F479631
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 762 | 372 | 756 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300025906|Ga0207699_10018962|Ga0207699_100189621 |
| Length | 128 |
| Sequence | MTTELLTDLTIFALAVLVGFEVISKVPATLHTPLMSGANSIHGVVLIGAMVITAAVSAPYAYVLGAVAMAFAAMNVVGGYVVTDRMLHMFRRRPAASLDLAHSHGRRNSQDVQMFLDLGCSWRRFVYT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 2 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 3 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 4 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 5 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 6 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 104 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 105 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 191 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 199 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 200 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 204 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 206 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 213 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 214 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 217 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 218 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 219 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 221 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 230 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 231 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 232 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 234 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 235 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 238 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 247 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 252 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 253 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 257 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 260 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 261 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 262 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 263 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 264 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 265 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 266 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 267 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 268 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 269 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 320 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 321 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 322 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 323 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 324 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 325 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 328 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 329 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 330 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 331 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 332 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 333 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 334 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 335 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 336 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 337 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 349 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 353 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 362 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 365 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 366 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 367 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 368 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 369 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 370 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 372 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.69 |
| Metatranscriptomes | 0.52 |
| Isolates | 0.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.31 |
| Nodule | 0.52 |
| Rhizoplane | 7.22 |
| Rhizosphere | 87.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1023400 | 3300001978 | Bacteria | 682 |
| 2 | JGI24743J22301_10153110 | 3300001991 | Bacteria | 517 |
| 3 | JGI24745J21846_1038504 | 3300002073 | Bacteria | 589 |
| 4 | JGI24742J22300_10082188 | 3300002244 | Bacteria | 610 |
| 5 | JGI24751J29686_10042150 | 3300002459 | Bacteria | 944 |
| 6 | Ga0070658_10473754 | 3300005327 | Bacteria | 1080 |
| 7 | Ga0070658_11402803 | 3300005327 | Bacteria | 606 |
| 8 | Ga0070676_10255187 | 3300005328 | Bacteria | 1172 |
| 9 | Ga0070676_10613891 | 3300005328 | Bacteria | 786 |
| 10 | Ga0070683_100177559 | 3300005329 | Bacteria | 2021 |
| 11 | Ga0070683_100200707 | 3300005329 | Bacteria | 1894 |
| 12 | Ga0070683_101859534 | 3300005329 | Bacteria | 579 |
| 13 | Ga0070690_100037680 | 3300005330 | Bacteria | 3048 |
| 14 | Ga0070670_101230925 | 3300005331 | Bacteria | 684 |
| 15 | Ga0068869_100114110 | 3300005334 | Bacteria | 2059 |
| 16 | Ga0070680_100000173 | 3300005336 | Bacteria | 41269 |
| 17 | Ga0070680_100401817 | 3300005336 | Bacteria | 1168 |
| 18 | Ga0070682_100364398 | 3300005337 | Bacteria | 1082 |
| 19 | Ga0068868_100145338 | 3300005338 | Bacteria | 1949 |
| 20 | Ga0068868_100360915 | 3300005338 | Bacteria | 1246 |
| 21 | Ga0070689_100066074 | 3300005340 | Bacteria | 2817 |
| 22 | Ga0070689_100323312 | 3300005340 | Bacteria | 1289 |
| 23 | Ga0070691_10097668 | 3300005341 | Bacteria | 1455 |
| 24 | Ga0070661_100036201 | 3300005344 | Bacteria | 3588 |
| 25 | Ga0070661_100383838 | 3300005344 | Bacteria | 1108 |
| 26 | Ga0070692_10016618 | 3300005345 | Bacteria | 3501 |
| 27 | Ga0070692_11276762 | 3300005345 | Bacteria | 526 |
| 28 | Ga0070669_100220714 | 3300005353 | Bacteria | 1499 |
| 29 | Ga0070675_100003195 | 3300005354 | Bacteria | 12415 |
| 30 | Ga0070675_100232228 | 3300005354 | Bacteria | 1609 |
| 31 | Ga0070671_101218634 | 3300005355 | Bacteria | 663 |
| 32 | Ga0070674_100003451 | 3300005356 | Bacteria | 8881 |
| 33 | Ga0070674_100572353 | 3300005356 | Bacteria | 951 |
| 34 | Ga0070674_101162177 | 3300005356 | Bacteria | 684 |
| 35 | Ga0070673_100188355 | 3300005364 | Bacteria | 1771 |
| 36 | Ga0070688_100053936 | 3300005365 | Bacteria | 2516 |
| 37 | Ga0070659_100010996 | 3300005366 | Bacteria | 6683 |
| 38 | Ga0070667_100367435 | 3300005367 | Bacteria | 1305 |
| 39 | Ga0070709_10627848 | 3300005434 | Bacteria | 830 |
| 40 | Ga0070714_100001186 | 3300005435 | Bacteria | 18758 |
| 41 | Ga0070714_101164065 | 3300005435 | Bacteria | 752 |
| 42 | Ga0070713_100280763 | 3300005436 | Bacteria | 1528 |
| 43 | Ga0070713_101495781 | 3300005436 | Bacteria | 655 |
| 44 | Ga0070710_10796291 | 3300005437 | Bacteria | 675 |
| 45 | Ga0070701_10004477 | 3300005438 | Bacteria | 5668 |
| 46 | Ga0070701_10640029 | 3300005438 | Bacteria | 709 |
| 47 | Ga0070705_100124650 | 3300005440 | Bacteria | 1669 |
| 48 | Ga0070705_100127636 | 3300005440 | Bacteria | 1654 |
| 49 | Ga0070705_100222860 | 3300005440 | Bacteria | 1307 |
| 50 | Ga0070705_100543001 | 3300005440 | Bacteria | 890 |
| 51 | Ga0070705_101098226 | 3300005440 | Bacteria | 651 |
| 52 | Ga0070700_100193487 | 3300005441 | Bacteria | 1424 |
| 53 | Ga0070700_100218892 | 3300005441 | Bacteria | 1348 |
| 54 | Ga0070694_100074556 | 3300005444 | Bacteria | 2345 |
| 55 | Ga0070694_100138455 | 3300005444 | Bacteria | 1765 |
| 56 | Ga0070694_100405529 | 3300005444 | Bacteria | 1068 |
| 57 | Ga0070694_101779322 | 3300005444 | Bacteria | 525 |
| 58 | Ga0070708_100038454 | 3300005445 | Bacteria | 4180 |
| 59 | Ga0070708_101267220 | 3300005445 | Bacteria | 689 |
| 60 | Ga0070708_102055054 | 3300005445 | Bacteria | 529 |
| 61 | Ga0070663_100603088 | 3300005455 | Bacteria | 924 |
| 62 | Ga0070663_100749357 | 3300005455 | Bacteria | 834 |
| 63 | Ga0070678_100104420 | 3300005456 | Bacteria | 2203 |
| 64 | Ga0070678_100297911 | 3300005456 | Bacteria | 1369 |
| 65 | Ga0070678_101666027 | 3300005456 | Bacteria | 600 |
| 66 | Ga0070662_100078511 | 3300005457 | Bacteria | 2452 |
| 67 | Ga0068867_100169807 | 3300005459 | Bacteria | 1726 |
| 68 | Ga0068867_102421492 | 3300005459 | Bacteria | 500 |
| 69 | Ga0070685_10027087 | 3300005466 | Bacteria | 3165 |
| 70 | Ga0070706_100000600 | 3300005467 | Bacteria | 41740 |
| 71 | Ga0070706_100217714 | 3300005467 | Bacteria | 1782 |
| 72 | Ga0070707_100004383 | 3300005468 | Bacteria | 13213 |
| 73 | Ga0070707_100420595 | 3300005468 | Bacteria | 1297 |
| 74 | Ga0070707_100762923 | 3300005468 | Bacteria | 931 |
| 75 | Ga0070707_101115226 | 3300005468 | Bacteria | 755 |
| 76 | Ga0070707_101168254 | 3300005468 | Bacteria | 736 |
| 77 | Ga0070698_100361535 | 3300005471 | Bacteria | 1383 |
| 78 | Ga0070698_100369777 | 3300005471 | Bacteria | 1366 |
| 79 | Ga0070698_100749695 | 3300005471 | Bacteria | 919 |
| 80 | Ga0070698_102112350 | 3300005471 | Bacteria | 517 |
| 81 | Ga0070699_100047696 | 3300005518 | Bacteria | 3706 |
| 82 | Ga0070699_100185627 | 3300005518 | Bacteria | 1846 |
| 83 | Ga0070699_100499335 | 3300005518 | Bacteria | 1105 |
| 84 | Ga0070699_100884803 | 3300005518 | Bacteria | 818 |
| 85 | Ga0070679_100198519 | 3300005530 | Bacteria | 1973 |
| 86 | Ga0070684_100349190 | 3300005535 | Bacteria | 1360 |
| 87 | Ga0070697_100105933 | 3300005536 | Bacteria | 2339 |
| 88 | Ga0070697_100166236 | 3300005536 | Bacteria | 1865 |
| 89 | Ga0070697_100187932 | 3300005536 | Bacteria | 1753 |
| 90 | Ga0070697_100366041 | 3300005536 | Bacteria | 1247 |
| 91 | Ga0070697_100409857 | 3300005536 | Bacteria | 1177 |
| 92 | Ga0070697_100994137 | 3300005536 | Bacteria | 746 |
| 93 | Ga0070672_100405098 | 3300005543 | Bacteria | 1170 |
| 94 | Ga0070672_100618225 | 3300005543 | Bacteria | 945 |
| 95 | Ga0070672_101202128 | 3300005543 | Bacteria | 675 |
| 96 | Ga0070686_100072419 | 3300005544 | Bacteria | 2259 |
| 97 | Ga0070686_100126178 | 3300005544 | Bacteria | 1764 |
| 98 | Ga0070686_100187324 | 3300005544 | Bacteria | 1474 |
| 99 | Ga0070686_100312082 | 3300005544 | Bacteria | 1170 |
| 100 | Ga0070695_100003885 | 3300005545 | Bacteria | 8718 |
| 101 | Ga0070696_100003098 | 3300005546 | Bacteria | 11060 |
| 102 | Ga0070696_100085253 | 3300005546 | Bacteria | 2242 |
| 103 | Ga0070696_100098053 | 3300005546 | Bacteria | 2096 |
| 104 | Ga0070696_100267424 | 3300005546 | Bacteria | 1299 |
| 105 | Ga0070696_101348758 | 3300005546 | Bacteria | 607 |
| 106 | Ga0070693_100675093 | 3300005547 | Bacteria | 754 |
| 107 | Ga0070693_100758259 | 3300005547 | Bacteria | 716 |
| 108 | Ga0070665_100010070 | 3300005548 | Bacteria | 9569 |
| 109 | Ga0070665_100033640 | 3300005548 | Bacteria | 5157 |
| 110 | Ga0070665_100192169 | 3300005548 | Bacteria | 2042 |
| 111 | Ga0070665_102271418 | 3300005548 | Bacteria | 546 |
| 112 | Ga0070704_100175309 | 3300005549 | Bacteria | 1710 |
| 113 | Ga0070704_100266781 | 3300005549 | Bacteria | 1412 |
| 114 | Ga0068855_100009172 | 3300005563 | Bacteria | 11949 |
| 115 | Ga0068855_100495608 | 3300005563 | Bacteria | 1328 |
| 116 | Ga0070664_100207918 | 3300005564 | Bacteria | 1748 |
| 117 | Ga0070664_102023982 | 3300005564 | Bacteria | 547 |
| 118 | Ga0068857_100060936 | 3300005577 | Bacteria | 3352 |
| 119 | Ga0068854_100007587 | 3300005578 | Bacteria | 6936 |
| 120 | Ga0068854_100050725 | 3300005578 | Bacteria | 2971 |
| 121 | Ga0068854_100073114 | 3300005578 | Bacteria | 2512 |
| 122 | Ga0068854_100927683 | 3300005578 | Bacteria | 767 |
| 123 | Ga0068856_100209416 | 3300005614 | Bacteria | 1965 |
| 124 | Ga0068856_101582146 | 3300005614 | Bacteria | 669 |
| 125 | Ga0070702_100034963 | 3300005615 | Bacteria | 2774 |
| 126 | Ga0070702_100438474 | 3300005615 | Bacteria | 944 |
| 127 | Ga0068852_100269854 | 3300005616 | Bacteria | 1637 |
| 128 | Ga0068852_100272016 | 3300005616 | Bacteria | 1630 |
| 129 | Ga0068852_102334760 | 3300005616 | Bacteria | 556 |
| 130 | Ga0068859_100014708 | 3300005617 | Bacteria | 7863 |
| 131 | Ga0068864_100619603 | 3300005618 | Bacteria | 1051 |
| 132 | Ga0068864_101743908 | 3300005618 | Bacteria | 628 |
| 133 | Ga0068866_10058423 | 3300005718 | Bacteria | 1992 |
| 134 | Ga0068861_100788669 | 3300005719 | Bacteria | 891 |
| 135 | Ga0068870_10635229 | 3300005840 | Bacteria | 729 |
| 136 | Ga0068863_100119652 | 3300005841 | Bacteria | 2510 |
| 137 | Ga0068863_100176763 | 3300005841 | Bacteria | 2049 |
| 138 | Ga0068863_100942310 | 3300005841 | Bacteria | 865 |
| 139 | Ga0068858_100041760 | 3300005842 | Bacteria | 4252 |
| 140 | Ga0068858_100074755 | 3300005842 | Bacteria | 3147 |
| 141 | Ga0068858_100106444 | 3300005842 | Bacteria | 2618 |
| 142 | Ga0068858_100784991 | 3300005842 | Bacteria | 929 |
| 143 | Ga0068860_100621775 | 3300005843 | Bacteria | 1087 |
| 144 | Ga0068860_101304215 | 3300005843 | Bacteria | 747 |
| 145 | Ga0068862_100891559 | 3300005844 | Bacteria | 874 |
| 146 | Ga0075365_10063862 | 3300006038 | Bacteria | 2465 |
| 147 | Ga0070715_10248645 | 3300006163 | Bacteria | 928 |
| 148 | Ga0070715_10317337 | 3300006163 | Bacteria | 840 |
| 149 | Ga0097621_100515450 | 3300006237 | Bacteria | 1085 |
| 150 | Ga0097621_100637377 | 3300006237 | Bacteria | 977 |
| 151 | Ga0068871_101420216 | 3300006358 | Bacteria | 654 |
| 152 | Ga0068871_102086601 | 3300006358 | Bacteria | 540 |
| 153 | Ga0075428_100161554 | 3300006844 | Bacteria | 2431 |
| 154 | Ga0075431_100305488 | 3300006847 | Bacteria | 1607 |
| 155 | Ga0075433_10247530 | 3300006852 | Bacteria | 1582 |
| 156 | Ga0075434_100259178 | 3300006871 | Bacteria | 1758 |
| 157 | Ga0075434_101285209 | 3300006871 | Bacteria | 743 |
| 158 | Ga0068865_100173369 | 3300006881 | Bacteria | 1655 |
| 159 | Ga0068865_102107785 | 3300006881 | Bacteria | 513 |
| 160 | Ga0097620_100014708 | 3300006931 | Bacteria | 7863 |
| 161 | Ga0097620_101664502 | 3300006931 | Bacteria | 705 |
| 162 | Ga0075435_100581200 | 3300007076 | Bacteria | 971 |
| 163 | Ga0075435_101136725 | 3300007076 | Bacteria | 683 |
| 164 | Ga0105244_10064083 | 3300009036 | Bacteria | 1845 |
| 165 | Ga0105240_10694343 | 3300009093 | Bacteria | 1111 |
| 166 | Ga0105240_11151478 | 3300009093 | Bacteria | 823 |
| 167 | Ga0111539_10065305 | 3300009094 | Bacteria | 4301 |
| 168 | Ga0111539_10102438 | 3300009094 | Bacteria | 3360 |
| 169 | Ga0111539_10134033 | 3300009094 | Bacteria | 2900 |
| 170 | Ga0111539_12691021 | 3300009094 | Bacteria | 577 |
| 171 | Ga0105245_10281584 | 3300009098 | Bacteria | 1625 |
| 172 | Ga0105245_10945336 | 3300009098 | Bacteria | 905 |
| 173 | Ga0105245_11002706 | 3300009098 | Bacteria | 879 |
| 174 | Ga0105245_11106658 | 3300009098 | Bacteria | 839 |
| 175 | Ga0105247_10127638 | 3300009101 | Bacteria | 1654 |
| 176 | Ga0105247_10129474 | 3300009101 | Bacteria | 1643 |
| 177 | Ga0114129_10291584 | 3300009147 | Bacteria | 2177 |
| 178 | Ga0114129_10322791 | 3300009147 | Bacteria | 2052 |
| 179 | Ga0114129_10469717 | 3300009147 | Bacteria | 1647 |
| 180 | Ga0105243_10012149 | 3300009148 | Bacteria | 6509 |
| 181 | Ga0105243_10521671 | 3300009148 | Bacteria | 1130 |
| 182 | Ga0105243_12348920 | 3300009148 | Unclassified | 571 |
| 183 | Ga0105241_10001574 | 3300009174 | Bacteria | 17467 |
| 184 | Ga0105241_10285007 | 3300009174 | Bacteria | 1412 |
| 185 | Ga0105241_10708312 | 3300009174 | Bacteria | 920 |
| 186 | Ga0105242_10017160 | 3300009176 | Bacteria | 5637 |
| 187 | Ga0105242_10254328 | 3300009176 | Bacteria | 1584 |
| 188 | Ga0105242_10551471 | 3300009176 | Bacteria | 1105 |
| 189 | Ga0105242_11587573 | 3300009176 | Bacteria | 687 |
| 190 | Ga0105248_10045858 | 3300009177 | Bacteria | 4900 |
| 191 | Ga0105248_10055704 | 3300009177 | Bacteria | 4436 |
| 192 | Ga0105237_10658030 | 3300009545 | Bacteria | 1054 |
| 193 | Ga0105237_11822945 | 3300009545 | Bacteria | 616 |
| 194 | Ga0105238_10008792 | 3300009551 | Bacteria | 10106 |
| 195 | Ga0105238_10032490 | 3300009551 | Bacteria | 5311 |
| 196 | Ga0105238_11889610 | 3300009551 | Bacteria | 630 |
| 197 | Ga0105238_12324891 | 3300009551 | Bacteria | 571 |
| 198 | Ga0105249_10009446 | 3300009553 | Bacteria | 8540 |
| 199 | Ga0105249_12682137 | 3300009553 | Bacteria | 570 |
| 200 | Ga0099796_10037250 | 3300010159 | Bacteria | 1625 |
| 201 | Ga0105239_10032267 | 3300010375 | Bacteria | 5756 |
| 202 | Ga0105239_10077529 | 3300010375 | Bacteria | 3657 |
| 203 | Ga0105239_10887695 | 3300010375 | Bacteria | 1023 |
| 204 | Ga0105239_12717477 | 3300010375 | Bacteria | 578 |
| 205 | Ga0105246_10344241 | 3300011119 | Bacteria | 1219 |
| 206 | Ga0105246_10758612 | 3300011119 | Bacteria | 857 |
| 207 | Ga0157318_1015878 | 3300012482 | Bacteria | 620 |
| 208 | Ga0157337_1011631 | 3300012483 | Bacteria | 698 |
| 209 | Ga0157314_1047316 | 3300012500 | Bacteria | 539 |
| 210 | Ga0157373_10703448 | 3300013100 | Bacteria | 741 |
| 211 | Ga0157371_10623866 | 3300013102 | Bacteria | 803 |
| 212 | Ga0157371_11356223 | 3300013102 | Bacteria | 551 |
| 213 | Ga0157374_10320086 | 3300013296 | Bacteria | 1537 |
| 214 | Ga0157374_10670941 | 3300013296 | Bacteria | 1049 |
| 215 | Ga0157374_10884523 | 3300013296 | Bacteria | 911 |
| 216 | Ga0157378_10235208 | 3300013297 | Bacteria | 1748 |
| 217 | Ga0157378_10240813 | 3300013297 | Bacteria | 1728 |
| 218 | Ga0157378_11755589 | 3300013297 | Bacteria | 668 |
| 219 | Ga0163162_10014545 | 3300013306 | Bacteria | 7690 |
| 220 | Ga0163162_10203360 | 3300013306 | Bacteria | 2110 |
| 221 | Ga0163162_10994652 | 3300013306 | Bacteria | 948 |
| 222 | Ga0157372_11620060 | 3300013307 | Bacteria | 745 |
| 223 | Ga0157375_10119364 | 3300013308 | Bacteria | 2745 |
| 224 | Ga0157375_11302548 | 3300013308 | Bacteria | 854 |
| 225 | Ga0163163_10055263 | 3300014325 | Bacteria | 3924 |
| 226 | Ga0163163_12432360 | 3300014325 | Bacteria | 582 |
| 227 | Ga0157380_10026353 | 3300014326 | Bacteria | 4413 |
| 228 | Ga0157380_10664514 | 3300014326 | Bacteria | 1042 |
| 229 | Ga0157380_11987813 | 3300014326 | Bacteria | 643 |
| 230 | Ga0157377_10015266 | 3300014745 | Bacteria | 3924 |
| 231 | Ga0157379_10069686 | 3300014968 | Bacteria | 3146 |
| 232 | Ga0157379_10076655 | 3300014968 | Bacteria | 2994 |
| 233 | Ga0157379_10138620 | 3300014968 | Bacteria | 2192 |
| 234 | Ga0157379_10354370 | 3300014968 | Bacteria | 1344 |
| 235 | Ga0157379_10648118 | 3300014968 | Bacteria | 989 |
| 236 | Ga0157379_10934432 | 3300014968 | Bacteria | 824 |
| 237 | Ga0157376_10205467 | 3300014969 | Bacteria | 1815 |
| 238 | Ga0157376_10790416 | 3300014969 | Bacteria | 961 |
| 239 | Ga0163161_10035856 | 3300017792 | Bacteria | 3551 |
| 240 | Ga0163161_10322340 | 3300017792 | Bacteria | 1222 |
| 241 | Ga0163161_10701708 | 3300017792 | Bacteria | 842 |
| 242 | Ga0163161_10967421 | 3300017792 | Bacteria | 725 |
| 243 | Ga0206356_11816342 | 3300020070 | Bacteria | 520 |
| 244 | Ga0207656_10241787 | 3300025321 | Bacteria | 882 |
| 245 | Ga0207655_1164228 | 3300025728 | Bacteria | 691 |
| 246 | Ga0207682_10084185 | 3300025893 | Bacteria | 1368 |
| 247 | Ga0207692_10657733 | 3300025898 | Bacteria | 677 |
| 248 | Ga0207692_10736018 | 3300025898 | Bacteria | 642 |
| 249 | Ga0207642_10043856 | 3300025899 | Bacteria | 1976 |
| 250 | Ga0207710_10343007 | 3300025900 | Bacteria | 760 |
| 251 | Ga0207688_10034995 | 3300025901 | Bacteria | 2782 |
| 252 | Ga0207688_10885733 | 3300025901 | Bacteria | 565 |
| 253 | Ga0207680_10040440 | 3300025903 | Bacteria | 2713 |
| 254 | Ga0207680_10380313 | 3300025903 | Bacteria | 995 |
| 255 | Ga0207647_10002717 | 3300025904 | Bacteria | 13365 |
| 256 | Ga0207685_10205343 | 3300025905 | Bacteria | 928 |
| 257 | Ga0207699_10018962 | 3300025906 | Bacteria | 3657 |
| 258 | Ga0207645_10060142 | 3300025907 | Bacteria | 2426 |
| 259 | Ga0207645_10456544 | 3300025907 | Bacteria | 863 |
| 260 | Ga0207643_10006292 | 3300025908 | Bacteria | 6356 |
| 261 | Ga0207684_10000496 | 3300025910 | Bacteria | 49956 |
| 262 | Ga0207684_10171173 | 3300025910 | Bacteria | 1872 |
| 263 | Ga0207684_10604758 | 3300025910 | Bacteria | 936 |
| 264 | Ga0207707_10578243 | 3300025912 | Bacteria | 952 |
| 265 | Ga0207707_11325135 | 3300025912 | Bacteria | 577 |
| 266 | Ga0207695_10002678 | 3300025913 | Bacteria | 26007 |
| 267 | Ga0207671_10001035 | 3300025914 | Bacteria | 33836 |
| 268 | Ga0207660_10000004 | 3300025917 | Bacteria | 371608 |
| 269 | Ga0207660_10314339 | 3300025917 | Bacteria | 1250 |
| 270 | Ga0207660_11357618 | 3300025917 | Bacteria | 576 |
| 271 | Ga0207662_10000807 | 3300025918 | Bacteria | 14429 |
| 272 | Ga0207662_10418128 | 3300025918 | Bacteria | 912 |
| 273 | Ga0207657_10011341 | 3300025919 | Bacteria | 8851 |
| 274 | Ga0207657_10145625 | 3300025919 | Bacteria | 1932 |
| 275 | Ga0207649_10172487 | 3300025920 | Bacteria | 1508 |
| 276 | Ga0207652_10601970 | 3300025921 | Bacteria | 985 |
| 277 | Ga0207646_10002151 | 3300025922 | Bacteria | 23529 |
| 278 | Ga0207646_10335464 | 3300025922 | Bacteria | 1366 |
| 279 | Ga0207646_11019218 | 3300025922 | Bacteria | 731 |
| 280 | Ga0207681_10055582 | 3300025923 | Bacteria | 2697 |
| 281 | Ga0207694_10001558 | 3300025924 | Bacteria | 19464 |
| 282 | Ga0207694_10831381 | 3300025924 | Bacteria | 780 |
| 283 | Ga0207650_11035775 | 3300025925 | Bacteria | 698 |
| 284 | Ga0207659_10237984 | 3300025926 | Bacteria | 1471 |
| 285 | Ga0207659_10641601 | 3300025926 | Bacteria | 907 |
| 286 | Ga0207687_10200819 | 3300025927 | Bacteria | 1558 |
| 287 | Ga0207687_10230182 | 3300025927 | Bacteria | 1464 |
| 288 | Ga0207687_10492345 | 3300025927 | Bacteria | 1022 |
| 289 | Ga0207687_11164835 | 3300025927 | Bacteria | 662 |
| 290 | Ga0207700_11271457 | 3300025928 | Bacteria | 656 |
| 291 | Ga0207700_11573324 | 3300025928 | Bacteria | 582 |
| 292 | Ga0207664_10000733 | 3300025929 | Bacteria | 22277 |
| 293 | Ga0207664_10883369 | 3300025929 | Bacteria | 803 |
| 294 | Ga0207664_11796293 | 3300025929 | Bacteria | 536 |
| 295 | Ga0207644_10942352 | 3300025931 | Bacteria | 724 |
| 296 | Ga0207690_10909209 | 3300025932 | Bacteria | 730 |
| 297 | Ga0207690_11541090 | 3300025932 | Bacteria | 556 |
| 298 | Ga0207706_10198270 | 3300025933 | Bacteria | 1761 |
| 299 | Ga0207706_10334565 | 3300025933 | Bacteria | 1317 |
| 300 | Ga0207686_10421994 | 3300025934 | Bacteria | 1020 |
| 301 | Ga0207709_10041173 | 3300025935 | Bacteria | 2771 |
| 302 | Ga0207709_10051472 | 3300025935 | Bacteria | 2525 |
| 303 | Ga0207709_10053264 | 3300025935 | Bacteria | 2489 |
| 304 | Ga0207669_10256886 | 3300025937 | Bacteria | 1304 |
| 305 | Ga0207669_10666941 | 3300025937 | Bacteria | 852 |
| 306 | Ga0207669_10697621 | 3300025937 | Bacteria | 834 |
| 307 | Ga0207704_10076829 | 3300025938 | Bacteria | 2141 |
| 308 | Ga0207665_10234650 | 3300025939 | Bacteria | 1349 |
| 309 | Ga0207665_10319073 | 3300025939 | Bacteria | 1165 |
| 310 | Ga0207691_10014085 | 3300025940 | Bacteria | 7631 |
| 311 | Ga0207711_10039731 | 3300025941 | Bacteria | 4002 |
| 312 | Ga0207711_10060515 | 3300025941 | Bacteria | 3264 |
| 313 | Ga0207711_10356493 | 3300025941 | Bacteria | 1355 |
| 314 | Ga0207711_11468662 | 3300025941 | Bacteria | 625 |
| 315 | Ga0207689_10150793 | 3300025942 | Bacteria | 1916 |
| 316 | Ga0207661_11007865 | 3300025944 | Bacteria | 767 |
| 317 | Ga0207679_10748864 | 3300025945 | Bacteria | 889 |
| 318 | Ga0207679_11422441 | 3300025945 | Bacteria | 636 |
| 319 | Ga0207667_10067774 | 3300025949 | Bacteria | 3717 |
| 320 | Ga0207667_11564245 | 3300025949 | Bacteria | 629 |
| 321 | Ga0207651_10936720 | 3300025960 | Bacteria | 772 |
| 322 | Ga0207712_10075148 | 3300025961 | Bacteria | 2442 |
| 323 | Ga0207712_10325362 | 3300025961 | Bacteria | 1270 |
| 324 | Ga0207712_10994953 | 3300025961 | Bacteria | 744 |
| 325 | Ga0207668_11605281 | 3300025972 | Bacteria | 587 |
| 326 | Ga0207640_10413132 | 3300025981 | Bacteria | 1102 |
| 327 | Ga0207640_10584725 | 3300025981 | Bacteria | 943 |
| 328 | Ga0207640_10631669 | 3300025981 | Bacteria | 910 |
| 329 | Ga0207640_10673922 | 3300025981 | Bacteria | 884 |
| 330 | Ga0207658_10167464 | 3300025986 | Bacteria | 1807 |
| 331 | Ga0207658_10338161 | 3300025986 | Bacteria | 1308 |
| 332 | Ga0207658_10464909 | 3300025986 | Bacteria | 1122 |
| 333 | Ga0207677_10145521 | 3300026023 | Bacteria | 1820 |
| 334 | Ga0207677_10214014 | 3300026023 | Bacteria | 1541 |
| 335 | Ga0207703_10068272 | 3300026035 | Bacteria | 2929 |
| 336 | Ga0207703_10102022 | 3300026035 | Bacteria | 2434 |
| 337 | Ga0207703_10546618 | 3300026035 | Bacteria | 1092 |
| 338 | Ga0207703_11365014 | 3300026035 | Bacteria | 682 |
| 339 | Ga0207703_12391518 | 3300026035 | Bacteria | 504 |
| 340 | Ga0207678_10016986 | 3300026067 | Bacteria | 6388 |
| 341 | Ga0207678_10211109 | 3300026067 | Bacteria | 1661 |
| 342 | Ga0207708_10012643 | 3300026075 | Bacteria | 6294 |
| 343 | Ga0207708_10063940 | 3300026075 | Bacteria | 2811 |
| 344 | Ga0207708_10348701 | 3300026075 | Bacteria | 1214 |
| 345 | Ga0207708_10827923 | 3300026075 | Bacteria | 798 |
| 346 | Ga0207702_10178238 | 3300026078 | Bacteria | 1955 |
| 347 | Ga0207702_10202907 | 3300026078 | Bacteria | 1839 |
| 348 | Ga0207702_12278449 | 3300026078 | Bacteria | 530 |
| 349 | Ga0207641_10111922 | 3300026088 | Bacteria | 2421 |
| 350 | Ga0207641_10143771 | 3300026088 | Bacteria | 2155 |
| 351 | Ga0207641_10206605 | 3300026088 | Bacteria | 1814 |
| 352 | Ga0207641_12365955 | 3300026088 | Bacteria | 530 |
| 353 | Ga0207648_10003395 | 3300026089 | Bacteria | 16717 |
| 354 | Ga0207648_11891179 | 3300026089 | Bacteria | 558 |
| 355 | Ga0207676_10111278 | 3300026095 | Bacteria | 2292 |
| 356 | Ga0207676_10214975 | 3300026095 | Bacteria | 1708 |
| 357 | Ga0207676_11543346 | 3300026095 | Bacteria | 661 |
| 358 | Ga0207674_10007747 | 3300026116 | Bacteria | 12498 |
| 359 | Ga0207674_10055881 | 3300026116 | Bacteria | 4011 |
| 360 | Ga0207674_10964430 | 3300026116 | Bacteria | 821 |
| 361 | Ga0207674_11309083 | 3300026116 | Bacteria | 694 |
| 362 | Ga0207675_100085382 | 3300026118 | Bacteria | 2962 |
| 363 | Ga0207675_101662603 | 3300026118 | Bacteria | 659 |
| 364 | Ga0207683_10014880 | 3300026121 | Bacteria | 6625 |
| 365 | Ga0207683_10372599 | 3300026121 | Bacteria | 1312 |
| 366 | Ga0207698_10172103 | 3300026142 | Bacteria | 1908 |
| 367 | Ga0207698_10216227 | 3300026142 | Bacteria | 1728 |
| 368 | Ga0207698_10850647 | 3300026142 | Bacteria | 917 |
| 369 | Ga0209971_1087954 | 3300027682 | Bacteria | 758 |
| 370 | Ga0209966_1011294 | 3300027695 | Bacteria | 1627 |
| 371 | Ga0209998_10008391 | 3300027717 | Bacteria | 2141 |
| 372 | Ga0209998_10095094 | 3300027717 | Bacteria | 734 |
| 373 | Ga0209974_10118171 | 3300027876 | Bacteria | 938 |
| 374 | Ga0207428_10146583 | 3300027907 | Bacteria | 1799 |
| 375 | Ga0207428_10253923 | 3300027907 | Bacteria | 1310 |
| 376 | Ga0268266_10143106 | 3300028379 | Bacteria | 2147 |
| 377 | Ga0268266_10247707 | 3300028379 | Bacteria | 1647 |
| 378 | Ga0268266_10992179 | 3300028379 | Bacteria | 813 |
| 379 | Ga0268264_10382876 | 3300028381 | Bacteria | 1347 |
| 380 | Ga0268264_10909151 | 3300028381 | Bacteria | 884 |
| 381 | Ga0265337_1039898 | 3300028556 | Bacteria | 1355 |
| 382 | Ga0265326_10003161 | 3300028558 | Bacteria | 5446 |
| 383 | Ga0265319_1001156 | 3300028563 | Bacteria | 16342 |
| 384 | Ga0265319_1015996 | 3300028563 | Bacteria | 2885 |
| 385 | Ga0265334_10016320 | 3300028573 | Bacteria | 3073 |
| 386 | Ga0265318_10121249 | 3300028577 | Bacteria | 961 |
| 387 | Ga0265318_10225363 | 3300028577 | Bacteria | 684 |
| 388 | Ga0265336_10013855 | 3300028666 | Bacteria | 2682 |
| 389 | Ga0265336_10062722 | 3300028666 | Bacteria | 1114 |
| 390 | Ga0307517_10348330 | 3300028786 | Bacteria | 806 |
| 391 | Ga0307515_10000683 | 3300028794 | Bacteria | 78103 |
| 392 | Ga0265338_10009994 | 3300028800 | Bacteria | 11219 |
| 393 | Ga0265338_10207024 | 3300028800 | Bacteria | 1475 |
| 394 | Ga0265324_10006133 | 3300029957 | Bacteria | 5070 |
| 395 | Ga0265324_10163919 | 3300029957 | Bacteria | 755 |
| 396 | Ga0307511_10003768 | 3300030521 | Bacteria | 15513 |
| 397 | Ga0307511_10151153 | 3300030521 | Bacteria | 1332 |
| 398 | Ga0307512_10061587 | 3300030522 | Bacteria | 2888 |
| 399 | Ga0265332_10040657 | 3300031238 | Bacteria | 2012 |
| 400 | Ga0265328_10021757 | 3300031239 | Bacteria | 2445 |
| 401 | Ga0265320_10006501 | 3300031240 | Bacteria | 7362 |
| 402 | Ga0265320_10277518 | 3300031240 | Bacteria | 742 |
| 403 | Ga0265320_10564853 | 3300031240 | Bacteria | 503 |
| 404 | Ga0265325_10067177 | 3300031241 | Bacteria | 1807 |
| 405 | Ga0265329_10168423 | 3300031242 | Bacteria | 714 |
| 406 | Ga0265340_10003591 | 3300031247 | Bacteria | 8727 |
| 407 | Ga0265339_10365160 | 3300031249 | Bacteria | 678 |
| 408 | Ga0265339_10386964 | 3300031249 | Bacteria | 655 |
| 409 | Ga0265331_10037731 | 3300031250 | Bacteria | 2364 |
| 410 | Ga0265316_10025415 | 3300031344 | Bacteria | 4942 |
| 411 | Ga0307509_10963490 | 3300031507 | Bacteria | 519 |
| 412 | Ga0307408_100379632 | 3300031548 | Bacteria | 1208 |
| 413 | Ga0265313_10073106 | 3300031595 | Bacteria | 1574 |
| 414 | Ga0307508_10040458 | 3300031616 | Bacteria | 4185 |
| 415 | Ga0307508_10058649 | 3300031616 | Bacteria | 3406 |
| 416 | Ga0307508_10487004 | 3300031616 | Bacteria | 827 |
| 417 | Ga0307508_10507405 | 3300031616 | Bacteria | 801 |
| 418 | Ga0307508_10779931 | 3300031616 | Bacteria | 571 |
| 419 | Ga0307514_10140355 | 3300031649 | Bacteria | 1644 |
| 420 | Ga0307514_10281218 | 3300031649 | Bacteria | 952 |
| 421 | Ga0316575_10000050 | 3300031665 | Bacteria | 29877 |
| 422 | Ga0316575_10107170 | 3300031665 | Bacteria | 1139 |
| 423 | Ga0265314_10000238 | 3300031711 | Bacteria | 81055 |
| 424 | Ga0316576_10000982 | 3300031727 | Bacteria | 14643 |
| 425 | Ga0316576_10139740 | 3300031727 | Bacteria | 1823 |
| 426 | Ga0316576_10497512 | 3300031727 | Bacteria | 897 |
| 427 | Ga0316576_10722828 | 3300031727 | Bacteria | 720 |
| 428 | Ga0316578_10101077 | 3300031728 | Bacteria | 1729 |
| 429 | Ga0316578_10114247 | 3300031728 | Bacteria | 1622 |
| 430 | Ga0316578_10139143 | 3300031728 | Bacteria | 1462 |
| 431 | Ga0307516_10068665 | 3300031730 | Bacteria | 3412 |
| 432 | Ga0307405_10049727 | 3300031731 | Bacteria | 2593 |
| 433 | Ga0307405_10897459 | 3300031731 | Bacteria | 749 |
| 434 | Ga0316577_10244198 | 3300031733 | Bacteria | 1016 |
| 435 | Ga0307518_10005430 | 3300031838 | Bacteria | 9116 |
| 436 | Ga0307518_10018700 | 3300031838 | Bacteria | 4972 |
| 437 | Ga0307410_10803152 | 3300031852 | Bacteria | 800 |
| 438 | Ga0307406_10497429 | 3300031901 | Bacteria | 988 |
| 439 | Ga0307406_10854504 | 3300031901 | Bacteria | 772 |
| 440 | Ga0307407_10907581 | 3300031903 | Bacteria | 676 |
| 441 | Ga0307412_10059107 | 3300031911 | Bacteria | 2568 |
| 442 | Ga0307412_10268393 | 3300031911 | Bacteria | 1334 |
| 443 | Ga0307416_100016705 | 3300032002 | Bacteria | 5110 |
| 444 | Ga0307416_100250504 | 3300032002 | Bacteria | 1723 |
| 445 | Ga0307416_100527406 | 3300032002 | Bacteria | 1250 |
| 446 | Ga0307416_102029044 | 3300032002 | Bacteria | 678 |
| 447 | Ga0307411_10116734 | 3300032005 | Bacteria | 1922 |
| 448 | Ga0307415_100044616 | 3300032126 | Bacteria | 2965 |
| 449 | Ga0307415_100353083 | 3300032126 | Bacteria | 1238 |
| 450 | Ga0307415_102377229 | 3300032126 | Bacteria | 521 |
| 451 | Ga0316583_10166750 | 3300032133 | Bacteria | 766 |
| 452 | Ga0316585_10224617 | 3300032137 | Bacteria | 622 |
| 453 | Ga0316580_10096700 | 3300032139 | Bacteria | 904 |
| 454 | Ga0316593_10353738 | 3300032168 | Bacteria | 562 |
| 455 | Ga0307507_10006176 | 3300033179 | Bacteria | 18695 |
| 456 | Ga0307507_10027402 | 3300033179 | Bacteria | 6108 |
| 457 | Ga0307510_10280271 | 3300033180 | Bacteria | 1138 |
| 458 | Ga0307510_10306937 | 3300033180 | Bacteria | 1047 |
| 459 | Ga0316592_1085684 | 3300033524 | Bacteria | 719 |
| 460 | Ga0316596_1166618 | 3300033541 | Bacteria | 608 |
| 461 | Ga0373938_0044612 | 3300034957 | Bacteria | 995 |
| 462 | Ga0373940_0095386 | 3300035088 | Bacteria | 897 |
| 463 | Ga0373952_0274811 | 3300035092 | Bacteria | 517 |
| 464 | Ga0373932_0415318 | 3300035112 | Bacteria | 523 |
| 465 | Ga0373960_0047630 | 3300035121 | Bacteria | 1262 |
| 466 | Ga0373943_0658858 | 3300035170 | Bacteria | 619 |
| 467 | Ga0373946_0078991 | 3300035171 | Bacteria | 1437 |
| 468 | Ga0373955_0690990 | 3300035172 | Bacteria | 626 |
| 469 | Ga0373942_0085696 | 3300035207 | Bacteria | 942 |
| 470 | Ga0316574_0015600 | 3300035398 | Bacteria | 4411 |
| 471 | Ga0316574_0019409 | 3300035398 | Bacteria | 4010 |
| 472 | Ga0316574_0082405 | 3300035398 | Bacteria | 2044 |
| 473 | Ga0316574_0086948 | 3300035398 | Bacteria | 1990 |
| 474 | Ga0316574_0667961 | 3300035398 | Bacteria | 639 |
| 475 | Ga0373924_0477039 | 3300035410 | Bacteria | 560 |
| 476 | Ga0373935_0129286 | 3300035692 | Bacteria | 1696 |
| 477 | Ga0373927_0580503 | 3300035695 | Bacteria | 741 |
| 478 | Ga0373937_0072933 | 3300036401 | Bacteria | 3167 |
| 479 | Ga0373937_0384141 | 3300036401 | Bacteria | 1332 |
| 480 | Ga0316582_0173148 | 3300036647 | Bacteria | 1466 |
| 481 | Ga0316582_0591730 | 3300036647 | Bacteria | 764 |
| 482 | Ga0316584_0289517 | 3300036712 | Bacteria | 1188 |
| 483 | Ga0316584_0304095 | 3300036712 | Bacteria | 1154 |
| 484 | Ga0316584_0398943 | 3300036712 | Bacteria | 980 |
| 485 | Ga0316584_0435467 | 3300036712 | Bacteria | 929 |
| 486 | Ga0316584_0934763 | 3300036712 | Bacteria | 582 |
| 487 | Ga0373925_0000592 | 3300037068 | Bacteria | 34869 |
| 488 | Ga0373925_0163307 | 3300037068 | Bacteria | 1755 |
| 489 | Ga0373925_0434024 | 3300037068 | Bacteria | 1074 |
| 490 | Ga0395905_0327441 | 3300037471 | Bacteria | 1422 |
| 491 | Ga0395901_0581964 | 3300038443 | Bacteria | 1131 |
| 492 | Ga0395901_1530866 | 3300038443 | Bacteria | 622 |
| 493 | Ga0439466_0216242 | 3300041411 | Bacteria | 582 |
| 494 | Ga0451798_0825340 | 3300041458 | Bacteria | 1056 |
| 495 | Ga0451800_0796850 | 3300041459 | Bacteria | 681 |
| 496 | Ga0451837_1057628 | 3300041494 | Bacteria | 501 |
| 497 | Ga0451837_1234475 | 3300041494 | Bacteria | 1356 |
| 498 | Ga0451839_0442632 | 3300041496 | Bacteria | 963 |
| 499 | Ga0451839_1545375 | 3300041496 | Bacteria | 598 |
| 500 | Ga0451841_0063569 | 3300041498 | Bacteria | 2404 |
| 501 | Ga0439433_0212924 | 3300041999 | Bacteria | 513 |
| 502 | Ga0450915_004053 | 3300042119 | Bacteria | 854 |
| 503 | Ga0450910_028688 | 3300042147 | Bacteria | 866 |
| 504 | Ga0439446_0093833 | 3300042156 | Bacteria | 942 |
| 505 | Ga0439446_0163505 | 3300042156 | Bacteria | 737 |
| 506 | Ga0439435_0030145 | 3300042436 | Bacteria | 1469 |
| 507 | Ga0466963_0099048 | 3300044694 | Bacteria | 1993 |
| 508 | Ga0466967_0010351 | 3300045976 | Bacteria | 6991 |
| 509 | Ga0495592_0147712 | 3300046454 | Bacteria | 1628 |
| 510 | Ga0495592_0158469 | 3300046454 | Bacteria | 1559 |
| 511 | Ga0495592_0376791 | 3300046454 | Bacteria | 904 |
| 512 | Ga0495629_0021206 | 3300046459 | Bacteria | 4637 |
| 513 | Ga0495629_0023689 | 3300046459 | Bacteria | 4372 |
| 514 | Ga0495629_0856717 | 3300046459 | Bacteria | 597 |
| 515 | Ga0495638_0171655 | 3300046460 | Bacteria | 1244 |
| 516 | Ga0495641_0207838 | 3300046461 | Bacteria | 878 |
| 517 | Ga0495641_0417989 | 3300046461 | Bacteria | 609 |
| 518 | Ga0495651_0021759 | 3300046462 | Bacteria | 4985 |
| 519 | Ga0495651_0030166 | 3300046462 | Bacteria | 4228 |
| 520 | Ga0495653_0010595 | 3300046463 | Bacteria | 7548 |
| 521 | Ga0495653_0207175 | 3300046463 | Bacteria | 1327 |
| 522 | Ga0495653_0229507 | 3300046463 | Bacteria | 1243 |
| 523 | Ga0495653_0270366 | 3300046463 | Bacteria | 1120 |
| 524 | Ga0495580_0109836 | 3300046472 | Bacteria | 1915 |
| 525 | Ga0495582_0110081 | 3300046473 | Bacteria | 1547 |
| 526 | Ga0495662_0001754 | 3300046476 | Bacteria | 10840 |
| 527 | Ga0495662_0015654 | 3300046476 | Bacteria | 3680 |
| 528 | Ga0495662_0321393 | 3300046476 | Bacteria | 761 |
| 529 | Ga0495662_0528742 | 3300046476 | Bacteria | 578 |
| 530 | Ga0495664_0003407 | 3300046477 | Bacteria | 8641 |
| 531 | Ga0495664_0004375 | 3300046477 | Bacteria | 7728 |
| 532 | Ga0495664_0953528 | 3300046477 | Bacteria | 500 |
| 533 | Ga0495594_0045213 | 3300046499 | Bacteria | 2417 |
| 534 | Ga0495594_0059562 | 3300046499 | Bacteria | 2112 |
| 535 | Ga0495594_0535746 | 3300046499 | Bacteria | 665 |
| 536 | Ga0495607_0515629 | 3300046501 | Bacteria | 529 |
| 537 | Ga0495608_0006200 | 3300046511 | Bacteria | 8485 |
| 538 | Ga0495608_0121987 | 3300046511 | Bacteria | 1671 |
| 539 | Ga0495608_0485690 | 3300046511 | Bacteria | 749 |
| 540 | Ga0495618_0049381 | 3300046514 | Bacteria | 2657 |
| 541 | Ga0495618_0302571 | 3300046514 | Bacteria | 994 |
| 542 | Ga0495618_0649070 | 3300046514 | Bacteria | 624 |
| 543 | Ga0495628_0007270 | 3300046516 | Bacteria | 9593 |
| 544 | Ga0495628_0123063 | 3300046516 | Bacteria | 1988 |
| 545 | Ga0495628_0269161 | 3300046516 | Bacteria | 1268 |
| 546 | Ga0495628_0734857 | 3300046516 | Bacteria | 695 |
| 547 | Ga0495628_0819790 | 3300046516 | Bacteria | 650 |
| 548 | Ga0495630_0054035 | 3300046517 | Bacteria | 3008 |
| 549 | Ga0495630_0064963 | 3300046517 | Bacteria | 2742 |
| 550 | Ga0495630_0217352 | 3300046517 | Bacteria | 1459 |
| 551 | Ga0495630_0370702 | 3300046517 | Bacteria | 1096 |
| 552 | Ga0495666_0000608 | 3300046526 | Bacteria | 16058 |
| 553 | Ga0495666_0065863 | 3300046526 | Bacteria | 1728 |
| 554 | Ga0495666_0110388 | 3300046526 | Bacteria | 1292 |
| 555 | Ga0495666_0297184 | 3300046526 | Bacteria | 731 |
| 556 | Ga0495652_0030799 | 3300046529 | Bacteria | 4702 |
| 557 | Ga0495652_0037620 | 3300046529 | Bacteria | 4196 |
| 558 | Ga0495652_0256376 | 3300046529 | Bacteria | 1294 |
| 559 | Ga0495652_0798606 | 3300046529 | Bacteria | 628 |
| 560 | Ga0495665_0027860 | 3300046531 | Bacteria | 3032 |
| 561 | Ga0495665_0498206 | 3300046531 | Bacteria | 614 |
| 562 | Ga0495640_0384636 | 3300046533 | Bacteria | 863 |
| 563 | Ga0495586_0070580 | 3300046535 | Bacteria | 1908 |
| 564 | Ga0495586_0405346 | 3300046535 | Bacteria | 785 |
| 565 | Ga0495586_0880687 | 3300046535 | Bacteria | 516 |
| 566 | Ga0495587_0002309 | 3300046536 | Bacteria | 12768 |
| 567 | Ga0495587_0024809 | 3300046536 | Bacteria | 3670 |
| 568 | Ga0495587_0514485 | 3300046536 | Bacteria | 661 |
| 569 | Ga0495645_0007004 | 3300046543 | Bacteria | 7840 |
| 570 | Ga0495645_0040792 | 3300046543 | Bacteria | 3385 |
| 571 | Ga0495645_0206782 | 3300046543 | Bacteria | 1328 |
| 572 | Ga0495622_0058189 | 3300046557 | Bacteria | 1790 |
| 573 | Ga0495622_0484333 | 3300046557 | Bacteria | 529 |
| 574 | Ga0495667_0008989 | 3300046559 | Bacteria | 6788 |
| 575 | Ga0495634_0001467 | 3300046642 | Bacteria | 20897 |
| 576 | Ga0495634_0040289 | 3300046642 | Bacteria | 3177 |
| 577 | Ga0495634_0644426 | 3300046642 | Bacteria | 612 |
| 578 | Ga0495635_0008194 | 3300046663 | Bacteria | 7299 |
| 579 | Ga0495635_0040494 | 3300046663 | Bacteria | 3219 |
| 580 | Ga0495635_0074838 | 3300046663 | Bacteria | 2320 |
| 581 | Ga0495588_0000515 | 3300046674 | Bacteria | 18686 |
| 582 | Ga0495588_0018008 | 3300046674 | Bacteria | 3439 |
| 583 | Ga0495657_0007246 | 3300046675 | Bacteria | 8593 |
| 584 | Ga0495657_0020907 | 3300046675 | Bacteria | 4703 |
| 585 | Ga0495657_0249545 | 3300046675 | Bacteria | 1069 |
| 586 | Ga0495599_0075842 | 3300046678 | Bacteria | 2099 |
| 587 | Ga0495599_0166118 | 3300046678 | Bacteria | 1363 |
| 588 | Ga0495599_0357790 | 3300046678 | Bacteria | 874 |
| 589 | Ga0495599_0636489 | 3300046678 | Bacteria | 619 |
| 590 | Ga0495623_0244619 | 3300046679 | Bacteria | 1011 |
| 591 | Ga0495646_0003871 | 3300046680 | Bacteria | 9357 |
| 592 | Ga0495646_0009651 | 3300046680 | Bacteria | 6126 |
| 593 | Ga0495647_0056572 | 3300046681 | Bacteria | 1538 |
| 594 | Ga0495658_0059866 | 3300046683 | Bacteria | 2182 |
| 595 | Ga0495658_0103775 | 3300046683 | Bacteria | 1701 |
| 596 | Ga0495658_0190702 | 3300046683 | Bacteria | 1274 |
| 597 | Ga0495658_0556884 | 3300046683 | Bacteria | 734 |
| 598 | Ga0495613_0020770 | 3300046689 | Bacteria | 4895 |
| 599 | Ga0495613_0021346 | 3300046689 | Bacteria | 4828 |
| 600 | Ga0495613_0432401 | 3300046689 | Bacteria | 894 |
| 601 | Ga0495613_0954264 | 3300046689 | Bacteria | 553 |
| 602 | Ga0495624_0170872 | 3300046690 | Bacteria | 1326 |
| 603 | Ga0495624_0509982 | 3300046690 | Bacteria | 719 |
| 604 | Ga0495624_0540560 | 3300046690 | Bacteria | 696 |
| 605 | Ga0495624_0715929 | 3300046690 | Bacteria | 594 |
| 606 | Ga0495600_0053227 | 3300046809 | Bacteria | 2643 |
| 607 | Ga0495600_0100465 | 3300046809 | Bacteria | 1885 |
| 608 | Ga0495600_0875081 | 3300046809 | Bacteria | 531 |
| 609 | Ga0495581_0027726 | 3300047315 | Bacteria | 3285 |
| 610 | Ga0495581_0130969 | 3300047315 | Bacteria | 1461 |
| 611 | Ga0495581_0134414 | 3300047315 | Bacteria | 1442 |
| 612 | Ga0495604_0001004 | 3300047317 | Bacteria | 23493 |
| 613 | Ga0495604_0008655 | 3300047317 | Bacteria | 8044 |
| 614 | Ga0495604_0717928 | 3300047317 | Bacteria | 634 |
| 615 | Ga0495674_0087167 | 3300047319 | Bacteria | 2672 |
| 616 | Ga0495674_0270395 | 3300047319 | Bacteria | 1394 |
| 617 | Ga0495674_0305620 | 3300047319 | Bacteria | 1298 |
| 618 | Ga0495674_0969056 | 3300047319 | Bacteria | 653 |
| 619 | Ga0495676_0004167 | 3300047321 | Bacteria | 13196 |
| 620 | Ga0495676_0385317 | 3300047321 | Bacteria | 932 |
| 621 | Ga0495676_0431925 | 3300047321 | Bacteria | 870 |
| 622 | Ga0495676_0837706 | 3300047321 | Bacteria | 591 |
| 623 | Ga0495680_0232108 | 3300047322 | Bacteria | 1313 |
| 624 | Ga0495680_0818508 | 3300047322 | Bacteria | 607 |
| 625 | Ga0495687_029074 | 3300047443 | Bacteria | 2563 |
| 626 | Ga0495675_0048068 | 3300047444 | Bacteria | 2714 |
| 627 | Ga0495675_0340645 | 3300047444 | Bacteria | 883 |
| 628 | Ga0495684_0050035 | 3300047471 | Bacteria | 3191 |
| 629 | Ga0495684_0138816 | 3300047471 | Bacteria | 1823 |
| 630 | Ga0495593_0005342 | 3300047673 | Bacteria | 7599 |
| 631 | Ga0495593_0051111 | 3300047673 | Bacteria | 2188 |
| 632 | Ga0495593_0370135 | 3300047673 | Bacteria | 716 |
| 633 | Ga0495602_0038937 | 3300048088 | Bacteria | 4386 |
| 634 | Ga0495602_0115478 | 3300048088 | Bacteria | 2171 |
| 635 | Ga0495614_0007784 | 3300048089 | Bacteria | 4761 |
| 636 | Ga0495614_0017499 | 3300048089 | Bacteria | 3113 |
| 637 | Ga0495614_0148137 | 3300048089 | Bacteria | 1046 |
| 638 | Ga0495614_0349779 | 3300048089 | Bacteria | 689 |
| 639 | Ga0496100_0504556 | 3300048903 | Bacteria | 932 |
| 640 | Ga0496101_0111834 | 3300048904 | Bacteria | 2057 |
| 641 | Ga0496101_0641232 | 3300048904 | Bacteria | 839 |
| 642 | Ga0496101_0668067 | 3300048904 | Bacteria | 821 |
| 643 | Ga0496102_0027821 | 3300048905 | Bacteria | 5049 |
| 644 | Ga0496102_0300365 | 3300048905 | Bacteria | 1513 |
| 645 | Ga0496102_0767965 | 3300048905 | Bacteria | 886 |
| 646 | Ga0496102_1796727 | 3300048905 | Bacteria | 530 |
| 647 | Ga0496103_0024554 | 3300048906 | Bacteria | 3639 |
| 648 | Ga0496103_0133682 | 3300048906 | Bacteria | 1585 |
| 649 | Ga0496104_0172375 | 3300048907 | Bacteria | 2074 |
| 650 | Ga0496104_0175188 | 3300048907 | Bacteria | 2055 |
| 651 | Ga0496104_0269271 | 3300048907 | Bacteria | 1616 |
| 652 | Ga0496104_0410607 | 3300048907 | Bacteria | 1266 |
| 653 | Ga0496104_0537846 | 3300048907 | Bacteria | 1079 |
| 654 | Ga0496105_0238642 | 3300048908 | Bacteria | 1476 |
| 655 | Ga0496105_0422287 | 3300048908 | Bacteria | 1055 |
| 656 | Ga0496105_0987375 | 3300048908 | Bacteria | 630 |
| 657 | Ga0496106_0017118 | 3300048909 | Bacteria | 5365 |
| 658 | Ga0496106_0597752 | 3300048909 | Bacteria | 884 |
| 659 | Ga0496106_0698786 | 3300048909 | Bacteria | 808 |
| 660 | Ga0496106_0816636 | 3300048909 | Bacteria | 739 |
| 661 | Ga0496107_0077331 | 3300048910 | Bacteria | 2424 |
| 662 | Ga0496107_0147136 | 3300048910 | Bacteria | 1742 |
| 663 | Ga0496107_0296919 | 3300048910 | Bacteria | 1202 |
| 664 | Ga0496107_0400658 | 3300048910 | Bacteria | 1020 |
| 665 | Ga0496108_0003323 | 3300048911 | Bacteria | 12923 |
| 666 | Ga0496108_0005914 | 3300048911 | Bacteria | 9912 |
| 667 | Ga0496108_0015800 | 3300048911 | Bacteria | 6154 |
| 668 | Ga0496108_0352037 | 3300048911 | Bacteria | 1285 |
| 669 | Ga0496109_0004880 | 3300048912 | Bacteria | 11200 |
| 670 | Ga0496109_0009032 | 3300048912 | Bacteria | 8490 |
| 671 | Ga0496109_0072119 | 3300048912 | Bacteria | 3172 |
| 672 | Ga0496109_0100411 | 3300048912 | Bacteria | 2684 |
| 673 | Ga0496110_0009313 | 3300048913 | Bacteria | 7944 |
| 674 | Ga0496110_0039305 | 3300048913 | Bacteria | 4120 |
| 675 | Ga0496110_0154951 | 3300048913 | Bacteria | 2075 |
| 676 | Ga0496111_0105994 | 3300048914 | Bacteria | 2069 |
| 677 | Ga0496111_0130885 | 3300048914 | Bacteria | 1856 |
| 678 | Ga0496111_0179431 | 3300048914 | Bacteria | 1574 |
| 679 | Ga0496112_0005846 | 3300048915 | Bacteria | 10712 |
| 680 | Ga0496112_0025324 | 3300048915 | Bacteria | 5697 |
| 681 | Ga0496112_0041936 | 3300048915 | Bacteria | 4478 |
| 682 | Ga0496112_0137120 | 3300048915 | Bacteria | 2417 |
| 683 | Ga0496112_0155134 | 3300048915 | Bacteria | 2256 |
| 684 | Ga0496113_0050285 | 3300048916 | Bacteria | 3107 |
| 685 | Ga0496113_0068855 | 3300048916 | Bacteria | 2686 |
| 686 | Ga0496113_0253916 | 3300048916 | Bacteria | 1404 |
| 687 | Ga0496113_0392882 | 3300048916 | Bacteria | 1113 |
| 688 | Ga0496114_0230424 | 3300048917 | Bacteria | 1627 |
| 689 | Ga0496114_0867561 | 3300048917 | Bacteria | 783 |
| 690 | Ga0496115_0807401 | 3300048918 | Bacteria | 730 |
| 691 | Ga0496118_0349038 | 3300048921 | Bacteria | 789 |
| 692 | Ga0496124_0940628 | 3300048927 | Bacteria | 520 |
| 693 | Ga0496126_0050129 | 3300048929 | Bacteria | 3806 |
| 694 | Ga0501298_096331 | 3300049521 | Bacteria | 670 |
| 695 | Ga0501034_0138222 | 3300049571 | Bacteria | 2416 |
| 696 | Ga0501034_1327300 | 3300049571 | Unclassified | 596 |
| 697 | Ga0501036_0289417 | 3300049572 | Bacteria | 1371 |
| 698 | Ga0501040_0146270 | 3300049576 | Bacteria | 1666 |
| 699 | Ga0501041_0059671 | 3300049577 | Bacteria | 2335 |
| 700 | Ga0501041_0460619 | 3300049577 | Bacteria | 807 |
| 701 | Ga0501041_0495852 | 3300049577 | Bacteria | 777 |
| 702 | Ga0501041_0509618 | 3300049577 | Bacteria | 766 |
| 703 | Ga0501048_0240828 | 3300049582 | Bacteria | 1284 |
| 704 | Ga0501048_0891206 | 3300049582 | Bacteria | 640 |
| 705 | Ga0501067_0212423 | 3300049583 | Bacteria | 1078 |
| 706 | Ga0501067_0254871 | 3300049583 | Bacteria | 977 |
| 707 | Ga0501067_0491707 | 3300049583 | Bacteria | 686 |
| 708 | Ga0501069_0628844 | 3300049585 | Bacteria | 645 |
| 709 | Ga0501069_0672016 | 3300049585 | Bacteria | 624 |
| 710 | Ga0501071_0082911 | 3300049587 | Bacteria | 2349 |
| 711 | Ga0501075_0062850 | 3300049591 | Bacteria | 2799 |
| 712 | Ga0501075_0461772 | 3300049591 | Bacteria | 968 |
| 713 | Ga0501075_0843895 | 3300049591 | Bacteria | 697 |
| 714 | Ga0501076_0530980 | 3300049592 | Bacteria | 970 |
| 715 | Ga0501076_1580161 | 3300049592 | Bacteria | 538 |
| 716 | Ga0501077_0076996 | 3300049593 | Bacteria | 2113 |
| 717 | Ga0501202_120671 | 3300049652 | Bacteria | 659 |
| 718 | Ga0501079_0105819 | 3300049741 | Bacteria | 2183 |
| 719 | Ga0501079_0165064 | 3300049741 | Bacteria | 1727 |
| 720 | Ga0501081_0207765 | 3300049743 | Bacteria | 1421 |
| 721 | Ga0501045_0537677 | 3300049824 | Bacteria | 867 |
| 722 | Ga0501045_0656337 | 3300049824 | Bacteria | 775 |
| 723 | nmdc:mga0yw44_102227_c1 | 3300050492 | Bacteria | 1827 |
| 724 | nmdc:mga05p37_1133384_c1 | 3300050507 | Bacteria | 815 |
| 725 | nmdc:mga05p37_150470_c1 | 3300050507 | Bacteria | 2847 |
| 726 | nmdc:mga06r32_1908120_c1 | 3300050510 | Bacteria | 528 |
| 727 | nmdc:mga06r32_822837_c1 | 3300050510 | Bacteria | 888 |
| 728 | nmdc:mga08y16_107219_c1 | 3300050511 | Bacteria | 2908 |
| 729 | nmdc:mga08y16_1167341_c1 | 3300050511 | Bacteria | 742 |
| 730 | nmdc:mga08y16_1656278_c1 | 3300050511 | Bacteria | 596 |
| 731 | nmdc:mga0n895_246792_c1 | 3300050512 | Bacteria | 1812 |
| 732 | nmdc:mga08x19_965442_c1 | 3300050514 | Bacteria | 605 |
| 733 | nmdc:mga0a205_45435_c1 | 3300050515 | Bacteria | 4234 |
| 734 | Ga0495601_0020495 | 3300053077 | Bacteria | 4039 |
| 735 | Ga0495601_0043640 | 3300053077 | Bacteria | 2816 |
| 736 | Ga0495601_0240807 | 3300053077 | Bacteria | 1181 |
| 737 | Ga0495601_0365346 | 3300053077 | Bacteria | 937 |
| 738 | Ga0495612_0013443 | 3300053078 | Bacteria | 3298 |
| 739 | Ga0495612_0255486 | 3300053078 | Bacteria | 780 |
| 740 | Ga0500635_0269837 | 3300053080 | Bacteria | 669 |
| 741 | Ga0495595_0292539 | 3300053084 | Bacteria | 819 |
| 742 | Ga0495619_0059283 | 3300053085 | Bacteria | 2543 |
| 743 | Ga0495619_0086285 | 3300053085 | Bacteria | 2121 |
| 744 | Ga0495619_0099449 | 3300053085 | Bacteria | 1978 |
| 745 | Ga0495619_0105628 | 3300053085 | Bacteria | 1920 |
| 746 | Ga0500583_0467815 | 3300053092 | Bacteria | 596 |
| 747 | Ga0500640_049489 | 3300053095 | Bacteria | 1840 |
| 748 | Ga0500560_001178 | 3300053107 | Bacteria | 4343 |
| 749 | Ga0500560_247045 | 3300053107 | Bacteria | 557 |
| 750 | Ga0500614_004485 | 3300053123 | Bacteria | 2948 |
| 751 | Ga0500573_0194500 | 3300053140 | Bacteria | 1081 |
| 752 | Ga0500624_002559 | 3300053157 | Bacteria | 2454 |
| 753 | Ga0501084_0078935 | 3300054114 | Bacteria | 2759 |
| 754 | Ga0501084_0322373 | 3300054114 | Bacteria | 1305 |
| 755 | Ga0501084_0762733 | 3300054114 | Bacteria | 815 |
| 756 | Ga0530510_0148845 | 3300061734 | Bacteria | 1728 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005441 | Ga0070700_100218892 | Ga0070700_1002188922 | 101 |
| 2 | 3300005544 | Ga0070686_100072419 | Ga0070686_1000724192 | 101 |
| 3 | 3300025917 | Ga0207660_10314339 | Ga0207660_103143392 | 101 |
| 4 | 3300025919 | Ga0207657_10011341 | Ga0207657_100113414 | 101 |
| 5 | 3300025935 | Ga0207709_10053264 | Ga0207709_100532642 | 101 |
| 6 | 3300026075 | Ga0207708_10063940 | Ga0207708_100639402 | 101 |
| 7 | 3300036401 | Ga0373937_0384141 | Ga0373937_0384141_279_593 | 101 |
| 8 | 3300049587 | Ga0501071_0082911 | Ga0501071_0082911_1662_1976 | 101 |
| 9 | 3300005434 | Ga0070709_10627848 | Ga0070709_106278482 | 102 |
| 10 | 3300005543 | Ga0070672_101202128 | Ga0070672_1012021282 | 102 |
| 11 | 3300005614 | Ga0068856_101582146 | Ga0068856_1015821462 | 102 |
| 12 | 3300013296 | Ga0157374_10670941 | Ga0157374_106709412 | 102 |
| 13 | 3300013297 | Ga0157378_10235208 | Ga0157378_102352082 | 102 |
| 14 | 3300026118 | Ga0207675_101662603 | Ga0207675_1016626032 | 102 |
| 15 | 3300028786 | Ga0307517_10348330 | Ga0307517_103483302 | 102 |
| 16 | 3300030521 | Ga0307511_10003768 | Ga0307511_1000376810 | 102 |
| 17 | 3300030521 | Ga0307511_10151153 | Ga0307511_101511532 | 102 |
| 18 | 3300031616 | Ga0307508_10040458 | Ga0307508_100404582 | 102 |
| 19 | 3300031616 | Ga0307508_10507405 | Ga0307508_105074052 | 102 |
| 20 | 3300031616 | Ga0307508_10779931 | Ga0307508_107799312 | 102 |
| 21 | 3300031665 | Ga0316575_10000050 | Ga0316575_1000005020 | 102 |
| 22 | 3300032002 | Ga0307416_102029044 | Ga0307416_1020290442 | 102 |
| 23 | 3300032126 | Ga0307415_102377229 | Ga0307415_1023772292 | 102 |
| 24 | 3300033180 | Ga0307510_10306937 | Ga0307510_103069372 | 102 |
| 25 | 3300041999 | Ga0439433_0212924 | Ga0439433_0212924_148_459 | 102 |
| 26 | 3300042119 | Ga0450915_004053 | Ga0450915_004053_294_650 | 102 |
| 27 | 3300042436 | Ga0439435_0030145 | Ga0439435_0030145_1068_1379 | 102 |
| 28 | 3300005336 | Ga0070680_100000173 | Ga0070680_10000017331 | 103 |
| 29 | 3300005468 | Ga0070707_100420595 | Ga0070707_1004205952 | 103 |
| 30 | 3300005518 | Ga0070699_100884803 | Ga0070699_1008848031 | 103 |
| 31 | 3300005536 | Ga0070697_100187932 | Ga0070697_1001879322 | 103 |
| 32 | 3300005546 | Ga0070696_100098053 | Ga0070696_1000980533 | 103 |
| 33 | 3300007076 | Ga0075435_100581200 | Ga0075435_1005812002 | 103 |
| 34 | 3300010375 | Ga0105239_12717477 | Ga0105239_127174772 | 103 |
| 35 | 3300017792 | Ga0163161_10701708 | Ga0163161_107017082 | 103 |
| 36 | 3300025901 | Ga0207688_10885733 | Ga0207688_108857332 | 103 |
| 37 | 3300025917 | Ga0207660_10000004 | Ga0207660_10000004300 | 103 |
| 38 | 3300025922 | Ga0207646_10335464 | Ga0207646_103354642 | 103 |
| 39 | 3300028556 | Ga0265337_1039898 | Ga0265337_10398982 | 103 |
| 40 | 3300028558 | Ga0265326_10003161 | Ga0265326_100031615 | 103 |
| 41 | 3300028563 | Ga0265319_1001156 | Ga0265319_10011568 | 103 |
| 42 | 3300028563 | Ga0265319_1015996 | Ga0265319_10159963 | 103 |
| 43 | 3300028573 | Ga0265334_10016320 | Ga0265334_100163202 | 103 |
| 44 | 3300028577 | Ga0265318_10225363 | Ga0265318_102253632 | 103 |
| 45 | 3300028666 | Ga0265336_10013855 | Ga0265336_100138553 | 103 |
| 46 | 3300028800 | Ga0265338_10009994 | Ga0265338_1000999410 | 103 |
| 47 | 3300029957 | Ga0265324_10006133 | Ga0265324_100061334 | 103 |
| 48 | 3300031238 | Ga0265332_10040657 | Ga0265332_100406572 | 103 |
| 49 | 3300031239 | Ga0265328_10021757 | Ga0265328_100217572 | 103 |
| 50 | 3300031240 | Ga0265320_10006501 | Ga0265320_100065013 | 103 |
| 51 | 3300031240 | Ga0265320_10277518 | Ga0265320_102775182 | 103 |
| 52 | 3300031240 | Ga0265320_10564853 | Ga0265320_105648531 | 103 |
| 53 | 3300031242 | Ga0265329_10168423 | Ga0265329_101684232 | 103 |
| 54 | 3300031247 | Ga0265340_10003591 | Ga0265340_100035912 | 103 |
| 55 | 3300031249 | Ga0265339_10365160 | Ga0265339_103651601 | 103 |
| 56 | 3300031249 | Ga0265339_10386964 | Ga0265339_103869642 | 103 |
| 57 | 3300031250 | Ga0265331_10037731 | Ga0265331_100377312 | 103 |
| 58 | 3300031344 | Ga0265316_10025415 | Ga0265316_100254153 | 103 |
| 59 | 3300031595 | Ga0265313_10073106 | Ga0265313_100731062 | 103 |
| 60 | 3300031711 | Ga0265314_10000238 | Ga0265314_1000023828 | 103 |
| 61 | 3300032002 | Ga0307416_100527406 | Ga0307416_1005274062 | 103 |
| 62 | 3300038443 | Ga0395901_0581964 | Ga0395901_0581964_143_511 | 103 |
| 63 | 3300046526 | Ga0495666_0110388 | Ga0495666_0110388_766_1077 | 103 |
| 64 | 3300046690 | Ga0495624_0715929 | Ga0495624_0715929_167_478 | 103 |
| 65 | 3300049571 | Ga0501034_0138222 | Ga0501034_0138222_1267_1581 | 103 |
| 66 | 3300049571 | Ga0501034_1327300 | Ga0501034_1327300_80_403 | 103 |
| 67 | 3300049583 | Ga0501067_0491707 | Ga0501067_0491707_198_521 | 103 |
| 68 | iso_pu_bacteria | 2863404153 | 2863410970 | 103 |
| 69 | 3300005327 | Ga0070658_10473754 | Ga0070658_104737541 | 104 |
| 70 | 3300005345 | Ga0070692_11276762 | Ga0070692_112767621 | 104 |
| 71 | 3300005543 | Ga0070672_100618225 | Ga0070672_1006182251 | 104 |
| 72 | 3300005548 | Ga0070665_100010070 | Ga0070665_1000100709 | 104 |
| 73 | 3300005548 | Ga0070665_100033640 | Ga0070665_1000336403 | 104 |
| 74 | 3300005563 | Ga0068855_100009172 | Ga0068855_10000917212 | 104 |
| 75 | 3300005578 | Ga0068854_100007587 | Ga0068854_1000075874 | 104 |
| 76 | 3300005578 | Ga0068854_100927683 | Ga0068854_1009276832 | 104 |
| 77 | 3300005614 | Ga0068856_100209416 | Ga0068856_1002094162 | 104 |
| 78 | 3300005616 | Ga0068852_100269854 | Ga0068852_1002698542 | 104 |
| 79 | 3300005618 | Ga0068864_101743908 | Ga0068864_1017439081 | 104 |
| 80 | 3300005841 | Ga0068863_100119652 | Ga0068863_1001196522 | 104 |
| 81 | 3300005842 | Ga0068858_100074755 | Ga0068858_1000747554 | 104 |
| 82 | 3300009093 | Ga0105240_10694343 | Ga0105240_106943431 | 104 |
| 83 | 3300009093 | Ga0105240_11151478 | Ga0105240_111514782 | 104 |
| 84 | 3300009101 | Ga0105247_10127638 | Ga0105247_101276382 | 104 |
| 85 | 3300009174 | Ga0105241_10001574 | Ga0105241_100015743 | 104 |
| 86 | 3300009177 | Ga0105248_10045858 | Ga0105248_100458584 | 104 |
| 87 | 3300009551 | Ga0105238_10008792 | Ga0105238_100087925 | 104 |
| 88 | 3300009551 | Ga0105238_11889610 | Ga0105238_118896102 | 104 |
| 89 | 3300010375 | Ga0105239_10032267 | Ga0105239_100322672 | 104 |
| 90 | 3300013296 | Ga0157374_10320086 | Ga0157374_103200862 | 104 |
| 91 | 3300014325 | Ga0163163_10055263 | Ga0163163_100552633 | 104 |
| 92 | 3300025898 | Ga0207692_10736018 | Ga0207692_107360182 | 104 |
| 93 | 3300025904 | Ga0207647_10002717 | Ga0207647_100027176 | 104 |
| 94 | 3300025913 | Ga0207695_10002678 | Ga0207695_1000267817 | 104 |
| 95 | 3300025914 | Ga0207671_10001035 | Ga0207671_1000103517 | 104 |
| 96 | 3300025924 | Ga0207694_10001558 | Ga0207694_100015582 | 104 |
| 97 | 3300025929 | Ga0207664_11796293 | Ga0207664_117962931 | 104 |
| 98 | 3300025941 | Ga0207711_10060515 | Ga0207711_100605152 | 104 |
| 99 | 3300025949 | Ga0207667_10067774 | Ga0207667_100677745 | 104 |
| 100 | 3300025981 | Ga0207640_10631669 | Ga0207640_106316692 | 104 |
| 101 | 3300026067 | Ga0207678_10211109 | Ga0207678_102111092 | 104 |
| 102 | 3300026078 | Ga0207702_10202907 | Ga0207702_102029072 | 104 |
| 103 | 3300026088 | Ga0207641_10111922 | Ga0207641_101119222 | 104 |
| 104 | 3300026095 | Ga0207676_11543346 | Ga0207676_115433462 | 104 |
| 105 | 3300026116 | Ga0207674_10964430 | Ga0207674_109644302 | 104 |
| 106 | 3300026142 | Ga0207698_10850647 | Ga0207698_108506471 | 104 |
| 107 | 3300027717 | Ga0209998_10008391 | Ga0209998_100083912 | 104 |
| 108 | 3300028379 | Ga0268266_10247707 | Ga0268266_102477072 | 104 |
| 109 | 3300031241 | Ga0265325_10067177 | Ga0265325_100671772 | 104 |
| 110 | 3300031616 | Ga0307508_10058649 | Ga0307508_100586493 | 104 |
| 111 | 3300031665 | Ga0316575_10107170 | Ga0316575_101071702 | 104 |
| 112 | 3300031727 | Ga0316576_10000982 | Ga0316576_100009826 | 104 |
| 113 | 3300031727 | Ga0316576_10139740 | Ga0316576_101397402 | 104 |
| 114 | 3300031727 | Ga0316576_10497512 | Ga0316576_104975122 | 104 |
| 115 | 3300031727 | Ga0316576_10722828 | Ga0316576_107228282 | 104 |
| 116 | 3300031728 | Ga0316578_10101077 | Ga0316578_101010772 | 104 |
| 117 | 3300031728 | Ga0316578_10114247 | Ga0316578_101142472 | 104 |
| 118 | 3300031728 | Ga0316578_10139143 | Ga0316578_101391432 | 104 |
| 119 | 3300031731 | Ga0307405_10897459 | Ga0307405_108974592 | 104 |
| 120 | 3300031733 | Ga0316577_10244198 | Ga0316577_102441982 | 104 |
| 121 | 3300031901 | Ga0307406_10854504 | Ga0307406_108545042 | 104 |
| 122 | 3300031903 | Ga0307407_10907581 | Ga0307407_109075812 | 104 |
| 123 | 3300031911 | Ga0307412_10268393 | Ga0307412_102683932 | 104 |
| 124 | 3300032002 | Ga0307416_100250504 | Ga0307416_1002505041 | 104 |
| 125 | 3300032005 | Ga0307411_10116734 | Ga0307411_101167342 | 104 |
| 126 | 3300032126 | Ga0307415_100353083 | Ga0307415_1003530831 | 104 |
| 127 | 3300032133 | Ga0316583_10166750 | Ga0316583_101667502 | 104 |
| 128 | 3300032137 | Ga0316585_10224617 | Ga0316585_102246172 | 104 |
| 129 | 3300032139 | Ga0316580_10096700 | Ga0316580_100967002 | 104 |
| 130 | 3300032168 | Ga0316593_10353738 | Ga0316593_103537381 | 104 |
| 131 | 3300033179 | Ga0307507_10006176 | Ga0307507_1000617610 | 104 |
| 132 | 3300033524 | Ga0316592_1085684 | Ga0316592_10856842 | 104 |
| 133 | 3300033541 | Ga0316596_1166618 | Ga0316596_11666181 | 104 |
| 134 | 3300035398 | Ga0316574_0015600 | Ga0316574_0015600_1886_2206 | 104 |
| 135 | 3300035398 | Ga0316574_0019409 | Ga0316574_0019409_3157_3477 | 104 |
| 136 | 3300035398 | Ga0316574_0082405 | Ga0316574_0082405_1218_1538 | 104 |
| 137 | 3300035398 | Ga0316574_0086948 | Ga0316574_0086948_1273_1593 | 104 |
| 138 | 3300035398 | Ga0316574_0667961 | Ga0316574_0667961_257_577 | 104 |
| 139 | 3300036647 | Ga0316582_0173148 | Ga0316582_0173148_255_575 | 104 |
| 140 | 3300036647 | Ga0316582_0591730 | Ga0316582_0591730_89_409 | 104 |
| 141 | 3300036712 | Ga0316584_0289517 | Ga0316584_0289517_476_796 | 104 |
| 142 | 3300036712 | Ga0316584_0304095 | Ga0316584_0304095_534_854 | 104 |
| 143 | 3300036712 | Ga0316584_0398943 | Ga0316584_0398943_22_342 | 104 |
| 144 | 3300036712 | Ga0316584_0435467 | Ga0316584_0435467_313_633 | 104 |
| 145 | 3300036712 | Ga0316584_0934763 | Ga0316584_0934763_131_451 | 104 |
| 146 | 3300041494 | Ga0451837_1057628 | Ga0451837_1057628_140_454 | 104 |
| 147 | 3300046454 | Ga0495592_0147712 | Ga0495592_0147712_980_1297 | 104 |
| 148 | 3300046459 | Ga0495629_0023689 | Ga0495629_0023689_1113_1430 | 104 |
| 149 | 3300046462 | Ga0495651_0021759 | Ga0495651_0021759_1446_1763 | 104 |
| 150 | 3300046463 | Ga0495653_0207175 | Ga0495653_0207175_572_889 | 104 |
| 151 | 3300046473 | Ga0495582_0110081 | Ga0495582_0110081_934_1251 | 104 |
| 152 | 3300046476 | Ga0495662_0001754 | Ga0495662_0001754_5514_5831 | 104 |
| 153 | 3300046477 | Ga0495664_0004375 | Ga0495664_0004375_1490_1807 | 104 |
| 154 | 3300046499 | Ga0495594_0059562 | Ga0495594_0059562_635_958 | 104 |
| 155 | 3300046511 | Ga0495608_0121987 | Ga0495608_0121987_1266_1583 | 104 |
| 156 | 3300046514 | Ga0495618_0049381 | Ga0495618_0049381_964_1281 | 104 |
| 157 | 3300046516 | Ga0495628_0123063 | Ga0495628_0123063_1379_1696 | 104 |
| 158 | 3300046517 | Ga0495630_0064963 | Ga0495630_0064963_1466_1783 | 104 |
| 159 | 3300046526 | Ga0495666_0065863 | Ga0495666_0065863_1187_1504 | 104 |
| 160 | 3300046529 | Ga0495652_0030799 | Ga0495652_0030799_1453_1770 | 104 |
| 161 | 3300046533 | Ga0495640_0384636 | Ga0495640_0384636_196_513 | 104 |
| 162 | 3300046535 | Ga0495586_0070580 | Ga0495586_0070580_200_517 | 104 |
| 163 | 3300046536 | Ga0495587_0002309 | Ga0495587_0002309_8838_9155 | 104 |
| 164 | 3300046543 | Ga0495645_0040792 | Ga0495645_0040792_1145_1462 | 104 |
| 165 | 3300046557 | Ga0495622_0058189 | Ga0495622_0058189_1027_1344 | 104 |
| 166 | 3300046642 | Ga0495634_0001467 | Ga0495634_0001467_10805_11122 | 104 |
| 167 | 3300046663 | Ga0495635_0008194 | Ga0495635_0008194_3497_3814 | 104 |
| 168 | 3300046674 | Ga0495588_0018008 | Ga0495588_0018008_321_638 | 104 |
| 169 | 3300046675 | Ga0495657_0007246 | Ga0495657_0007246_4455_4772 | 104 |
| 170 | 3300046678 | Ga0495599_0166118 | Ga0495599_0166118_466_783 | 104 |
| 171 | 3300046680 | Ga0495646_0003871 | Ga0495646_0003871_5439_5756 | 104 |
| 172 | 3300046683 | Ga0495658_0059866 | Ga0495658_0059866_901_1218 | 104 |
| 173 | 3300046689 | Ga0495613_0021346 | Ga0495613_0021346_48_365 | 104 |
| 174 | 3300046690 | Ga0495624_0170872 | Ga0495624_0170872_587_904 | 104 |
| 175 | 3300046809 | Ga0495600_0053227 | Ga0495600_0053227_2069_2386 | 104 |
| 176 | 3300047315 | Ga0495581_0027726 | Ga0495581_0027726_218_535 | 104 |
| 177 | 3300047317 | Ga0495604_0008655 | Ga0495604_0008655_1482_1799 | 104 |
| 178 | 3300047321 | Ga0495676_0004167 | Ga0495676_0004167_4704_5021 | 104 |
| 179 | 3300047444 | Ga0495675_0048068 | Ga0495675_0048068_924_1241 | 104 |
| 180 | 3300047471 | Ga0495684_0138816 | Ga0495684_0138816_303_620 | 104 |
| 181 | 3300047673 | Ga0495593_0005342 | Ga0495593_0005342_5820_6137 | 104 |
| 182 | 3300048088 | Ga0495602_0038937 | Ga0495602_0038937_1427_1744 | 104 |
| 183 | 3300048089 | Ga0495614_0007784 | Ga0495614_0007784_821_1138 | 104 |
| 184 | 3300048907 | Ga0496104_0269271 | Ga0496104_0269271_1177_1500 | 104 |
| 185 | 3300048907 | Ga0496104_0410607 | Ga0496104_0410607_638_961 | 104 |
| 186 | 3300048908 | Ga0496105_0238642 | Ga0496105_0238642_997_1320 | 104 |
| 187 | 3300048915 | Ga0496112_0025324 | Ga0496112_0025324_3130_3453 | 104 |
| 188 | 3300048915 | Ga0496112_0041936 | Ga0496112_0041936_2387_2710 | 104 |
| 189 | 3300049521 | Ga0501298_096331 | Ga0501298_096331_122_436 | 104 |
| 190 | 3300049652 | Ga0501202_120671 | Ga0501202_120671_19_333 | 104 |
| 191 | 3300050511 | nmdc:mga08y16_1167341_c1 | nmdc:mga08y16_1167341_c1_281_601 | 104 |
| 192 | 3300053078 | Ga0495612_0013443 | Ga0495612_0013443_2619_2936 | 104 |
| 193 | 3300053080 | Ga0500635_0269837 | Ga0500635_0269837_32_349 | 104 |
| 194 | 3300053085 | Ga0495619_0086285 | Ga0495619_0086285_1357_1674 | 104 |
| 195 | 3300053095 | Ga0500640_049489 | Ga0500640_049489_693_1010 | 104 |
| 196 | 3300053123 | Ga0500614_004485 | Ga0500614_004485_270_587 | 104 |
| 197 | 3300053157 | Ga0500624_002559 | Ga0500624_002559_659_976 | 104 |
| 198 | iso_pu_bacteria | 2527291627 | 2528205560 | 104 |
| 199 | iso_pu_bacteria | 2546825537 | 2546950254 | 104 |
| 200 | iso_pu_bacteria | 2684623036 | 2686543386 | 104 |
| 201 | iso_pu_bacteria | 2773857924 | 2774866403 | 104 |
| 202 | iso_pu_bacteria | 637000116 | 637880268 | 104 |
| 203 | 3300005329 | Ga0070683_100200707 | Ga0070683_1002007072 | 105 |
| 204 | 3300005329 | Ga0070683_101859534 | Ga0070683_1018595341 | 105 |
| 205 | 3300005336 | Ga0070680_100401817 | Ga0070680_1004018172 | 105 |
| 206 | 3300005337 | Ga0070682_100364398 | Ga0070682_1003643982 | 105 |
| 207 | 3300005344 | Ga0070661_100383838 | Ga0070661_1003838382 | 105 |
| 208 | 3300005354 | Ga0070675_100232228 | Ga0070675_1002322282 | 105 |
| 209 | 3300005355 | Ga0070671_101218634 | Ga0070671_1012186342 | 105 |
| 210 | 3300005435 | Ga0070714_100001186 | Ga0070714_10000118610 | 105 |
| 211 | 3300005435 | Ga0070714_101164065 | Ga0070714_1011640651 | 105 |
| 212 | 3300005436 | Ga0070713_101495781 | Ga0070713_1014957811 | 105 |
| 213 | 3300005438 | Ga0070701_10640029 | Ga0070701_106400291 | 105 |
| 214 | 3300005440 | Ga0070705_101098226 | Ga0070705_1010982261 | 105 |
| 215 | 3300005445 | Ga0070708_100038454 | Ga0070708_1000384545 | 105 |
| 216 | 3300005445 | Ga0070708_101267220 | Ga0070708_1012672202 | 105 |
| 217 | 3300005455 | Ga0070663_100603088 | Ga0070663_1006030882 | 105 |
| 218 | 3300005456 | Ga0070678_100297911 | Ga0070678_1002979112 | 105 |
| 219 | 3300005468 | Ga0070707_100762923 | Ga0070707_1007629232 | 105 |
| 220 | 3300005468 | Ga0070707_101115226 | Ga0070707_1011152262 | 105 |
| 221 | 3300005471 | Ga0070698_100749695 | Ga0070698_1007496952 | 105 |
| 222 | 3300005518 | Ga0070699_100047696 | Ga0070699_1000476963 | 105 |
| 223 | 3300005536 | Ga0070697_100366041 | Ga0070697_1003660412 | 105 |
| 224 | 3300005544 | Ga0070686_100312082 | Ga0070686_1003120822 | 105 |
| 225 | 3300005548 | Ga0070665_100192169 | Ga0070665_1001921692 | 105 |
| 226 | 3300005564 | Ga0070664_102023982 | Ga0070664_1020239821 | 105 |
| 227 | 3300005844 | Ga0068862_100891559 | Ga0068862_1008915592 | 105 |
| 228 | 3300006163 | Ga0070715_10248645 | Ga0070715_102486452 | 105 |
| 229 | 3300006358 | Ga0068871_101420216 | Ga0068871_1014202162 | 105 |
| 230 | 3300009174 | Ga0105241_10285007 | Ga0105241_102850072 | 105 |
| 231 | 3300009176 | Ga0105242_10254328 | Ga0105242_102543282 | 105 |
| 232 | 3300009551 | Ga0105238_12324891 | Ga0105238_123248912 | 105 |
| 233 | 3300010375 | Ga0105239_10887695 | Ga0105239_108876952 | 105 |
| 234 | 3300011119 | Ga0105246_10758612 | Ga0105246_107586122 | 105 |
| 235 | 3300013102 | Ga0157371_11356223 | Ga0157371_113562232 | 105 |
| 236 | 3300013297 | Ga0157378_11755589 | Ga0157378_117555891 | 105 |
| 237 | 3300013306 | Ga0163162_10994652 | Ga0163162_109946522 | 105 |
| 238 | 3300014968 | Ga0157379_10069686 | Ga0157379_100696862 | 105 |
| 239 | 3300014969 | Ga0157376_10790416 | Ga0157376_107904162 | 105 |
| 240 | 3300025893 | Ga0207682_10084185 | Ga0207682_100841852 | 105 |
| 241 | 3300025903 | Ga0207680_10380313 | Ga0207680_103803132 | 105 |
| 242 | 3300025905 | Ga0207685_10205343 | Ga0207685_102053432 | 105 |
| 243 | 3300025920 | Ga0207649_10172487 | Ga0207649_101724872 | 105 |
| 244 | 3300025922 | Ga0207646_11019218 | Ga0207646_110192182 | 105 |
| 245 | 3300025926 | Ga0207659_10237984 | Ga0207659_102379842 | 105 |
| 246 | 3300025928 | Ga0207700_11271457 | Ga0207700_112714571 | 105 |
| 247 | 3300025929 | Ga0207664_10000733 | Ga0207664_1000073312 | 105 |
| 248 | 3300025929 | Ga0207664_10883369 | Ga0207664_108833692 | 105 |
| 249 | 3300025933 | Ga0207706_10334565 | Ga0207706_103345652 | 105 |
| 250 | 3300025934 | Ga0207686_10421994 | Ga0207686_104219942 | 105 |
| 251 | 3300025944 | Ga0207661_11007865 | Ga0207661_110078652 | 105 |
| 252 | 3300025945 | Ga0207679_10748864 | Ga0207679_107488642 | 105 |
| 253 | 3300025981 | Ga0207640_10584725 | Ga0207640_105847252 | 105 |
| 254 | 3300025986 | Ga0207658_10167464 | Ga0207658_101674642 | 105 |
| 255 | 3300026035 | Ga0207703_10068272 | Ga0207703_100682723 | 105 |
| 256 | 3300026088 | Ga0207641_10206605 | Ga0207641_102066052 | 105 |
| 257 | 3300026089 | Ga0207648_11891179 | Ga0207648_118911792 | 105 |
| 258 | 3300026121 | Ga0207683_10372599 | Ga0207683_103725992 | 105 |
| 259 | 3300026142 | Ga0207698_10172103 | Ga0207698_101721032 | 105 |
| 260 | 3300028379 | Ga0268266_10143106 | Ga0268266_101431062 | 105 |
| 261 | 3300030522 | Ga0307512_10061587 | Ga0307512_100615873 | 105 |
| 262 | 3300031616 | Ga0307508_10487004 | Ga0307508_104870042 | 105 |
| 263 | 3300046499 | Ga0495594_0535746 | Ga0495594_0535746_177_512 | 105 |
| 264 | 3300048904 | Ga0496101_0111834 | Ga0496101_0111834_481_798 | 105 |
| 265 | 3300048905 | Ga0496102_1796727 | Ga0496102_1796727_135_452 | 105 |
| 266 | 3300048909 | Ga0496106_0597752 | Ga0496106_0597752_65_382 | 105 |
| 267 | 3300048910 | Ga0496107_0400658 | Ga0496107_0400658_130_447 | 105 |
| 268 | 3300048911 | Ga0496108_0352037 | Ga0496108_0352037_577_894 | 105 |
| 269 | 3300048915 | Ga0496112_0137120 | Ga0496112_0137120_248_565 | 105 |
| 270 | 3300048916 | Ga0496113_0253916 | Ga0496113_0253916_746_1063 | 105 |
| 271 | 3300049592 | Ga0501076_0530980 | Ga0501076_0530980_482_805 | 105 |
| 272 | 3300049592 | Ga0501076_1580161 | Ga0501076_1580161_199_516 | 105 |
| 273 | 3300049741 | Ga0501079_0105819 | Ga0501079_0105819_1464_1781 | 105 |
| 274 | 3300050510 | nmdc:mga06r32_1908120_c1 | nmdc:mga06r32_1908120_c1_127_444 | 105 |
| 275 | 3300054114 | Ga0501084_0322373 | Ga0501084_0322373_635_952 | 105 |
| 276 | 3300005327 | Ga0070658_11402803 | Ga0070658_114028031 | 106 |
| 277 | 3300005328 | Ga0070676_10255187 | Ga0070676_102551872 | 106 |
| 278 | 3300005340 | Ga0070689_100323312 | Ga0070689_1003233122 | 106 |
| 279 | 3300005440 | Ga0070705_100124650 | Ga0070705_1001246502 | 106 |
| 280 | 3300005444 | Ga0070694_100405529 | Ga0070694_1004055292 | 106 |
| 281 | 3300005467 | Ga0070706_100000600 | Ga0070706_1000006009 | 106 |
| 282 | 3300005468 | Ga0070707_100004383 | Ga0070707_1000043832 | 106 |
| 283 | 3300005471 | Ga0070698_102112350 | Ga0070698_1021123501 | 106 |
| 284 | 3300005536 | Ga0070697_100105933 | Ga0070697_1001059332 | 106 |
| 285 | 3300005546 | Ga0070696_100085253 | Ga0070696_1000852532 | 106 |
| 286 | 3300005547 | Ga0070693_100758259 | Ga0070693_1007582591 | 106 |
| 287 | 3300005549 | Ga0070704_100266781 | Ga0070704_1002667812 | 106 |
| 288 | 3300005563 | Ga0068855_100495608 | Ga0068855_1004956082 | 106 |
| 289 | 3300005578 | Ga0068854_100073114 | Ga0068854_1000731142 | 106 |
| 290 | 3300005615 | Ga0070702_100034963 | Ga0070702_1000349632 | 106 |
| 291 | 3300005719 | Ga0068861_100788669 | Ga0068861_1007886691 | 106 |
| 292 | 3300005842 | Ga0068858_100041760 | Ga0068858_1000417603 | 106 |
| 293 | 3300009176 | Ga0105242_11587573 | Ga0105242_115875732 | 106 |
| 294 | 3300013297 | Ga0157378_10240813 | Ga0157378_102408133 | 106 |
| 295 | 3300014968 | Ga0157379_10354370 | Ga0157379_103543702 | 106 |
| 296 | 3300020070 | Ga0206356_11816342 | Ga0206356_118163422 | 106 |
| 297 | 3300025906 | Ga0207699_10018962 | Ga0207699_100189621 | 106 |
| 298 | 3300025907 | Ga0207645_10060142 | Ga0207645_100601422 | 106 |
| 299 | 3300025907 | Ga0207645_10456544 | Ga0207645_104565442 | 106 |
| 300 | 3300025910 | Ga0207684_10000496 | Ga0207684_100004962 | 106 |
| 301 | 3300025912 | Ga0207707_11325135 | Ga0207707_113251351 | 106 |
| 302 | 3300025922 | Ga0207646_10002151 | Ga0207646_1000215110 | 106 |
| 303 | 3300025981 | Ga0207640_10413132 | Ga0207640_104131322 | 106 |
| 304 | 3300026035 | Ga0207703_10546618 | Ga0207703_105466182 | 106 |
| 305 | 3300026035 | Ga0207703_12391518 | Ga0207703_123915182 | 106 |
| 306 | 3300026116 | Ga0207674_10055881 | Ga0207674_100558812 | 106 |
| 307 | 3300028577 | Ga0265318_10121249 | Ga0265318_101212492 | 106 |
| 308 | 3300028666 | Ga0265336_10062722 | Ga0265336_100627222 | 106 |
| 309 | 3300028794 | Ga0307515_10000683 | Ga0307515_1000068347 | 106 |
| 310 | 3300028800 | Ga0265338_10207024 | Ga0265338_102070242 | 106 |
| 311 | 3300029957 | Ga0265324_10163919 | Ga0265324_101639192 | 106 |
| 312 | 3300031507 | Ga0307509_10963490 | Ga0307509_109634901 | 106 |
| 313 | 3300031649 | Ga0307514_10140355 | Ga0307514_101403553 | 106 |
| 314 | 3300031649 | Ga0307514_10281218 | Ga0307514_102812182 | 106 |
| 315 | 3300031730 | Ga0307516_10068665 | Ga0307516_100686654 | 106 |
| 316 | 3300031838 | Ga0307518_10005430 | Ga0307518_100054308 | 106 |
| 317 | 3300031838 | Ga0307518_10018700 | Ga0307518_100187003 | 106 |
| 318 | 3300033179 | Ga0307507_10027402 | Ga0307507_100274023 | 106 |
| 319 | 3300033180 | Ga0307510_10280271 | Ga0307510_102802712 | 106 |
| 320 | 3300041496 | Ga0451839_1545375 | Ga0451839_1545375_182_502 | 106 |
| 321 | 3300044694 | Ga0466963_0099048 | Ga0466963_0099048_1305_1631 | 106 |
| 322 | 3300045976 | Ga0466967_0010351 | Ga0466967_0010351_346_672 | 106 |
| 323 | 3300046454 | Ga0495592_0158469 | Ga0495592_0158469_592_924 | 106 |
| 324 | 3300046459 | Ga0495629_0021206 | Ga0495629_0021206_472_810 | 106 |
| 325 | 3300046460 | Ga0495638_0171655 | Ga0495638_0171655_463_783 | 106 |
| 326 | 3300046462 | Ga0495651_0030166 | Ga0495651_0030166_1818_2150 | 106 |
| 327 | 3300046463 | Ga0495653_0010595 | Ga0495653_0010595_4592_4924 | 106 |
| 328 | 3300046472 | Ga0495580_0109836 | Ga0495580_0109836_1473_1805 | 106 |
| 329 | 3300046476 | Ga0495662_0015654 | Ga0495662_0015654_120_452 | 106 |
| 330 | 3300046477 | Ga0495664_0003407 | Ga0495664_0003407_5344_5676 | 106 |
| 331 | 3300046499 | Ga0495594_0045213 | Ga0495594_0045213_1449_1787 | 106 |
| 332 | 3300046501 | Ga0495607_0515629 | Ga0495607_0515629_62_382 | 106 |
| 333 | 3300046511 | Ga0495608_0006200 | Ga0495608_0006200_1330_1662 | 106 |
| 334 | 3300046516 | Ga0495628_0007270 | Ga0495628_0007270_8241_8573 | 106 |
| 335 | 3300046517 | Ga0495630_0054035 | Ga0495630_0054035_470_802 | 106 |
| 336 | 3300046526 | Ga0495666_0000608 | Ga0495666_0000608_8482_8814 | 106 |
| 337 | 3300046529 | Ga0495652_0037620 | Ga0495652_0037620_636_968 | 106 |
| 338 | 3300046531 | Ga0495665_0027860 | Ga0495665_0027860_1435_1767 | 106 |
| 339 | 3300046536 | Ga0495587_0024809 | Ga0495587_0024809_238_570 | 106 |
| 340 | 3300046543 | Ga0495645_0007004 | Ga0495645_0007004_4261_4593 | 106 |
| 341 | 3300046559 | Ga0495667_0008989 | Ga0495667_0008989_442_774 | 106 |
| 342 | 3300046642 | Ga0495634_0040289 | Ga0495634_0040289_1170_1502 | 106 |
| 343 | 3300046663 | Ga0495635_0040494 | Ga0495635_0040494_2418_2750 | 106 |
| 344 | 3300046674 | Ga0495588_0000515 | Ga0495588_0000515_15547_15885 | 106 |
| 345 | 3300046675 | Ga0495657_0020907 | Ga0495657_0020907_2918_3250 | 106 |
| 346 | 3300046678 | Ga0495599_0075842 | Ga0495599_0075842_1298_1630 | 106 |
| 347 | 3300046679 | Ga0495623_0244619 | Ga0495623_0244619_238_570 | 106 |
| 348 | 3300046680 | Ga0495646_0009651 | Ga0495646_0009651_764_1096 | 106 |
| 349 | 3300046689 | Ga0495613_0020770 | Ga0495613_0020770_3094_3426 | 106 |
| 350 | 3300046809 | Ga0495600_0100465 | Ga0495600_0100465_238_570 | 106 |
| 351 | 3300047315 | Ga0495581_0130969 | Ga0495581_0130969_391_723 | 106 |
| 352 | 3300047317 | Ga0495604_0001004 | Ga0495604_0001004_22141_22473 | 106 |
| 353 | 3300047319 | Ga0495674_0270395 | Ga0495674_0270395_893_1225 | 106 |
| 354 | 3300047321 | Ga0495676_0385317 | Ga0495676_0385317_212_550 | 106 |
| 355 | 3300047443 | Ga0495687_029074 | Ga0495687_029074_1438_1776 | 106 |
| 356 | 3300047444 | Ga0495675_0340645 | Ga0495675_0340645_238_570 | 106 |
| 357 | 3300047471 | Ga0495684_0050035 | Ga0495684_0050035_2418_2750 | 106 |
| 358 | 3300047673 | Ga0495593_0370135 | Ga0495593_0370135_365_697 | 106 |
| 359 | 3300048088 | Ga0495602_0115478 | Ga0495602_0115478_366_698 | 106 |
| 360 | 3300048089 | Ga0495614_0017499 | Ga0495614_0017499_2555_2893 | 106 |
| 361 | 3300048905 | Ga0496102_0027821 | Ga0496102_0027821_374_700 | 106 |
| 362 | 3300048906 | Ga0496103_0024554 | Ga0496103_0024554_3202_3528 | 106 |
| 363 | 3300048909 | Ga0496106_0017118 | Ga0496106_0017118_2295_2621 | 106 |
| 364 | 3300048910 | Ga0496107_0077331 | Ga0496107_0077331_1308_1634 | 106 |
| 365 | 3300048921 | Ga0496118_0349038 | Ga0496118_0349038_391_747 | 106 |
| 366 | 3300048927 | Ga0496124_0940628 | Ga0496124_0940628_42_398 | 106 |
| 367 | 3300053077 | Ga0495601_0020495 | Ga0495601_0020495_3369_3701 | 106 |
| 368 | 3300053085 | Ga0495619_0105628 | Ga0495619_0105628_1005_1337 | 106 |
| 369 | 3300053092 | Ga0500583_0467815 | Ga0500583_0467815_208_546 | 106 |
| 370 | 3300053107 | Ga0500560_001178 | Ga0500560_001178_2567_2905 | 106 |
| 371 | 3300053107 | Ga0500560_247045 | Ga0500560_247045_194_532 | 106 |
| 372 | 3300053140 | Ga0500573_0194500 | Ga0500573_0194500_735_1067 | 106 |
| 373 | 3300012500 | Ga0157314_1047316 | Ga0157314_10473161 | 107 |
| 374 | 3300037068 | Ga0373925_0000592 | Ga0373925_0000592_29937_30308 | 107 |
| 375 | 3300046477 | Ga0495664_0953528 | Ga0495664_0953528_45_374 | 107 |
| 376 | 3300048929 | Ga0496126_0050129 | Ga0496126_0050129_1021_1380 | 107 |
| 377 | 3300005436 | Ga0070713_100280763 | Ga0070713_1002807631 | 108 |
| 378 | 3300005546 | Ga0070696_101348758 | Ga0070696_1013487582 | 108 |
| 379 | 3300005842 | Ga0068858_100784991 | Ga0068858_1007849912 | 108 |
| 380 | 3300009545 | Ga0105237_11822945 | Ga0105237_118229452 | 108 |
| 381 | 3300013308 | Ga0157375_11302548 | Ga0157375_113025482 | 108 |
| 382 | 3300014325 | Ga0163163_12432360 | Ga0163163_124323602 | 108 |
| 383 | 3300014968 | Ga0157379_10138620 | Ga0157379_101386202 | 108 |
| 384 | 3300014969 | Ga0157376_10205467 | Ga0157376_102054672 | 108 |
| 385 | 3300017792 | Ga0163161_10322340 | Ga0163161_103223402 | 108 |
| 386 | 3300025321 | Ga0207656_10241787 | Ga0207656_102417872 | 108 |
| 387 | 3300025918 | Ga0207662_10418128 | Ga0207662_104181282 | 108 |
| 388 | 3300025928 | Ga0207700_11573324 | Ga0207700_115733241 | 108 |
| 389 | 3300025937 | Ga0207669_10697621 | Ga0207669_106976212 | 108 |
| 390 | 3300025939 | Ga0207665_10319073 | Ga0207665_103190732 | 108 |
| 391 | 3300026035 | Ga0207703_11365014 | Ga0207703_113650142 | 108 |
| 392 | 3300026116 | Ga0207674_11309083 | Ga0207674_113090832 | 108 |
| 393 | 3300027682 | Ga0209971_1087954 | Ga0209971_10879542 | 108 |
| 394 | 3300036401 | Ga0373937_0072933 | Ga0373937_0072933_2404_2736 | 108 |
| 395 | 3300041494 | Ga0451837_1234475 | Ga0451837_1234475_769_1110 | 108 |
| 396 | 3300041498 | Ga0451841_0063569 | Ga0451841_0063569_426_767 | 108 |
| 397 | 3300046454 | Ga0495592_0376791 | Ga0495592_0376791_17_349 | 108 |
| 398 | 3300046461 | Ga0495641_0417989 | Ga0495641_0417989_94_426 | 108 |
| 399 | 3300046463 | Ga0495653_0229507 | Ga0495653_0229507_431_763 | 108 |
| 400 | 3300046476 | Ga0495662_0321393 | Ga0495662_0321393_328_660 | 108 |
| 401 | 3300046511 | Ga0495608_0485690 | Ga0495608_0485690_244_576 | 108 |
| 402 | 3300046514 | Ga0495618_0302571 | Ga0495618_0302571_231_563 | 108 |
| 403 | 3300046514 | Ga0495618_0649070 | Ga0495618_0649070_98_430 | 108 |
| 404 | 3300046516 | Ga0495628_0734857 | Ga0495628_0734857_181_513 | 108 |
| 405 | 3300046516 | Ga0495628_0819790 | Ga0495628_0819790_36_368 | 108 |
| 406 | 3300046517 | Ga0495630_0370702 | Ga0495630_0370702_104_436 | 108 |
| 407 | 3300046529 | Ga0495652_0256376 | Ga0495652_0256376_567_899 | 108 |
| 408 | 3300046531 | Ga0495665_0498206 | Ga0495665_0498206_221_553 | 108 |
| 409 | 3300046535 | Ga0495586_0880687 | Ga0495586_0880687_152_484 | 108 |
| 410 | 3300046536 | Ga0495587_0514485 | Ga0495587_0514485_199_531 | 108 |
| 411 | 3300046543 | Ga0495645_0206782 | Ga0495645_0206782_532_864 | 108 |
| 412 | 3300046663 | Ga0495635_0074838 | Ga0495635_0074838_533_865 | 108 |
| 413 | 3300046675 | Ga0495657_0249545 | Ga0495657_0249545_668_1000 | 108 |
| 414 | 3300046678 | Ga0495599_0357790 | Ga0495599_0357790_158_490 | 108 |
| 415 | 3300046683 | Ga0495658_0190702 | Ga0495658_0190702_743_1075 | 108 |
| 416 | 3300046683 | Ga0495658_0556884 | Ga0495658_0556884_259_591 | 108 |
| 417 | 3300046690 | Ga0495624_0509982 | Ga0495624_0509982_25_357 | 108 |
| 418 | 3300046809 | Ga0495600_0875081 | Ga0495600_0875081_189_521 | 108 |
| 419 | 3300047317 | Ga0495604_0717928 | Ga0495604_0717928_286_618 | 108 |
| 420 | 3300047319 | Ga0495674_0087167 | Ga0495674_0087167_1303_1635 | 108 |
| 421 | 3300047319 | Ga0495674_0305620 | Ga0495674_0305620_172_504 | 108 |
| 422 | 3300047321 | Ga0495676_0431925 | Ga0495676_0431925_385_717 | 108 |
| 423 | 3300047322 | Ga0495680_0232108 | Ga0495680_0232108_189_521 | 108 |
| 424 | 3300047673 | Ga0495593_0051111 | Ga0495593_0051111_573_905 | 108 |
| 425 | 3300048089 | Ga0495614_0148137 | Ga0495614_0148137_211_543 | 108 |
| 426 | 3300048910 | Ga0496107_0296919 | Ga0496107_0296919_596_928 | 108 |
| 427 | 3300048912 | Ga0496109_0072119 | Ga0496109_0072119_1445_1777 | 108 |
| 428 | 3300049582 | Ga0501048_0240828 | Ga0501048_0240828_109_465 | 108 |
| 429 | 3300049583 | Ga0501067_0254871 | Ga0501067_0254871_593_922 | 108 |
| 430 | 3300049593 | Ga0501077_0076996 | Ga0501077_0076996_145_477 | 108 |
| 431 | 3300049743 | Ga0501081_0207765 | Ga0501081_0207765_567_893 | 108 |
| 432 | 3300053077 | Ga0495601_0240807 | Ga0495601_0240807_422_754 | 108 |
| 433 | 3300053077 | Ga0495601_0365346 | Ga0495601_0365346_129_461 | 108 |
| 434 | 3300053078 | Ga0495612_0255486 | Ga0495612_0255486_256_588 | 108 |
| 435 | 3300053084 | Ga0495595_0292539 | Ga0495595_0292539_241_573 | 108 |
| 436 | 3300053085 | Ga0495619_0099449 | Ga0495619_0099449_999_1331 | 108 |
| 437 | 3300005356 | Ga0070674_100572353 | Ga0070674_1005723532 | 109 |
| 438 | 3300005440 | Ga0070705_100127636 | Ga0070705_1001276362 | 109 |
| 439 | 3300005444 | Ga0070694_100074556 | Ga0070694_1000745563 | 109 |
| 440 | 3300005444 | Ga0070694_100138455 | Ga0070694_1001384552 | 109 |
| 441 | 3300005459 | Ga0068867_102421492 | Ga0068867_1024214921 | 109 |
| 442 | 3300005467 | Ga0070706_100217714 | Ga0070706_1002177142 | 109 |
| 443 | 3300005471 | Ga0070698_100361535 | Ga0070698_1003615352 | 109 |
| 444 | 3300005518 | Ga0070699_100185627 | Ga0070699_1001856272 | 109 |
| 445 | 3300005530 | Ga0070679_100198519 | Ga0070679_1001985192 | 109 |
| 446 | 3300005536 | Ga0070697_100166236 | Ga0070697_1001662362 | 109 |
| 447 | 3300005545 | Ga0070695_100003885 | Ga0070695_1000038855 | 109 |
| 448 | 3300005546 | Ga0070696_100003098 | Ga0070696_1000030989 | 109 |
| 449 | 3300005547 | Ga0070693_100675093 | Ga0070693_1006750932 | 109 |
| 450 | 3300005549 | Ga0070704_100175309 | Ga0070704_1001753092 | 109 |
| 451 | 3300013100 | Ga0157373_10703448 | Ga0157373_107034482 | 109 |
| 452 | 3300014326 | Ga0157380_10664514 | Ga0157380_106645142 | 109 |
| 453 | 3300025910 | Ga0207684_10171173 | Ga0207684_101711732 | 109 |
| 454 | 3300025917 | Ga0207660_11357618 | Ga0207660_113576182 | 109 |
| 455 | 3300025921 | Ga0207652_10601970 | Ga0207652_106019702 | 109 |
| 456 | 3300025932 | Ga0207690_11541090 | Ga0207690_115410902 | 109 |
| 457 | 3300025937 | Ga0207669_10666941 | Ga0207669_106669412 | 109 |
| 458 | 3300025949 | Ga0207667_11564245 | Ga0207667_115642452 | 109 |
| 459 | 3300025972 | Ga0207668_11605281 | Ga0207668_116052812 | 109 |
| 460 | 3300026075 | Ga0207708_10348701 | Ga0207708_103487012 | 109 |
| 461 | 3300035088 | Ga0373940_0095386 | Ga0373940_0095386_444_776 | 109 |
| 462 | 3300042147 | Ga0450910_028688 | Ga0450910_028688_376_705 | 109 |
| 463 | 3300042156 | Ga0439446_0093833 | Ga0439446_0093833_22_351 | 109 |
| 464 | 3300042156 | Ga0439446_0163505 | Ga0439446_0163505_327_656 | 109 |
| 465 | 3300049577 | Ga0501041_0059671 | Ga0501041_0059671_93_422 | 109 |
| 466 | 3300049577 | Ga0501041_0460619 | Ga0501041_0460619_132_461 | 109 |
| 467 | 3300049585 | Ga0501069_0628844 | Ga0501069_0628844_140_469 | 109 |
| 468 | 3300049591 | Ga0501075_0461772 | Ga0501075_0461772_338_667 | 109 |
| 469 | 3300049824 | Ga0501045_0537677 | Ga0501045_0537677_90_419 | 109 |
| 470 | 3300005356 | Ga0070674_101162177 | Ga0070674_1011621771 | 110 |
| 471 | 3300005536 | Ga0070697_100409857 | Ga0070697_1004098572 | 110 |
| 472 | 3300006871 | Ga0075434_101285209 | Ga0075434_1012852092 | 110 |
| 473 | 3300009094 | Ga0111539_10102438 | Ga0111539_101024382 | 110 |
| 474 | 3300009094 | Ga0111539_12691021 | Ga0111539_126910211 | 110 |
| 475 | 3300009098 | Ga0105245_11106658 | Ga0105245_111066582 | 110 |
| 476 | 3300009148 | Ga0105243_10521671 | Ga0105243_105216712 | 110 |
| 477 | 3300009148 | Ga0105243_12348920 | Ga0105243_123489202 | 110 |
| 478 | 3300009553 | Ga0105249_12682137 | Ga0105249_126821371 | 110 |
| 479 | 3300014326 | Ga0157380_11987813 | Ga0157380_119878132 | 110 |
| 480 | 3300017792 | Ga0163161_10967421 | Ga0163161_109674211 | 110 |
| 481 | 3300025935 | Ga0207709_10051472 | Ga0207709_100514722 | 110 |
| 482 | 3300025961 | Ga0207712_10325362 | Ga0207712_103253622 | 110 |
| 483 | 3300025961 | Ga0207712_10994953 | Ga0207712_109949532 | 110 |
| 484 | 3300026075 | Ga0207708_10827923 | Ga0207708_108279232 | 110 |
| 485 | 3300037471 | Ga0395905_0327441 | Ga0395905_0327441_824_1156 | 110 |
| 486 | 3300038443 | Ga0395901_1530866 | Ga0395901_1530866_33_365 | 110 |
| 487 | 3300041411 | Ga0439466_0216242 | Ga0439466_0216242_70_402 | 110 |
| 488 | 3300046557 | Ga0495622_0484333 | Ga0495622_0484333_122_454 | 110 |
| 489 | 3300050511 | nmdc:mga08y16_1656278_c1 | nmdc:mga08y16_1656278_c1_196_528 | 110 |
| 490 | 3300005616 | Ga0068852_102334760 | Ga0068852_1023347601 | 111 |
| 491 | 3300006881 | Ga0068865_102107785 | Ga0068865_1021077852 | 111 |
| 492 | 3300025986 | Ga0207658_10338161 | Ga0207658_103381612 | 111 |
| 493 | 3300041496 | Ga0451839_0442632 | Ga0451839_0442632_139_474 | 111 |
| 494 | 3300046689 | Ga0495613_0954264 | Ga0495613_0954264_162_503 | 111 |
| 495 | 3300001978 | JGI24747J21853_1023400 | JGI24747J21853_10234002 | 112 |
| 496 | 3300001991 | JGI24743J22301_10153110 | JGI24743J22301_101531102 | 112 |
| 497 | 3300002073 | JGI24745J21846_1038504 | JGI24745J21846_10385041 | 112 |
| 498 | 3300002244 | JGI24742J22300_10082188 | JGI24742J22300_100821881 | 112 |
| 499 | 3300002459 | JGI24751J29686_10042150 | JGI24751J29686_100421502 | 112 |
| 500 | 3300005328 | Ga0070676_10613891 | Ga0070676_106138912 | 112 |
| 501 | 3300005329 | Ga0070683_100177559 | Ga0070683_1001775592 | 112 |
| 502 | 3300005330 | Ga0070690_100037680 | Ga0070690_1000376802 | 112 |
| 503 | 3300005331 | Ga0070670_101230925 | Ga0070670_1012309252 | 112 |
| 504 | 3300005334 | Ga0068869_100114110 | Ga0068869_1001141102 | 112 |
| 505 | 3300005338 | Ga0068868_100145338 | Ga0068868_1001453382 | 112 |
| 506 | 3300005338 | Ga0068868_100360915 | Ga0068868_1003609152 | 112 |
| 507 | 3300005340 | Ga0070689_100066074 | Ga0070689_1000660742 | 112 |
| 508 | 3300005341 | Ga0070691_10097668 | Ga0070691_100976682 | 112 |
| 509 | 3300005344 | Ga0070661_100036201 | Ga0070661_1000362012 | 112 |
| 510 | 3300005345 | Ga0070692_10016618 | Ga0070692_100166182 | 112 |
| 511 | 3300005353 | Ga0070669_100220714 | Ga0070669_1002207142 | 112 |
| 512 | 3300005354 | Ga0070675_100003195 | Ga0070675_1000031952 | 112 |
| 513 | 3300005356 | Ga0070674_100003451 | Ga0070674_1000034519 | 112 |
| 514 | 3300005364 | Ga0070673_100188355 | Ga0070673_1001883552 | 112 |
| 515 | 3300005365 | Ga0070688_100053936 | Ga0070688_1000539362 | 112 |
| 516 | 3300005366 | Ga0070659_100010996 | Ga0070659_1000109966 | 112 |
| 517 | 3300005367 | Ga0070667_100367435 | Ga0070667_1003674352 | 112 |
| 518 | 3300005437 | Ga0070710_10796291 | Ga0070710_107962912 | 112 |
| 519 | 3300005438 | Ga0070701_10004477 | Ga0070701_100044772 | 112 |
| 520 | 3300005440 | Ga0070705_100222860 | Ga0070705_1002228602 | 112 |
| 521 | 3300005440 | Ga0070705_100543001 | Ga0070705_1005430012 | 112 |
| 522 | 3300005441 | Ga0070700_100193487 | Ga0070700_1001934872 | 112 |
| 523 | 3300005444 | Ga0070694_101779322 | Ga0070694_1017793221 | 112 |
| 524 | 3300005445 | Ga0070708_102055054 | Ga0070708_1020550541 | 112 |
| 525 | 3300005455 | Ga0070663_100749357 | Ga0070663_1007493572 | 112 |
| 526 | 3300005456 | Ga0070678_100104420 | Ga0070678_1001044202 | 112 |
| 527 | 3300005456 | Ga0070678_101666027 | Ga0070678_1016660272 | 112 |
| 528 | 3300005457 | Ga0070662_100078511 | Ga0070662_1000785112 | 112 |
| 529 | 3300005459 | Ga0068867_100169807 | Ga0068867_1001698072 | 112 |
| 530 | 3300005466 | Ga0070685_10027087 | Ga0070685_100270872 | 112 |
| 531 | 3300005468 | Ga0070707_101168254 | Ga0070707_1011682542 | 112 |
| 532 | 3300005471 | Ga0070698_100369777 | Ga0070698_1003697772 | 112 |
| 533 | 3300005518 | Ga0070699_100499335 | Ga0070699_1004993352 | 112 |
| 534 | 3300005535 | Ga0070684_100349190 | Ga0070684_1003491902 | 112 |
| 535 | 3300005536 | Ga0070697_100994137 | Ga0070697_1009941372 | 112 |
| 536 | 3300005543 | Ga0070672_100405098 | Ga0070672_1004050982 | 112 |
| 537 | 3300005544 | Ga0070686_100126178 | Ga0070686_1001261782 | 112 |
| 538 | 3300005544 | Ga0070686_100187324 | Ga0070686_1001873242 | 112 |
| 539 | 3300005546 | Ga0070696_100267424 | Ga0070696_1002674242 | 112 |
| 540 | 3300005548 | Ga0070665_102271418 | Ga0070665_1022714181 | 112 |
| 541 | 3300005564 | Ga0070664_100207918 | Ga0070664_1002079182 | 112 |
| 542 | 3300005577 | Ga0068857_100060936 | Ga0068857_1000609362 | 112 |
| 543 | 3300005578 | Ga0068854_100050725 | Ga0068854_1000507252 | 112 |
| 544 | 3300005615 | Ga0070702_100438474 | Ga0070702_1004384741 | 112 |
| 545 | 3300005616 | Ga0068852_100272016 | Ga0068852_1002720162 | 112 |
| 546 | 3300005617 | Ga0068859_100014708 | Ga0068859_1000147082 | 112 |
| 547 | 3300005618 | Ga0068864_100619603 | Ga0068864_1006196032 | 112 |
| 548 | 3300005718 | Ga0068866_10058423 | Ga0068866_100584233 | 112 |
| 549 | 3300005840 | Ga0068870_10635229 | Ga0068870_106352292 | 112 |
| 550 | 3300005841 | Ga0068863_100176763 | Ga0068863_1001767632 | 112 |
| 551 | 3300005841 | Ga0068863_100942310 | Ga0068863_1009423102 | 112 |
| 552 | 3300005842 | Ga0068858_100106444 | Ga0068858_1001064442 | 112 |
| 553 | 3300005843 | Ga0068860_100621775 | Ga0068860_1006217752 | 112 |
| 554 | 3300005843 | Ga0068860_101304215 | Ga0068860_1013042152 | 112 |
| 555 | 3300006038 | Ga0075365_10063862 | Ga0075365_100638622 | 112 |
| 556 | 3300006163 | Ga0070715_10317337 | Ga0070715_103173372 | 112 |
| 557 | 3300006237 | Ga0097621_100515450 | Ga0097621_1005154502 | 112 |
| 558 | 3300006237 | Ga0097621_100637377 | Ga0097621_1006373772 | 112 |
| 559 | 3300006358 | Ga0068871_102086601 | Ga0068871_1020866012 | 112 |
| 560 | 3300006844 | Ga0075428_100161554 | Ga0075428_1001615542 | 112 |
| 561 | 3300006847 | Ga0075431_100305488 | Ga0075431_1003054882 | 112 |
| 562 | 3300006852 | Ga0075433_10247530 | Ga0075433_102475302 | 112 |
| 563 | 3300006871 | Ga0075434_100259178 | Ga0075434_1002591782 | 112 |
| 564 | 3300006881 | Ga0068865_100173369 | Ga0068865_1001733692 | 112 |
| 565 | 3300006931 | Ga0097620_100014708 | Ga0097620_1000147082 | 112 |
| 566 | 3300006931 | Ga0097620_101664502 | Ga0097620_1016645022 | 112 |
| 567 | 3300007076 | Ga0075435_101136725 | Ga0075435_1011367252 | 112 |
| 568 | 3300009036 | Ga0105244_10064083 | Ga0105244_100640832 | 112 |
| 569 | 3300009094 | Ga0111539_10065305 | Ga0111539_100653052 | 112 |
| 570 | 3300009094 | Ga0111539_10134033 | Ga0111539_101340332 | 112 |
| 571 | 3300009098 | Ga0105245_10281584 | Ga0105245_102815842 | 112 |
| 572 | 3300009098 | Ga0105245_10945336 | Ga0105245_109453362 | 112 |
| 573 | 3300009098 | Ga0105245_11002706 | Ga0105245_110027061 | 112 |
| 574 | 3300009101 | Ga0105247_10129474 | Ga0105247_101294742 | 112 |
| 575 | 3300009147 | Ga0114129_10291584 | Ga0114129_102915841 | 112 |
| 576 | 3300009147 | Ga0114129_10322791 | Ga0114129_103227912 | 112 |
| 577 | 3300009147 | Ga0114129_10469717 | Ga0114129_104697172 | 112 |
| 578 | 3300009148 | Ga0105243_10012149 | Ga0105243_100121492 | 112 |
| 579 | 3300009174 | Ga0105241_10708312 | Ga0105241_107083122 | 112 |
| 580 | 3300009176 | Ga0105242_10017160 | Ga0105242_100171604 | 112 |
| 581 | 3300009176 | Ga0105242_10551471 | Ga0105242_105514712 | 112 |
| 582 | 3300009177 | Ga0105248_10055704 | Ga0105248_100557042 | 112 |
| 583 | 3300009545 | Ga0105237_10658030 | Ga0105237_106580302 | 112 |
| 584 | 3300009551 | Ga0105238_10032490 | Ga0105238_100324902 | 112 |
| 585 | 3300009553 | Ga0105249_10009446 | Ga0105249_100094467 | 112 |
| 586 | 3300010159 | Ga0099796_10037250 | Ga0099796_100372502 | 112 |
| 587 | 3300010375 | Ga0105239_10077529 | Ga0105239_100775292 | 112 |
| 588 | 3300011119 | Ga0105246_10344241 | Ga0105246_103442412 | 112 |
| 589 | 3300012482 | Ga0157318_1015878 | Ga0157318_10158782 | 112 |
| 590 | 3300012483 | Ga0157337_1011631 | Ga0157337_10116312 | 112 |
| 591 | 3300013102 | Ga0157371_10623866 | Ga0157371_106238662 | 112 |
| 592 | 3300013296 | Ga0157374_10884523 | Ga0157374_108845232 | 112 |
| 593 | 3300013306 | Ga0163162_10014545 | Ga0163162_100145457 | 112 |
| 594 | 3300013306 | Ga0163162_10203360 | Ga0163162_102033602 | 112 |
| 595 | 3300013307 | Ga0157372_11620060 | Ga0157372_116200601 | 112 |
| 596 | 3300013308 | Ga0157375_10119364 | Ga0157375_101193643 | 112 |
| 597 | 3300014326 | Ga0157380_10026353 | Ga0157380_100263531 | 112 |
| 598 | 3300014745 | Ga0157377_10015266 | Ga0157377_100152662 | 112 |
| 599 | 3300014968 | Ga0157379_10076655 | Ga0157379_100766552 | 112 |
| 600 | 3300014968 | Ga0157379_10648118 | Ga0157379_106481182 | 112 |
| 601 | 3300014968 | Ga0157379_10934432 | Ga0157379_109344322 | 112 |
| 602 | 3300017792 | Ga0163161_10035856 | Ga0163161_100358563 | 112 |
| 603 | 3300025728 | Ga0207655_1164228 | Ga0207655_11642282 | 112 |
| 604 | 3300025898 | Ga0207692_10657733 | Ga0207692_106577331 | 112 |
| 605 | 3300025899 | Ga0207642_10043856 | Ga0207642_100438562 | 112 |
| 606 | 3300025900 | Ga0207710_10343007 | Ga0207710_103430072 | 112 |
| 607 | 3300025901 | Ga0207688_10034995 | Ga0207688_100349953 | 112 |
| 608 | 3300025903 | Ga0207680_10040440 | Ga0207680_100404401 | 112 |
| 609 | 3300025908 | Ga0207643_10006292 | Ga0207643_100062922 | 112 |
| 610 | 3300025910 | Ga0207684_10604758 | Ga0207684_106047581 | 112 |
| 611 | 3300025912 | Ga0207707_10578243 | Ga0207707_105782432 | 112 |
| 612 | 3300025918 | Ga0207662_10000807 | Ga0207662_1000080711 | 112 |
| 613 | 3300025919 | Ga0207657_10145625 | Ga0207657_101456252 | 112 |
| 614 | 3300025923 | Ga0207681_10055582 | Ga0207681_100555823 | 112 |
| 615 | 3300025924 | Ga0207694_10831381 | Ga0207694_108313812 | 112 |
| 616 | 3300025925 | Ga0207650_11035775 | Ga0207650_110357752 | 112 |
| 617 | 3300025926 | Ga0207659_10641601 | Ga0207659_106416012 | 112 |
| 618 | 3300025927 | Ga0207687_10200819 | Ga0207687_102008192 | 112 |
| 619 | 3300025927 | Ga0207687_10230182 | Ga0207687_102301822 | 112 |
| 620 | 3300025927 | Ga0207687_10492345 | Ga0207687_104923452 | 112 |
| 621 | 3300025927 | Ga0207687_11164835 | Ga0207687_111648352 | 112 |
| 622 | 3300025931 | Ga0207644_10942352 | Ga0207644_109423522 | 112 |
| 623 | 3300025932 | Ga0207690_10909209 | Ga0207690_109092092 | 112 |
| 624 | 3300025933 | Ga0207706_10198270 | Ga0207706_101982702 | 112 |
| 625 | 3300025935 | Ga0207709_10041173 | Ga0207709_100411732 | 112 |
| 626 | 3300025937 | Ga0207669_10256886 | Ga0207669_102568862 | 112 |
| 627 | 3300025938 | Ga0207704_10076829 | Ga0207704_100768292 | 112 |
| 628 | 3300025939 | Ga0207665_10234650 | Ga0207665_102346502 | 112 |
| 629 | 3300025940 | Ga0207691_10014085 | Ga0207691_100140859 | 112 |
| 630 | 3300025941 | Ga0207711_10039731 | Ga0207711_100397313 | 112 |
| 631 | 3300025941 | Ga0207711_10356493 | Ga0207711_103564932 | 112 |
| 632 | 3300025941 | Ga0207711_11468662 | Ga0207711_114686622 | 112 |
| 633 | 3300025942 | Ga0207689_10150793 | Ga0207689_101507932 | 112 |
| 634 | 3300025945 | Ga0207679_11422441 | Ga0207679_114224412 | 112 |
| 635 | 3300025960 | Ga0207651_10936720 | Ga0207651_109367201 | 112 |
| 636 | 3300025961 | Ga0207712_10075148 | Ga0207712_100751482 | 112 |
| 637 | 3300025981 | Ga0207640_10673922 | Ga0207640_106739221 | 112 |
| 638 | 3300025986 | Ga0207658_10464909 | Ga0207658_104649092 | 112 |
| 639 | 3300026023 | Ga0207677_10145521 | Ga0207677_101455212 | 112 |
| 640 | 3300026023 | Ga0207677_10214014 | Ga0207677_102140142 | 112 |
| 641 | 3300026035 | Ga0207703_10102022 | Ga0207703_101020222 | 112 |
| 642 | 3300026067 | Ga0207678_10016986 | Ga0207678_100169866 | 112 |
| 643 | 3300026075 | Ga0207708_10012643 | Ga0207708_100126434 | 112 |
| 644 | 3300026078 | Ga0207702_10178238 | Ga0207702_101782381 | 112 |
| 645 | 3300026078 | Ga0207702_12278449 | Ga0207702_122784491 | 112 |
| 646 | 3300026088 | Ga0207641_10143771 | Ga0207641_101437712 | 112 |
| 647 | 3300026088 | Ga0207641_12365955 | Ga0207641_123659552 | 112 |
| 648 | 3300026089 | Ga0207648_10003395 | Ga0207648_100033953 | 112 |
| 649 | 3300026095 | Ga0207676_10111278 | Ga0207676_101112781 | 112 |
| 650 | 3300026095 | Ga0207676_10214975 | Ga0207676_102149752 | 112 |
| 651 | 3300026116 | Ga0207674_10007747 | Ga0207674_100077478 | 112 |
| 652 | 3300026118 | Ga0207675_100085382 | Ga0207675_1000853823 | 112 |
| 653 | 3300026121 | Ga0207683_10014880 | Ga0207683_100148806 | 112 |
| 654 | 3300026142 | Ga0207698_10216227 | Ga0207698_102162272 | 112 |
| 655 | 3300027695 | Ga0209966_1011294 | Ga0209966_10112942 | 112 |
| 656 | 3300027717 | Ga0209998_10095094 | Ga0209998_100950942 | 112 |
| 657 | 3300027876 | Ga0209974_10118171 | Ga0209974_101181712 | 112 |
| 658 | 3300027907 | Ga0207428_10146583 | Ga0207428_101465832 | 112 |
| 659 | 3300027907 | Ga0207428_10253923 | Ga0207428_102539232 | 112 |
| 660 | 3300028379 | Ga0268266_10992179 | Ga0268266_109921792 | 112 |
| 661 | 3300028381 | Ga0268264_10382876 | Ga0268264_103828762 | 112 |
| 662 | 3300028381 | Ga0268264_10909151 | Ga0268264_109091512 | 112 |
| 663 | 3300031548 | Ga0307408_100379632 | Ga0307408_1003796322 | 112 |
| 664 | 3300031731 | Ga0307405_10049727 | Ga0307405_100497272 | 112 |
| 665 | 3300031852 | Ga0307410_10803152 | Ga0307410_108031521 | 112 |
| 666 | 3300031901 | Ga0307406_10497429 | Ga0307406_104974292 | 112 |
| 667 | 3300031911 | Ga0307412_10059107 | Ga0307412_100591072 | 112 |
| 668 | 3300032002 | Ga0307416_100016705 | Ga0307416_1000167052 | 112 |
| 669 | 3300032126 | Ga0307415_100044616 | Ga0307415_1000446162 | 112 |
| 670 | 3300034957 | Ga0373938_0044612 | Ga0373938_0044612_13_351 | 112 |
| 671 | 3300035092 | Ga0373952_0274811 | Ga0373952_0274811_40_378 | 112 |
| 672 | 3300035112 | Ga0373932_0415318 | Ga0373932_0415318_51_389 | 112 |
| 673 | 3300035121 | Ga0373960_0047630 | Ga0373960_0047630_97_435 | 112 |
| 674 | 3300035170 | Ga0373943_0658858 | Ga0373943_0658858_49_387 | 112 |
| 675 | 3300035171 | Ga0373946_0078991 | Ga0373946_0078991_638_976 | 112 |
| 676 | 3300035172 | Ga0373955_0690990 | Ga0373955_0690990_227_565 | 112 |
| 677 | 3300035207 | Ga0373942_0085696 | Ga0373942_0085696_53_391 | 112 |
| 678 | 3300035410 | Ga0373924_0477039 | Ga0373924_0477039_14_352 | 112 |
| 679 | 3300035692 | Ga0373935_0129286 | Ga0373935_0129286_1139_1477 | 112 |
| 680 | 3300035695 | Ga0373927_0580503 | Ga0373927_0580503_197_535 | 112 |
| 681 | 3300037068 | Ga0373925_0163307 | Ga0373925_0163307_969_1307 | 112 |
| 682 | 3300037068 | Ga0373925_0434024 | Ga0373925_0434024_139_477 | 112 |
| 683 | 3300041458 | Ga0451798_0825340 | Ga0451798_0825340_211_555 | 112 |
| 684 | 3300041459 | Ga0451800_0796850 | Ga0451800_0796850_72_410 | 112 |
| 685 | 3300046459 | Ga0495629_0856717 | Ga0495629_0856717_134_472 | 112 |
| 686 | 3300046461 | Ga0495641_0207838 | Ga0495641_0207838_374_712 | 112 |
| 687 | 3300046463 | Ga0495653_0270366 | Ga0495653_0270366_389_727 | 112 |
| 688 | 3300046476 | Ga0495662_0528742 | Ga0495662_0528742_222_560 | 112 |
| 689 | 3300046516 | Ga0495628_0269161 | Ga0495628_0269161_169_507 | 112 |
| 690 | 3300046517 | Ga0495630_0217352 | Ga0495630_0217352_691_1029 | 112 |
| 691 | 3300046526 | Ga0495666_0297184 | Ga0495666_0297184_178_516 | 112 |
| 692 | 3300046529 | Ga0495652_0798606 | Ga0495652_0798606_192_530 | 112 |
| 693 | 3300046535 | Ga0495586_0405346 | Ga0495586_0405346_315_653 | 112 |
| 694 | 3300046642 | Ga0495634_0644426 | Ga0495634_0644426_69_407 | 112 |
| 695 | 3300046678 | Ga0495599_0636489 | Ga0495599_0636489_148_486 | 112 |
| 696 | 3300046681 | Ga0495647_0056572 | Ga0495647_0056572_348_686 | 112 |
| 697 | 3300046683 | Ga0495658_0103775 | Ga0495658_0103775_969_1307 | 112 |
| 698 | 3300046689 | Ga0495613_0432401 | Ga0495613_0432401_49_387 | 112 |
| 699 | 3300046690 | Ga0495624_0540560 | Ga0495624_0540560_332_670 | 112 |
| 700 | 3300047315 | Ga0495581_0134414 | Ga0495581_0134414_827_1165 | 112 |
| 701 | 3300047319 | Ga0495674_0969056 | Ga0495674_0969056_160_498 | 112 |
| 702 | 3300047321 | Ga0495676_0837706 | Ga0495676_0837706_208_546 | 112 |
| 703 | 3300047322 | Ga0495680_0818508 | Ga0495680_0818508_234_572 | 112 |
| 704 | 3300048089 | Ga0495614_0349779 | Ga0495614_0349779_274_612 | 112 |
| 705 | 3300048903 | Ga0496100_0504556 | Ga0496100_0504556_71_409 | 112 |
| 706 | 3300048904 | Ga0496101_0641232 | Ga0496101_0641232_430_768 | 112 |
| 707 | 3300048904 | Ga0496101_0668067 | Ga0496101_0668067_82_420 | 112 |
| 708 | 3300048905 | Ga0496102_0300365 | Ga0496102_0300365_773_1111 | 112 |
| 709 | 3300048905 | Ga0496102_0767965 | Ga0496102_0767965_155_493 | 112 |
| 710 | 3300048906 | Ga0496103_0133682 | Ga0496103_0133682_445_783 | 112 |
| 711 | 3300048907 | Ga0496104_0172375 | Ga0496104_0172375_17_355 | 112 |
| 712 | 3300048907 | Ga0496104_0175188 | Ga0496104_0175188_36_374 | 112 |
| 713 | 3300048907 | Ga0496104_0537846 | Ga0496104_0537846_456_794 | 112 |
| 714 | 3300048908 | Ga0496105_0422287 | Ga0496105_0422287_376_714 | 112 |
| 715 | 3300048908 | Ga0496105_0987375 | Ga0496105_0987375_16_354 | 112 |
| 716 | 3300048909 | Ga0496106_0698786 | Ga0496106_0698786_403_741 | 112 |
| 717 | 3300048909 | Ga0496106_0816636 | Ga0496106_0816636_158_496 | 112 |
| 718 | 3300048910 | Ga0496107_0147136 | Ga0496107_0147136_99_437 | 112 |
| 719 | 3300048911 | Ga0496108_0003323 | Ga0496108_0003323_7635_7973 | 112 |
| 720 | 3300048911 | Ga0496108_0005914 | Ga0496108_0005914_3822_4160 | 112 |
| 721 | 3300048911 | Ga0496108_0015800 | Ga0496108_0015800_2575_2913 | 112 |
| 722 | 3300048912 | Ga0496109_0004880 | Ga0496109_0004880_1739_2077 | 112 |
| 723 | 3300048912 | Ga0496109_0009032 | Ga0496109_0009032_3295_3633 | 112 |
| 724 | 3300048912 | Ga0496109_0100411 | Ga0496109_0100411_208_546 | 112 |
| 725 | 3300048913 | Ga0496110_0009313 | Ga0496110_0009313_5779_6117 | 112 |
| 726 | 3300048913 | Ga0496110_0039305 | Ga0496110_0039305_587_925 | 112 |
| 727 | 3300048913 | Ga0496110_0154951 | Ga0496110_0154951_322_660 | 112 |
| 728 | 3300048914 | Ga0496111_0105994 | Ga0496111_0105994_817_1155 | 112 |
| 729 | 3300048914 | Ga0496111_0130885 | Ga0496111_0130885_1421_1759 | 112 |
| 730 | 3300048914 | Ga0496111_0179431 | Ga0496111_0179431_323_661 | 112 |
| 731 | 3300048915 | Ga0496112_0005846 | Ga0496112_0005846_5511_5849 | 112 |
| 732 | 3300048915 | Ga0496112_0155134 | Ga0496112_0155134_1352_1690 | 112 |
| 733 | 3300048916 | Ga0496113_0050285 | Ga0496113_0050285_2623_2961 | 112 |
| 734 | 3300048916 | Ga0496113_0068855 | Ga0496113_0068855_1399_1737 | 112 |
| 735 | 3300048916 | Ga0496113_0392882 | Ga0496113_0392882_596_934 | 112 |
| 736 | 3300048917 | Ga0496114_0230424 | Ga0496114_0230424_466_804 | 112 |
| 737 | 3300048917 | Ga0496114_0867561 | Ga0496114_0867561_231_569 | 112 |
| 738 | 3300048918 | Ga0496115_0807401 | Ga0496115_0807401_157_495 | 112 |
| 739 | 3300049572 | Ga0501036_0289417 | Ga0501036_0289417_996_1334 | 112 |
| 740 | 3300049576 | Ga0501040_0146270 | Ga0501040_0146270_1095_1433 | 112 |
| 741 | 3300049577 | Ga0501041_0495852 | Ga0501041_0495852_47_385 | 112 |
| 742 | 3300049577 | Ga0501041_0509618 | Ga0501041_0509618_190_528 | 112 |
| 743 | 3300049582 | Ga0501048_0891206 | Ga0501048_0891206_61_399 | 112 |
| 744 | 3300049583 | Ga0501067_0212423 | Ga0501067_0212423_579_923 | 112 |
| 745 | 3300049585 | Ga0501069_0672016 | Ga0501069_0672016_109_447 | 112 |
| 746 | 3300049591 | Ga0501075_0062850 | Ga0501075_0062850_1456_1794 | 112 |
| 747 | 3300049591 | Ga0501075_0843895 | Ga0501075_0843895_225_563 | 112 |
| 748 | 3300049741 | Ga0501079_0165064 | Ga0501079_0165064_944_1282 | 112 |
| 749 | 3300049824 | Ga0501045_0656337 | Ga0501045_0656337_239_595 | 112 |
| 750 | 3300050492 | nmdc:mga0yw44_102227_c1 | nmdc:mga0yw44_102227_c1_646_984 | 112 |
| 751 | 3300050507 | nmdc:mga05p37_1133384_c1 | nmdc:mga05p37_1133384_c1_378_716 | 112 |
| 752 | 3300050507 | nmdc:mga05p37_150470_c1 | nmdc:mga05p37_150470_c1_127_465 | 112 |
| 753 | 3300050510 | nmdc:mga06r32_822837_c1 | nmdc:mga06r32_822837_c1_501_839 | 112 |
| 754 | 3300050511 | nmdc:mga08y16_107219_c1 | nmdc:mga08y16_107219_c1_921_1259 | 112 |
| 755 | 3300050512 | nmdc:mga0n895_246792_c1 | nmdc:mga0n895_246792_c1_123_461 | 112 |
| 756 | 3300050514 | nmdc:mga08x19_965442_c1 | nmdc:mga08x19_965442_c1_136_477 | 112 |
| 757 | 3300050515 | nmdc:mga0a205_45435_c1 | nmdc:mga0a205_45435_c1_951_1289 | 112 |
| 758 | 3300053077 | Ga0495601_0043640 | Ga0495601_0043640_2378_2716 | 112 |
| 759 | 3300053085 | Ga0495619_0059283 | Ga0495619_0059283_1669_2007 | 112 |
| 760 | 3300054114 | Ga0501084_0078935 | Ga0501084_0078935_1185_1523 | 112 |
| 761 | 3300054114 | Ga0501084_0762733 | Ga0501084_0762733_91_429 | 112 |
| 762 | 3300061734 | Ga0530510_0148845 | Ga0530510_0148845_732_1079 | 112 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2vzb-assembly1.cif.gz_A | a dodecameric thioferritin in the bacterial domain, characterization of the bacterioferritin-related protein from bacteroides fragilis | 0.7429 | 28 | 92 |
| 3rj1-assembly1.cif.gz_A | architecture of the mediator head module | 0.7204 | 36 | 95 |
| 8ij9-assembly1.cif.gz_C | crystal structure of the elks1/rab6b complex | 0.7189 | 33 | 94 |
| 8glv-assembly1.cif.gz_HE | 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella | 0.6802 | 23 | 88 |
| 4uxz-assembly1.cif.gz_C | structure of delta7-dgka-syn in 7.9 mag to 2.18 angstrom resolution | 0.6159 | 17 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q552M6_244_370_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.7697 | 30 | 92 | 3.30.40.10 |
| af_Q95XR1_4_111_1.20.58.90 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.7207 | 39 | 105 | 1.20.58.90 |
| 4aflC00 | Special;Helix non-globular;Helix Hairpins; | 0.7164 | 33 | 95 | 6.10.140.1740 |
| af_A0A1D8PK25_22_146_1.20.58.70 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.7143 | 29 | 105 | 1.20.58.70 |
| af_A0A0R0F7N4_1_104_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6705 | 39 | 99 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A442UTR1-F1-model_v4 | Uncharacterized protein | 0.7277 | 39 | 108 |
|
| AF-A0A842WVZ0-F1-model_v4 | Uncharacterized protein | 0.7012 | 32 | 106 |
GO:0016020
|
| AF-A0A7C9IUW1-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.686 | 36 | 112 |
GO:0005524
GO:0016887 |
| AF-A0A6H9RZ11-F1-model_v4 | proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) | 0.6843 | 29 | 106 |
GO:0005886
GO:0006740 GO:0008750 GO:0050661 |
| AF-A0A7S1WTL7-F1-model_v4 | Uncharacterized protein | 0.6767 | 22 | 104 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar