassified 1642
287 Ga0207688_10989157 3300025901 Bacteria 532
288 Ga0207680_10100758 3300025903 Bacteria 1855
289 Ga0207685_10594401 3300025905 Bacteria 593
290 Ga0207699_11123622 3300025906 Unclassified 582
291 Ga0207699_11289066 3300025906 Unclassified 541
292 Ga0207645_10306527 3300025907 Bacteria 1058
293 Ga0207643_10420899 3300025908 Bacteria 847
294 Ga0207705_11247687 3300025909 Unclassified 569
295 Ga0207705_11315002 3300025909 Bacteria 552
296 Ga0207654_10077750 3300025911 Bacteria 1990
297 Ga0207654_10416436 3300025911 Bacteria 937
298 Ga0207707_10283948 3300025912 Bacteria 1433
299 Ga0207707_10464570 3300025912 Bacteria 1082
300 Ga0207707_10681848 3300025912 Bacteria 864
301 Ga0207707_11349552 3300025912 Unclassified 571
302 Ga0207695_10834626 3300025913 Bacteria 802
303 Ga0207671_10903311 3300025914 Bacteria 698
304 Ga0207671_11080949 3300025914 Bacteria 630
305 Ga0207693_10011778 3300025915 Bacteria 7069
306 Ga0207693_10044509 3300025915 Bacteria 3489
307 Ga0207693_10122284 3300025915 Bacteria 2044
308 Ga0207693_10180155 3300025915 Bacteria 1663
309 Ga0207693_11353893 3300025915 Bacteria 530
310 Ga0207663_10052119 3300025916 Unclassified 2551
311 Ga0207663_10283902 3300025916 Bacteria 1231
312 Ga0207663_10366887 3300025916 Unclassified 1094
313 Ga0207663_10440732 3300025916 Bacteria 1003
314 Ga0207657_10078110 3300025919 Bacteria 2788
315 Ga0207652_10049357 3300025921 Bacteria 3602
316 Ga0207652_10993903 3300025921 Bacteria 738
317 Ga0207681_10095571 3300025923 Bacteria 2132
318 Ga0207681_11064503 3300025923 Bacteria 679
319 Ga0207694_11219918 3300025924 Bacteria 636
320 Ga0207659_10103589 3300025926 Bacteria 2150
321 Ga0207659_10213745 3300025926 Bacteria 1547
322 Ga0207687_10007786 3300025927 Bacteria 7027
323 Ga0207687_10021995 3300025927 Bacteria 4241
324 Ga0207687_10081684 3300025927 Unclassified 2336
325 Ga0207687_10095941 3300025927 Bacteria 2172
326 Ga0207687_10118312 3300025927 Bacteria 1978
327 Ga0207664_10141256 3300025929 Unclassified 2037
328 Ga0207664_10163194 3300025929 Unclassified 1902
329 Ga0207664_10314289 3300025929 Bacteria 1381
330 Ga0207644_10314449 3300025931 Unclassified 1265
331 Ga0207644_10350096 3300025931 Bacteria 1199
332 Ga0207690_10089300 3300025932 Bacteria 2173
333 Ga0207690_10129902 3300025932 Bacteria 1842
334 Ga0207690_11042814 3300025932 Unclassified 681
335 Ga0207706_10009700 3300025933 Bacteria 8836
336 Ga0207706_10266200 3300025933 Bacteria 1496
337 Ga0207686_10016674 3300025934 Bacteria 4125
338 Ga0207686_11104761 3300025934 Unclassified 646
339 Ga0207686_11635451 3300025934 Bacteria 532
340 Ga0207709_10028119 3300025935 Bacteria 3248
341 Ga0207709_10312331 3300025935 Unclassified 1173
342 Ga0207709_10401220 3300025935 Bacteria 1048
343 Ga0207709_10646343 3300025935 Unclassified 842
344 Ga0207709_11251944 3300025935 Bacteria 612
345 Ga0207709_11364373 3300025935 Unclassified 587
346 Ga0207670_10578838 3300025936 Bacteria 920
347 Ga0207670_11620002 3300025936 Bacteria 551
348 Ga0207669_10094942 3300025937 Bacteria 1953
349 Ga0207669_10447509 3300025937 Bacteria 1023
350 Ga0207669_10493681 3300025937 Bacteria 978
351 Ga0207669_11007778 3300025937 Bacteria 700
352 Ga0207704_10083960 3300025938 Bacteria 2069
353 Ga0207704_10672675 3300025938 Bacteria 854
354 Ga0207704_11314883 3300025938 Unclassified 618
355 Ga0207665_11545093 3300025939 Unclassified 527
356 Ga0207691_10202826 3300025940 Bacteria 1725
357 Ga0207689_10148935 3300025942 Unclassified 1929
358 Ga0207689_10361140 3300025942 Bacteria 1208
359 Ga0207661_10031697 3300025944 Bacteria 4088
360 Ga0207661_10035686 3300025944 Bacteria 3877
361 Ga0207661_11579494 3300025944 Bacteria 600
362 Ga0207679_10288410 3300025945 Bacteria 1410
363 Ga0207679_11246697 3300025945 Bacteria 682
364 Ga0207667_10026920 3300025949 Bacteria 6273
365 Ga0207712_10333079 3300025961 Unclassified 1256
366 Ga0207712_10377281 3300025961 Bacteria 1186
367 Ga0207668_10052405 3300025972 Bacteria 2823
368 Ga0207668_10508383 3300025972 Bacteria 1038
369 Ga0207668_11311972 3300025972 Unclassified 652
370 Ga0207640_10225657 3300025981 Unclassified 1437
371 Ga0207640_10248085 3300025981 Bacteria 1380
372 Ga0207640_10797168 3300025981 Bacteria 818
373 Ga0207640_10944908 3300025981 Bacteria 755
374 Ga0207640_10979692 3300025981 Bacteria 743
375 Ga0207640_11154525 3300025981 Unclassified 687
376 Ga0207658_10538385 3300025986 Bacteria 1044
377 Ga0207658_11168554 3300025986 Unclassified 703
378 Ga0207677_10183081 3300026023 Bacteria 1649
379 Ga0207703_10571599 3300026035 Unclassified 1067
380 Ga0207678_10094927 3300026067 Bacteria 2549
381 Ga0207678_10112290 3300026067 Bacteria 2325
382 Ga0207678_10213794 3300026067 Bacteria 1650
383 Ga0207708_10000610 3300026075 Bacteria 27534
384 Ga0207708_10086493 3300026075 Bacteria 2412
385 Ga0207708_10403899 3300026075 Unclassified 1130
386 Ga0207708_10862677 3300026075 Unclassified 782
387 Ga0207702_10040691 3300026078 Bacteria 3896
388 Ga0207702_11121145 3300026078 Bacteria 781
389 Ga0207641_10341980 3300026088 Unclassified 1424
390 Ga0207641_10877107 3300026088 Unclassified 890
391 Ga0207648_10022027 3300026089 Bacteria 5724
392 Ga0207648_10044516 3300026089 Bacteria 3894
393 Ga0207648_11760412 3300026089 Unclassified 581
394 Ga0207676_10953831 3300026095 Unclassified 843
395 Ga0207676_11442329 3300026095 Bacteria 685
396 Ga0207674_10726439 3300026116 Unclassified 959
397 Ga0207675_100017563 3300026118 Bacteria 6676
398 Ga0207675_100236685 3300026118 Bacteria 1763
399 Ga0207683_10000098 3300026121 Bacteria 71739
400 Ga0207683_10540852 3300026121 Unclassified 1077
401 Ga0207683_10583410 3300026121 Bacteria 1034
402 Ga0207683_10956544 3300026121 Unclassified 795
403 Ga0207698_10009641 3300026142 Bacteria 6165
404 Ga0207698_10157041 3300026142 Bacteria 1983
405 Ga0207698_10164235 3300026142 Bacteria 1946
406 Ga0207698_11225695 3300026142 Unclassified 764
407 Ga0207428_10041841 3300027907 Bacteria 3708
408 Ga0207428_10138277 3300027907 Bacteria 1861
409 Ga0207428_10803476 3300027907 Unclassified 668
410 Ga0207428_10999354 3300027907 Bacteria 588
411 Ga0268266_10041473 3300028379 Bacteria 3928
412 Ga0268265_10542184 3300028380 Bacteria 1103
413 Ga0268265_11613000 3300028380 Unclassified 654
414 Ga0268264_10093314 3300028381 Bacteria 2600
415 Ga0268264_10262669 3300028381 Bacteria 1609
416 Ga0265319_1025981 3300028563 Bacteria 2090
417 Ga0265318_10026778 3300028577 Bacteria 2269
418 Ga0265318_10239141 3300028577 Bacteria 663
419 Ga0265338_10051655 3300028800 Bacteria 3698
420 Ga0265320_10369575 3300031240 Bacteria 633
421 Ga0265327_10004579 3300031251 Bacteria 12173
422 Ga0307408_101685073 3300031548 Bacteria 604
423 Ga0265314_10130962 3300031711 Bacteria 1565
424 Ga0265314_10299512 3300031711 Bacteria 903
425 Ga0307405_10367479 3300031731 Bacteria 1115
426 Ga0307413_10286347 3300031824 Bacteria 1242
427 Ga0307413_10302156 3300031824 Bacteria 1214
428 Ga0307410_10261617 3300031852 Bacteria 1349
429 Ga0307410_10460621 3300031852 Bacteria 1039
430 Ga0307410_11792190 3300031852 Bacteria 545
431 Ga0307406_10105101 3300031901 Bacteria 1931
432 Ga0307406_10664910 3300031901 Bacteria 866
433 Ga0307406_10935081 3300031901 Bacteria 740
434 Ga0307407_10084949 3300031903 Unclassified 1925
435 Ga0307412_10151690 3300031911 Bacteria 1711
436 Ga0307412_10652625 3300031911 Bacteria 898
437 Ga0307412_12086522 3300031911 Unclassified 526
438 Ga0307409_100054075 3300031995 Bacteria 3089
439 Ga0307409_102173929 3300031995 Unclassified 584
440 Ga0307416_100665094 3300032002 Unclassified 1128
441 Ga0307416_102828370 3300032002 Bacteria 580
442 Ga0307416_103154026 3300032002 Bacteria 552
443 Ga0307414_10193932 3300032004 Bacteria 1646
444 Ga0307411_11710960 3300032005 Unclassified 582
445 Ga0307415_100548007 3300032126 Bacteria 1020
446 Ga0307415_101314320 3300032126 Bacteria 685
447 Ga0307415_101349521 3300032126 Bacteria 677
448 Ga0373944_0186769 3300035089 Bacteria 745
449 Ga0373923_0004844 3300035111 Bacteria 4508
450 Ga0373936_0033654 3300035113 Bacteria 2032
451 Ga0373945_0264992 3300035116 Bacteria 729
452 Ga0373945_0302440 3300035116 Bacteria 685
453 Ga0373953_0437267 3300035117 Unclassified 577
454 Ga0373954_0083557 3300035118 Bacteria 1528
455 Ga0373956_0217075 3300035119 Bacteria 908
456 Ga0373957_0213503 3300035120 Bacteria 806
457 Ga0373943_0049653 3300035170 Bacteria 2059
458 Ga0373943_0227841 3300035170 Bacteria 1040
459 Ga0373946_0640759 3300035171 Bacteria 553
460 Ga0373955_0077652 3300035172 Bacteria 1870
461 Ga0373924_0049465 3300035410 Bacteria 1739
462 Ga0373935_0160600 3300035692 Unclassified 1531
463 Ga0373927_0134354 3300035695 Bacteria 1617
464 Ga0373927_0139102 3300035695 Bacteria 1587
465 Ga0373927_0328376 3300035695 Bacteria 1008
466 Ga0373933_0043773 3300035724 Bacteria 2650
467 Ga0373947_0048843 3300035725 Bacteria 2539
468 Ga0373947_0310619 3300035725 Bacteria 1053
469 Ga0373937_0346631 3300036401 Bacteria 1406
470 Ga0373925_0108455 3300037068 Bacteria 2142
471 Ga0373925_0204130 3300037068 Bacteria 1573
472 Ga0395898_0342978 3300037466 Bacteria 1425
473 Ga0436364_0334055 3300037853 Unclassified 983
474 Ga0436364_0635347 3300037853 Bacteria 5851
475 Ga0436364_0649140 3300037853 Bacteria 6357
476 Ga0436364_0731868 3300037853 Unclassified 614
477 Ga0436364_1031907 3300037853 Bacteria 102112
478 Ga0436364_1102629 3300037853 Bacteria 6181
479 Ga0436364_1427363 3300037853 Bacteria 3698
480 Ga0436364_1441737 3300037853 Bacteria 1567
481 Ga0436365_0237483 3300039437 Bacteria 749
482 Ga0436365_0401331 3300039437 Bacteria 6190
483 Ga0436365_0904996 3300039437 Bacteria 14294
484 Ga0436365_1066112 3300039437 Bacteria 4477
485 Ga0436365_1258992 3300039437 Bacteria 1785
486 Ga0436365_1650091 3300039437 Bacteria 13373
487 Ga0436360_0936914 3300039438 Unclassified 894
488 Ga0436361_0474887 3300039447 Unclassified 823
489 Ga0436363_0142574 3300039450 Bacteria 1430
490 Ga0436363_0445240 3300039450 Bacteria 1021
491 Ga0436363_0709244 3300039450 Unclassified 757
492 Ga0436363_0793499 3300039450 Unclassified 836
493 Ga0436363_1050794 3300039450 Unclassified 569
494 Ga0436363_1089750 3300039450 Bacteria 10440
495 Ga0436363_1106810 3300039450 Bacteria 5353
496 Ga0436363_1357287 3300039450 Bacteria 1076
497 Ga0436363_1644680 3300039450 Bacteria 1284
498 Ga0436363_1705603 3300039450 Bacteria 5301
499 Ga0436362_0310761 3300039453 Unclassified 1607
500 Ga0436362_0626285 3300039453 Bacteria 773
501 Ga0436362_0906932 3300039453 Unclassified 1445
502 Ga0451789_0720585 3300041443 Bacteria 686
503 Ga0451853_0030295 3300041512 Unclassified 578
504 Ga0451853_0468880 3300041512 Unclassified 603
505 Ga0439448_0226952 3300042005 Unclassified 657
506 Ga0450915_005259 3300042119 Bacteria 793
507 Ga0450888_003572 3300042126 Bacteria 1583
508 Ga0466966_0220968 3300044684 Bacteria 1144
509 Ga0466964_0423154 3300044706 Unclassified 701
510 Ga0466968_0034907 3300044735 Bacteria 2102
511 Ga0466959_0199329 3300045049 Unclassified 1394
512 Ga0466959_0298225 3300045049 Unclassified 1104
513 Ga0466958_0108445 3300045836 Unclassified 1732
514 Ga0466958_0311555 3300045836 Unclassified 1011
515 Ga0466967_0027714 3300045976 Bacteria 4716
516 Ga0466967_0050202 3300045976 Bacteria 3652
517 Ga0466967_0414128 3300045976 Bacteria 1313
518 Ga0466967_0423638 3300045976 Bacteria 1298
519 Ga0466967_0467108 3300045976 Bacteria 1235
520 Ga0466967_0722272 3300045976 Bacteria 987
521 Ga0466967_1351463 3300045976 Bacteria 710
522 Ga0466967_2058120 3300045976 Unclassified 567
523 Ga0495592_0294649 3300046454 Unclassified 1056
524 Ga0495592_0864191 3300046454 Unclassified 534
525 Ga0495603_0065347 3300046455 Bacteria 2144
526 Ga0495603_0159578 3300046455 Bacteria 1308
527 Ga0495603_0476065 3300046455 Bacteria 715
528 Ga0495629_0052587 3300046459 Bacteria 2850
529 Ga0495641_0048719 3300046461 Bacteria 1942
530 Ga0495641_0063736 3300046461 Bacteria 1660
531 Ga0495641_0212455 3300046461 Bacteria 867
532 Ga0495651_0097342 3300046462 Bacteria 2197
533 Ga0495653_0010293 3300046463 Bacteria 7653
534 Ga0495653_0331423 3300046463 Unclassified 984
535 Ga0495653_0495249 3300046463 Unclassified 763
536 Ga0495580_0131021 3300046472 Bacteria 1739
537 Ga0495582_0017805 3300046473 Bacteria 3883
538 Ga0495582_0433986 3300046473 Bacteria 758
539 Ga0495582_0528047 3300046473 Bacteria 682
540 Ga0495639_0002417 3300046475 Bacteria 8156
541 Ga0495639_0112290 3300046475 Bacteria 1294
542 Ga0495662_0002132 3300046476 Bacteria 9924
543 Ga0495662_0395879 3300046476 Bacteria 678
544 Ga0495664_0376426 3300046477 Bacteria 854
545 Ga0495585_0220687 3300046492 Unclassified 957
546 Ga0495594_0008788 3300046499 Bacteria 5208
547 Ga0495608_0049917 3300046511 Bacteria 2776
548 Ga0495608_0675439 3300046511 Bacteria 616
549 Ga0495618_0022487 3300046514 Bacteria 3894
550 Ga0495618_0429057 3300046514 Bacteria 805
551 Ga0495620_0321827 3300046515 Bacteria 587
552 Ga0495628_0577172 3300046516 Bacteria 805
553 Ga0495630_0054473 3300046517 Bacteria 2996
554 Ga0495666_0010114 3300046526 Bacteria 4706
555 Ga0495652_0097601 3300046529 Bacteria 2390
556 Ga0495652_0136672 3300046529 Bacteria 1933
557 Ga0495665_0001629 3300046531 Bacteria 12014
558 Ga0495640_0519470 3300046533 Bacteria 723
559 Ga0495640_0607476 3300046533 Bacteria 660
560 Ga0495587_0563144 3300046536 Unclassified 628
561 Ga0495667_0009327 3300046559 Bacteria 6650
562 Ga0495656_0327837 3300046615 Bacteria 790
563 Ga0495656_0492103 3300046615 Bacteria 650
564 Ga0495668_0437180 3300046616 Unclassified 720
565 Ga0495634_0012006 3300046642 Bacteria 6279
566 Ga0495635_0022073 3300046663 Bacteria 4435
567 Ga0495588_0075512 3300046674 Bacteria 1756
568 Ga0495657_0013747 3300046675 Bacteria 5959
569 Ga0495599_0375291 3300046678 Unclassified 850
570 Ga0495599_0879588 3300046678 Unclassified 508
571 Ga0495623_0098773 3300046679 Bacteria 1781
572 Ga0495646_0564020 3300046680 Bacteria 580
573 Ga0495646_0577311 3300046680 Bacteria 572
574 Ga0495647_0000590 3300046681 Bacteria 10755
575 Ga0495658_0279153 3300046683 Bacteria 1054
576 Ga0495613_0015895 3300046689 Bacteria 5603
577 Ga0495624_0023602 3300046690 Bacteria 4054
578 Ga0495624_0895062 3300046690 Bacteria 523
579 Ga0495624_0953726 3300046690 Unclassified 504
580 Ga0495670_0533288 3300046691 Bacteria 638
581 Ga0495589_0459147 3300046794 Bacteria 583
582 Ga0495600_0043352 3300046809 Bacteria 2934
583 Ga0495600_0045946 3300046809 Bacteria 2849
584 Ga0495581_0005143 3300047315 Bacteria 7569
585 Ga0495581_0663290 3300047315 Unclassified 602
586 Ga0495604_0052658 3300047317 Bacteria 3150
587 Ga0495674_0003550 3300047319 Bacteria 15161
588 Ga0495674_1451571 3300047319 Bacteria 509
589 Ga0495676_0030243 3300047321 Bacteria 4601
590 Ga0495676_0158256 3300047321 Bacteria 1605
591 Ga0495680_0017614 3300047322 Bacteria 6089
592 Ga0495675_0016700 3300047444 Bacteria 4642
593 Ga0495684_0006150 3300047471 Bacteria 9344
594 Ga0495593_0025452 3300047673 Bacteria 3275
595 Ga0495593_0261004 3300047673 Bacteria 867
596 Ga0495602_1028565 3300048088 Bacteria 543
597 Ga0495614_0021631 3300048089 Bacteria 2776
598 Ga0495615_0162911 3300048090 Bacteria 671
599 Ga0496100_0002592 3300048903 Bacteria 9215
600 Ga0496100_0124538 3300048903 Bacteria 1807
601 Ga0496100_0204058 3300048903 Unclassified 1442
602 Ga0496100_0346083 3300048903 Bacteria 1122
603 Ga0496100_0583548 3300048903 Unclassified 867
604 Ga0496100_1352830 3300048903 Unclassified 562
605 Ga0496101_0006496 3300048904 Bacteria 7528
606 Ga0496101_0018561 3300048904 Bacteria 4731
607 Ga0496101_0060214 3300048904 Bacteria 2754
608 Ga0496101_0187915 3300048904 Bacteria 1593
609 Ga0496102_0002361 3300048905 Bacteria 16111
610 Ga0496102_0004122 3300048905 Bacteria 12319
611 Ga0496102_0053118 3300048905 Bacteria 3694
612 Ga0496102_0179746 3300048905 Bacteria 1993
613 Ga0496102_0186797 3300048905 Bacteria 1953
614 Ga0496102_0202924 3300048905 Bacteria 1869
615 Ga0496102_0700877 3300048905 Bacteria 935
616 Ga0496102_1163889 3300048905 Unclassified 691
617 Ga0496102_1803528 3300048905 Bacteria 529
618 Ga0496103_0000900 3300048906 Bacteria 21361
619 Ga0496103_0261985 3300048906 Bacteria 1112
620 Ga0496103_0519329 3300048906 Bacteria 761
621 Ga0496103_0700006 3300048906 Bacteria 642
622 Ga0496103_0793104 3300048906 Unclassified 598
623 Ga0496104_0002813 3300048907 Bacteria 15001
624 Ga0496104_0016977 3300048907 Bacteria 6622
625 Ga0496104_0035622 3300048907 Bacteria 4647
626 Ga0496104_0039310 3300048907 Bacteria 4430
627 Ga0496104_0516501 3300048907 Bacteria 1106
628 Ga0496104_1693459 3300048907 Bacteria 535
629 Ga0496105_0009674 3300048908 Bacteria 7546
630 Ga0496105_0033357 3300048908 Bacteria 4227
631 Ga0496105_0675332 3300048908 Bacteria 795
632 Ga0496106_0004546 3300048909 Bacteria 10281
633 Ga0496106_0046292 3300048909 Bacteria 3269
634 Ga0496106_0052832 3300048909 Bacteria 3067
635 Ga0496107_0004168 3300048910 Bacteria 9760
636 Ga0496107_0028545 3300048910 Bacteria 3966
637 Ga0496107_0036418 3300048910 Bacteria 3529
638 Ga0496108_0025064 3300048911 Bacteria 4914
639 Ga0496108_0095159 3300048911 Bacteria 2535
640 Ga0496108_0332200 3300048911 Unclassified 1326
641 Ga0496109_0000999 3300048912 Bacteria 23362
642 Ga0496109_0050806 3300048912 Bacteria 3775
643 Ga0496109_0063573 3300048912 Bacteria 3376
644 Ga0496109_0338547 3300048912 Unclassified 1421
645 Ga0496109_1084782 3300048912 Bacteria 738
646 Ga0496110_0001024 3300048913 Bacteria 19667
647 Ga0496110_0027449 3300048913 Bacteria 4881
648 Ga0496110_0621833 3300048913 Unclassified 979
649 Ga0496110_1369135 3300048913 Unclassified 617
650 Ga0496111_0005422 3300048914 Bacteria 8174
651 Ga0496111_0027704 3300048914 Bacteria 4012
652 Ga0496111_0532315 3300048914 Unclassified 863
653 Ga0496112_0021398 3300048915 Bacteria 6150
654 Ga0496112_0101937 3300048915 Unclassified 2840
655 Ga0496112_0482719 3300048915 Bacteria 1176
656 Ga0496112_1736120 3300048915 Unclassified 536
657 Ga0496113_0010790 3300048916 Bacteria 6059
658 Ga0496113_0925846 3300048916 Bacteria 689
659 Ga0496113_1187655 3300048916 Unclassified 596
660 Ga0496114_0020808 3300048917 Bacteria 5326
661 Ga0496114_0045492 3300048917 Bacteria 3646
662 Ga0496114_0046951 3300048917 Bacteria 3590
663 Ga0496114_0380887 3300048917 Unclassified 1249
664 Ga0496114_1145004 3300048917 Unclassified 663
665 Ga0496115_0009605 3300048918 Bacteria 7193
666 Ga0496115_0011122 3300048918 Bacteria 6743
667 Ga0496115_0028400 3300048918 Bacteria 4384
668 Ga0496115_0056933 3300048918 Bacteria 3143
669 Ga0496115_0978589 3300048918 Bacteria 648
670 Ga0501031_0098080 3300049568 Bacteria 1912
671 Ga0501033_0178223 3300049570 Bacteria 1524
672 Ga0501034_0374862 3300049571 Bacteria 1349
673 Ga0501036_0088604 3300049572 Bacteria 2615
674 Ga0501036_0270575 3300049572 Bacteria 1422
675 Ga0501037_0221816 3300049573 Bacteria 1330
676 Ga0501039_0257285 3300049575 Bacteria 1372
677 Ga0501040_0091518 3300049576 Bacteria 2114
678 Ga0501040_0494696 3300049576 Bacteria 881
679 Ga0501041_0014031 3300049577 Bacteria 4754
680 Ga0501041_0258216 3300049577 Bacteria 1095
681 Ga0501042_0095351 3300049578 Bacteria 2137
682 Ga0501042_0110522 3300049578 Bacteria 1979
683 Ga0501042_1073303 3300049578 Bacteria 587
684 Ga0501046_0140512 3300049580 Bacteria 1828
685 Ga0501046_0235187 3300049580 Unclassified 1353
686 Ga0501046_0527766 3300049580 Bacteria 843
687 Ga0501048_0078076 3300049582 Bacteria 2336
688 Ga0501048_0110944 3300049582 Bacteria 1937
689 Ga0501048_0227513 3300049582 Bacteria 1323
690 Ga0501048_0312538 3300049582 Unclassified 1119
691 Ga0501068_0482102 3300049584 Bacteria 804
692 Ga0501068_1059695 3300049584 Bacteria 536
693 Ga0501069_0604575 3300049585 Bacteria 658
694 Ga0501070_0238078 3300049586 Bacteria 1490
695 Ga0501071_0051006 3300049587 Bacteria 2981
696 Ga0501071_0073172 3300049587 Bacteria 2499
697 Ga0501071_0826770 3300049587 Unclassified 714
698 Ga0501071_1093476 3300049587 Bacteria 616
699 Ga0501072_0180744 3300049588 Bacteria 1682
700 Ga0501072_0376088 3300049588 Unclassified 1127
701 Ga0501072_0408109 3300049588 Unclassified 1077
702 Ga0501074_0043550 3300049590 Bacteria 3249
703 Ga0501074_0230281 3300049590 Bacteria 1319
704 Ga0501074_0587014 3300049590 Unclassified 788
705 Ga0501075_0043708 3300049591 Bacteria 3360
706 Ga0501076_0019050 3300049592 Bacteria 5236
707 Ga0501076_0121921 3300049592 Bacteria 2111
708 Ga0501076_0621237 3300049592 Unclassified 891
709 Ga0501077_0111146 3300049593 Bacteria 1737
710 Ga0501077_0423794 3300049593 Unclassified 851
711 Ga0501079_0198164 3300049741 Unclassified 1568
712 Ga0501079_0711593 3300049741 Unclassified 790
713 Ga0501080_0226217 3300049742 Unclassified 1711
714 Ga0501080_0346554 3300049742 Unclassified 1342
715 Ga0501081_0064875 3300049743 Bacteria 2537
716 Ga0501081_0290905 3300049743 Bacteria 1197
717 Ga0501081_0291723 3300049743 Unclassified 1196
718 Ga0501081_1080571 3300049743 Unclassified 607
719 Ga0501083_0137141 3300049744 Bacteria 1603
720 Ga0501045_0114345 3300049824 Bacteria 2001
721 Ga0501045_0279007 3300049824 Unclassified 1244
722 nmdc:mga03683_8898_c1 3300050489 Bacteria 3550
723 nmdc:mga03n38_194074_c1 3300050490 Bacteria 1047
724 nmdc:mga03n38_789519_c1 3300050490 Unclassified 552
725 nmdc:mga00v17_14620_c1 3300050491 Bacteria 4387
726 nmdc:mga05p37_1203412_c1 3300050507 Bacteria 782
727 nmdc:mga05p37_1393678_c1 3300050507 Bacteria 707
728 nmdc:mga05p37_2045321_c1 3300050507 Unclassified 540
729 nmdc:mga05p37_873857_c1 3300050507 Unclassified 973
730 nmdc:mga09592_126603_c1 3300050508 Bacteria 2196
731 nmdc:mga09592_874732_c1 3300050508 Bacteria 757
732 nmdc:mga06r32_10365_c1 3300050510 Bacteria 8408
733 nmdc:mga06r32_131044_c1 3300050510 Bacteria 2479
734 nmdc:mga06r32_190835_c1 3300050510 Bacteria 2037
735 nmdc:mga08y16_1073349_c1 3300050511 Bacteria 781
736 nmdc:mga08y16_147968_c1 3300050511 Bacteria 2441
737 nmdc:mga08y16_21380_c1 3300050511 Bacteria 6833
738 nmdc:mga08y16_60559_c1 3300050511 Bacteria 3954
739 nmdc:mga08y16_723813_c1 3300050511 Bacteria 993
740 nmdc:mga0n895_2012500_c1 3300050512 Bacteria 535
741 nmdc:mga0n895_468166_c1 3300050512 Bacteria 1271
742 nmdc:mga0n895_74928_c1 3300050512 Bacteria 3363
743 nmdc:mga0rr50_1498909_c1 3300050513 Unclassified 570
744 nmdc:mga0rr50_1712788_c1 3300050513 Bacteria 530
745 nmdc:mga08x19_161378_c1 3300050514 Unclassified 1522
746 nmdc:mga08x19_899529_c1 3300050514 Bacteria 629
747 Ga0495601_0147897 3300053077 Bacteria 1533
748 Ga0495612_0200639 3300053078 Bacteria 880
749 Ga0495595_0005295 3300053084 Bacteria 5216
750 Ga0495595_0276020 3300053084 Bacteria 843
751 Ga0495619_0003931 3300053085 Bacteria 9549
752 Ga0500616_0096673 3300053153 Bacteria 1451
753 Ga0501084_0017709 3300054114 Bacteria 5927
754 Ga0501084_0207082 3300054114 Bacteria 1655
755 Ga0501084_0212016 3300054114 Bacteria 1634
756 Ga0501082_0050508 3300060353 Bacteria 3586
757 Ga0501082_0124883 3300060353 Bacteria 2232
758 Ga0501082_0461896 3300060353 Bacteria 1109
759 Ga0466962_0631453 3300061719 Unclassified 547
760 Ga0530510_0011028 3300061734 Bacteria 6339
761 Ga0530510_0115082 3300061734 Unclassified 1971
762 Ga0530510_0393201 3300061734 Unclassified 1044
763 Ga0307416_101317210
764 Ga0070676_10180947
765 Ga0070683_100915640
766 Ga0070690_100402211
767 Ga0068869_100039228
768 Ga0068869_100096015
769 Ga0070666_10396223
770 Ga0070666_11084880
771 Ga0070666_11460413
772 Ga0070680_100354813
773 Ga0070680_100654196
774 Ga0070682_100067762
775 Ga0070682_100670740
776 Ga0070682_100792793
777 Ga0068868_100001984
778 Ga0068868_100356156
779 Ga0068868_100385962
780 Ga0070660_100065011
781 Ga0070689_100806312
782 Ga0070691_10005696
783 Ga0070691_10021585
784 Ga0070668_100032709
785 Ga0070668_100057906
786 Ga0070669_100892804
787 Ga0070669_100912922
788 Ga0070675_100040215
789 Ga0070675_100256270
790 Ga0070675_100394384
791 Ga0070671_100208832
792 Ga0070671_100595502
793 Ga0070671_100648947
794 Ga0070671_102118797
795 Ga0070674_100043457
796 Ga0070674_100078634
797 Ga0070674_100279812
798 Ga0070674_100984320
799 Ga0070674_101316018
800 Ga0070674_101316258
801 Ga0070688_100063706
802 Ga0070688_100642680
803 Ga0070659_101092600
804 Ga0070659_101349853
805 Ga0070667_100114562
806 Ga0070667_100487793
807 Ga0070667_100969395
808 Ga0070667_102206448
809 Ga0070714_100072611
810 Ga0070714_100304034
811 Ga0070714_100634395
812 Ga0070713_100519802
813 Ga0070710_10040149
814 Ga0070710_10231788
815 Ga0070710_10315394
816 Ga0070710_11175814
817 Ga0070701_10176785
818 Ga0070701_10874033
819 Ga0070701_11269540
820 Ga0070711_100025636
821 Ga0070711_100181844
822 Ga0070711_100220104
823 Ga0070711_100304891
824 Ga0070711_100957947
825 Ga0070705_100017337
826 Ga0070705_100723618
827 Ga0070705_101490598
828 Ga0070700_100001106
829 Ga0070700_100132215
830 Ga0070700_100277363
831 Ga0070694_100657380
832 Ga0070694_100815468
833 Ga0070694_101864920
834 Ga0070663_100027740
835 Ga0070663_100567010
836 Ga0070678_101001618
837 Ga0070662_100054441
838 Ga0070681_10147509
839 Ga0070681_10386216
840 Ga0070681_10859848
841 Ga0068867_100128251
842 Ga0068867_100959832
843 Ga0068867_101282483
844 Ga0070685_11540947
845 Ga0070699_101438911
846 Ga0070679_100265327
847 Ga0070679_100286282
848 Ga0070679_101760047
849 Ga0070684_100006386
850 Ga0070684_100054473
851 Ga0070684_100595658
852 Ga0070684_100934842
853 Ga0070684_102337487
854 Ga0068853_100378902
855 Ga0070672_100120278
856 Ga0070672_100148224
857 Ga0070672_100784067
858 Ga0070686_100050418
859 Ga0070686_100177040
860 Ga0070686_100385240
861 Ga0070695_100595309
862 Ga0070696_100047166
863 Ga0070696_101954914
864 Ga0070693_100119616
865 Ga0070693_100246567
866 Ga0070693_100287603
867 Ga0070665_100153705
868 Ga0068855_100284083
869 Ga0068855_101012266
870 Ga0070664_100028477
871 Ga0070664_101607493
872 Ga0068854_100037103
873 Ga0068854_101215480
874 Ga0068854_101252123
875 Ga0068856_100064219
876 Ga0068856_102032541
877 Ga0070702_100027315
878 Ga0070702_100040550
879 Ga0070702_100335458
880 Ga0068852_100104417
881 Ga0068852_101851370
882 Ga0068864_100023860
883 Ga0068864_101547495
884 Ga0068866_10038107
885 Ga0068866_10134254
886 Ga0068866_10941246
887 Ga0068861_100153614
888 Ga0068861_100307988
889 Ga0068861_100452299
890 Ga0068861_102092368
891 Ga0068861_102634891
892 Ga0068851_10655033
893 Ga0068870_10285777
894 Ga0068870_10881091
895 Ga0068863_100361025
896 Ga0068863_100785081
897 Ga0068863_101030986
898 Ga0068858_100175146
899 Ga0068858_101696643
900 Ga0068860_100015334
901 Ga0068860_102381641
902 Ga0068862_100928927
903 Ga0068862_101423028
904 Ga0081538_10048324
905 Ga0081540_1036100
906 Ga0081540_1070877
907 Ga0081539_10001190
908 Ga0070717_10015315
909 Ga0070717_10650129
910 Ga0075365_10259404
911 Ga0075365_10667466
912 Ga0075363_100261627
913 Ga0075364_10270593
914 Ga0070712_100007279
915 Ga0070712_100221354
916 Ga0070712_100596238
917 Ga0075362_10008980
918 Ga0075427_10007523
919 Ga0097621_100009042
920 Ga0097621_101308246
921 Ga0068871_100540665
922 Ga0068871_100738813
923 Ga0075428_100547616
924 Ga0075428_101742009
925 Ga0075428_101770461
926 Ga0075428_101862535
927 Ga0075430_100228928
928 Ga0075430_101545998
929 Ga0075431_100970738
930 Ga0075431_101177657
931 Ga0075433_10086335
932 Ga0075433_11332423
933 Ga0075434_100060563
934 Ga0075434_100145958
935 Ga0075434_101894207
936 Ga0075434_102412375
937 Ga0075429_100111761
938 Ga0075429_100233732
939 Ga0068865_100266502
940 Ga0068865_100761048
941 Ga0068865_101750788
942 Ga0075436_100158587
943 Ga0075436_100176028
944 Ga0075436_100429604
945 Ga0075435_100134076
946 Ga0105251_10517116
947 Ga0105240_10307341
948 Ga0111539_10029819
949 Ga0111539_10159693
950 Ga0111539_10401659
951 Ga0111539_10742690
952 Ga0111539_10791102
953 Ga0111539_10856862
954 Ga0111539_12169618
955 Ga0105245_10002929
956 Ga0105245_10078973
957 Ga0105245_10247081
958 Ga0105245_10492208
959 Ga0105245_12483293
960 Ga0105247_10048222
961 Ga0114129_11961072
962 Ga0114129_12078922
963 Ga0105243_10013864
964 Ga0105243_10045020
965 Ga0105243_10092076
966 Ga0105243_11196581
967 Ga0105241_10114948
968 Ga0105241_10222526
969 Ga0105241_11380690
970 Ga0105242_10010591
971 Ga0105242_10582622
972 Ga0105242_10623809
973 Ga0105242_10747799
974 Ga0105242_10983994
975 Ga0105242_12278231
976 Ga0105237_10449032
977 Ga0105237_11597223
978 Ga0105237_12325517
979 Ga0105238_10006448
980 Ga0105238_11408480
981 Ga0105238_11853344
982 Ga0105249_10062351
983 Ga0105249_10157726
984 Ga0105249_10188336
985 Ga0105239_10008213
986 Ga0105239_10012054
987 Ga0105239_10197722
988 Ga0105239_11477305
989 Ga0105246_10077093
990 Ga0105246_10167886
991 Ga0105246_10679389
992 Ga0157374_10047947
993 Ga0157374_10052475
994 Ga0157378_10013326
995 Ga0157378_10250461
996 Ga0163162_10689585
997 Ga0157372_10038710
998 Ga0157372_10240773
999 Ga0157372_12286956
1000 Ga0157372_12533317
1001 Ga0157375_10051006
1002 Ga0157375_10114706
1003 Ga0157375_11097328
1004 Ga0157375_11263875
1005 Ga0157375_12264909
1006 Ga0163163_10011750
1007 Ga0163163_10053752
1008 Ga0163163_12463218
1009 Ga0163163_12835665
1010 Ga0157380_10730259
1011 Ga0157380_10789565
1012 Ga0157380_11506914
1013 Ga0157380_12813541
1014 Ga0157380_13431259
1015 Ga0157377_10001428
1016 Ga0157377_10009705
1017 Ga0157377_11405901
1018 Ga0157379_10003614
1019 Ga0157379_10164221
1020 Ga0157376_10073372
1021 Ga0157376_10209645
1022 Ga0163161_10608507
1023 Ga0163161_10981831
1024 Ga0163161_11234241
1025 Ga0206353_11318564
1026 Ga0213874_10008924
1027 Ga0213874_10018406
1028 Ga0213874_10032377
1029 Ga0213874_10125995
1030 Ga0213876_10005125
1031 Ga0213876_10014095
1032 Ga0213876_10014320
1033 Ga0213876_10183150
1034 Ga0213875_10000432
1035 Ga0213875_10024011
1036 Ga0213875_10039358
1037 Ga0213875_10271764
1038 Ga0213875_10511500
1039 Ga0207426_1034212
1040 Ga0207692_10220643
1041 Ga0207692_10607901
1042 Ga0207692_11168621
1043 Ga0207642_10467265
1044 Ga0207710_10038277
1045 Ga0207688_10013672
1046 Ga0207688_10048070
1047 Ga0207688_10073720
1048 Ga0207688_10104140
1049 Ga0207688_10989157
1050 Ga0207680_10100758
1051 Ga0207685_10594401
1052 Ga0207699_11123622
1053 Ga0207699_11289066
1054 Ga0207645_10306527
1055 Ga0207643_10420899
1056 Ga0207705_11247687
1057 Ga0207705_11315002
1058 Ga0207654_10077750
1059 Ga0207654_10416436
1060 Ga0207707_10283948
1061 Ga0207707_10464570
1062 Ga0207707_10681848
1063 Ga0207707_11349552
1064 Ga0207695_10834626
1065 Ga0207671_10903311
1066 Ga0207671_11080949
1067 Ga0207693_10011778
1068 Ga0207693_10044509
1069 Ga0207693_10122284
1070 Ga0207693_10180155
1071 Ga0207693_11353893
1072 Ga0207663_10052119
1073 Ga0207663_10283902
1074 Ga0207663_10366887
1075 Ga0207663_10440732
1076 Ga0207657_10078110
1077 Ga0207652_10049357
1078 Ga0207652_10993903
1079 Ga0207681_10095571
1080 Ga0207681_11064503
1081 Ga0207694_11219918
1082 Ga0207659_10103589
1083 Ga0207659_10213745
1084 Ga0207687_10007786
1085 Ga0207687_10021995
1086 Ga0207687_10081684
1087 Ga0207687_10095941
1088 Ga0207687_10118312
1089 Ga0207664_10141256
1090 Ga0207664_10163194
1091 Ga0207664_10314289
1092 Ga0207644_10314449
1093 Ga0207644_10350096
1094 Ga0207690_10089300
1095 Ga0207690_10129902
1096 Ga0207690_11042814
1097 Ga0207706_10009700
1098 Ga0207706_10266200
1099 Ga0207686_10016674
1100 Ga0207686_11104761
1101 Ga0207686_11635451
1102 Ga0207709_10028119
1103 Ga0207709_10312331
1104 Ga0207709_10401220
1105 Ga0207709_10646343
1106 Ga0207709_11251944
1107 Ga0207709_11364373
1108 Ga0207670_10578838
1109 Ga0207670_11620002
1110 Ga0207669_10094942
1111 Ga0207669_10447509
1112 Ga0207669_10493681
1113 Ga0207669_11007778
1114 Ga0207704_10083960
1115 Ga0207704_10672675
1116 Ga0207704_11314883
1117 Ga0207665_11545093
1118 Ga0207691_10202826
1119 Ga0207689_10148935
1120 Ga0207689_10361140
1121 Ga0207661_10031697
1122 Ga0207661_10035686
1123 Ga0207661_11579494
1124 Ga0207679_10288410
1125 Ga0207679_11246697
1126 Ga0207667_10026920
1127 Ga0207712_10333079
1128 Ga0207712_10377281
1129 Ga0207668_10052405
1130 Ga0207668_10508383
1131 Ga0207668_11311972
1132 Ga0207640_10225657
1133 Ga0207640_10248085
1134 Ga0207640_10797168
1135 Ga0207640_10944908
1136 Ga0207640_10979692
1137 Ga0207640_11154525
1138 Ga0207658_10538385
1139 Ga0207658_11168554
1140 Ga0207677_10183081
1141 Ga0207703_10571599
1142 Ga0207678_10094927
1143 Ga0207678_10112290
1144 Ga0207678_10213794
1145 Ga0207708_10000610
1146 Ga0207708_10086493
1147 Ga0207708_10403899
1148 Ga0207708_10862677
1149 Ga0207702_10040691
1150 Ga0207702_11121145
1151 Ga0207641_10341980
1152 Ga0207641_10877107
1153 Ga0207648_10022027
1154 Ga0207648_10044516
1155 Ga0207648_11760412
1156 Ga0207676_10953831
1157 Ga0207676_11442329
1158 Ga0207674_10726439
1159 Ga0207675_100017563
1160 Ga0207675_100236685
1161 Ga0207683_10000098
1162 Ga0207683_10540852
1163 Ga0207683_10583410
1164 Ga0207683_10956544
1165 Ga0207698_10009641
1166 Ga0207698_10157041
1167 Ga0207698_10164235
1168 Ga0207698_11225695
1169 Ga0207428_10041841
1170 Ga0207428_10138277
1171 Ga0207428_10803476
1172 Ga0207428_10999354
1173 Ga0268266_10041473
1174 Ga0268265_10542184
1175 Ga0268265_11613000
1176 Ga0268264_10093314
1177 Ga0268264_10262669
1178 Ga0265319_1025981
1179 Ga0265318_10026778
1180 Ga0265318_10239141
1181 Ga0265338_10051655
1182 Ga0265320_10369575
1183 Ga0265327_10004579
1184 Ga0307408_101685073
1185 Ga0265314_10130962
1186 Ga0265314_10299512
1187 Ga0307405_10367479
1188 Ga0307413_10286347
1189 Ga0307413_10302156
1190 Ga0307410_10261617
1191 Ga0307410_10460621
1192 Ga0307410_11792190
1193 Ga0307406_10105101
1194 Ga0307406_10664910
1195 Ga0307406_10935081
1196 Ga0307407_10084949
1197 Ga0307412_10151690
1198 Ga0307412_10652625
1199 Ga0307412_12086522
1200 Ga0307409_100054075
1201 Ga0307409_102173929
1202 Ga0307416_100665094
1203 Ga0307416_102828370
1204 Ga0307416_103154026
1205 Ga0307414_10193932
1206 Ga0307411_11710960
1207 Ga0307415_100548007
1208 Ga0307415_101314320
1209 Ga0307415_101349521
1210 Ga0373944_0186769
1211 Ga0373923_0004844
1212 Ga0373936_0033654
1213 Ga0373945_0264992
1214 Ga0373945_0302440
1215 Ga0373953_0437267
1216 Ga0373954_0083557
1217 Ga0373956_0217075
1218 Ga0373957_0213503
1219 Ga0373943_0049653
1220 Ga0373943_0227841
1221 Ga0373946_0640759
1222 Ga0373955_0077652
1223 Ga0373924_0049465
1224 Ga0373935_0160600
1225 Ga0373927_0134354
1226 Ga0373927_0139102
1227 Ga0373927_0328376
1228 Ga0373933_0043773
1229 Ga0373947_0048843
1230 Ga0373947_0310619
1231 Ga0373937_0346631
1232 Ga0373925_0108455
1233 Ga0373925_0204130
1234 Ga0395898_0342978
1235 Ga0436364_0334055
1236 Ga0436364_0635347
1237 Ga0436364_0649140
1238 Ga0436364_0731868
1239 Ga0436364_1031907
1240 Ga0436364_1102629
1241 Ga0436364_1427363
1242 Ga0436364_1441737
1243 Ga0436365_0237483
1244 Ga0436365_0401331
1245 Ga0436365_0904996
1246 Ga0436365_1066112
1247 Ga0436365_1258992
1248 Ga0436365_1650091
1249 Ga0436360_0936914
1250 Ga0436361_0474887
1251 Ga0436363_0142574
1252 Ga0436363_0445240
1253 Ga0436363_0709244
1254 Ga0436363_0793499
1255 Ga0436363_1050794
1256 Ga0436363_1089750
1257 Ga0436363_1106810
1258 Ga0436363_1357287
1259 Ga0436363_1644680
1260 Ga0436363_1705603
1261 Ga0436362_0310761
1262 Ga0436362_0626285
1263 Ga0436362_0906932
1264 Ga0451789_0720585
1265 Ga0451853_0030295
1266 Ga0451853_0468880
1267 Ga0439448_0226952
1268 Ga0450915_005259
1269 Ga0450888_003572
1270 Ga0466966_0220968
1271 Ga0466964_0423154
1272 Ga0466968_0034907
1273 Ga0466959_0199329
1274 Ga0466959_0298225
1275 Ga0466958_0108445
1276 Ga0466958_0311555
1277 Ga0466967_0027714
1278 Ga0466967_0050202
1279 Ga0466967_0414128
1280 Ga0466967_0423638
1281 Ga0466967_0467108
1282 Ga0466967_0722272
1283 Ga0466967_1351463
1284 Ga0466967_2058120
1285 Ga0495592_0294649
1286 Ga0495592_0864191
1287 Ga0495603_0065347
1288 Ga0495603_0159578
1289 Ga0495603_0476065
1290 Ga0495629_0052587
1291 Ga0495641_0048719
1292 Ga0495641_0063736
1293 Ga0495641_0212455
1294 Ga0495651_0097342
1295 Ga0495653_0010293
1296 Ga0495653_0331423
1297 Ga0495653_0495249
1298 Ga0495580_0131021
1299 Ga0495582_0017805
1300 Ga0495582_0433986
1301 Ga0495582_0528047
1302 Ga0495639_0002417
1303 Ga0495639_0112290
1304 Ga0495662_0002132
1305 Ga0495662_0395879
1306 Ga0495664_0376426
1307 Ga0495585_0220687
1308 Ga0495594_0008788
1309 Ga0495608_0049917
1310 Ga0495608_0675439
1311 Ga0495618_0022487
1312 Ga0495618_0429057
1313 Ga0495620_0321827
1314 Ga0495628_0577172
1315 Ga0495630_0054473
1316 Ga0495666_0010114
1317 Ga0495652_0097601
1318 Ga0495652_0136672
1319 Ga0495665_0001629
1320 Ga0495640_0519470
1321 Ga0495640_0607476
1322 Ga0495587_0563144
1323 Ga0495667_0009327
1324 Ga0495656_0327837
1325 Ga0495656_0492103
1326 Ga0495668_0437180
1327 Ga0495634_0012006
1328 Ga0495635_0022073
1329 Ga0495588_0075512
1330 Ga0495657_0013747
1331 Ga0495599_0375291
1332 Ga0495599_0879588
1333 Ga0495623_0098773
1334 Ga0495646_0564020
1335 Ga0495646_0577311
1336 Ga0495647_0000590
1337 Ga0495658_0279153
1338 Ga0495613_0015895
1339 Ga0495624_0023602
1340 Ga0495624_0895062
1341 Ga0495624_0953726
1342 Ga0495670_0533288
1343 Ga0495589_0459147
1344 Ga0495600_0043352
1345 Ga0495600_0045946
1346 Ga0495581_0005143
1347 Ga0495581_0663290
1348 Ga0495604_0052658
1349 Ga0495674_0003550
1350 Ga0495674_1451571
1351 Ga0495676_0030243
1352 Ga0495676_0158256
1353 Ga0495680_0017614
1354 Ga0495675_0016700
1355 Ga0495684_0006150
1356 Ga0495593_0025452
1357 Ga0495593_0261004
1358 Ga0495602_1028565
1359 Ga0495614_0021631
1360 Ga0495615_0162911
1361 Ga0496100_0002592
1362 Ga0496100_0124538
1363 Ga0496100_0204058
1364 Ga0496100_0346083
1365 Ga0496100_0583548
1366 Ga0496100_1352830
1367 Ga0496101_0006496
1368 Ga0496101_0018561
1369 Ga0496101_0060214
1370 Ga0496101_0187915
1371 Ga0496102_0002361
1372 Ga0496102_0004122
1373 Ga0496102_0053118
1374 Ga0496102_0179746
1375 Ga0496102_0186797
1376 Ga0496102_0202924
1377 Ga0496102_0700877
1378 Ga0496102_1163889
1379 Ga0496102_1803528
1380 Ga0496103_0000900
1381 Ga0496103_0261985
1382 Ga0496103_0519329
1383 Ga0496103_0700006
1384 Ga0496103_0793104
1385 Ga0496104_0002813
1386 Ga0496104_0016977
1387 Ga0496104_0035622
1388 Ga0496104_0039310
1389 Ga0496104_0516501
1390 Ga0496104_1693459
1391 Ga0496105_0009674
1392 Ga0496105_0033357
1393 Ga0496105_0675332
1394 Ga0496106_0004546
1395 Ga0496106_0046292
1396 Ga0496106_0052832
1397 Ga0496107_0004168
1398 Ga0496107_0028545
1399 Ga0496107_0036418
1400 Ga0496108_0025064
1401 Ga0496108_0095159
1402 Ga0496108_0332200
1403 Ga0496109_0000999
1404 Ga0496109_0050806
1405 Ga0496109_0063573
1406 Ga0496109_0338547
1407 Ga0496109_1084782
1408 Ga0496110_0001024
1409 Ga0496110_0027449
1410 Ga0496110_0621833
1411 Ga0496110_1369135
1412 Ga0496111_0005422
1413 Ga0496111_0027704
1414 Ga0496111_0532315
1415 Ga0496112_0021398
1416 Ga0496112_0101937
1417 Ga0496112_0482719
1418 Ga0496112_1736120
1419 Ga0496113_0010790
1420 Ga0496113_0925846
1421 Ga0496113_1187655
1422 Ga0496114_0020808
1423 Ga0496114_0045492
1424 Ga0496114_0046951
1425 Ga0496114_0380887
1426 Ga0496114_1145004
1427 Ga0496115_0009605
1428 Ga0496115_0011122
1429 Ga0496115_0028400
1430 Ga0496115_0056933
1431 Ga0496115_0978589
1432 Ga0501031_0098080
1433 Ga0501033_0178223
1434 Ga0501034_0374862
1435 Ga0501036_0088604
1436 Ga0501036_0270575
1437 Ga0501037_0221816
1438 Ga0501039_0257285
1439 Ga0501040_0091518
1440 Ga0501040_0494696
1441 Ga0501041_0014031
1442 Ga0501041_0258216
1443 Ga0501042_0095351
1444 Ga0501042_0110522
1445 Ga0501042_1073303
1446 Ga0501046_0140512
1447 Ga0501046_0235187
1448 Ga0501046_0527766
1449 Ga0501048_0078076
1450 Ga0501048_0110944
1451 Ga0501048_0227513
1452 Ga0501048_0312538
1453 Ga0501068_0482102
1454 Ga0501068_1059695
1455 Ga0501069_0604575
1456 Ga0501070_0238078
1457 Ga0501071_0051006
1458 Ga0501071_0073172
1459 Ga0501071_0826770
1460 Ga0501071_1093476
1461 Ga0501072_0180744
1462 Ga0501072_0376088
1463 Ga0501072_0408109
1464 Ga0501074_0043550
1465 Ga0501074_0230281
1466 Ga0501074_0587014
1467 Ga0501075_0043708
1468 Ga0501076_0019050
1469 Ga0501076_0121921
1470 Ga0501076_0621237
1471 Ga0501077_0111146
1472 Ga0501077_0423794
1473 Ga0501079_0198164
1474 Ga0501079_0711593
1475 Ga0501080_0226217
1476 Ga0501080_0346554
1477 Ga0501081_0064875
1478 Ga0501081_0290905
1479 Ga0501081_0291723
1480 Ga0501081_1080571
1481 Ga0501083_0137141
1482 Ga0501045_0114345
1483 Ga0501045_0279007
1484 nmdc:mga03683_8898_c1
1485 nmdc:mga03n38_194074_c1
1486 nmdc:mga03n38_789519_c1
1487 nmdc:mga00v17_14620_c1
1488 nmdc:mga05p37_1203412_c1
1489 nmdc:mga05p37_1393678_c1
1490 nmdc:mga05p37_2045321_c1
1491 nmdc:mga05p37_873857_c1
1492 nmdc:mga09592_126603_c1
1493 nmdc:mga09592_874732_c1
1494 nmdc:mga06r32_10365_c1
1495 nmdc:mga06r32_131044_c1
1496 nmdc:mga06r32_190835_c1
1497 nmdc:mga08y16_1073349_c1
1498 nmdc:mga08y16_147968_c1
1499 nmdc:mga08y16_21380_c1
1500 nmdc:mga08y16_60559_c1
1501 nmdc:mga08y16_723813_c1
1502 nmdc:mga0n895_2012500_c1
1503 nmdc:mga0n895_468166_c1
1504 nmdc:mga0n895_74928_c1
1505 nmdc:mga0rr50_1498909_c1
1506 nmdc:mga0rr50_1712788_c1
1507 nmdc:mga08x19_161378_c1
1508 nmdc:mga08x19_899529_c1
1509 Ga0495601_0147897
1510 Ga0495612_0200639
1511 Ga0495595_0005295
1512 Ga0495595_0276020
1513 Ga0495619_0003931
1514 Ga0500616_0096673
1515 Ga0501084_0017709
1516 Ga0501084_0207082
1517 Ga0501084_0212016
1518 Ga0501082_0050508
1519 Ga0501082_0124883
1520 Ga0501082_0461896
1521 Ga0466962_0631453
1522 Ga0530510_0011028
1523 Ga0530510_0115082
1524 Ga0530510_0393201

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j8f-assembly1.cif.gz_A human mof k274p crystal structure 0.3687 33 56
1ggj-assembly1.cif.gz_C crystal structure of catalase hpii from escherichia coli, asn201ala variant. 0.2832 32 67
6ks5-assembly1.cif.gz_A crystal structure of legionella pneumophila deubiquitinase ceg23 0.187 20 56
5j8f-assembly1.cif.gz_A human mof k274p crystal structure 0.1684 33 56
1ggj-assembly1.cif.gz_C crystal structure of catalase hpii from escherichia coli, asn201ala variant. 0.1625 32 67
ID Description Score Start End Superfamily
af_Q5SVQ0_329_390_3.30.60.60 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;N-acetyl transferase-like 0.671 37 48 3.30.60.60
af_Q5ACY2_33_127_3.30.60.60 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;N-acetyl transferase-like 0.6276 35 48 3.30.60.60
af_Q8III2_323_384_3.30.60.60 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;N-acetyl transferase-like 0.4917 33 48 3.30.60.60
4dncB01 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;N-acetyl transferase-like 0.3168 20 56 3.30.60.60
af_U4PRX5_195_303_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.2672 17 78 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A838PHD1-F1-model_v4 Zinc finger/thioredoxin putative domain-containing protein 0.9575 1 80
AF-A0A7Y5X0S9-F1-model_v4 Uncharacterized protein 0.9574 1 75
AF-A0A1M3BK64-F1-model_v4 Uncharacterized protein 0.9047 6 79
AF-A0A838PHD1-F1-model_v4 Zinc finger/thioredoxin putative domain-containing protein 0.9021 1 80
AF-A0A062U2Q4-F1-model_v4 C2H2-type domain-containing protein 0.8725 1 75

Map