F479631

General Info

Members Datasets Scaffolds Average Seq Length
762 372 756 109

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10018962|Ga0207699_100189621
Length 128
Sequence MTTELLTDLTIFALAVLVGFEVISKVPATLHTPLMSGANSIHGVVLIGAMVITAAVSAPYAYVLGAVAMAFAAMNVVGGYVVTDRMLHMFRRRPAASLDLAHSHGRRNSQDVQMFLDLGCSWRRFVYT

Samples

Sample ID Description Type Environment
1 2527291627 Frankia casuarinae Thr Isolate Nodule
2 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
3 2684623036 Frankia sp. CgIM4 Isolate Nodule
4 2773857924 Frankia sp. CgIS1 Isolate Nodule
5 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
6 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
104 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
105 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
189 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
190 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
191 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
192 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
193 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
194 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
198 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
199 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
200 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
201 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
202 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
205 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
206 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
214 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
217 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
220 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
221 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
230 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
231 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
232 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
234 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
235 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
238 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
239 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
240 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
241 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
246 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
247 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
252 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
257 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
258 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
259 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
260 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
261 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
262 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
263 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
264 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
265 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
266 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
278 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
281 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
282 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
283 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
284 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
285 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
288 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
289 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
290 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
312 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
313 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
314 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
315 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
316 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
317 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
325 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
326 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
327 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
328 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
329 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
330 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
331 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
332 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
333 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
334 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
335 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
336 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
337 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
343 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
344 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
345 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
346 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
347 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
348 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
349 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
350 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
351 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
352 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
358 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
359 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
360 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
361 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
362 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
363 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
364 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
365 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
366 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
367 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
368 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
369 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
370 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
371 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
372 637000116 Frankia casuarinae CcI3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0.52
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.31
Nodule 0.52
Rhizoplane 7.22
Rhizosphere 87.14
Stem 0
Stem Tuber 0
Unclassified 3.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1023400 3300001978 Bacteria 682
2 JGI24743J22301_10153110 3300001991 Bacteria 517
3 JGI24745J21846_1038504 3300002073 Bacteria 589
4 JGI24742J22300_10082188 3300002244 Bacteria 610
5 JGI24751J29686_10042150 3300002459 Bacteria 944
6 Ga0070658_10473754 3300005327 Bacteria 1080
7 Ga0070658_11402803 3300005327 Bacteria 606
8 Ga0070676_10255187 3300005328 Bacteria 1172
9 Ga0070676_10613891 3300005328 Bacteria 786
10 Ga0070683_100177559 3300005329 Bacteria 2021
11 Ga0070683_100200707 3300005329 Bacteria 1894
12 Ga0070683_101859534 3300005329 Bacteria 579
13 Ga0070690_100037680 3300005330 Bacteria 3048
14 Ga0070670_101230925 3300005331 Bacteria 684
15 Ga0068869_100114110 3300005334 Bacteria 2059
16 Ga0070680_100000173 3300005336 Bacteria 41269
17 Ga0070680_100401817 3300005336 Bacteria 1168
18 Ga0070682_100364398 3300005337 Bacteria 1082
19 Ga0068868_100145338 3300005338 Bacteria 1949
20 Ga0068868_100360915 3300005338 Bacteria 1246
21 Ga0070689_100066074 3300005340 Bacteria 2817
22 Ga0070689_100323312 3300005340 Bacteria 1289
23 Ga0070691_10097668 3300005341 Bacteria 1455
24 Ga0070661_100036201 3300005344 Bacteria 3588
25 Ga0070661_100383838 3300005344 Bacteria 1108
26 Ga0070692_10016618 3300005345 Bacteria 3501
27 Ga0070692_11276762 3300005345 Bacteria 526
28 Ga0070669_100220714 3300005353 Bacteria 1499
29 Ga0070675_100003195 3300005354 Bacteria 12415
30 Ga0070675_100232228 3300005354 Bacteria 1609
31 Ga0070671_101218634 3300005355 Bacteria 663
32 Ga0070674_100003451 3300005356 Bacteria 8881
33 Ga0070674_100572353 3300005356 Bacteria 951
34 Ga0070674_101162177 3300005356 Bacteria 684
35 Ga0070673_100188355 3300005364 Bacteria 1771
36 Ga0070688_100053936 3300005365 Bacteria 2516
37 Ga0070659_100010996 3300005366 Bacteria 6683
38 Ga0070667_100367435 3300005367 Bacteria 1305
39 Ga0070709_10627848 3300005434 Bacteria 830
40 Ga0070714_100001186 3300005435 Bacteria 18758
41 Ga0070714_101164065 3300005435 Bacteria 752
42 Ga0070713_100280763 3300005436 Bacteria 1528
43 Ga0070713_101495781 3300005436 Bacteria 655
44 Ga0070710_10796291 3300005437 Bacteria 675
45 Ga0070701_10004477 3300005438 Bacteria 5668
46 Ga0070701_10640029 3300005438 Bacteria 709
47 Ga0070705_100124650 3300005440 Bacteria 1669
48 Ga0070705_100127636 3300005440 Bacteria 1654
49 Ga0070705_100222860 3300005440 Bacteria 1307
50 Ga0070705_100543001 3300005440 Bacteria 890
51 Ga0070705_101098226 3300005440 Bacteria 651
52 Ga0070700_100193487 3300005441 Bacteria 1424
53 Ga0070700_100218892 3300005441 Bacteria 1348
54 Ga0070694_100074556 3300005444 Bacteria 2345
55 Ga0070694_100138455 3300005444 Bacteria 1765
56 Ga0070694_100405529 3300005444 Bacteria 1068
57 Ga0070694_101779322 3300005444 Bacteria 525
58 Ga0070708_100038454 3300005445 Bacteria 4180
59 Ga0070708_101267220 3300005445 Bacteria 689
60 Ga0070708_102055054 3300005445 Bacteria 529
61 Ga0070663_100603088 3300005455 Bacteria 924
62 Ga0070663_100749357 3300005455 Bacteria 834
63 Ga0070678_100104420 3300005456 Bacteria 2203
64 Ga0070678_100297911 3300005456 Bacteria 1369
65 Ga0070678_101666027 3300005456 Bacteria 600
66 Ga0070662_100078511 3300005457 Bacteria 2452
67 Ga0068867_100169807 3300005459 Bacteria 1726
68 Ga0068867_102421492 3300005459 Bacteria 500
69 Ga0070685_10027087 3300005466 Bacteria 3165
70 Ga0070706_100000600 3300005467 Bacteria 41740
71 Ga0070706_100217714 3300005467 Bacteria 1782
72 Ga0070707_100004383 3300005468 Bacteria 13213
73 Ga0070707_100420595 3300005468 Bacteria 1297
74 Ga0070707_100762923 3300005468 Bacteria 931
75 Ga0070707_101115226 3300005468 Bacteria 755
76 Ga0070707_101168254 3300005468 Bacteria 736
77 Ga0070698_100361535 3300005471 Bacteria 1383
78 Ga0070698_100369777 3300005471 Bacteria 1366
79 Ga0070698_100749695 3300005471 Bacteria 919
80 Ga0070698_102112350 3300005471 Bacteria 517
81 Ga0070699_100047696 3300005518 Bacteria 3706
82 Ga0070699_100185627 3300005518 Bacteria 1846
83 Ga0070699_100499335 3300005518 Bacteria 1105
84 Ga0070699_100884803 3300005518 Bacteria 818
85 Ga0070679_100198519 3300005530 Bacteria 1973
86 Ga0070684_100349190 3300005535 Bacteria 1360
87 Ga0070697_100105933 3300005536 Bacteria 2339
88 Ga0070697_100166236 3300005536 Bacteria 1865
89 Ga0070697_100187932 3300005536 Bacteria 1753
90 Ga0070697_100366041 3300005536 Bacteria 1247
91 Ga0070697_100409857 3300005536 Bacteria 1177
92 Ga0070697_100994137 3300005536 Bacteria 746
93 Ga0070672_100405098 3300005543 Bacteria 1170
94 Ga0070672_100618225 3300005543 Bacteria 945
95 Ga0070672_101202128 3300005543 Bacteria 675
96 Ga0070686_100072419 3300005544 Bacteria 2259
97 Ga0070686_100126178 3300005544 Bacteria 1764
98 Ga0070686_100187324 3300005544 Bacteria 1474
99 Ga0070686_100312082 3300005544 Bacteria 1170
100 Ga0070695_100003885 3300005545 Bacteria 8718
101 Ga0070696_100003098 3300005546 Bacteria 11060
102 Ga0070696_100085253 3300005546 Bacteria 2242
103 Ga0070696_100098053 3300005546 Bacteria 2096
104 Ga0070696_100267424 3300005546 Bacteria 1299
105 Ga0070696_101348758 3300005546 Bacteria 607
106 Ga0070693_100675093 3300005547 Bacteria 754
107 Ga0070693_100758259 3300005547 Bacteria 716
108 Ga0070665_100010070 3300005548 Bacteria 9569
109 Ga0070665_100033640 3300005548 Bacteria 5157
110 Ga0070665_100192169 3300005548 Bacteria 2042
111 Ga0070665_102271418 3300005548 Bacteria 546
112 Ga0070704_100175309 3300005549 Bacteria 1710
113 Ga0070704_100266781 3300005549 Bacteria 1412
114 Ga0068855_100009172 3300005563 Bacteria 11949
115 Ga0068855_100495608 3300005563 Bacteria 1328
116 Ga0070664_100207918 3300005564 Bacteria 1748
117 Ga0070664_102023982 3300005564 Bacteria 547
118 Ga0068857_100060936 3300005577 Bacteria 3352
119 Ga0068854_100007587 3300005578 Bacteria 6936
120 Ga0068854_100050725 3300005578 Bacteria 2971
121 Ga0068854_100073114 3300005578 Bacteria 2512
122 Ga0068854_100927683 3300005578 Bacteria 767
123 Ga0068856_100209416 3300005614 Bacteria 1965
124 Ga0068856_101582146 3300005614 Bacteria 669
125 Ga0070702_100034963 3300005615 Bacteria 2774
126 Ga0070702_100438474 3300005615 Bacteria 944
127 Ga0068852_100269854 3300005616 Bacteria 1637
128 Ga0068852_100272016 3300005616 Bacteria 1630
129 Ga0068852_102334760 3300005616 Bacteria 556
130 Ga0068859_100014708 3300005617 Bacteria 7863
131 Ga0068864_100619603 3300005618 Bacteria 1051
132 Ga0068864_101743908 3300005618 Bacteria 628
133 Ga0068866_10058423 3300005718 Bacteria 1992
134 Ga0068861_100788669 3300005719 Bacteria 891
135 Ga0068870_10635229 3300005840 Bacteria 729
136 Ga0068863_100119652 3300005841 Bacteria 2510
137 Ga0068863_100176763 3300005841 Bacteria 2049
138 Ga0068863_100942310 3300005841 Bacteria 865
139 Ga0068858_100041760 3300005842 Bacteria 4252
140 Ga0068858_100074755 3300005842 Bacteria 3147
141 Ga0068858_100106444 3300005842 Bacteria 2618
142 Ga0068858_100784991 3300005842 Bacteria 929
143 Ga0068860_100621775 3300005843 Bacteria 1087
144 Ga0068860_101304215 3300005843 Bacteria 747
145 Ga0068862_100891559 3300005844 Bacteria 874
146 Ga0075365_10063862 3300006038 Bacteria 2465
147 Ga0070715_10248645 3300006163 Bacteria 928
148 Ga0070715_10317337 3300006163 Bacteria 840
149 Ga0097621_100515450 3300006237 Bacteria 1085
150 Ga0097621_100637377 3300006237 Bacteria 977
151 Ga0068871_101420216 3300006358 Bacteria 654
152 Ga0068871_102086601 3300006358 Bacteria 540
153 Ga0075428_100161554 3300006844 Bacteria 2431
154 Ga0075431_100305488 3300006847 Bacteria 1607
155 Ga0075433_10247530 3300006852 Bacteria 1582
156 Ga0075434_100259178 3300006871 Bacteria 1758
157 Ga0075434_101285209 3300006871 Bacteria 743
158 Ga0068865_100173369 3300006881 Bacteria 1655
159 Ga0068865_102107785 3300006881 Bacteria 513
160 Ga0097620_100014708 3300006931 Bacteria 7863
161 Ga0097620_101664502 3300006931 Bacteria 705
162 Ga0075435_100581200 3300007076 Bacteria 971
163 Ga0075435_101136725 3300007076 Bacteria 683
164 Ga0105244_10064083 3300009036 Bacteria 1845
165 Ga0105240_10694343 3300009093 Bacteria 1111
166 Ga0105240_11151478 3300009093 Bacteria 823
167 Ga0111539_10065305 3300009094 Bacteria 4301
168 Ga0111539_10102438 3300009094 Bacteria 3360
169 Ga0111539_10134033 3300009094 Bacteria 2900
170 Ga0111539_12691021 3300009094 Bacteria 577
171 Ga0105245_10281584 3300009098 Bacteria 1625
172 Ga0105245_10945336 3300009098 Bacteria 905
173 Ga0105245_11002706 3300009098 Bacteria 879
174 Ga0105245_11106658 3300009098 Bacteria 839
175 Ga0105247_10127638 3300009101 Bacteria 1654
176 Ga0105247_10129474 3300009101 Bacteria 1643
177 Ga0114129_10291584 3300009147 Bacteria 2177
178 Ga0114129_10322791 3300009147 Bacteria 2052
179 Ga0114129_10469717 3300009147 Bacteria 1647
180 Ga0105243_10012149 3300009148 Bacteria 6509
181 Ga0105243_10521671 3300009148 Bacteria 1130
182 Ga0105243_12348920 3300009148 Unclassified 571
183 Ga0105241_10001574 3300009174 Bacteria 17467
184 Ga0105241_10285007 3300009174 Bacteria 1412
185 Ga0105241_10708312 3300009174 Bacteria 920
186 Ga0105242_10017160 3300009176 Bacteria 5637
187 Ga0105242_10254328 3300009176 Bacteria 1584
188 Ga0105242_10551471 3300009176 Bacteria 1105
189 Ga0105242_11587573 3300009176 Bacteria 687
190 Ga0105248_10045858 3300009177 Bacteria 4900
191 Ga0105248_10055704 3300009177 Bacteria 4436
192 Ga0105237_10658030 3300009545 Bacteria 1054
193 Ga0105237_11822945 3300009545 Bacteria 616
194 Ga0105238_10008792 3300009551 Bacteria 10106
195 Ga0105238_10032490 3300009551 Bacteria 5311
196 Ga0105238_11889610 3300009551 Bacteria 630
197 Ga0105238_12324891 3300009551 Bacteria 571
198 Ga0105249_10009446 3300009553 Bacteria 8540
199 Ga0105249_12682137 3300009553 Bacteria 570
200 Ga0099796_10037250 3300010159 Bacteria 1625
201 Ga0105239_10032267 3300010375 Bacteria 5756
202 Ga0105239_10077529 3300010375 Bacteria 3657
203 Ga0105239_10887695 3300010375 Bacteria 1023
204 Ga0105239_12717477 3300010375 Bacteria 578
205 Ga0105246_10344241 3300011119 Bacteria 1219
206 Ga0105246_10758612 3300011119 Bacteria 857
207 Ga0157318_1015878 3300012482 Bacteria 620
208 Ga0157337_1011631 3300012483 Bacteria 698
209 Ga0157314_1047316 3300012500 Bacteria 539
210 Ga0157373_10703448 3300013100 Bacteria 741
211 Ga0157371_10623866 3300013102 Bacteria 803
212 Ga0157371_11356223 3300013102 Bacteria 551
213 Ga0157374_10320086 3300013296 Bacteria 1537
214 Ga0157374_10670941 3300013296 Bacteria 1049
215 Ga0157374_10884523 3300013296 Bacteria 911
216 Ga0157378_10235208 3300013297 Bacteria 1748
217 Ga0157378_10240813 3300013297 Bacteria 1728
218 Ga0157378_11755589 3300013297 Bacteria 668
219 Ga0163162_10014545 3300013306 Bacteria 7690
220 Ga0163162_10203360 3300013306 Bacteria 2110
221 Ga0163162_10994652 3300013306 Bacteria 948
222 Ga0157372_11620060 3300013307 Bacteria 745
223 Ga0157375_10119364 3300013308 Bacteria 2745
224 Ga0157375_11302548 3300013308 Bacteria 854
225 Ga0163163_10055263 3300014325 Bacteria 3924
226 Ga0163163_12432360 3300014325 Bacteria 582
227 Ga0157380_10026353 3300014326 Bacteria 4413
228 Ga0157380_10664514 3300014326 Bacteria 1042
229 Ga0157380_11987813 3300014326 Bacteria 643
230 Ga0157377_10015266 3300014745 Bacteria 3924
231 Ga0157379_10069686 3300014968 Bacteria 3146
232 Ga0157379_10076655 3300014968 Bacteria 2994
233 Ga0157379_10138620 3300014968 Bacteria 2192
234 Ga0157379_10354370 3300014968 Bacteria 1344
235 Ga0157379_10648118 3300014968 Bacteria 989
236 Ga0157379_10934432 3300014968 Bacteria 824
237 Ga0157376_10205467 3300014969 Bacteria 1815
238 Ga0157376_10790416 3300014969 Bacteria 961
239 Ga0163161_10035856 3300017792 Bacteria 3551
240 Ga0163161_10322340 3300017792 Bacteria 1222
241 Ga0163161_10701708 3300017792 Bacteria 842
242 Ga0163161_10967421 3300017792 Bacteria 725
243 Ga0206356_11816342 3300020070 Bacteria 520
244 Ga0207656_10241787 3300025321 Bacteria 882
245 Ga0207655_1164228 3300025728 Bacteria 691
246 Ga0207682_10084185 3300025893 Bacteria 1368
247 Ga0207692_10657733 3300025898 Bacteria 677
248 Ga0207692_10736018 3300025898 Bacteria 642
249 Ga0207642_10043856 3300025899 Bacteria 1976
250 Ga0207710_10343007 3300025900 Bacteria 760
251 Ga0207688_10034995 3300025901 Bacteria 2782
252 Ga0207688_10885733 3300025901 Bacteria 565
253 Ga0207680_10040440 3300025903 Bacteria 2713
254 Ga0207680_10380313 3300025903 Bacteria 995
255 Ga0207647_10002717 3300025904 Bacteria 13365
256 Ga0207685_10205343 3300025905 Bacteria 928
257 Ga0207699_10018962 3300025906 Bacteria 3657
258 Ga0207645_10060142 3300025907 Bacteria 2426
259 Ga0207645_10456544 3300025907 Bacteria 863
260 Ga0207643_10006292 3300025908 Bacteria 6356
261 Ga0207684_10000496 3300025910 Bacteria 49956
262 Ga0207684_10171173 3300025910 Bacteria 1872
263 Ga0207684_10604758 3300025910 Bacteria 936
264 Ga0207707_10578243 3300025912 Bacteria 952
265 Ga0207707_11325135 3300025912 Bacteria 577
266 Ga0207695_10002678 3300025913 Bacteria 26007
267 Ga0207671_10001035 3300025914 Bacteria 33836
268 Ga0207660_10000004 3300025917 Bacteria 371608
269 Ga0207660_10314339 3300025917 Bacteria 1250
270 Ga0207660_11357618 3300025917 Bacteria 576
271 Ga0207662_10000807 3300025918 Bacteria 14429
272 Ga0207662_10418128 3300025918 Bacteria 912
273 Ga0207657_10011341 3300025919 Bacteria 8851
274 Ga0207657_10145625 3300025919 Bacteria 1932
275 Ga0207649_10172487 3300025920 Bacteria 1508
276 Ga0207652_10601970 3300025921 Bacteria 985
277 Ga0207646_10002151 3300025922 Bacteria 23529
278 Ga0207646_10335464 3300025922 Bacteria 1366
279 Ga0207646_11019218 3300025922 Bacteria 731
280 Ga0207681_10055582 3300025923 Bacteria 2697
281 Ga0207694_10001558 3300025924 Bacteria 19464
282 Ga0207694_10831381 3300025924 Bacteria 780
283 Ga0207650_11035775 3300025925 Bacteria 698
284 Ga0207659_10237984 3300025926 Bacteria 1471
285 Ga0207659_10641601 3300025926 Bacteria 907
286 Ga0207687_10200819 3300025927 Bacteria 1558
287 Ga0207687_10230182 3300025927 Bacteria 1464
288 Ga0207687_10492345 3300025927 Bacteria 1022
289 Ga0207687_11164835 3300025927 Bacteria 662
290 Ga0207700_11271457 3300025928 Bacteria 656
291 Ga0207700_11573324 3300025928 Bacteria 582
292 Ga0207664_10000733 3300025929 Bacteria 22277
293 Ga0207664_10883369 3300025929 Bacteria 803
294 Ga0207664_11796293 3300025929 Bacteria 536
295 Ga0207644_10942352 3300025931 Bacteria 724
296 Ga0207690_10909209 3300025932 Bacteria 730
297 Ga0207690_11541090 3300025932 Bacteria 556
298 Ga0207706_10198270 3300025933 Bacteria 1761
299 Ga0207706_10334565 3300025933 Bacteria 1317
300 Ga0207686_10421994 3300025934 Bacteria 1020
301 Ga0207709_10041173 3300025935 Bacteria 2771
302 Ga0207709_10051472 3300025935 Bacteria 2525
303 Ga0207709_10053264 3300025935 Bacteria 2489
304 Ga0207669_10256886 3300025937 Bacteria 1304
305 Ga0207669_10666941 3300025937 Bacteria 852
306 Ga0207669_10697621 3300025937 Bacteria 834
307 Ga0207704_10076829 3300025938 Bacteria 2141
308 Ga0207665_10234650 3300025939 Bacteria 1349
309 Ga0207665_10319073 3300025939 Bacteria 1165
310 Ga0207691_10014085 3300025940 Bacteria 7631
311 Ga0207711_10039731 3300025941 Bacteria 4002
312 Ga0207711_10060515 3300025941 Bacteria 3264
313 Ga0207711_10356493 3300025941 Bacteria 1355
314 Ga0207711_11468662 3300025941 Bacteria 625
315 Ga0207689_10150793 3300025942 Bacteria 1916
316 Ga0207661_11007865 3300025944 Bacteria 767
317 Ga0207679_10748864 3300025945 Bacteria 889
318 Ga0207679_11422441 3300025945 Bacteria 636
319 Ga0207667_10067774 3300025949 Bacteria 3717
320 Ga0207667_11564245 3300025949 Bacteria 629
321 Ga0207651_10936720 3300025960 Bacteria 772
322 Ga0207712_10075148 3300025961 Bacteria 2442
323 Ga0207712_10325362 3300025961 Bacteria 1270
324 Ga0207712_10994953 3300025961 Bacteria 744
325 Ga0207668_11605281 3300025972 Bacteria 587
326 Ga0207640_10413132 3300025981 Bacteria 1102
327 Ga0207640_10584725 3300025981 Bacteria 943
328 Ga0207640_10631669 3300025981 Bacteria 910
329 Ga0207640_10673922 3300025981 Bacteria 884
330 Ga0207658_10167464 3300025986 Bacteria 1807
331 Ga0207658_10338161 3300025986 Bacteria 1308
332 Ga0207658_10464909 3300025986 Bacteria 1122
333 Ga0207677_10145521 3300026023 Bacteria 1820
334 Ga0207677_10214014 3300026023 Bacteria 1541
335 Ga0207703_10068272 3300026035 Bacteria 2929
336 Ga0207703_10102022 3300026035 Bacteria 2434
337 Ga0207703_10546618 3300026035 Bacteria 1092
338 Ga0207703_11365014 3300026035 Bacteria 682
339 Ga0207703_12391518 3300026035 Bacteria 504
340 Ga0207678_10016986 3300026067 Bacteria 6388
341 Ga0207678_10211109 3300026067 Bacteria 1661
342 Ga0207708_10012643 3300026075 Bacteria 6294
343 Ga0207708_10063940 3300026075 Bacteria 2811
344 Ga0207708_10348701 3300026075 Bacteria 1214
345 Ga0207708_10827923 3300026075 Bacteria 798
346 Ga0207702_10178238 3300026078 Bacteria 1955
347 Ga0207702_10202907 3300026078 Bacteria 1839
348 Ga0207702_12278449 3300026078 Bacteria 530
349 Ga0207641_10111922 3300026088 Bacteria 2421
350 Ga0207641_10143771 3300026088 Bacteria 2155
351 Ga0207641_10206605 3300026088 Bacteria 1814
352 Ga0207641_12365955 3300026088 Bacteria 530
353 Ga0207648_10003395 3300026089 Bacteria 16717
354 Ga0207648_11891179 3300026089 Bacteria 558
355 Ga0207676_10111278 3300026095 Bacteria 2292
356 Ga0207676_10214975 3300026095 Bacteria 1708
357 Ga0207676_11543346 3300026095 Bacteria 661
358 Ga0207674_10007747 3300026116 Bacteria 12498
359 Ga0207674_10055881 3300026116 Bacteria 4011
360 Ga0207674_10964430 3300026116 Bacteria 821
361 Ga0207674_11309083 3300026116 Bacteria 694
362 Ga0207675_100085382 3300026118 Bacteria 2962
363 Ga0207675_101662603 3300026118 Bacteria 659
364 Ga0207683_10014880 3300026121 Bacteria 6625
365 Ga0207683_10372599 3300026121 Bacteria 1312
366 Ga0207698_10172103 3300026142 Bacteria 1908
367 Ga0207698_10216227 3300026142 Bacteria 1728
368 Ga0207698_10850647 3300026142 Bacteria 917
369 Ga0209971_1087954 3300027682 Bacteria 758
370 Ga0209966_1011294 3300027695 Bacteria 1627
371 Ga0209998_10008391 3300027717 Bacteria 2141
372 Ga0209998_10095094 3300027717 Bacteria 734
373 Ga0209974_10118171 3300027876 Bacteria 938
374 Ga0207428_10146583 3300027907 Bacteria 1799
375 Ga0207428_10253923 3300027907 Bacteria 1310
376 Ga0268266_10143106 3300028379 Bacteria 2147
377 Ga0268266_10247707 3300028379 Bacteria 1647
378 Ga0268266_10992179 3300028379 Bacteria 813
379 Ga0268264_10382876 3300028381 Bacteria 1347
380 Ga0268264_10909151 3300028381 Bacteria 884
381 Ga0265337_1039898 3300028556 Bacteria 1355
382 Ga0265326_10003161 3300028558 Bacteria 5446
383 Ga0265319_1001156 3300028563 Bacteria 16342
384 Ga0265319_1015996 3300028563 Bacteria 2885
385 Ga0265334_10016320 3300028573 Bacteria 3073
386 Ga0265318_10121249 3300028577 Bacteria 961
387 Ga0265318_10225363 3300028577 Bacteria 684
388 Ga0265336_10013855 3300028666 Bacteria 2682
389 Ga0265336_10062722 3300028666 Bacteria 1114
390 Ga0307517_10348330 3300028786 Bacteria 806
391 Ga0307515_10000683 3300028794 Bacteria 78103
392 Ga0265338_10009994 3300028800 Bacteria 11219
393 Ga0265338_10207024 3300028800 Bacteria 1475
394 Ga0265324_10006133 3300029957 Bacteria 5070
395 Ga0265324_10163919 3300029957 Bacteria 755
396 Ga0307511_10003768 3300030521 Bacteria 15513
397 Ga0307511_10151153 3300030521 Bacteria 1332
398 Ga0307512_10061587 3300030522 Bacteria 2888
399 Ga0265332_10040657 3300031238 Bacteria 2012
400 Ga0265328_10021757 3300031239 Bacteria 2445
401 Ga0265320_10006501 3300031240 Bacteria 7362
402 Ga0265320_10277518 3300031240 Bacteria 742
403 Ga0265320_10564853 3300031240 Bacteria 503
404 Ga0265325_10067177 3300031241 Bacteria 1807
405 Ga0265329_10168423 3300031242 Bacteria 714
406 Ga0265340_10003591 3300031247 Bacteria 8727
407 Ga0265339_10365160 3300031249 Bacteria 678
408 Ga0265339_10386964 3300031249 Bacteria 655
409 Ga0265331_10037731 3300031250 Bacteria 2364
410 Ga0265316_10025415 3300031344 Bacteria 4942
411 Ga0307509_10963490 3300031507 Bacteria 519
412 Ga0307408_100379632 3300031548 Bacteria 1208
413 Ga0265313_10073106 3300031595 Bacteria 1574
414 Ga0307508_10040458 3300031616 Bacteria 4185
415 Ga0307508_10058649 3300031616 Bacteria 3406
416 Ga0307508_10487004 3300031616 Bacteria 827
417 Ga0307508_10507405 3300031616 Bacteria 801
418 Ga0307508_10779931 3300031616 Bacteria 571
419 Ga0307514_10140355 3300031649 Bacteria 1644
420 Ga0307514_10281218 3300031649 Bacteria 952
421 Ga0316575_10000050 3300031665 Bacteria 29877
422 Ga0316575_10107170 3300031665 Bacteria 1139
423 Ga0265314_10000238 3300031711 Bacteria 81055
424 Ga0316576_10000982 3300031727 Bacteria 14643
425 Ga0316576_10139740 3300031727 Bacteria 1823
426 Ga0316576_10497512 3300031727 Bacteria 897
427 Ga0316576_10722828 3300031727 Bacteria 720
428 Ga0316578_10101077 3300031728 Bacteria 1729
429 Ga0316578_10114247 3300031728 Bacteria 1622
430 Ga0316578_10139143 3300031728 Bacteria 1462
431 Ga0307516_10068665 3300031730 Bacteria 3412
432 Ga0307405_10049727 3300031731 Bacteria 2593
433 Ga0307405_10897459 3300031731 Bacteria 749
434 Ga0316577_10244198 3300031733 Bacteria 1016
435 Ga0307518_10005430 3300031838 Bacteria 9116
436 Ga0307518_10018700 3300031838 Bacteria 4972
437 Ga0307410_10803152 3300031852 Bacteria 800
438 Ga0307406_10497429 3300031901 Bacteria 988
439 Ga0307406_10854504 3300031901 Bacteria 772
440 Ga0307407_10907581 3300031903 Bacteria 676
441 Ga0307412_10059107 3300031911 Bacteria 2568
442 Ga0307412_10268393 3300031911 Bacteria 1334
443 Ga0307416_100016705 3300032002 Bacteria 5110
444 Ga0307416_100250504 3300032002 Bacteria 1723
445 Ga0307416_100527406 3300032002 Bacteria 1250
446 Ga0307416_102029044 3300032002 Bacteria 678
447 Ga0307411_10116734 3300032005 Bacteria 1922
448 Ga0307415_100044616 3300032126 Bacteria 2965
449 Ga0307415_100353083 3300032126 Bacteria 1238
450 Ga0307415_102377229 3300032126 Bacteria 521
451 Ga0316583_10166750 3300032133 Bacteria 766
452 Ga0316585_10224617 3300032137 Bacteria 622
453 Ga0316580_10096700 3300032139 Bacteria 904
454 Ga0316593_10353738 3300032168 Bacteria 562
455 Ga0307507_10006176 3300033179 Bacteria 18695
456 Ga0307507_10027402 3300033179 Bacteria 6108
457 Ga0307510_10280271 3300033180 Bacteria 1138
458 Ga0307510_10306937 3300033180 Bacteria 1047
459 Ga0316592_1085684 3300033524 Bacteria 719
460 Ga0316596_1166618 3300033541 Bacteria 608
461 Ga0373938_0044612 3300034957 Bacteria 995
462 Ga0373940_0095386 3300035088 Bacteria 897
463 Ga0373952_0274811 3300035092 Bacteria 517
464 Ga0373932_0415318 3300035112 Bacteria 523
465 Ga0373960_0047630 3300035121 Bacteria 1262
466 Ga0373943_0658858 3300035170 Bacteria 619
467 Ga0373946_0078991 3300035171 Bacteria 1437
468 Ga0373955_0690990 3300035172 Bacteria 626
469 Ga0373942_0085696 3300035207 Bacteria 942
470 Ga0316574_0015600 3300035398 Bacteria 4411
471 Ga0316574_0019409 3300035398 Bacteria 4010
472 Ga0316574_0082405 3300035398 Bacteria 2044
473 Ga0316574_0086948 3300035398 Bacteria 1990
474 Ga0316574_0667961 3300035398 Bacteria 639
475 Ga0373924_0477039 3300035410 Bacteria 560
476 Ga0373935_0129286 3300035692 Bacteria 1696
477 Ga0373927_0580503 3300035695 Bacteria 741
478 Ga0373937_0072933 3300036401 Bacteria 3167
479 Ga0373937_0384141 3300036401 Bacteria 1332
480 Ga0316582_0173148 3300036647 Bacteria 1466
481 Ga0316582_0591730 3300036647 Bacteria 764
482 Ga0316584_0289517 3300036712 Bacteria 1188
483 Ga0316584_0304095 3300036712 Bacteria 1154
484 Ga0316584_0398943 3300036712 Bacteria 980
485 Ga0316584_0435467 3300036712 Bacteria 929
486 Ga0316584_0934763 3300036712 Bacteria 582
487 Ga0373925_0000592 3300037068 Bacteria 34869
488 Ga0373925_0163307 3300037068 Bacteria 1755
489 Ga0373925_0434024 3300037068 Bacteria 1074
490 Ga0395905_0327441 3300037471 Bacteria 1422
491 Ga0395901_0581964 3300038443 Bacteria 1131
492 Ga0395901_1530866 3300038443 Bacteria 622
493 Ga0439466_0216242 3300041411 Bacteria 582
494 Ga0451798_0825340 3300041458 Bacteria 1056
495 Ga0451800_0796850 3300041459 Bacteria 681
496 Ga0451837_1057628 3300041494 Bacteria 501
497 Ga0451837_1234475 3300041494 Bacteria 1356
498 Ga0451839_0442632 3300041496 Bacteria 963
499 Ga0451839_1545375 3300041496 Bacteria 598
500 Ga0451841_0063569 3300041498 Bacteria 2404
501 Ga0439433_0212924 3300041999 Bacteria 513
502 Ga0450915_004053 3300042119 Bacteria 854
503 Ga0450910_028688 3300042147 Bacteria 866
504 Ga0439446_0093833 3300042156 Bacteria 942
505 Ga0439446_0163505 3300042156 Bacteria 737
506 Ga0439435_0030145 3300042436 Bacteria 1469
507 Ga0466963_0099048 3300044694 Bacteria 1993
508 Ga0466967_0010351 3300045976 Bacteria 6991
509 Ga0495592_0147712 3300046454 Bacteria 1628
510 Ga0495592_0158469 3300046454 Bacteria 1559
511 Ga0495592_0376791 3300046454 Bacteria 904
512 Ga0495629_0021206 3300046459 Bacteria 4637
513 Ga0495629_0023689 3300046459 Bacteria 4372
514 Ga0495629_0856717 3300046459 Bacteria 597
515 Ga0495638_0171655 3300046460 Bacteria 1244
516 Ga0495641_0207838 3300046461 Bacteria 878
517 Ga0495641_0417989 3300046461 Bacteria 609
518 Ga0495651_0021759 3300046462 Bacteria 4985
519 Ga0495651_0030166 3300046462 Bacteria 4228
520 Ga0495653_0010595 3300046463 Bacteria 7548
521 Ga0495653_0207175 3300046463 Bacteria 1327
522 Ga0495653_0229507 3300046463 Bacteria 1243
523 Ga0495653_0270366 3300046463 Bacteria 1120
524 Ga0495580_0109836 3300046472 Bacteria 1915
525 Ga0495582_0110081 3300046473 Bacteria 1547
526 Ga0495662_0001754 3300046476 Bacteria 10840
527 Ga0495662_0015654 3300046476 Bacteria 3680
528 Ga0495662_0321393 3300046476 Bacteria 761
529 Ga0495662_0528742 3300046476 Bacteria 578
530 Ga0495664_0003407 3300046477 Bacteria 8641
531 Ga0495664_0004375 3300046477 Bacteria 7728
532 Ga0495664_0953528 3300046477 Bacteria 500
533 Ga0495594_0045213 3300046499 Bacteria 2417
534 Ga0495594_0059562 3300046499 Bacteria 2112
535 Ga0495594_0535746 3300046499 Bacteria 665
536 Ga0495607_0515629 3300046501 Bacteria 529
537 Ga0495608_0006200 3300046511 Bacteria 8485
538 Ga0495608_0121987 3300046511 Bacteria 1671
539 Ga0495608_0485690 3300046511 Bacteria 749
540 Ga0495618_0049381 3300046514 Bacteria 2657
541 Ga0495618_0302571 3300046514 Bacteria 994
542 Ga0495618_0649070 3300046514 Bacteria 624
543 Ga0495628_0007270 3300046516 Bacteria 9593
544 Ga0495628_0123063 3300046516 Bacteria 1988
545 Ga0495628_0269161 3300046516 Bacteria 1268
546 Ga0495628_0734857 3300046516 Bacteria 695
547 Ga0495628_0819790 3300046516 Bacteria 650
548 Ga0495630_0054035 3300046517 Bacteria 3008
549 Ga0495630_0064963 3300046517 Bacteria 2742
550 Ga0495630_0217352 3300046517 Bacteria 1459
551 Ga0495630_0370702 3300046517 Bacteria 1096
552 Ga0495666_0000608 3300046526 Bacteria 16058
553 Ga0495666_0065863 3300046526 Bacteria 1728
554 Ga0495666_0110388 3300046526 Bacteria 1292
555 Ga0495666_0297184 3300046526 Bacteria 731
556 Ga0495652_0030799 3300046529 Bacteria 4702
557 Ga0495652_0037620 3300046529 Bacteria 4196
558 Ga0495652_0256376 3300046529 Bacteria 1294
559 Ga0495652_0798606 3300046529 Bacteria 628
560 Ga0495665_0027860 3300046531 Bacteria 3032
561 Ga0495665_0498206 3300046531 Bacteria 614
562 Ga0495640_0384636 3300046533 Bacteria 863
563 Ga0495586_0070580 3300046535 Bacteria 1908
564 Ga0495586_0405346 3300046535 Bacteria 785
565 Ga0495586_0880687 3300046535 Bacteria 516
566 Ga0495587_0002309 3300046536 Bacteria 12768
567 Ga0495587_0024809 3300046536 Bacteria 3670
568 Ga0495587_0514485 3300046536 Bacteria 661
569 Ga0495645_0007004 3300046543 Bacteria 7840
570 Ga0495645_0040792 3300046543 Bacteria 3385
571 Ga0495645_0206782 3300046543 Bacteria 1328
572 Ga0495622_0058189 3300046557 Bacteria 1790
573 Ga0495622_0484333 3300046557 Bacteria 529
574 Ga0495667_0008989 3300046559 Bacteria 6788
575 Ga0495634_0001467 3300046642 Bacteria 20897
576 Ga0495634_0040289 3300046642 Bacteria 3177
577 Ga0495634_0644426 3300046642 Bacteria 612
578 Ga0495635_0008194 3300046663 Bacteria 7299
579 Ga0495635_0040494 3300046663 Bacteria 3219
580 Ga0495635_0074838 3300046663 Bacteria 2320
581 Ga0495588_0000515 3300046674 Bacteria 18686
582 Ga0495588_0018008 3300046674 Bacteria 3439
583 Ga0495657_0007246 3300046675 Bacteria 8593
584 Ga0495657_0020907 3300046675 Bacteria 4703
585 Ga0495657_0249545 3300046675 Bacteria 1069
586 Ga0495599_0075842 3300046678 Bacteria 2099
587 Ga0495599_0166118 3300046678 Bacteria 1363
588 Ga0495599_0357790 3300046678 Bacteria 874
589 Ga0495599_0636489 3300046678 Bacteria 619
590 Ga0495623_0244619 3300046679 Bacteria 1011
591 Ga0495646_0003871 3300046680 Bacteria 9357
592 Ga0495646_0009651 3300046680 Bacteria 6126
593 Ga0495647_0056572 3300046681 Bacteria 1538
594 Ga0495658_0059866 3300046683 Bacteria 2182
595 Ga0495658_0103775 3300046683 Bacteria 1701
596 Ga0495658_0190702 3300046683 Bacteria 1274
597 Ga0495658_0556884 3300046683 Bacteria 734
598 Ga0495613_0020770 3300046689 Bacteria 4895
599 Ga0495613_0021346 3300046689 Bacteria 4828
600 Ga0495613_0432401 3300046689 Bacteria 894
601 Ga0495613_0954264 3300046689 Bacteria 553
602 Ga0495624_0170872 3300046690 Bacteria 1326
603 Ga0495624_0509982 3300046690 Bacteria 719
604 Ga0495624_0540560 3300046690 Bacteria 696
605 Ga0495624_0715929 3300046690 Bacteria 594
606 Ga0495600_0053227 3300046809 Bacteria 2643
607 Ga0495600_0100465 3300046809 Bacteria 1885
608 Ga0495600_0875081 3300046809 Bacteria 531
609 Ga0495581_0027726 3300047315 Bacteria 3285
610 Ga0495581_0130969 3300047315 Bacteria 1461
611 Ga0495581_0134414 3300047315 Bacteria 1442
612 Ga0495604_0001004 3300047317 Bacteria 23493
613 Ga0495604_0008655 3300047317 Bacteria 8044
614 Ga0495604_0717928 3300047317 Bacteria 634
615 Ga0495674_0087167 3300047319 Bacteria 2672
616 Ga0495674_0270395 3300047319 Bacteria 1394
617 Ga0495674_0305620 3300047319 Bacteria 1298
618 Ga0495674_0969056 3300047319 Bacteria 653
619 Ga0495676_0004167 3300047321 Bacteria 13196
620 Ga0495676_0385317 3300047321 Bacteria 932
621 Ga0495676_0431925 3300047321 Bacteria 870
622 Ga0495676_0837706 3300047321 Bacteria 591
623 Ga0495680_0232108 3300047322 Bacteria 1313
624 Ga0495680_0818508 3300047322 Bacteria 607
625 Ga0495687_029074 3300047443 Bacteria 2563
626 Ga0495675_0048068 3300047444 Bacteria 2714
627 Ga0495675_0340645 3300047444 Bacteria 883
628 Ga0495684_0050035 3300047471 Bacteria 3191
629 Ga0495684_0138816 3300047471 Bacteria 1823
630 Ga0495593_0005342 3300047673 Bacteria 7599
631 Ga0495593_0051111 3300047673 Bacteria 2188
632 Ga0495593_0370135 3300047673 Bacteria 716
633 Ga0495602_0038937 3300048088 Bacteria 4386
634 Ga0495602_0115478 3300048088 Bacteria 2171
635 Ga0495614_0007784 3300048089 Bacteria 4761
636 Ga0495614_0017499 3300048089 Bacteria 3113
637 Ga0495614_0148137 3300048089 Bacteria 1046
638 Ga0495614_0349779 3300048089 Bacteria 689
639 Ga0496100_0504556 3300048903 Bacteria 932
640 Ga0496101_0111834 3300048904 Bacteria 2057
641 Ga0496101_0641232 3300048904 Bacteria 839
642 Ga0496101_0668067 3300048904 Bacteria 821
643 Ga0496102_0027821 3300048905 Bacteria 5049
644 Ga0496102_0300365 3300048905 Bacteria 1513
645 Ga0496102_0767965 3300048905 Bacteria 886
646 Ga0496102_1796727 3300048905 Bacteria 530
647 Ga0496103_0024554 3300048906 Bacteria 3639
648 Ga0496103_0133682 3300048906 Bacteria 1585
649 Ga0496104_0172375 3300048907 Bacteria 2074
650 Ga0496104_0175188 3300048907 Bacteria 2055
651 Ga0496104_0269271 3300048907 Bacteria 1616
652 Ga0496104_0410607 3300048907 Bacteria 1266
653 Ga0496104_0537846 3300048907 Bacteria 1079
654 Ga0496105_0238642 3300048908 Bacteria 1476
655 Ga0496105_0422287 3300048908 Bacteria 1055
656 Ga0496105_0987375 3300048908 Bacteria 630
657 Ga0496106_0017118 3300048909 Bacteria 5365
658 Ga0496106_0597752 3300048909 Bacteria 884
659 Ga0496106_0698786 3300048909 Bacteria 808
660 Ga0496106_0816636 3300048909 Bacteria 739
661 Ga0496107_0077331 3300048910 Bacteria 2424
662 Ga0496107_0147136 3300048910 Bacteria 1742
663 Ga0496107_0296919 3300048910 Bacteria 1202
664 Ga0496107_0400658 3300048910 Bacteria 1020
665 Ga0496108_0003323 3300048911 Bacteria 12923
666 Ga0496108_0005914 3300048911 Bacteria 9912
667 Ga0496108_0015800 3300048911 Bacteria 6154
668 Ga0496108_0352037 3300048911 Bacteria 1285
669 Ga0496109_0004880 3300048912 Bacteria 11200
670 Ga0496109_0009032 3300048912 Bacteria 8490
671 Ga0496109_0072119 3300048912 Bacteria 3172
672 Ga0496109_0100411 3300048912 Bacteria 2684
673 Ga0496110_0009313 3300048913 Bacteria 7944
674 Ga0496110_0039305 3300048913 Bacteria 4120
675 Ga0496110_0154951 3300048913 Bacteria 2075
676 Ga0496111_0105994 3300048914 Bacteria 2069
677 Ga0496111_0130885 3300048914 Bacteria 1856
678 Ga0496111_0179431 3300048914 Bacteria 1574
679 Ga0496112_0005846 3300048915 Bacteria 10712
680 Ga0496112_0025324 3300048915 Bacteria 5697
681 Ga0496112_0041936 3300048915 Bacteria 4478
682 Ga0496112_0137120 3300048915 Bacteria 2417
683 Ga0496112_0155134 3300048915 Bacteria 2256
684 Ga0496113_0050285 3300048916 Bacteria 3107
685 Ga0496113_0068855 3300048916 Bacteria 2686
686 Ga0496113_0253916 3300048916 Bacteria 1404
687 Ga0496113_0392882 3300048916 Bacteria 1113
688 Ga0496114_0230424 3300048917 Bacteria 1627
689 Ga0496114_0867561 3300048917 Bacteria 783
690 Ga0496115_0807401 3300048918 Bacteria 730
691 Ga0496118_0349038 3300048921 Bacteria 789
692 Ga0496124_0940628 3300048927 Bacteria 520
693 Ga0496126_0050129 3300048929 Bacteria 3806
694 Ga0501298_096331 3300049521 Bacteria 670
695 Ga0501034_0138222 3300049571 Bacteria 2416
696 Ga0501034_1327300 3300049571 Unclassified 596
697 Ga0501036_0289417 3300049572 Bacteria 1371
698 Ga0501040_0146270 3300049576 Bacteria 1666
699 Ga0501041_0059671 3300049577 Bacteria 2335
700 Ga0501041_0460619 3300049577 Bacteria 807
701 Ga0501041_0495852 3300049577 Bacteria 777
702 Ga0501041_0509618 3300049577 Bacteria 766
703 Ga0501048_0240828 3300049582 Bacteria 1284
704 Ga0501048_0891206 3300049582 Bacteria 640
705 Ga0501067_0212423 3300049583 Bacteria 1078
706 Ga0501067_0254871 3300049583 Bacteria 977
707 Ga0501067_0491707 3300049583 Bacteria 686
708 Ga0501069_0628844 3300049585 Bacteria 645
709 Ga0501069_0672016 3300049585 Bacteria 624
710 Ga0501071_0082911 3300049587 Bacteria 2349
711 Ga0501075_0062850 3300049591 Bacteria 2799
712 Ga0501075_0461772 3300049591 Bacteria 968
713 Ga0501075_0843895 3300049591 Bacteria 697
714 Ga0501076_0530980 3300049592 Bacteria 970
715 Ga0501076_1580161 3300049592 Bacteria 538
716 Ga0501077_0076996 3300049593 Bacteria 2113
717 Ga0501202_120671 3300049652 Bacteria 659
718 Ga0501079_0105819 3300049741 Bacteria 2183
719 Ga0501079_0165064 3300049741 Bacteria 1727
720 Ga0501081_0207765 3300049743 Bacteria 1421
721 Ga0501045_0537677 3300049824 Bacteria 867
722 Ga0501045_0656337 3300049824 Bacteria 775
723 nmdc:mga0yw44_102227_c1 3300050492 Bacteria 1827
724 nmdc:mga05p37_1133384_c1 3300050507 Bacteria 815
725 nmdc:mga05p37_150470_c1 3300050507 Bacteria 2847
726 nmdc:mga06r32_1908120_c1 3300050510 Bacteria 528
727 nmdc:mga06r32_822837_c1 3300050510 Bacteria 888
728 nmdc:mga08y16_107219_c1 3300050511 Bacteria 2908
729 nmdc:mga08y16_1167341_c1 3300050511 Bacteria 742
730 nmdc:mga08y16_1656278_c1 3300050511 Bacteria 596
731 nmdc:mga0n895_246792_c1 3300050512 Bacteria 1812
732 nmdc:mga08x19_965442_c1 3300050514 Bacteria 605
733 nmdc:mga0a205_45435_c1 3300050515 Bacteria 4234
734 Ga0495601_0020495 3300053077 Bacteria 4039
735 Ga0495601_0043640 3300053077 Bacteria 2816
736 Ga0495601_0240807 3300053077 Bacteria 1181
737 Ga0495601_0365346 3300053077 Bacteria 937
738 Ga0495612_0013443 3300053078 Bacteria 3298
739 Ga0495612_0255486 3300053078 Bacteria 780
740 Ga0500635_0269837 3300053080 Bacteria 669
741 Ga0495595_0292539 3300053084 Bacteria 819
742 Ga0495619_0059283 3300053085 Bacteria 2543
743 Ga0495619_0086285 3300053085 Bacteria 2121
744 Ga0495619_0099449 3300053085 Bacteria 1978
745 Ga0495619_0105628 3300053085 Bacteria 1920
746 Ga0500583_0467815 3300053092 Bacteria 596
747 Ga0500640_049489 3300053095 Bacteria 1840
748 Ga0500560_001178 3300053107 Bacteria 4343
749 Ga0500560_247045 3300053107 Bacteria 557
750 Ga0500614_004485 3300053123 Bacteria 2948
751 Ga0500573_0194500 3300053140 Bacteria 1081
752 Ga0500624_002559 3300053157 Bacteria 2454
753 Ga0501084_0078935 3300054114 Bacteria 2759
754 Ga0501084_0322373 3300054114 Bacteria 1305
755 Ga0501084_0762733 3300054114 Bacteria 815
756 Ga0530510_0148845 3300061734 Bacteria 1728

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005441 Ga0070700_100218892 Ga0070700_1002188922 101
2 3300005544 Ga0070686_100072419 Ga0070686_1000724192 101
3 3300025917 Ga0207660_10314339 Ga0207660_103143392 101
4 3300025919 Ga0207657_10011341 Ga0207657_100113414 101
5 3300025935 Ga0207709_10053264 Ga0207709_100532642 101
6 3300026075 Ga0207708_10063940 Ga0207708_100639402 101
7 3300036401 Ga0373937_0384141 Ga0373937_0384141_279_593 101
8 3300049587 Ga0501071_0082911 Ga0501071_0082911_1662_1976 101
9 3300005434 Ga0070709_10627848 Ga0070709_106278482 102
10 3300005543 Ga0070672_101202128 Ga0070672_1012021282 102
11 3300005614 Ga0068856_101582146 Ga0068856_1015821462 102
12 3300013296 Ga0157374_10670941 Ga0157374_106709412 102
13 3300013297 Ga0157378_10235208 Ga0157378_102352082 102
14 3300026118 Ga0207675_101662603 Ga0207675_1016626032 102
15 3300028786 Ga0307517_10348330 Ga0307517_103483302 102
16 3300030521 Ga0307511_10003768 Ga0307511_1000376810 102
17 3300030521 Ga0307511_10151153 Ga0307511_101511532 102
18 3300031616 Ga0307508_10040458 Ga0307508_100404582 102
19 3300031616 Ga0307508_10507405 Ga0307508_105074052 102
20 3300031616 Ga0307508_10779931 Ga0307508_107799312 102
21 3300031665 Ga0316575_10000050 Ga0316575_1000005020 102
22 3300032002 Ga0307416_102029044 Ga0307416_1020290442 102
23 3300032126 Ga0307415_102377229 Ga0307415_1023772292 102
24 3300033180 Ga0307510_10306937 Ga0307510_103069372 102
25 3300041999 Ga0439433_0212924 Ga0439433_0212924_148_459 102
26 3300042119 Ga0450915_004053 Ga0450915_004053_294_650 102
27 3300042436 Ga0439435_0030145 Ga0439435_0030145_1068_1379 102
28 3300005336 Ga0070680_100000173 Ga0070680_10000017331 103
29 3300005468 Ga0070707_100420595 Ga0070707_1004205952 103
30 3300005518 Ga0070699_100884803 Ga0070699_1008848031 103
31 3300005536 Ga0070697_100187932 Ga0070697_1001879322 103
32 3300005546 Ga0070696_100098053 Ga0070696_1000980533 103
33 3300007076 Ga0075435_100581200 Ga0075435_1005812002 103
34 3300010375 Ga0105239_12717477 Ga0105239_127174772 103
35 3300017792 Ga0163161_10701708 Ga0163161_107017082 103
36 3300025901 Ga0207688_10885733 Ga0207688_108857332 103
37 3300025917 Ga0207660_10000004 Ga0207660_10000004300 103
38 3300025922 Ga0207646_10335464 Ga0207646_103354642 103
39 3300028556 Ga0265337_1039898 Ga0265337_10398982 103
40 3300028558 Ga0265326_10003161 Ga0265326_100031615 103
41 3300028563 Ga0265319_1001156 Ga0265319_10011568 103
42 3300028563 Ga0265319_1015996 Ga0265319_10159963 103
43 3300028573 Ga0265334_10016320 Ga0265334_100163202 103
44 3300028577 Ga0265318_10225363 Ga0265318_102253632 103
45 3300028666 Ga0265336_10013855 Ga0265336_100138553 103
46 3300028800 Ga0265338_10009994 Ga0265338_1000999410 103
47 3300029957 Ga0265324_10006133 Ga0265324_100061334 103
48 3300031238 Ga0265332_10040657 Ga0265332_100406572 103
49 3300031239 Ga0265328_10021757 Ga0265328_100217572 103
50 3300031240 Ga0265320_10006501 Ga0265320_100065013 103
51 3300031240 Ga0265320_10277518 Ga0265320_102775182 103
52 3300031240 Ga0265320_10564853 Ga0265320_105648531 103
53 3300031242 Ga0265329_10168423 Ga0265329_101684232 103
54 3300031247 Ga0265340_10003591 Ga0265340_100035912 103
55 3300031249 Ga0265339_10365160 Ga0265339_103651601 103
56 3300031249 Ga0265339_10386964 Ga0265339_103869642 103
57 3300031250 Ga0265331_10037731 Ga0265331_100377312 103
58 3300031344 Ga0265316_10025415 Ga0265316_100254153 103
59 3300031595 Ga0265313_10073106 Ga0265313_100731062 103
60 3300031711 Ga0265314_10000238 Ga0265314_1000023828 103
61 3300032002 Ga0307416_100527406 Ga0307416_1005274062 103
62 3300038443 Ga0395901_0581964 Ga0395901_0581964_143_511 103
63 3300046526 Ga0495666_0110388 Ga0495666_0110388_766_1077 103
64 3300046690 Ga0495624_0715929 Ga0495624_0715929_167_478 103
65 3300049571 Ga0501034_0138222 Ga0501034_0138222_1267_1581 103
66 3300049571 Ga0501034_1327300 Ga0501034_1327300_80_403 103
67 3300049583 Ga0501067_0491707 Ga0501067_0491707_198_521 103
68 iso_pu_bacteria 2863404153 2863410970 103
69 3300005327 Ga0070658_10473754 Ga0070658_104737541 104
70 3300005345 Ga0070692_11276762 Ga0070692_112767621 104
71 3300005543 Ga0070672_100618225 Ga0070672_1006182251 104
72 3300005548 Ga0070665_100010070 Ga0070665_1000100709 104
73 3300005548 Ga0070665_100033640 Ga0070665_1000336403 104
74 3300005563 Ga0068855_100009172 Ga0068855_10000917212 104
75 3300005578 Ga0068854_100007587 Ga0068854_1000075874 104
76 3300005578 Ga0068854_100927683 Ga0068854_1009276832 104
77 3300005614 Ga0068856_100209416 Ga0068856_1002094162 104
78 3300005616 Ga0068852_100269854 Ga0068852_1002698542 104
79 3300005618 Ga0068864_101743908 Ga0068864_1017439081 104
80 3300005841 Ga0068863_100119652 Ga0068863_1001196522 104
81 3300005842 Ga0068858_100074755 Ga0068858_1000747554 104
82 3300009093 Ga0105240_10694343 Ga0105240_106943431 104
83 3300009093 Ga0105240_11151478 Ga0105240_111514782 104
84 3300009101 Ga0105247_10127638 Ga0105247_101276382 104
85 3300009174 Ga0105241_10001574 Ga0105241_100015743 104
86 3300009177 Ga0105248_10045858 Ga0105248_100458584 104
87 3300009551 Ga0105238_10008792 Ga0105238_100087925 104
88 3300009551 Ga0105238_11889610 Ga0105238_118896102 104
89 3300010375 Ga0105239_10032267 Ga0105239_100322672 104
90 3300013296 Ga0157374_10320086 Ga0157374_103200862 104
91 3300014325 Ga0163163_10055263 Ga0163163_100552633 104
92 3300025898 Ga0207692_10736018 Ga0207692_107360182 104
93 3300025904 Ga0207647_10002717 Ga0207647_100027176 104
94 3300025913 Ga0207695_10002678 Ga0207695_1000267817 104
95 3300025914 Ga0207671_10001035 Ga0207671_1000103517 104
96 3300025924 Ga0207694_10001558 Ga0207694_100015582 104
97 3300025929 Ga0207664_11796293 Ga0207664_117962931 104
98 3300025941 Ga0207711_10060515 Ga0207711_100605152 104
99 3300025949 Ga0207667_10067774 Ga0207667_100677745 104
100 3300025981 Ga0207640_10631669 Ga0207640_106316692 104
101 3300026067 Ga0207678_10211109 Ga0207678_102111092 104
102 3300026078 Ga0207702_10202907 Ga0207702_102029072 104
103 3300026088 Ga0207641_10111922 Ga0207641_101119222 104
104 3300026095 Ga0207676_11543346 Ga0207676_115433462 104
105 3300026116 Ga0207674_10964430 Ga0207674_109644302 104
106 3300026142 Ga0207698_10850647 Ga0207698_108506471 104
107 3300027717 Ga0209998_10008391 Ga0209998_100083912 104
108 3300028379 Ga0268266_10247707 Ga0268266_102477072 104
109 3300031241 Ga0265325_10067177 Ga0265325_100671772 104
110 3300031616 Ga0307508_10058649 Ga0307508_100586493 104
111 3300031665 Ga0316575_10107170 Ga0316575_101071702 104
112 3300031727 Ga0316576_10000982 Ga0316576_100009826 104
113 3300031727 Ga0316576_10139740 Ga0316576_101397402 104
114 3300031727 Ga0316576_10497512 Ga0316576_104975122 104
115 3300031727 Ga0316576_10722828 Ga0316576_107228282 104
116 3300031728 Ga0316578_10101077 Ga0316578_101010772 104
117 3300031728 Ga0316578_10114247 Ga0316578_101142472 104
118 3300031728 Ga0316578_10139143 Ga0316578_101391432 104
119 3300031731 Ga0307405_10897459 Ga0307405_108974592 104
120 3300031733 Ga0316577_10244198 Ga0316577_102441982 104
121 3300031901 Ga0307406_10854504 Ga0307406_108545042 104
122 3300031903 Ga0307407_10907581 Ga0307407_109075812 104
123 3300031911 Ga0307412_10268393 Ga0307412_102683932 104
124 3300032002 Ga0307416_100250504 Ga0307416_1002505041 104
125 3300032005 Ga0307411_10116734 Ga0307411_101167342 104
126 3300032126 Ga0307415_100353083 Ga0307415_1003530831 104
127 3300032133 Ga0316583_10166750 Ga0316583_101667502 104
128 3300032137 Ga0316585_10224617 Ga0316585_102246172 104
129 3300032139 Ga0316580_10096700 Ga0316580_100967002 104
130 3300032168 Ga0316593_10353738 Ga0316593_103537381 104
131 3300033179 Ga0307507_10006176 Ga0307507_1000617610 104
132 3300033524 Ga0316592_1085684 Ga0316592_10856842 104
133 3300033541 Ga0316596_1166618 Ga0316596_11666181 104
134 3300035398 Ga0316574_0015600 Ga0316574_0015600_1886_2206 104
135 3300035398 Ga0316574_0019409 Ga0316574_0019409_3157_3477 104
136 3300035398 Ga0316574_0082405 Ga0316574_0082405_1218_1538 104
137 3300035398 Ga0316574_0086948 Ga0316574_0086948_1273_1593 104
138 3300035398 Ga0316574_0667961 Ga0316574_0667961_257_577 104
139 3300036647 Ga0316582_0173148 Ga0316582_0173148_255_575 104
140 3300036647 Ga0316582_0591730 Ga0316582_0591730_89_409 104
141 3300036712 Ga0316584_0289517 Ga0316584_0289517_476_796 104
142 3300036712 Ga0316584_0304095 Ga0316584_0304095_534_854 104
143 3300036712 Ga0316584_0398943 Ga0316584_0398943_22_342 104
144 3300036712 Ga0316584_0435467 Ga0316584_0435467_313_633 104
145 3300036712 Ga0316584_0934763 Ga0316584_0934763_131_451 104
146 3300041494 Ga0451837_1057628 Ga0451837_1057628_140_454 104
147 3300046454 Ga0495592_0147712 Ga0495592_0147712_980_1297 104
148 3300046459 Ga0495629_0023689 Ga0495629_0023689_1113_1430 104
149 3300046462 Ga0495651_0021759 Ga0495651_0021759_1446_1763 104
150 3300046463 Ga0495653_0207175 Ga0495653_0207175_572_889 104
151 3300046473 Ga0495582_0110081 Ga0495582_0110081_934_1251 104
152 3300046476 Ga0495662_0001754 Ga0495662_0001754_5514_5831 104
153 3300046477 Ga0495664_0004375 Ga0495664_0004375_1490_1807 104
154 3300046499 Ga0495594_0059562 Ga0495594_0059562_635_958 104
155 3300046511 Ga0495608_0121987 Ga0495608_0121987_1266_1583 104
156 3300046514 Ga0495618_0049381 Ga0495618_0049381_964_1281 104
157 3300046516 Ga0495628_0123063 Ga0495628_0123063_1379_1696 104
158 3300046517 Ga0495630_0064963 Ga0495630_0064963_1466_1783 104
159 3300046526 Ga0495666_0065863 Ga0495666_0065863_1187_1504 104
160 3300046529 Ga0495652_0030799 Ga0495652_0030799_1453_1770 104
161 3300046533 Ga0495640_0384636 Ga0495640_0384636_196_513 104
162 3300046535 Ga0495586_0070580 Ga0495586_0070580_200_517 104
163 3300046536 Ga0495587_0002309 Ga0495587_0002309_8838_9155 104
164 3300046543 Ga0495645_0040792 Ga0495645_0040792_1145_1462 104
165 3300046557 Ga0495622_0058189 Ga0495622_0058189_1027_1344 104
166 3300046642 Ga0495634_0001467 Ga0495634_0001467_10805_11122 104
167 3300046663 Ga0495635_0008194 Ga0495635_0008194_3497_3814 104
168 3300046674 Ga0495588_0018008 Ga0495588_0018008_321_638 104
169 3300046675 Ga0495657_0007246 Ga0495657_0007246_4455_4772 104
170 3300046678 Ga0495599_0166118 Ga0495599_0166118_466_783 104
171 3300046680 Ga0495646_0003871 Ga0495646_0003871_5439_5756 104
172 3300046683 Ga0495658_0059866 Ga0495658_0059866_901_1218 104
173 3300046689 Ga0495613_0021346 Ga0495613_0021346_48_365 104
174 3300046690 Ga0495624_0170872 Ga0495624_0170872_587_904 104
175 3300046809 Ga0495600_0053227 Ga0495600_0053227_2069_2386 104
176 3300047315 Ga0495581_0027726 Ga0495581_0027726_218_535 104
177 3300047317 Ga0495604_0008655 Ga0495604_0008655_1482_1799 104
178 3300047321 Ga0495676_0004167 Ga0495676_0004167_4704_5021 104
179 3300047444 Ga0495675_0048068 Ga0495675_0048068_924_1241 104
180 3300047471 Ga0495684_0138816 Ga0495684_0138816_303_620 104
181 3300047673 Ga0495593_0005342 Ga0495593_0005342_5820_6137 104
182 3300048088 Ga0495602_0038937 Ga0495602_0038937_1427_1744 104
183 3300048089 Ga0495614_0007784 Ga0495614_0007784_821_1138 104
184 3300048907 Ga0496104_0269271 Ga0496104_0269271_1177_1500 104
185 3300048907 Ga0496104_0410607 Ga0496104_0410607_638_961 104
186 3300048908 Ga0496105_0238642 Ga0496105_0238642_997_1320 104
187 3300048915 Ga0496112_0025324 Ga0496112_0025324_3130_3453 104
188 3300048915 Ga0496112_0041936 Ga0496112_0041936_2387_2710 104
189 3300049521 Ga0501298_096331 Ga0501298_096331_122_436 104
190 3300049652 Ga0501202_120671 Ga0501202_120671_19_333 104
191 3300050511 nmdc:mga08y16_1167341_c1 nmdc:mga08y16_1167341_c1_281_601 104
192 3300053078 Ga0495612_0013443 Ga0495612_0013443_2619_2936 104
193 3300053080 Ga0500635_0269837 Ga0500635_0269837_32_349 104
194 3300053085 Ga0495619_0086285 Ga0495619_0086285_1357_1674 104
195 3300053095 Ga0500640_049489 Ga0500640_049489_693_1010 104
196 3300053123 Ga0500614_004485 Ga0500614_004485_270_587 104
197 3300053157 Ga0500624_002559 Ga0500624_002559_659_976 104
198 iso_pu_bacteria 2527291627 2528205560 104
199 iso_pu_bacteria 2546825537 2546950254 104
200 iso_pu_bacteria 2684623036 2686543386 104
201 iso_pu_bacteria 2773857924 2774866403 104
202 iso_pu_bacteria 637000116 637880268 104
203 3300005329 Ga0070683_100200707 Ga0070683_1002007072 105
204 3300005329 Ga0070683_101859534 Ga0070683_1018595341 105
205 3300005336 Ga0070680_100401817 Ga0070680_1004018172 105
206 3300005337 Ga0070682_100364398 Ga0070682_1003643982 105
207 3300005344 Ga0070661_100383838 Ga0070661_1003838382 105
208 3300005354 Ga0070675_100232228 Ga0070675_1002322282 105
209 3300005355 Ga0070671_101218634 Ga0070671_1012186342 105
210 3300005435 Ga0070714_100001186 Ga0070714_10000118610 105
211 3300005435 Ga0070714_101164065 Ga0070714_1011640651 105
212 3300005436 Ga0070713_101495781 Ga0070713_1014957811 105
213 3300005438 Ga0070701_10640029 Ga0070701_106400291 105
214 3300005440 Ga0070705_101098226 Ga0070705_1010982261 105
215 3300005445 Ga0070708_100038454 Ga0070708_1000384545 105
216 3300005445 Ga0070708_101267220 Ga0070708_1012672202 105
217 3300005455 Ga0070663_100603088 Ga0070663_1006030882 105
218 3300005456 Ga0070678_100297911 Ga0070678_1002979112 105
219 3300005468 Ga0070707_100762923 Ga0070707_1007629232 105
220 3300005468 Ga0070707_101115226 Ga0070707_1011152262 105
221 3300005471 Ga0070698_100749695 Ga0070698_1007496952 105
222 3300005518 Ga0070699_100047696 Ga0070699_1000476963 105
223 3300005536 Ga0070697_100366041 Ga0070697_1003660412 105
224 3300005544 Ga0070686_100312082 Ga0070686_1003120822 105
225 3300005548 Ga0070665_100192169 Ga0070665_1001921692 105
226 3300005564 Ga0070664_102023982 Ga0070664_1020239821 105
227 3300005844 Ga0068862_100891559 Ga0068862_1008915592 105
228 3300006163 Ga0070715_10248645 Ga0070715_102486452 105
229 3300006358 Ga0068871_101420216 Ga0068871_1014202162 105
230 3300009174 Ga0105241_10285007 Ga0105241_102850072 105
231 3300009176 Ga0105242_10254328 Ga0105242_102543282 105
232 3300009551 Ga0105238_12324891 Ga0105238_123248912 105
233 3300010375 Ga0105239_10887695 Ga0105239_108876952 105
234 3300011119 Ga0105246_10758612 Ga0105246_107586122 105
235 3300013102 Ga0157371_11356223 Ga0157371_113562232 105
236 3300013297 Ga0157378_11755589 Ga0157378_117555891 105
237 3300013306 Ga0163162_10994652 Ga0163162_109946522 105
238 3300014968 Ga0157379_10069686 Ga0157379_100696862 105
239 3300014969 Ga0157376_10790416 Ga0157376_107904162 105
240 3300025893 Ga0207682_10084185 Ga0207682_100841852 105
241 3300025903 Ga0207680_10380313 Ga0207680_103803132 105
242 3300025905 Ga0207685_10205343 Ga0207685_102053432 105
243 3300025920 Ga0207649_10172487 Ga0207649_101724872 105
244 3300025922 Ga0207646_11019218 Ga0207646_110192182 105
245 3300025926 Ga0207659_10237984 Ga0207659_102379842 105
246 3300025928 Ga0207700_11271457 Ga0207700_112714571 105
247 3300025929 Ga0207664_10000733 Ga0207664_1000073312 105
248 3300025929 Ga0207664_10883369 Ga0207664_108833692 105
249 3300025933 Ga0207706_10334565 Ga0207706_103345652 105
250 3300025934 Ga0207686_10421994 Ga0207686_104219942 105
251 3300025944 Ga0207661_11007865 Ga0207661_110078652 105
252 3300025945 Ga0207679_10748864 Ga0207679_107488642 105
253 3300025981 Ga0207640_10584725 Ga0207640_105847252 105
254 3300025986 Ga0207658_10167464 Ga0207658_101674642 105
255 3300026035 Ga0207703_10068272 Ga0207703_100682723 105
256 3300026088 Ga0207641_10206605 Ga0207641_102066052 105
257 3300026089 Ga0207648_11891179 Ga0207648_118911792 105
258 3300026121 Ga0207683_10372599 Ga0207683_103725992 105
259 3300026142 Ga0207698_10172103 Ga0207698_101721032 105
260 3300028379 Ga0268266_10143106 Ga0268266_101431062 105
261 3300030522 Ga0307512_10061587 Ga0307512_100615873 105
262 3300031616 Ga0307508_10487004 Ga0307508_104870042 105
263 3300046499 Ga0495594_0535746 Ga0495594_0535746_177_512 105
264 3300048904 Ga0496101_0111834 Ga0496101_0111834_481_798 105
265 3300048905 Ga0496102_1796727 Ga0496102_1796727_135_452 105
266 3300048909 Ga0496106_0597752 Ga0496106_0597752_65_382 105
267 3300048910 Ga0496107_0400658 Ga0496107_0400658_130_447 105
268 3300048911 Ga0496108_0352037 Ga0496108_0352037_577_894 105
269 3300048915 Ga0496112_0137120 Ga0496112_0137120_248_565 105
270 3300048916 Ga0496113_0253916 Ga0496113_0253916_746_1063 105
271 3300049592 Ga0501076_0530980 Ga0501076_0530980_482_805 105
272 3300049592 Ga0501076_1580161 Ga0501076_1580161_199_516 105
273 3300049741 Ga0501079_0105819 Ga0501079_0105819_1464_1781 105
274 3300050510 nmdc:mga06r32_1908120_c1 nmdc:mga06r32_1908120_c1_127_444 105
275 3300054114 Ga0501084_0322373 Ga0501084_0322373_635_952 105
276 3300005327 Ga0070658_11402803 Ga0070658_114028031 106
277 3300005328 Ga0070676_10255187 Ga0070676_102551872 106
278 3300005340 Ga0070689_100323312 Ga0070689_1003233122 106
279 3300005440 Ga0070705_100124650 Ga0070705_1001246502 106
280 3300005444 Ga0070694_100405529 Ga0070694_1004055292 106
281 3300005467 Ga0070706_100000600 Ga0070706_1000006009 106
282 3300005468 Ga0070707_100004383 Ga0070707_1000043832 106
283 3300005471 Ga0070698_102112350 Ga0070698_1021123501 106
284 3300005536 Ga0070697_100105933 Ga0070697_1001059332 106
285 3300005546 Ga0070696_100085253 Ga0070696_1000852532 106
286 3300005547 Ga0070693_100758259 Ga0070693_1007582591 106
287 3300005549 Ga0070704_100266781 Ga0070704_1002667812 106
288 3300005563 Ga0068855_100495608 Ga0068855_1004956082 106
289 3300005578 Ga0068854_100073114 Ga0068854_1000731142 106
290 3300005615 Ga0070702_100034963 Ga0070702_1000349632 106
291 3300005719 Ga0068861_100788669 Ga0068861_1007886691 106
292 3300005842 Ga0068858_100041760 Ga0068858_1000417603 106
293 3300009176 Ga0105242_11587573 Ga0105242_115875732 106
294 3300013297 Ga0157378_10240813 Ga0157378_102408133 106
295 3300014968 Ga0157379_10354370 Ga0157379_103543702 106
296 3300020070 Ga0206356_11816342 Ga0206356_118163422 106
297 3300025906 Ga0207699_10018962 Ga0207699_100189621 106
298 3300025907 Ga0207645_10060142 Ga0207645_100601422 106
299 3300025907 Ga0207645_10456544 Ga0207645_104565442 106
300 3300025910 Ga0207684_10000496 Ga0207684_100004962 106
301 3300025912 Ga0207707_11325135 Ga0207707_113251351 106
302 3300025922 Ga0207646_10002151 Ga0207646_1000215110 106
303 3300025981 Ga0207640_10413132 Ga0207640_104131322 106
304 3300026035 Ga0207703_10546618 Ga0207703_105466182 106
305 3300026035 Ga0207703_12391518 Ga0207703_123915182 106
306 3300026116 Ga0207674_10055881 Ga0207674_100558812 106
307 3300028577 Ga0265318_10121249 Ga0265318_101212492 106
308 3300028666 Ga0265336_10062722 Ga0265336_100627222 106
309 3300028794 Ga0307515_10000683 Ga0307515_1000068347 106
310 3300028800 Ga0265338_10207024 Ga0265338_102070242 106
311 3300029957 Ga0265324_10163919 Ga0265324_101639192 106
312 3300031507 Ga0307509_10963490 Ga0307509_109634901 106
313 3300031649 Ga0307514_10140355 Ga0307514_101403553 106
314 3300031649 Ga0307514_10281218 Ga0307514_102812182 106
315 3300031730 Ga0307516_10068665 Ga0307516_100686654 106
316 3300031838 Ga0307518_10005430 Ga0307518_100054308 106
317 3300031838 Ga0307518_10018700 Ga0307518_100187003 106
318 3300033179 Ga0307507_10027402 Ga0307507_100274023 106
319 3300033180 Ga0307510_10280271 Ga0307510_102802712 106
320 3300041496 Ga0451839_1545375 Ga0451839_1545375_182_502 106
321 3300044694 Ga0466963_0099048 Ga0466963_0099048_1305_1631 106
322 3300045976 Ga0466967_0010351 Ga0466967_0010351_346_672 106
323 3300046454 Ga0495592_0158469 Ga0495592_0158469_592_924 106
324 3300046459 Ga0495629_0021206 Ga0495629_0021206_472_810 106
325 3300046460 Ga0495638_0171655 Ga0495638_0171655_463_783 106
326 3300046462 Ga0495651_0030166 Ga0495651_0030166_1818_2150 106
327 3300046463 Ga0495653_0010595 Ga0495653_0010595_4592_4924 106
328 3300046472 Ga0495580_0109836 Ga0495580_0109836_1473_1805 106
329 3300046476 Ga0495662_0015654 Ga0495662_0015654_120_452 106
330 3300046477 Ga0495664_0003407 Ga0495664_0003407_5344_5676 106
331 3300046499 Ga0495594_0045213 Ga0495594_0045213_1449_1787 106
332 3300046501 Ga0495607_0515629 Ga0495607_0515629_62_382 106
333 3300046511 Ga0495608_0006200 Ga0495608_0006200_1330_1662 106
334 3300046516 Ga0495628_0007270 Ga0495628_0007270_8241_8573 106
335 3300046517 Ga0495630_0054035 Ga0495630_0054035_470_802 106
336 3300046526 Ga0495666_0000608 Ga0495666_0000608_8482_8814 106
337 3300046529 Ga0495652_0037620 Ga0495652_0037620_636_968 106
338 3300046531 Ga0495665_0027860 Ga0495665_0027860_1435_1767 106
339 3300046536 Ga0495587_0024809 Ga0495587_0024809_238_570 106
340 3300046543 Ga0495645_0007004 Ga0495645_0007004_4261_4593 106
341 3300046559 Ga0495667_0008989 Ga0495667_0008989_442_774 106
342 3300046642 Ga0495634_0040289 Ga0495634_0040289_1170_1502 106
343 3300046663 Ga0495635_0040494 Ga0495635_0040494_2418_2750 106
344 3300046674 Ga0495588_0000515 Ga0495588_0000515_15547_15885 106
345 3300046675 Ga0495657_0020907 Ga0495657_0020907_2918_3250 106
346 3300046678 Ga0495599_0075842 Ga0495599_0075842_1298_1630 106
347 3300046679 Ga0495623_0244619 Ga0495623_0244619_238_570 106
348 3300046680 Ga0495646_0009651 Ga0495646_0009651_764_1096 106
349 3300046689 Ga0495613_0020770 Ga0495613_0020770_3094_3426 106
350 3300046809 Ga0495600_0100465 Ga0495600_0100465_238_570 106
351 3300047315 Ga0495581_0130969 Ga0495581_0130969_391_723 106
352 3300047317 Ga0495604_0001004 Ga0495604_0001004_22141_22473 106
353 3300047319 Ga0495674_0270395 Ga0495674_0270395_893_1225 106
354 3300047321 Ga0495676_0385317 Ga0495676_0385317_212_550 106
355 3300047443 Ga0495687_029074 Ga0495687_029074_1438_1776 106
356 3300047444 Ga0495675_0340645 Ga0495675_0340645_238_570 106
357 3300047471 Ga0495684_0050035 Ga0495684_0050035_2418_2750 106
358 3300047673 Ga0495593_0370135 Ga0495593_0370135_365_697 106
359 3300048088 Ga0495602_0115478 Ga0495602_0115478_366_698 106
360 3300048089 Ga0495614_0017499 Ga0495614_0017499_2555_2893 106
361 3300048905 Ga0496102_0027821 Ga0496102_0027821_374_700 106
362 3300048906 Ga0496103_0024554 Ga0496103_0024554_3202_3528 106
363 3300048909 Ga0496106_0017118 Ga0496106_0017118_2295_2621 106
364 3300048910 Ga0496107_0077331 Ga0496107_0077331_1308_1634 106
365 3300048921 Ga0496118_0349038 Ga0496118_0349038_391_747 106
366 3300048927 Ga0496124_0940628 Ga0496124_0940628_42_398 106
367 3300053077 Ga0495601_0020495 Ga0495601_0020495_3369_3701 106
368 3300053085 Ga0495619_0105628 Ga0495619_0105628_1005_1337 106
369 3300053092 Ga0500583_0467815 Ga0500583_0467815_208_546 106
370 3300053107 Ga0500560_001178 Ga0500560_001178_2567_2905 106
371 3300053107 Ga0500560_247045 Ga0500560_247045_194_532 106
372 3300053140 Ga0500573_0194500 Ga0500573_0194500_735_1067 106
373 3300012500 Ga0157314_1047316 Ga0157314_10473161 107
374 3300037068 Ga0373925_0000592 Ga0373925_0000592_29937_30308 107
375 3300046477 Ga0495664_0953528 Ga0495664_0953528_45_374 107
376 3300048929 Ga0496126_0050129 Ga0496126_0050129_1021_1380 107
377 3300005436 Ga0070713_100280763 Ga0070713_1002807631 108
378 3300005546 Ga0070696_101348758 Ga0070696_1013487582 108
379 3300005842 Ga0068858_100784991 Ga0068858_1007849912 108
380 3300009545 Ga0105237_11822945 Ga0105237_118229452 108
381 3300013308 Ga0157375_11302548 Ga0157375_113025482 108
382 3300014325 Ga0163163_12432360 Ga0163163_124323602 108
383 3300014968 Ga0157379_10138620 Ga0157379_101386202 108
384 3300014969 Ga0157376_10205467 Ga0157376_102054672 108
385 3300017792 Ga0163161_10322340 Ga0163161_103223402 108
386 3300025321 Ga0207656_10241787 Ga0207656_102417872 108
387 3300025918 Ga0207662_10418128 Ga0207662_104181282 108
388 3300025928 Ga0207700_11573324 Ga0207700_115733241 108
389 3300025937 Ga0207669_10697621 Ga0207669_106976212 108
390 3300025939 Ga0207665_10319073 Ga0207665_103190732 108
391 3300026035 Ga0207703_11365014 Ga0207703_113650142 108
392 3300026116 Ga0207674_11309083 Ga0207674_113090832 108
393 3300027682 Ga0209971_1087954 Ga0209971_10879542 108
394 3300036401 Ga0373937_0072933 Ga0373937_0072933_2404_2736 108
395 3300041494 Ga0451837_1234475 Ga0451837_1234475_769_1110 108
396 3300041498 Ga0451841_0063569 Ga0451841_0063569_426_767 108
397 3300046454 Ga0495592_0376791 Ga0495592_0376791_17_349 108
398 3300046461 Ga0495641_0417989 Ga0495641_0417989_94_426 108
399 3300046463 Ga0495653_0229507 Ga0495653_0229507_431_763 108
400 3300046476 Ga0495662_0321393 Ga0495662_0321393_328_660 108
401 3300046511 Ga0495608_0485690 Ga0495608_0485690_244_576 108
402 3300046514 Ga0495618_0302571 Ga0495618_0302571_231_563 108
403 3300046514 Ga0495618_0649070 Ga0495618_0649070_98_430 108
404 3300046516 Ga0495628_0734857 Ga0495628_0734857_181_513 108
405 3300046516 Ga0495628_0819790 Ga0495628_0819790_36_368 108
406 3300046517 Ga0495630_0370702 Ga0495630_0370702_104_436 108
407 3300046529 Ga0495652_0256376 Ga0495652_0256376_567_899 108
408 3300046531 Ga0495665_0498206 Ga0495665_0498206_221_553 108
409 3300046535 Ga0495586_0880687 Ga0495586_0880687_152_484 108
410 3300046536 Ga0495587_0514485 Ga0495587_0514485_199_531 108
411 3300046543 Ga0495645_0206782 Ga0495645_0206782_532_864 108
412 3300046663 Ga0495635_0074838 Ga0495635_0074838_533_865 108
413 3300046675 Ga0495657_0249545 Ga0495657_0249545_668_1000 108
414 3300046678 Ga0495599_0357790 Ga0495599_0357790_158_490 108
415 3300046683 Ga0495658_0190702 Ga0495658_0190702_743_1075 108
416 3300046683 Ga0495658_0556884 Ga0495658_0556884_259_591 108
417 3300046690 Ga0495624_0509982 Ga0495624_0509982_25_357 108
418 3300046809 Ga0495600_0875081 Ga0495600_0875081_189_521 108
419 3300047317 Ga0495604_0717928 Ga0495604_0717928_286_618 108
420 3300047319 Ga0495674_0087167 Ga0495674_0087167_1303_1635 108
421 3300047319 Ga0495674_0305620 Ga0495674_0305620_172_504 108
422 3300047321 Ga0495676_0431925 Ga0495676_0431925_385_717 108
423 3300047322 Ga0495680_0232108 Ga0495680_0232108_189_521 108
424 3300047673 Ga0495593_0051111 Ga0495593_0051111_573_905 108
425 3300048089 Ga0495614_0148137 Ga0495614_0148137_211_543 108
426 3300048910 Ga0496107_0296919 Ga0496107_0296919_596_928 108
427 3300048912 Ga0496109_0072119 Ga0496109_0072119_1445_1777 108
428 3300049582 Ga0501048_0240828 Ga0501048_0240828_109_465 108
429 3300049583 Ga0501067_0254871 Ga0501067_0254871_593_922 108
430 3300049593 Ga0501077_0076996 Ga0501077_0076996_145_477 108
431 3300049743 Ga0501081_0207765 Ga0501081_0207765_567_893 108
432 3300053077 Ga0495601_0240807 Ga0495601_0240807_422_754 108
433 3300053077 Ga0495601_0365346 Ga0495601_0365346_129_461 108
434 3300053078 Ga0495612_0255486 Ga0495612_0255486_256_588 108
435 3300053084 Ga0495595_0292539 Ga0495595_0292539_241_573 108
436 3300053085 Ga0495619_0099449 Ga0495619_0099449_999_1331 108
437 3300005356 Ga0070674_100572353 Ga0070674_1005723532 109
438 3300005440 Ga0070705_100127636 Ga0070705_1001276362 109
439 3300005444 Ga0070694_100074556 Ga0070694_1000745563 109
440 3300005444 Ga0070694_100138455 Ga0070694_1001384552 109
441 3300005459 Ga0068867_102421492 Ga0068867_1024214921 109
442 3300005467 Ga0070706_100217714 Ga0070706_1002177142 109
443 3300005471 Ga0070698_100361535 Ga0070698_1003615352 109
444 3300005518 Ga0070699_100185627 Ga0070699_1001856272 109
445 3300005530 Ga0070679_100198519 Ga0070679_1001985192 109
446 3300005536 Ga0070697_100166236 Ga0070697_1001662362 109
447 3300005545 Ga0070695_100003885 Ga0070695_1000038855 109
448 3300005546 Ga0070696_100003098 Ga0070696_1000030989 109
449 3300005547 Ga0070693_100675093 Ga0070693_1006750932 109
450 3300005549 Ga0070704_100175309 Ga0070704_1001753092 109
451 3300013100 Ga0157373_10703448 Ga0157373_107034482 109
452 3300014326 Ga0157380_10664514 Ga0157380_106645142 109
453 3300025910 Ga0207684_10171173 Ga0207684_101711732 109
454 3300025917 Ga0207660_11357618 Ga0207660_113576182 109
455 3300025921 Ga0207652_10601970 Ga0207652_106019702 109
456 3300025932 Ga0207690_11541090 Ga0207690_115410902 109
457 3300025937 Ga0207669_10666941 Ga0207669_106669412 109
458 3300025949 Ga0207667_11564245 Ga0207667_115642452 109
459 3300025972 Ga0207668_11605281 Ga0207668_116052812 109
460 3300026075 Ga0207708_10348701 Ga0207708_103487012 109
461 3300035088 Ga0373940_0095386 Ga0373940_0095386_444_776 109
462 3300042147 Ga0450910_028688 Ga0450910_028688_376_705 109
463 3300042156 Ga0439446_0093833 Ga0439446_0093833_22_351 109
464 3300042156 Ga0439446_0163505 Ga0439446_0163505_327_656 109
465 3300049577 Ga0501041_0059671 Ga0501041_0059671_93_422 109
466 3300049577 Ga0501041_0460619 Ga0501041_0460619_132_461 109
467 3300049585 Ga0501069_0628844 Ga0501069_0628844_140_469 109
468 3300049591 Ga0501075_0461772 Ga0501075_0461772_338_667 109
469 3300049824 Ga0501045_0537677 Ga0501045_0537677_90_419 109
470 3300005356 Ga0070674_101162177 Ga0070674_1011621771 110
471 3300005536 Ga0070697_100409857 Ga0070697_1004098572 110
472 3300006871 Ga0075434_101285209 Ga0075434_1012852092 110
473 3300009094 Ga0111539_10102438 Ga0111539_101024382 110
474 3300009094 Ga0111539_12691021 Ga0111539_126910211 110
475 3300009098 Ga0105245_11106658 Ga0105245_111066582 110
476 3300009148 Ga0105243_10521671 Ga0105243_105216712 110
477 3300009148 Ga0105243_12348920 Ga0105243_123489202 110
478 3300009553 Ga0105249_12682137 Ga0105249_126821371 110
479 3300014326 Ga0157380_11987813 Ga0157380_119878132 110
480 3300017792 Ga0163161_10967421 Ga0163161_109674211 110
481 3300025935 Ga0207709_10051472 Ga0207709_100514722 110
482 3300025961 Ga0207712_10325362 Ga0207712_103253622 110
483 3300025961 Ga0207712_10994953 Ga0207712_109949532 110
484 3300026075 Ga0207708_10827923 Ga0207708_108279232 110
485 3300037471 Ga0395905_0327441 Ga0395905_0327441_824_1156 110
486 3300038443 Ga0395901_1530866 Ga0395901_1530866_33_365 110
487 3300041411 Ga0439466_0216242 Ga0439466_0216242_70_402 110
488 3300046557 Ga0495622_0484333 Ga0495622_0484333_122_454 110
489 3300050511 nmdc:mga08y16_1656278_c1 nmdc:mga08y16_1656278_c1_196_528 110
490 3300005616 Ga0068852_102334760 Ga0068852_1023347601 111
491 3300006881 Ga0068865_102107785 Ga0068865_1021077852 111
492 3300025986 Ga0207658_10338161 Ga0207658_103381612 111
493 3300041496 Ga0451839_0442632 Ga0451839_0442632_139_474 111
494 3300046689 Ga0495613_0954264 Ga0495613_0954264_162_503 111
495 3300001978 JGI24747J21853_1023400 JGI24747J21853_10234002 112
496 3300001991 JGI24743J22301_10153110 JGI24743J22301_101531102 112
497 3300002073 JGI24745J21846_1038504 JGI24745J21846_10385041 112
498 3300002244 JGI24742J22300_10082188 JGI24742J22300_100821881 112
499 3300002459 JGI24751J29686_10042150 JGI24751J29686_100421502 112
500 3300005328 Ga0070676_10613891 Ga0070676_106138912 112
501 3300005329 Ga0070683_100177559 Ga0070683_1001775592 112
502 3300005330 Ga0070690_100037680 Ga0070690_1000376802 112
503 3300005331 Ga0070670_101230925 Ga0070670_1012309252 112
504 3300005334 Ga0068869_100114110 Ga0068869_1001141102 112
505 3300005338 Ga0068868_100145338 Ga0068868_1001453382 112
506 3300005338 Ga0068868_100360915 Ga0068868_1003609152 112
507 3300005340 Ga0070689_100066074 Ga0070689_1000660742 112
508 3300005341 Ga0070691_10097668 Ga0070691_100976682 112
509 3300005344 Ga0070661_100036201 Ga0070661_1000362012 112
510 3300005345 Ga0070692_10016618 Ga0070692_100166182 112
511 3300005353 Ga0070669_100220714 Ga0070669_1002207142 112
512 3300005354 Ga0070675_100003195 Ga0070675_1000031952 112
513 3300005356 Ga0070674_100003451 Ga0070674_1000034519 112
514 3300005364 Ga0070673_100188355 Ga0070673_1001883552 112
515 3300005365 Ga0070688_100053936 Ga0070688_1000539362 112
516 3300005366 Ga0070659_100010996 Ga0070659_1000109966 112
517 3300005367 Ga0070667_100367435 Ga0070667_1003674352 112
518 3300005437 Ga0070710_10796291 Ga0070710_107962912 112
519 3300005438 Ga0070701_10004477 Ga0070701_100044772 112
520 3300005440 Ga0070705_100222860 Ga0070705_1002228602 112
521 3300005440 Ga0070705_100543001 Ga0070705_1005430012 112
522 3300005441 Ga0070700_100193487 Ga0070700_1001934872 112
523 3300005444 Ga0070694_101779322 Ga0070694_1017793221 112
524 3300005445 Ga0070708_102055054 Ga0070708_1020550541 112
525 3300005455 Ga0070663_100749357 Ga0070663_1007493572 112
526 3300005456 Ga0070678_100104420 Ga0070678_1001044202 112
527 3300005456 Ga0070678_101666027 Ga0070678_1016660272 112
528 3300005457 Ga0070662_100078511 Ga0070662_1000785112 112
529 3300005459 Ga0068867_100169807 Ga0068867_1001698072 112
530 3300005466 Ga0070685_10027087 Ga0070685_100270872 112
531 3300005468 Ga0070707_101168254 Ga0070707_1011682542 112
532 3300005471 Ga0070698_100369777 Ga0070698_1003697772 112
533 3300005518 Ga0070699_100499335 Ga0070699_1004993352 112
534 3300005535 Ga0070684_100349190 Ga0070684_1003491902 112
535 3300005536 Ga0070697_100994137 Ga0070697_1009941372 112
536 3300005543 Ga0070672_100405098 Ga0070672_1004050982 112
537 3300005544 Ga0070686_100126178 Ga0070686_1001261782 112
538 3300005544 Ga0070686_100187324 Ga0070686_1001873242 112
539 3300005546 Ga0070696_100267424 Ga0070696_1002674242 112
540 3300005548 Ga0070665_102271418 Ga0070665_1022714181 112
541 3300005564 Ga0070664_100207918 Ga0070664_1002079182 112
542 3300005577 Ga0068857_100060936 Ga0068857_1000609362 112
543 3300005578 Ga0068854_100050725 Ga0068854_1000507252 112
544 3300005615 Ga0070702_100438474 Ga0070702_1004384741 112
545 3300005616 Ga0068852_100272016 Ga0068852_1002720162 112
546 3300005617 Ga0068859_100014708 Ga0068859_1000147082 112
547 3300005618 Ga0068864_100619603 Ga0068864_1006196032 112
548 3300005718 Ga0068866_10058423 Ga0068866_100584233 112
549 3300005840 Ga0068870_10635229 Ga0068870_106352292 112
550 3300005841 Ga0068863_100176763 Ga0068863_1001767632 112
551 3300005841 Ga0068863_100942310 Ga0068863_1009423102 112
552 3300005842 Ga0068858_100106444 Ga0068858_1001064442 112
553 3300005843 Ga0068860_100621775 Ga0068860_1006217752 112
554 3300005843 Ga0068860_101304215 Ga0068860_1013042152 112
555 3300006038 Ga0075365_10063862 Ga0075365_100638622 112
556 3300006163 Ga0070715_10317337 Ga0070715_103173372 112
557 3300006237 Ga0097621_100515450 Ga0097621_1005154502 112
558 3300006237 Ga0097621_100637377 Ga0097621_1006373772 112
559 3300006358 Ga0068871_102086601 Ga0068871_1020866012 112
560 3300006844 Ga0075428_100161554 Ga0075428_1001615542 112
561 3300006847 Ga0075431_100305488 Ga0075431_1003054882 112
562 3300006852 Ga0075433_10247530 Ga0075433_102475302 112
563 3300006871 Ga0075434_100259178 Ga0075434_1002591782 112
564 3300006881 Ga0068865_100173369 Ga0068865_1001733692 112
565 3300006931 Ga0097620_100014708 Ga0097620_1000147082 112
566 3300006931 Ga0097620_101664502 Ga0097620_1016645022 112
567 3300007076 Ga0075435_101136725 Ga0075435_1011367252 112
568 3300009036 Ga0105244_10064083 Ga0105244_100640832 112
569 3300009094 Ga0111539_10065305 Ga0111539_100653052 112
570 3300009094 Ga0111539_10134033 Ga0111539_101340332 112
571 3300009098 Ga0105245_10281584 Ga0105245_102815842 112
572 3300009098 Ga0105245_10945336 Ga0105245_109453362 112
573 3300009098 Ga0105245_11002706 Ga0105245_110027061 112
574 3300009101 Ga0105247_10129474 Ga0105247_101294742 112
575 3300009147 Ga0114129_10291584 Ga0114129_102915841 112
576 3300009147 Ga0114129_10322791 Ga0114129_103227912 112
577 3300009147 Ga0114129_10469717 Ga0114129_104697172 112
578 3300009148 Ga0105243_10012149 Ga0105243_100121492 112
579 3300009174 Ga0105241_10708312 Ga0105241_107083122 112
580 3300009176 Ga0105242_10017160 Ga0105242_100171604 112
581 3300009176 Ga0105242_10551471 Ga0105242_105514712 112
582 3300009177 Ga0105248_10055704 Ga0105248_100557042 112
583 3300009545 Ga0105237_10658030 Ga0105237_106580302 112
584 3300009551 Ga0105238_10032490 Ga0105238_100324902 112
585 3300009553 Ga0105249_10009446 Ga0105249_100094467 112
586 3300010159 Ga0099796_10037250 Ga0099796_100372502 112
587 3300010375 Ga0105239_10077529 Ga0105239_100775292 112
588 3300011119 Ga0105246_10344241 Ga0105246_103442412 112
589 3300012482 Ga0157318_1015878 Ga0157318_10158782 112
590 3300012483 Ga0157337_1011631 Ga0157337_10116312 112
591 3300013102 Ga0157371_10623866 Ga0157371_106238662 112
592 3300013296 Ga0157374_10884523 Ga0157374_108845232 112
593 3300013306 Ga0163162_10014545 Ga0163162_100145457 112
594 3300013306 Ga0163162_10203360 Ga0163162_102033602 112
595 3300013307 Ga0157372_11620060 Ga0157372_116200601 112
596 3300013308 Ga0157375_10119364 Ga0157375_101193643 112
597 3300014326 Ga0157380_10026353 Ga0157380_100263531 112
598 3300014745 Ga0157377_10015266 Ga0157377_100152662 112
599 3300014968 Ga0157379_10076655 Ga0157379_100766552 112
600 3300014968 Ga0157379_10648118 Ga0157379_106481182 112
601 3300014968 Ga0157379_10934432 Ga0157379_109344322 112
602 3300017792 Ga0163161_10035856 Ga0163161_100358563 112
603 3300025728 Ga0207655_1164228 Ga0207655_11642282 112
604 3300025898 Ga0207692_10657733 Ga0207692_106577331 112
605 3300025899 Ga0207642_10043856 Ga0207642_100438562 112
606 3300025900 Ga0207710_10343007 Ga0207710_103430072 112
607 3300025901 Ga0207688_10034995 Ga0207688_100349953 112
608 3300025903 Ga0207680_10040440 Ga0207680_100404401 112
609 3300025908 Ga0207643_10006292 Ga0207643_100062922 112
610 3300025910 Ga0207684_10604758 Ga0207684_106047581 112
611 3300025912 Ga0207707_10578243 Ga0207707_105782432 112
612 3300025918 Ga0207662_10000807 Ga0207662_1000080711 112
613 3300025919 Ga0207657_10145625 Ga0207657_101456252 112
614 3300025923 Ga0207681_10055582 Ga0207681_100555823 112
615 3300025924 Ga0207694_10831381 Ga0207694_108313812 112
616 3300025925 Ga0207650_11035775 Ga0207650_110357752 112
617 3300025926 Ga0207659_10641601 Ga0207659_106416012 112
618 3300025927 Ga0207687_10200819 Ga0207687_102008192 112
619 3300025927 Ga0207687_10230182 Ga0207687_102301822 112
620 3300025927 Ga0207687_10492345 Ga0207687_104923452 112
621 3300025927 Ga0207687_11164835 Ga0207687_111648352 112
622 3300025931 Ga0207644_10942352 Ga0207644_109423522 112
623 3300025932 Ga0207690_10909209 Ga0207690_109092092 112
624 3300025933 Ga0207706_10198270 Ga0207706_101982702 112
625 3300025935 Ga0207709_10041173 Ga0207709_100411732 112
626 3300025937 Ga0207669_10256886 Ga0207669_102568862 112
627 3300025938 Ga0207704_10076829 Ga0207704_100768292 112
628 3300025939 Ga0207665_10234650 Ga0207665_102346502 112
629 3300025940 Ga0207691_10014085 Ga0207691_100140859 112
630 3300025941 Ga0207711_10039731 Ga0207711_100397313 112
631 3300025941 Ga0207711_10356493 Ga0207711_103564932 112
632 3300025941 Ga0207711_11468662 Ga0207711_114686622 112
633 3300025942 Ga0207689_10150793 Ga0207689_101507932 112
634 3300025945 Ga0207679_11422441 Ga0207679_114224412 112
635 3300025960 Ga0207651_10936720 Ga0207651_109367201 112
636 3300025961 Ga0207712_10075148 Ga0207712_100751482 112
637 3300025981 Ga0207640_10673922 Ga0207640_106739221 112
638 3300025986 Ga0207658_10464909 Ga0207658_104649092 112
639 3300026023 Ga0207677_10145521 Ga0207677_101455212 112
640 3300026023 Ga0207677_10214014 Ga0207677_102140142 112
641 3300026035 Ga0207703_10102022 Ga0207703_101020222 112
642 3300026067 Ga0207678_10016986 Ga0207678_100169866 112
643 3300026075 Ga0207708_10012643 Ga0207708_100126434 112
644 3300026078 Ga0207702_10178238 Ga0207702_101782381 112
645 3300026078 Ga0207702_12278449 Ga0207702_122784491 112
646 3300026088 Ga0207641_10143771 Ga0207641_101437712 112
647 3300026088 Ga0207641_12365955 Ga0207641_123659552 112
648 3300026089 Ga0207648_10003395 Ga0207648_100033953 112
649 3300026095 Ga0207676_10111278 Ga0207676_101112781 112
650 3300026095 Ga0207676_10214975 Ga0207676_102149752 112
651 3300026116 Ga0207674_10007747 Ga0207674_100077478 112
652 3300026118 Ga0207675_100085382 Ga0207675_1000853823 112
653 3300026121 Ga0207683_10014880 Ga0207683_100148806 112
654 3300026142 Ga0207698_10216227 Ga0207698_102162272 112
655 3300027695 Ga0209966_1011294 Ga0209966_10112942 112
656 3300027717 Ga0209998_10095094 Ga0209998_100950942 112
657 3300027876 Ga0209974_10118171 Ga0209974_101181712 112
658 3300027907 Ga0207428_10146583 Ga0207428_101465832 112
659 3300027907 Ga0207428_10253923 Ga0207428_102539232 112
660 3300028379 Ga0268266_10992179 Ga0268266_109921792 112
661 3300028381 Ga0268264_10382876 Ga0268264_103828762 112
662 3300028381 Ga0268264_10909151 Ga0268264_109091512 112
663 3300031548 Ga0307408_100379632 Ga0307408_1003796322 112
664 3300031731 Ga0307405_10049727 Ga0307405_100497272 112
665 3300031852 Ga0307410_10803152 Ga0307410_108031521 112
666 3300031901 Ga0307406_10497429 Ga0307406_104974292 112
667 3300031911 Ga0307412_10059107 Ga0307412_100591072 112
668 3300032002 Ga0307416_100016705 Ga0307416_1000167052 112
669 3300032126 Ga0307415_100044616 Ga0307415_1000446162 112
670 3300034957 Ga0373938_0044612 Ga0373938_0044612_13_351 112
671 3300035092 Ga0373952_0274811 Ga0373952_0274811_40_378 112
672 3300035112 Ga0373932_0415318 Ga0373932_0415318_51_389 112
673 3300035121 Ga0373960_0047630 Ga0373960_0047630_97_435 112
674 3300035170 Ga0373943_0658858 Ga0373943_0658858_49_387 112
675 3300035171 Ga0373946_0078991 Ga0373946_0078991_638_976 112
676 3300035172 Ga0373955_0690990 Ga0373955_0690990_227_565 112
677 3300035207 Ga0373942_0085696 Ga0373942_0085696_53_391 112
678 3300035410 Ga0373924_0477039 Ga0373924_0477039_14_352 112
679 3300035692 Ga0373935_0129286 Ga0373935_0129286_1139_1477 112
680 3300035695 Ga0373927_0580503 Ga0373927_0580503_197_535 112
681 3300037068 Ga0373925_0163307 Ga0373925_0163307_969_1307 112
682 3300037068 Ga0373925_0434024 Ga0373925_0434024_139_477 112
683 3300041458 Ga0451798_0825340 Ga0451798_0825340_211_555 112
684 3300041459 Ga0451800_0796850 Ga0451800_0796850_72_410 112
685 3300046459 Ga0495629_0856717 Ga0495629_0856717_134_472 112
686 3300046461 Ga0495641_0207838 Ga0495641_0207838_374_712 112
687 3300046463 Ga0495653_0270366 Ga0495653_0270366_389_727 112
688 3300046476 Ga0495662_0528742 Ga0495662_0528742_222_560 112
689 3300046516 Ga0495628_0269161 Ga0495628_0269161_169_507 112
690 3300046517 Ga0495630_0217352 Ga0495630_0217352_691_1029 112
691 3300046526 Ga0495666_0297184 Ga0495666_0297184_178_516 112
692 3300046529 Ga0495652_0798606 Ga0495652_0798606_192_530 112
693 3300046535 Ga0495586_0405346 Ga0495586_0405346_315_653 112
694 3300046642 Ga0495634_0644426 Ga0495634_0644426_69_407 112
695 3300046678 Ga0495599_0636489 Ga0495599_0636489_148_486 112
696 3300046681 Ga0495647_0056572 Ga0495647_0056572_348_686 112
697 3300046683 Ga0495658_0103775 Ga0495658_0103775_969_1307 112
698 3300046689 Ga0495613_0432401 Ga0495613_0432401_49_387 112
699 3300046690 Ga0495624_0540560 Ga0495624_0540560_332_670 112
700 3300047315 Ga0495581_0134414 Ga0495581_0134414_827_1165 112
701 3300047319 Ga0495674_0969056 Ga0495674_0969056_160_498 112
702 3300047321 Ga0495676_0837706 Ga0495676_0837706_208_546 112
703 3300047322 Ga0495680_0818508 Ga0495680_0818508_234_572 112
704 3300048089 Ga0495614_0349779 Ga0495614_0349779_274_612 112
705 3300048903 Ga0496100_0504556 Ga0496100_0504556_71_409 112
706 3300048904 Ga0496101_0641232 Ga0496101_0641232_430_768 112
707 3300048904 Ga0496101_0668067 Ga0496101_0668067_82_420 112
708 3300048905 Ga0496102_0300365 Ga0496102_0300365_773_1111 112
709 3300048905 Ga0496102_0767965 Ga0496102_0767965_155_493 112
710 3300048906 Ga0496103_0133682 Ga0496103_0133682_445_783 112
711 3300048907 Ga0496104_0172375 Ga0496104_0172375_17_355 112
712 3300048907 Ga0496104_0175188 Ga0496104_0175188_36_374 112
713 3300048907 Ga0496104_0537846 Ga0496104_0537846_456_794 112
714 3300048908 Ga0496105_0422287 Ga0496105_0422287_376_714 112
715 3300048908 Ga0496105_0987375 Ga0496105_0987375_16_354 112
716 3300048909 Ga0496106_0698786 Ga0496106_0698786_403_741 112
717 3300048909 Ga0496106_0816636 Ga0496106_0816636_158_496 112
718 3300048910 Ga0496107_0147136 Ga0496107_0147136_99_437 112
719 3300048911 Ga0496108_0003323 Ga0496108_0003323_7635_7973 112
720 3300048911 Ga0496108_0005914 Ga0496108_0005914_3822_4160 112
721 3300048911 Ga0496108_0015800 Ga0496108_0015800_2575_2913 112
722 3300048912 Ga0496109_0004880 Ga0496109_0004880_1739_2077 112
723 3300048912 Ga0496109_0009032 Ga0496109_0009032_3295_3633 112
724 3300048912 Ga0496109_0100411 Ga0496109_0100411_208_546 112
725 3300048913 Ga0496110_0009313 Ga0496110_0009313_5779_6117 112
726 3300048913 Ga0496110_0039305 Ga0496110_0039305_587_925 112
727 3300048913 Ga0496110_0154951 Ga0496110_0154951_322_660 112
728 3300048914 Ga0496111_0105994 Ga0496111_0105994_817_1155 112
729 3300048914 Ga0496111_0130885 Ga0496111_0130885_1421_1759 112
730 3300048914 Ga0496111_0179431 Ga0496111_0179431_323_661 112
731 3300048915 Ga0496112_0005846 Ga0496112_0005846_5511_5849 112
732 3300048915 Ga0496112_0155134 Ga0496112_0155134_1352_1690 112
733 3300048916 Ga0496113_0050285 Ga0496113_0050285_2623_2961 112
734 3300048916 Ga0496113_0068855 Ga0496113_0068855_1399_1737 112
735 3300048916 Ga0496113_0392882 Ga0496113_0392882_596_934 112
736 3300048917 Ga0496114_0230424 Ga0496114_0230424_466_804 112
737 3300048917 Ga0496114_0867561 Ga0496114_0867561_231_569 112
738 3300048918 Ga0496115_0807401 Ga0496115_0807401_157_495 112
739 3300049572 Ga0501036_0289417 Ga0501036_0289417_996_1334 112
740 3300049576 Ga0501040_0146270 Ga0501040_0146270_1095_1433 112
741 3300049577 Ga0501041_0495852 Ga0501041_0495852_47_385 112
742 3300049577 Ga0501041_0509618 Ga0501041_0509618_190_528 112
743 3300049582 Ga0501048_0891206 Ga0501048_0891206_61_399 112
744 3300049583 Ga0501067_0212423 Ga0501067_0212423_579_923 112
745 3300049585 Ga0501069_0672016 Ga0501069_0672016_109_447 112
746 3300049591 Ga0501075_0062850 Ga0501075_0062850_1456_1794 112
747 3300049591 Ga0501075_0843895 Ga0501075_0843895_225_563 112
748 3300049741 Ga0501079_0165064 Ga0501079_0165064_944_1282 112
749 3300049824 Ga0501045_0656337 Ga0501045_0656337_239_595 112
750 3300050492 nmdc:mga0yw44_102227_c1 nmdc:mga0yw44_102227_c1_646_984 112
751 3300050507 nmdc:mga05p37_1133384_c1 nmdc:mga05p37_1133384_c1_378_716 112
752 3300050507 nmdc:mga05p37_150470_c1 nmdc:mga05p37_150470_c1_127_465 112
753 3300050510 nmdc:mga06r32_822837_c1 nmdc:mga06r32_822837_c1_501_839 112
754 3300050511 nmdc:mga08y16_107219_c1 nmdc:mga08y16_107219_c1_921_1259 112
755 3300050512 nmdc:mga0n895_246792_c1 nmdc:mga0n895_246792_c1_123_461 112
756 3300050514 nmdc:mga08x19_965442_c1 nmdc:mga08x19_965442_c1_136_477 112
757 3300050515 nmdc:mga0a205_45435_c1 nmdc:mga0a205_45435_c1_951_1289 112
758 3300053077 Ga0495601_0043640 Ga0495601_0043640_2378_2716 112
759 3300053085 Ga0495619_0059283 Ga0495619_0059283_1669_2007 112
760 3300054114 Ga0501084_0078935 Ga0501084_0078935_1185_1523 112
761 3300054114 Ga0501084_0762733 Ga0501084_0762733_91_429 112
762 3300061734 Ga0530510_0148845 Ga0530510_0148845_732_1079 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12769

PNTB_4TM

4TM region of pyridine nucleotide transhydrogenase, mitoch

8

92

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vzb-assembly1.cif.gz_A a dodecameric thioferritin in the bacterial domain, characterization of the bacterioferritin-related protein from bacteroides fragilis 0.7429 28 92
3rj1-assembly1.cif.gz_A architecture of the mediator head module 0.7204 36 95
8ij9-assembly1.cif.gz_C crystal structure of the elks1/rab6b complex 0.7189 33 94
8glv-assembly1.cif.gz_HE 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.6802 23 88
4uxz-assembly1.cif.gz_C structure of delta7-dgka-syn in 7.9 mag to 2.18 angstrom resolution 0.6159 17 95
ID Description Score Start End Superfamily
af_Q552M6_244_370_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7697 30 92 3.30.40.10
af_Q95XR1_4_111_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7207 39 105 1.20.58.90
4aflC00 Special;Helix non-globular;Helix Hairpins; 0.7164 33 95 6.10.140.1740
af_A0A1D8PK25_22_146_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7143 29 105 1.20.58.70
af_A0A0R0F7N4_1_104_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6705 39 99 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A442UTR1-F1-model_v4 Uncharacterized protein 0.7277 39 108
AF-A0A842WVZ0-F1-model_v4 Uncharacterized protein 0.7012 32 106 GO:0016020
AF-A0A7C9IUW1-F1-model_v4 ATP-binding cassette domain-containing protein 0.686 36 112 GO:0005524
GO:0016887
AF-A0A6H9RZ11-F1-model_v4 proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) 0.6843 29 106 GO:0005886
GO:0006740
GO:0008750
GO:0050661
AF-A0A7S1WTL7-F1-model_v4 Uncharacterized protein 0.6767 22 104

Feature Viewer

pLDDT pTM Quality
81.04 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map