F479619
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 762 | 346 | 762 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300005437|Ga0070710_10055528|Ga0070710_100555284 |
| Length | 172 |
| Sequence | MWTTENRHRYDRDRLRYPSDLTDTEWAHIAPLIPPAKRGGGKRTVNMREVVNGVMYVLSTGCQWRYIPKDLPPRSTVNGYFCLWGWDGTLEKMHHALYVKCRELAEREISPTACIVDSQSVKSAEKRLSCLSRVVPTFHDLSWTAAPQGWRVAPPPSAASALTHRVPRQSGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 6 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 80 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 81 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 97 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 98 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 99 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 100 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 101 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 102 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 103 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 104 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 105 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 106 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 107 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 125 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 126 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 189 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 194 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 195 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 196 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 197 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 198 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 199 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 210 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 214 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 220 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 227 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 237 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 240 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 241 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 247 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 248 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 249 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 250 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 251 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 252 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 253 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 254 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 255 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 256 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 257 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 258 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 259 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 260 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 329 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.17 |
| Rhizosphere | 87.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c009791 | 3300000041 | Bacteria | 814 |
| 2 | ARcpr5oldR_c018606 | 3300000041 | Bacteria | 614 |
| 3 | ARSoilYngRDRAFT_c01721 | 3300000042 | Bacteria | 974 |
| 4 | CNXas_1008030 | 3300000545 | Bacteria | 744 |
| 5 | JGI24752J21851_1042332 | 3300001976 | Bacteria | 611 |
| 6 | JGI24746J21847_1016837 | 3300001977 | Bacteria | 1041 |
| 7 | JGI24747J21853_1019408 | 3300001978 | Bacteria | 733 |
| 8 | JGI24740J21852_10065131 | 3300001979 | Bacteria | 992 |
| 9 | JGI24739J22299_10082481 | 3300001989 | Bacteria | 986 |
| 10 | JGI24739J22299_10090407 | 3300001989 | Unclassified | 933 |
| 11 | JGI24737J22298_10158940 | 3300001990 | Bacteria | 666 |
| 12 | JGI24735J21928_10074040 | 3300002067 | Bacteria | 975 |
| 13 | JGI24735J21928_10107470 | 3300002067 | Unclassified | 802 |
| 14 | JGI24750J21931_1016855 | 3300002070 | Bacteria | 995 |
| 15 | JGI24745J21846_1011588 | 3300002073 | Bacteria | 1008 |
| 16 | JGI24745J21846_1018261 | 3300002073 | Unclassified | 818 |
| 17 | JGI24738J21930_10037390 | 3300002075 | Unclassified | 987 |
| 18 | JGI24738J21930_10038203 | 3300002075 | Bacteria | 976 |
| 19 | JGI24744J21845_10033284 | 3300002077 | Bacteria | 981 |
| 20 | JGI24742J22300_10028200 | 3300002244 | Bacteria | 974 |
| 21 | Ga0070676_10568279 | 3300005328 | Bacteria | 814 |
| 22 | Ga0070683_100398866 | 3300005329 | Bacteria | 1312 |
| 23 | Ga0068869_100406577 | 3300005334 | Bacteria | 1121 |
| 24 | Ga0070682_100254655 | 3300005337 | Bacteria | 1267 |
| 25 | Ga0070682_100498818 | 3300005337 | Bacteria | 943 |
| 26 | Ga0068868_100328653 | 3300005338 | Bacteria | 1304 |
| 27 | Ga0068868_100608351 | 3300005338 | Bacteria | 969 |
| 28 | Ga0070660_100663280 | 3300005339 | Bacteria | 874 |
| 29 | Ga0070691_10127896 | 3300005341 | Bacteria | 1285 |
| 30 | Ga0070687_100317661 | 3300005343 | Bacteria | 994 |
| 31 | Ga0070661_100431550 | 3300005344 | Bacteria | 1046 |
| 32 | Ga0070668_100073853 | 3300005347 | Bacteria | 2659 |
| 33 | Ga0070675_100409576 | 3300005354 | Bacteria | 1211 |
| 34 | Ga0070675_100459706 | 3300005354 | Bacteria | 1142 |
| 35 | Ga0070671_100509250 | 3300005355 | Bacteria | 1036 |
| 36 | Ga0070674_100102483 | 3300005356 | Bacteria | 2087 |
| 37 | Ga0070659_100538241 | 3300005366 | Bacteria | 999 |
| 38 | Ga0070667_100900131 | 3300005367 | Bacteria | 824 |
| 39 | Ga0070709_10302024 | 3300005434 | Bacteria | 1169 |
| 40 | Ga0070709_10328247 | 3300005434 | Bacteria | 1125 |
| 41 | Ga0070709_10585569 | 3300005434 | Bacteria | 857 |
| 42 | Ga0070714_100272154 | 3300005435 | Bacteria | 1571 |
| 43 | Ga0070714_100579280 | 3300005435 | Bacteria | 1076 |
| 44 | Ga0070714_100640730 | 3300005435 | Unclassified | 1022 |
| 45 | Ga0070714_100850255 | 3300005435 | Bacteria | 885 |
| 46 | Ga0070714_101000789 | 3300005435 | Unclassified | 813 |
| 47 | Ga0070714_101895977 | 3300005435 | Bacteria | 582 |
| 48 | Ga0070713_100144619 | 3300005436 | Unclassified | 2109 |
| 49 | Ga0070713_100322622 | 3300005436 | Bacteria | 1427 |
| 50 | Ga0070713_100364949 | 3300005436 | Bacteria | 1342 |
| 51 | Ga0070713_100403752 | 3300005436 | Bacteria | 1276 |
| 52 | Ga0070713_100421446 | 3300005436 | Bacteria | 1250 |
| 53 | Ga0070713_100650161 | 3300005436 | Bacteria | 1004 |
| 54 | Ga0070713_100687637 | 3300005436 | Bacteria | 976 |
| 55 | Ga0070713_101082672 | 3300005436 | Bacteria | 774 |
| 56 | Ga0070713_101351855 | 3300005436 | Bacteria | 690 |
| 57 | Ga0070710_10055528 | 3300005437 | Bacteria | 2238 |
| 58 | Ga0070710_10121666 | 3300005437 | Bacteria | 1581 |
| 59 | Ga0070710_10123994 | 3300005437 | Bacteria | 1567 |
| 60 | Ga0070710_10202314 | 3300005437 | Bacteria | 1255 |
| 61 | Ga0070710_10292419 | 3300005437 | Bacteria | 1061 |
| 62 | Ga0070710_10300446 | 3300005437 | Bacteria | 1048 |
| 63 | Ga0070710_10360878 | 3300005437 | Unclassified | 964 |
| 64 | Ga0070710_10652947 | 3300005437 | Bacteria | 738 |
| 65 | Ga0070711_100134708 | 3300005439 | Bacteria | 1845 |
| 66 | Ga0070711_100171566 | 3300005439 | Bacteria | 1654 |
| 67 | Ga0070711_100181451 | 3300005439 | Unclassified | 1612 |
| 68 | Ga0070711_100340175 | 3300005439 | Unclassified | 1204 |
| 69 | Ga0070711_100360733 | 3300005439 | Unclassified | 1170 |
| 70 | Ga0070711_100457475 | 3300005439 | Bacteria | 1046 |
| 71 | Ga0070700_100128407 | 3300005441 | Bacteria | 1707 |
| 72 | Ga0070663_100475255 | 3300005455 | Bacteria | 1034 |
| 73 | Ga0070678_100356586 | 3300005456 | Bacteria | 1259 |
| 74 | Ga0070678_100442452 | 3300005456 | Bacteria | 1137 |
| 75 | Ga0070662_100271811 | 3300005457 | Bacteria | 1369 |
| 76 | Ga0070662_100436449 | 3300005457 | Unclassified | 1085 |
| 77 | Ga0070681_10473192 | 3300005458 | Bacteria | 1165 |
| 78 | Ga0070681_11279741 | 3300005458 | Unclassified | 656 |
| 79 | Ga0068867_100091225 | 3300005459 | Bacteria | 2313 |
| 80 | Ga0068867_100591368 | 3300005459 | Bacteria | 966 |
| 81 | Ga0070707_100610224 | 3300005468 | Bacteria | 1053 |
| 82 | Ga0070698_100445183 | 3300005471 | Bacteria | 1231 |
| 83 | Ga0070679_100275559 | 3300005530 | Bacteria | 1635 |
| 84 | Ga0070684_100554462 | 3300005535 | Bacteria | 1067 |
| 85 | Ga0070684_100849019 | 3300005535 | Bacteria | 855 |
| 86 | Ga0070697_101167644 | 3300005536 | Bacteria | 686 |
| 87 | Ga0068853_100580495 | 3300005539 | Bacteria | 1064 |
| 88 | Ga0068853_100742164 | 3300005539 | Unclassified | 938 |
| 89 | Ga0070672_100087229 | 3300005543 | Bacteria | 2511 |
| 90 | Ga0070686_101079539 | 3300005544 | Bacteria | 662 |
| 91 | Ga0070695_100264818 | 3300005545 | Bacteria | 1257 |
| 92 | Ga0070696_100069683 | 3300005546 | Bacteria | 2472 |
| 93 | Ga0070696_101447706 | 3300005546 | Bacteria | 587 |
| 94 | Ga0070693_100034579 | 3300005547 | Bacteria | 2797 |
| 95 | Ga0068855_100460967 | 3300005563 | Bacteria | 1386 |
| 96 | Ga0068855_100560001 | 3300005563 | Unclassified | 1237 |
| 97 | Ga0068855_100579867 | 3300005563 | Bacteria | 1211 |
| 98 | Ga0070664_100481889 | 3300005564 | Bacteria | 1141 |
| 99 | Ga0068857_100470768 | 3300005577 | Bacteria | 1176 |
| 100 | Ga0068854_100212537 | 3300005578 | Bacteria | 1526 |
| 101 | Ga0068854_100370889 | 3300005578 | Bacteria | 1177 |
| 102 | Ga0068856_100208465 | 3300005614 | Unclassified | 1969 |
| 103 | Ga0068856_100341557 | 3300005614 | Bacteria | 1515 |
| 104 | Ga0068856_100495418 | 3300005614 | Unclassified | 1243 |
| 105 | Ga0068856_100901247 | 3300005614 | Bacteria | 903 |
| 106 | Ga0068856_101240481 | 3300005614 | Bacteria | 761 |
| 107 | Ga0068856_101320014 | 3300005614 | Bacteria | 737 |
| 108 | Ga0070702_100296431 | 3300005615 | Bacteria | 1117 |
| 109 | Ga0068852_100636002 | 3300005616 | Bacteria | 1073 |
| 110 | Ga0068861_100206639 | 3300005719 | Bacteria | 1651 |
| 111 | Ga0068863_100367948 | 3300005841 | Bacteria | 1402 |
| 112 | Ga0068858_100310923 | 3300005842 | Bacteria | 1505 |
| 113 | Ga0068858_100503253 | 3300005842 | Bacteria | 1171 |
| 114 | Ga0068860_100333327 | 3300005843 | Bacteria | 1491 |
| 115 | Ga0068860_100368614 | 3300005843 | Bacteria | 1416 |
| 116 | Ga0068862_100344260 | 3300005844 | Bacteria | 1382 |
| 117 | Ga0081455_10092336 | 3300005937 | Bacteria | 2449 |
| 118 | Ga0070717_10173876 | 3300006028 | Bacteria | 1874 |
| 119 | Ga0070717_10388316 | 3300006028 | Bacteria | 1252 |
| 120 | Ga0070717_10472465 | 3300006028 | Bacteria | 1132 |
| 121 | Ga0070717_10506154 | 3300006028 | Bacteria | 1092 |
| 122 | Ga0070717_10754668 | 3300006028 | Bacteria | 884 |
| 123 | Ga0070717_11086736 | 3300006028 | Unclassified | 728 |
| 124 | Ga0075432_10019443 | 3300006058 | Bacteria | 2321 |
| 125 | Ga0075432_10550808 | 3300006058 | Unclassified | 521 |
| 126 | Ga0070715_10059776 | 3300006163 | Bacteria | 1668 |
| 127 | Ga0070715_10176464 | 3300006163 | Unclassified | 1068 |
| 128 | Ga0070716_100243622 | 3300006173 | Bacteria | 1221 |
| 129 | Ga0070716_100378061 | 3300006173 | Bacteria | 1011 |
| 130 | Ga0070716_101117439 | 3300006173 | Unclassified | 629 |
| 131 | Ga0070716_101467215 | 3300006173 | Bacteria | 557 |
| 132 | Ga0070712_100280251 | 3300006175 | Bacteria | 1342 |
| 133 | Ga0070712_100340237 | 3300006175 | Bacteria | 1225 |
| 134 | Ga0070712_100363570 | 3300006175 | Unclassified | 1187 |
| 135 | Ga0070712_100412377 | 3300006175 | Bacteria | 1118 |
| 136 | Ga0097621_100271257 | 3300006237 | Unclassified | 1491 |
| 137 | Ga0097621_100319973 | 3300006237 | Unclassified | 1374 |
| 138 | Ga0097621_100428399 | 3300006237 | Bacteria | 1188 |
| 139 | Ga0097621_100598444 | 3300006237 | Bacteria | 1007 |
| 140 | Ga0068871_100332285 | 3300006358 | Bacteria | 1341 |
| 141 | Ga0068871_100564610 | 3300006358 | Unclassified | 1032 |
| 142 | Ga0068871_101392462 | 3300006358 | Bacteria | 661 |
| 143 | Ga0075433_10417180 | 3300006852 | Bacteria | 1184 |
| 144 | Ga0075434_100447151 | 3300006871 | Unclassified | 1313 |
| 145 | Ga0075429_100650054 | 3300006880 | Bacteria | 924 |
| 146 | Ga0068865_100303466 | 3300006881 | Bacteria | 1279 |
| 147 | Ga0068865_100386439 | 3300006881 | Unclassified | 1143 |
| 148 | Ga0068865_100578953 | 3300006881 | Unclassified | 946 |
| 149 | Ga0075436_100218603 | 3300006914 | Unclassified | 1352 |
| 150 | Ga0075436_100908572 | 3300006914 | Bacteria | 659 |
| 151 | Ga0075435_100469905 | 3300007076 | Unclassified | 1086 |
| 152 | Ga0075435_100546855 | 3300007076 | Bacteria | 1002 |
| 153 | Ga0075435_101620211 | 3300007076 | Bacteria | 568 |
| 154 | Ga0099794_10133476 | 3300007265 | Bacteria | 1255 |
| 155 | Ga0099795_10106961 | 3300007788 | Bacteria | 1104 |
| 156 | Ga0099795_10110451 | 3300007788 | Bacteria | 1089 |
| 157 | Ga0105244_10133403 | 3300009036 | Bacteria | 1198 |
| 158 | Ga0105240_10502721 | 3300009093 | Bacteria | 1347 |
| 159 | Ga0111539_10273114 | 3300009094 | Bacteria | 1968 |
| 160 | Ga0111539_11366615 | 3300009094 | Bacteria | 822 |
| 161 | Ga0105245_10553540 | 3300009098 | Bacteria | 1172 |
| 162 | Ga0105245_11036741 | 3300009098 | Unclassified | 865 |
| 163 | Ga0105247_10262509 | 3300009101 | Unclassified | 1184 |
| 164 | Ga0105247_10872050 | 3300009101 | Bacteria | 693 |
| 165 | Ga0105247_10900153 | 3300009101 | Bacteria | 683 |
| 166 | Ga0105243_10444733 | 3300009148 | Bacteria | 1214 |
| 167 | Ga0105243_11172785 | 3300009148 | Unclassified | 780 |
| 168 | Ga0105243_11589578 | 3300009148 | Bacteria | 680 |
| 169 | Ga0105241_10636922 | 3300009174 | Bacteria | 967 |
| 170 | Ga0105241_10640672 | 3300009174 | Unclassified | 964 |
| 171 | Ga0105242_10401188 | 3300009176 | Bacteria | 1280 |
| 172 | Ga0105242_10423581 | 3300009176 | Unclassified | 1248 |
| 173 | Ga0105242_11418374 | 3300009176 | Bacteria | 722 |
| 174 | Ga0105248_10400801 | 3300009177 | Unclassified | 1545 |
| 175 | Ga0105248_10917251 | 3300009177 | Bacteria | 989 |
| 176 | Ga0105237_10435107 | 3300009545 | Bacteria | 1317 |
| 177 | Ga0105238_10485549 | 3300009551 | Bacteria | 1235 |
| 178 | Ga0105238_11351325 | 3300009551 | Bacteria | 739 |
| 179 | Ga0105249_10314553 | 3300009553 | Bacteria | 1575 |
| 180 | Ga0105249_10356568 | 3300009553 | Unclassified | 1483 |
| 181 | Ga0099796_10098712 | 3300010159 | Bacteria | 1096 |
| 182 | Ga0099796_10163580 | 3300010159 | Bacteria | 883 |
| 183 | Ga0099796_10211494 | 3300010159 | Bacteria | 791 |
| 184 | Ga0105239_10291681 | 3300010375 | Bacteria | 1837 |
| 185 | Ga0105239_10666392 | 3300010375 | Bacteria | 1189 |
| 186 | Ga0105239_10894832 | 3300010375 | Bacteria | 1019 |
| 187 | Ga0105239_11219824 | 3300010375 | Unclassified | 867 |
| 188 | Ga0105246_10318816 | 3300011119 | Bacteria | 1262 |
| 189 | Ga0105246_10702729 | 3300011119 | Unclassified | 886 |
| 190 | Ga0105246_10716348 | 3300011119 | Unclassified | 879 |
| 191 | Ga0105246_10779823 | 3300011119 | Bacteria | 846 |
| 192 | Ga0105246_10789319 | 3300011119 | Bacteria | 841 |
| 193 | Ga0157340_1003418 | 3300012473 | Unclassified | 870 |
| 194 | Ga0157336_1002308 | 3300012477 | Bacteria | 1069 |
| 195 | Ga0157320_1001188 | 3300012481 | Bacteria | 1269 |
| 196 | Ga0157337_1030317 | 3300012483 | Bacteria | 551 |
| 197 | Ga0157325_1003579 | 3300012485 | Bacteria | 865 |
| 198 | Ga0157321_1000527 | 3300012487 | Bacteria | 1747 |
| 199 | Ga0157322_1003049 | 3300012490 | Unclassified | 997 |
| 200 | Ga0157323_1001470 | 3300012495 | Bacteria | 1187 |
| 201 | Ga0157319_1001572 | 3300012497 | Unclassified | 1200 |
| 202 | Ga0157347_1006729 | 3300012502 | Bacteria | 1131 |
| 203 | Ga0157342_1019984 | 3300012507 | Bacteria | 771 |
| 204 | Ga0157338_1004006 | 3300012515 | Bacteria | 1253 |
| 205 | Ga0157371_10256946 | 3300013102 | Unclassified | 1259 |
| 206 | Ga0157371_10447341 | 3300013102 | Unclassified | 950 |
| 207 | Ga0157370_10090670 | 3300013104 | Bacteria | 2870 |
| 208 | Ga0157369_11382160 | 3300013105 | Bacteria | 717 |
| 209 | Ga0157369_11679563 | 3300013105 | Bacteria | 645 |
| 210 | Ga0157374_10327884 | 3300013296 | Bacteria | 1518 |
| 211 | Ga0157374_10393927 | 3300013296 | Unclassified | 1381 |
| 212 | Ga0157374_11657729 | 3300013296 | Unclassified | 664 |
| 213 | Ga0157378_10313310 | 3300013297 | Bacteria | 1522 |
| 214 | Ga0157378_10495091 | 3300013297 | Unclassified | 1220 |
| 215 | Ga0163162_10131572 | 3300013306 | Bacteria | 2611 |
| 216 | Ga0163162_10214035 | 3300013306 | Unclassified | 2057 |
| 217 | Ga0163162_10732127 | 3300013306 | Bacteria | 1109 |
| 218 | Ga0163162_11099922 | 3300013306 | Bacteria | 900 |
| 219 | Ga0157372_10150735 | 3300013307 | Bacteria | 2684 |
| 220 | Ga0157372_10842635 | 3300013307 | Bacteria | 1064 |
| 221 | Ga0157372_11838971 | 3300013307 | Bacteria | 696 |
| 222 | Ga0157375_10692787 | 3300013308 | Unclassified | 1173 |
| 223 | Ga0157375_10762682 | 3300013308 | Unclassified | 1118 |
| 224 | Ga0163163_11903013 | 3300014325 | Bacteria | 655 |
| 225 | Ga0157380_10592783 | 3300014326 | Bacteria | 1095 |
| 226 | Ga0182008_10030177 | 3300014497 | Bacteria | 2734 |
| 227 | Ga0182008_10053297 | 3300014497 | Bacteria | 2003 |
| 228 | Ga0182008_10090742 | 3300014497 | Bacteria | 1506 |
| 229 | Ga0182008_10135606 | 3300014497 | Bacteria | 1229 |
| 230 | Ga0182008_10903815 | 3300014497 | Bacteria | 520 |
| 231 | Ga0157377_10214692 | 3300014745 | Bacteria | 1228 |
| 232 | Ga0157379_10291155 | 3300014968 | Bacteria | 1487 |
| 233 | Ga0157379_10363728 | 3300014968 | Bacteria | 1326 |
| 234 | Ga0157379_10598322 | 3300014968 | Bacteria | 1029 |
| 235 | Ga0157376_10156291 | 3300014969 | Bacteria | 2062 |
| 236 | Ga0157376_10230967 | 3300014969 | Bacteria | 1718 |
| 237 | Ga0157376_10413481 | 3300014969 | Bacteria | 1307 |
| 238 | Ga0157376_10552189 | 3300014969 | Bacteria | 1140 |
| 239 | Ga0163161_10244874 | 3300017792 | Unclassified | 1396 |
| 240 | Ga0163161_10268217 | 3300017792 | Bacteria | 1335 |
| 241 | Ga0206353_11291880 | 3300020082 | Bacteria | 773 |
| 242 | Ga0213873_10076813 | 3300021358 | Bacteria | 928 |
| 243 | Ga0213873_10085351 | 3300021358 | Bacteria | 889 |
| 244 | Ga0213872_10037559 | 3300021361 | Bacteria | 2211 |
| 245 | Ga0213874_10052003 | 3300021377 | Bacteria | 1259 |
| 246 | Ga0213874_10079775 | 3300021377 | Bacteria | 1058 |
| 247 | Ga0213874_10088964 | 3300021377 | Bacteria | 1011 |
| 248 | Ga0213874_10102993 | 3300021377 | Bacteria | 951 |
| 249 | Ga0213874_10107710 | 3300021377 | Bacteria | 933 |
| 250 | Ga0213876_10171733 | 3300021384 | Bacteria | 1153 |
| 251 | Ga0213876_10194414 | 3300021384 | Bacteria | 1078 |
| 252 | Ga0213876_10204175 | 3300021384 | Bacteria | 1050 |
| 253 | Ga0213876_10214462 | 3300021384 | Bacteria | 1023 |
| 254 | Ga0213876_10258873 | 3300021384 | Bacteria | 924 |
| 255 | Ga0213876_10497707 | 3300021384 | Bacteria | 648 |
| 256 | Ga0213875_10021387 | 3300021388 | Bacteria | 3099 |
| 257 | Ga0213875_10141589 | 3300021388 | Bacteria | 1125 |
| 258 | Ga0213875_10182296 | 3300021388 | Bacteria | 986 |
| 259 | Ga0213871_10066702 | 3300021441 | Bacteria | 1010 |
| 260 | Ga0213871_10067506 | 3300021441 | Bacteria | 1005 |
| 261 | Ga0213871_10220210 | 3300021441 | Bacteria | 596 |
| 262 | Ga0213871_10229420 | 3300021441 | Bacteria | 585 |
| 263 | Ga0207656_10228527 | 3300025321 | Bacteria | 906 |
| 264 | Ga0207655_1124449 | 3300025728 | Bacteria | 849 |
| 265 | Ga0207653_10059364 | 3300025885 | Bacteria | 1287 |
| 266 | Ga0207692_10265609 | 3300025898 | Unclassified | 1033 |
| 267 | Ga0207692_10276687 | 3300025898 | Bacteria | 1014 |
| 268 | Ga0207692_10289611 | 3300025898 | Unclassified | 993 |
| 269 | Ga0207692_10725618 | 3300025898 | Bacteria | 646 |
| 270 | Ga0207692_11130548 | 3300025898 | Bacteria | 519 |
| 271 | Ga0207642_10115400 | 3300025899 | Bacteria | 1375 |
| 272 | Ga0207710_10285931 | 3300025900 | Unclassified | 831 |
| 273 | Ga0207688_10064425 | 3300025901 | Bacteria | 2069 |
| 274 | Ga0207688_10099961 | 3300025901 | Bacteria | 1674 |
| 275 | Ga0207685_10003995 | 3300025905 | Bacteria | 3679 |
| 276 | Ga0207685_10125786 | 3300025905 | Bacteria | 1132 |
| 277 | Ga0207685_10178945 | 3300025905 | Unclassified | 982 |
| 278 | Ga0207685_10257921 | 3300025905 | Bacteria | 846 |
| 279 | Ga0207699_10086157 | 3300025906 | Bacteria | 1961 |
| 280 | Ga0207699_10301996 | 3300025906 | Bacteria | 1118 |
| 281 | Ga0207699_10359489 | 3300025906 | Unclassified | 1029 |
| 282 | Ga0207699_10419669 | 3300025906 | Bacteria | 955 |
| 283 | Ga0207699_10496192 | 3300025906 | Unclassified | 881 |
| 284 | Ga0207699_11041624 | 3300025906 | Bacteria | 605 |
| 285 | Ga0207654_10286683 | 3300025911 | Bacteria | 1115 |
| 286 | Ga0207654_10384027 | 3300025911 | Bacteria | 973 |
| 287 | Ga0207707_10461368 | 3300025912 | Bacteria | 1086 |
| 288 | Ga0207707_11170101 | 3300025912 | Bacteria | 624 |
| 289 | Ga0207695_10705245 | 3300025913 | Bacteria | 890 |
| 290 | Ga0207671_10576429 | 3300025914 | Bacteria | 897 |
| 291 | Ga0207671_10628190 | 3300025914 | Bacteria | 856 |
| 292 | Ga0207671_10644018 | 3300025914 | Bacteria | 844 |
| 293 | Ga0207693_10190698 | 3300025915 | Unclassified | 1613 |
| 294 | Ga0207693_10210552 | 3300025915 | Bacteria | 1528 |
| 295 | Ga0207693_10286388 | 3300025915 | Bacteria | 1291 |
| 296 | Ga0207693_10331239 | 3300025915 | Unclassified | 1192 |
| 297 | Ga0207663_10381923 | 3300025916 | Bacteria | 1073 |
| 298 | Ga0207663_10410941 | 3300025916 | Bacteria | 1037 |
| 299 | Ga0207663_10424580 | 3300025916 | Bacteria | 1021 |
| 300 | Ga0207663_10427020 | 3300025916 | Unclassified | 1018 |
| 301 | Ga0207663_10429627 | 3300025916 | Unclassified | 1015 |
| 302 | Ga0207663_11132631 | 3300025916 | Bacteria | 629 |
| 303 | Ga0207660_10444310 | 3300025917 | Bacteria | 1048 |
| 304 | Ga0207662_10229620 | 3300025918 | Bacteria | 1211 |
| 305 | Ga0207657_10347306 | 3300025919 | Bacteria | 1170 |
| 306 | Ga0207652_10687403 | 3300025921 | Bacteria | 913 |
| 307 | Ga0207646_10547631 | 3300025922 | Bacteria | 1040 |
| 308 | Ga0207659_10561732 | 3300025926 | Bacteria | 971 |
| 309 | Ga0207659_11391073 | 3300025926 | Bacteria | 602 |
| 310 | Ga0207687_10447560 | 3300025927 | Unclassified | 1071 |
| 311 | Ga0207687_10476169 | 3300025927 | Bacteria | 1039 |
| 312 | Ga0207687_10519740 | 3300025927 | Bacteria | 996 |
| 313 | Ga0207700_10080272 | 3300025928 | Bacteria | 2543 |
| 314 | Ga0207700_10206222 | 3300025928 | Bacteria | 1659 |
| 315 | Ga0207700_10229061 | 3300025928 | Bacteria | 1579 |
| 316 | Ga0207700_10281252 | 3300025928 | Bacteria | 1431 |
| 317 | Ga0207700_10491448 | 3300025928 | Bacteria | 1085 |
| 318 | Ga0207700_10534692 | 3300025928 | Unclassified | 1039 |
| 319 | Ga0207700_10564300 | 3300025928 | Bacteria | 1011 |
| 320 | Ga0207700_10569349 | 3300025928 | Bacteria | 1007 |
| 321 | Ga0207700_10838948 | 3300025928 | Bacteria | 822 |
| 322 | Ga0207664_10080381 | 3300025929 | Plasmid | 2649 |
| 323 | Ga0207664_10314694 | 3300025929 | Bacteria | 1380 |
| 324 | Ga0207664_10386413 | 3300025929 | Bacteria | 1243 |
| 325 | Ga0207664_10444618 | 3300025929 | Bacteria | 1156 |
| 326 | Ga0207664_10521101 | 3300025929 | Bacteria | 1065 |
| 327 | Ga0207664_10574273 | 3300025929 | Bacteria | 1012 |
| 328 | Ga0207664_10588329 | 3300025929 | Bacteria | 999 |
| 329 | Ga0207664_11247287 | 3300025929 | Bacteria | 662 |
| 330 | Ga0207644_10570571 | 3300025931 | Unclassified | 938 |
| 331 | Ga0207690_10422457 | 3300025932 | Bacteria | 1067 |
| 332 | Ga0207706_10348974 | 3300025933 | Bacteria | 1287 |
| 333 | Ga0207706_10361211 | 3300025933 | Unclassified | 1262 |
| 334 | Ga0207686_10362561 | 3300025934 | Bacteria | 1094 |
| 335 | Ga0207686_10992513 | 3300025934 | Unclassified | 681 |
| 336 | Ga0207709_10270762 | 3300025935 | Bacteria | 1250 |
| 337 | Ga0207704_10339066 | 3300025938 | Bacteria | 1166 |
| 338 | Ga0207704_10475154 | 3300025938 | Bacteria | 1002 |
| 339 | Ga0207704_10908798 | 3300025938 | Bacteria | 741 |
| 340 | Ga0207704_11021519 | 3300025938 | Unclassified | 700 |
| 341 | Ga0207665_10103639 | 3300025939 | Bacteria | 1990 |
| 342 | Ga0207665_10127856 | 3300025939 | Unclassified | 1801 |
| 343 | Ga0207665_10181537 | 3300025939 | Bacteria | 1524 |
| 344 | Ga0207665_10351619 | 3300025939 | Bacteria | 1112 |
| 345 | Ga0207665_10368663 | 3300025939 | Bacteria | 1087 |
| 346 | Ga0207691_10410429 | 3300025940 | Bacteria | 1155 |
| 347 | Ga0207689_10309441 | 3300025942 | Bacteria | 1310 |
| 348 | Ga0207661_10449564 | 3300025944 | Bacteria | 1173 |
| 349 | Ga0207661_10503983 | 3300025944 | Bacteria | 1106 |
| 350 | Ga0207661_11969520 | 3300025944 | Unclassified | 530 |
| 351 | Ga0207679_10527059 | 3300025945 | Bacteria | 1057 |
| 352 | Ga0207667_10397605 | 3300025949 | Unclassified | 1403 |
| 353 | Ga0207667_10435307 | 3300025949 | Bacteria | 1333 |
| 354 | Ga0207667_10686525 | 3300025949 | Bacteria | 1027 |
| 355 | Ga0207712_10527775 | 3300025961 | Bacteria | 1013 |
| 356 | Ga0207668_10563275 | 3300025972 | Bacteria | 988 |
| 357 | Ga0207640_10425139 | 3300025981 | Bacteria | 1088 |
| 358 | Ga0207640_10580413 | 3300025981 | Bacteria | 946 |
| 359 | Ga0207677_10305800 | 3300026023 | Bacteria | 1315 |
| 360 | Ga0207639_10706900 | 3300026041 | Unclassified | 935 |
| 361 | Ga0207639_10797705 | 3300026041 | Bacteria | 880 |
| 362 | Ga0207678_10350612 | 3300026067 | Bacteria | 1273 |
| 363 | Ga0207708_10160956 | 3300026075 | Bacteria | 1772 |
| 364 | Ga0207702_10574838 | 3300026078 | Bacteria | 1104 |
| 365 | Ga0207702_11050811 | 3300026078 | Unclassified | 808 |
| 366 | Ga0207702_11134469 | 3300026078 | Bacteria | 776 |
| 367 | Ga0207641_10690429 | 3300026088 | Bacteria | 1004 |
| 368 | Ga0207641_12221970 | 3300026088 | Unclassified | 549 |
| 369 | Ga0207648_10135967 | 3300026089 | Bacteria | 2165 |
| 370 | Ga0207674_10530041 | 3300026116 | Bacteria | 1138 |
| 371 | Ga0207675_100642835 | 3300026118 | Bacteria | 1066 |
| 372 | Ga0207675_100989725 | 3300026118 | Unclassified | 859 |
| 373 | Ga0207683_10349697 | 3300026121 | Bacteria | 1356 |
| 374 | Ga0207683_10583378 | 3300026121 | Bacteria | 1034 |
| 375 | Ga0207698_10689433 | 3300026142 | Bacteria | 1015 |
| 376 | Ga0207698_10759290 | 3300026142 | Bacteria | 969 |
| 377 | Ga0207698_10842122 | 3300026142 | Bacteria | 922 |
| 378 | Ga0207698_12585186 | 3300026142 | Unclassified | 517 |
| 379 | Ga0209179_1042914 | 3300027512 | Bacteria | 955 |
| 380 | Ga0209588_1088485 | 3300027671 | Bacteria | 998 |
| 381 | Ga0207428_10280109 | 3300027907 | Bacteria | 1238 |
| 382 | Ga0207428_10377972 | 3300027907 | Bacteria | 1040 |
| 383 | Ga0268265_10669357 | 3300028380 | Bacteria | 999 |
| 384 | Ga0268264_10678980 | 3300028381 | Unclassified | 1021 |
| 385 | Ga0268264_10689034 | 3300028381 | Bacteria | 1014 |
| 386 | Ga0265336_10124662 | 3300028666 | Bacteria | 767 |
| 387 | Ga0265324_10101149 | 3300029957 | Unclassified | 979 |
| 388 | Ga0265328_10110287 | 3300031239 | Unclassified | 1022 |
| 389 | Ga0265325_10428752 | 3300031241 | Bacteria | 577 |
| 390 | Ga0265340_10174649 | 3300031247 | Bacteria | 972 |
| 391 | Ga0265331_10173342 | 3300031250 | Unclassified | 975 |
| 392 | Ga0265327_10043144 | 3300031251 | Bacteria | 2416 |
| 393 | Ga0265327_10062032 | 3300031251 | Unclassified | 1904 |
| 394 | Ga0265316_10828379 | 3300031344 | Bacteria | 648 |
| 395 | Ga0316579_10508996 | 3300031691 | Unclassified | 583 |
| 396 | Ga0316578_10234498 | 3300031728 | Bacteria | 1102 |
| 397 | Ga0373930_0026584 | 3300034816 | Bacteria | 1167 |
| 398 | Ga0373930_0152846 | 3300034816 | Bacteria | 580 |
| 399 | Ga0373948_0023337 | 3300034817 | Bacteria | 1199 |
| 400 | Ga0373948_0029747 | 3300034817 | Unclassified | 1094 |
| 401 | Ga0373948_0031062 | 3300034817 | Bacteria | 1077 |
| 402 | Ga0373950_0026741 | 3300034818 | Bacteria | 1048 |
| 403 | Ga0373958_0018192 | 3300034819 | Bacteria | 1271 |
| 404 | Ga0373958_0021363 | 3300034819 | Bacteria | 1200 |
| 405 | Ga0373959_0029794 | 3300034820 | Unclassified | 1096 |
| 406 | Ga0373959_0031082 | 3300034820 | Bacteria | 1078 |
| 407 | Ga0373959_0075094 | 3300034820 | Unclassified | 770 |
| 408 | Ga0373938_0031356 | 3300034957 | Bacteria | 1139 |
| 409 | Ga0373938_0044836 | 3300034957 | Unclassified | 993 |
| 410 | Ga0373926_0088561 | 3300035083 | Unclassified | 1149 |
| 411 | Ga0373926_0106819 | 3300035083 | Bacteria | 1050 |
| 412 | Ga0373926_0314216 | 3300035083 | Unclassified | 612 |
| 413 | Ga0373926_0458046 | 3300035083 | Bacteria | 506 |
| 414 | Ga0373928_0037539 | 3300035084 | Bacteria | 1099 |
| 415 | Ga0373928_0043280 | 3300035084 | Unclassified | 1041 |
| 416 | Ga0373929_0021640 | 3300035085 | Bacteria | 1306 |
| 417 | Ga0373929_0021722 | 3300035085 | Bacteria | 1304 |
| 418 | Ga0373929_0045899 | 3300035085 | Unclassified | 985 |
| 419 | Ga0373934_0131361 | 3300035086 | Unclassified | 1021 |
| 420 | Ga0373934_0142914 | 3300035086 | Bacteria | 979 |
| 421 | Ga0373934_0158544 | 3300035086 | Bacteria | 928 |
| 422 | Ga0373940_0056330 | 3300035088 | Unclassified | 1114 |
| 423 | Ga0373940_0072601 | 3300035088 | Bacteria | 1004 |
| 424 | Ga0373944_0103499 | 3300035089 | Unclassified | 964 |
| 425 | Ga0373949_0049342 | 3300035090 | Bacteria | 1056 |
| 426 | Ga0373951_0022088 | 3300035091 | Bacteria | 1463 |
| 427 | Ga0373951_0061319 | 3300035091 | Bacteria | 942 |
| 428 | Ga0373952_0049726 | 3300035092 | Bacteria | 995 |
| 429 | Ga0373923_0080242 | 3300035111 | Bacteria | 1414 |
| 430 | Ga0373923_0166204 | 3300035111 | Unclassified | 1008 |
| 431 | Ga0373923_0201335 | 3300035111 | Bacteria | 920 |
| 432 | Ga0373923_0244388 | 3300035111 | Bacteria | 839 |
| 433 | Ga0373923_0343941 | 3300035111 | Bacteria | 711 |
| 434 | Ga0373932_0033928 | 3300035112 | Bacteria | 1435 |
| 435 | Ga0373932_0061317 | 3300035112 | Bacteria | 1143 |
| 436 | Ga0373936_0008530 | 3300035113 | Bacteria | 3859 |
| 437 | Ga0373936_0047881 | 3300035113 | Bacteria | 1725 |
| 438 | Ga0373936_0063262 | 3300035113 | Bacteria | 1514 |
| 439 | Ga0373939_0007616 | 3300035114 | Bacteria | 2632 |
| 440 | Ga0373939_0054417 | 3300035114 | Unclassified | 1253 |
| 441 | Ga0373939_0073616 | 3300035114 | Bacteria | 1118 |
| 442 | Ga0373939_0128613 | 3300035114 | Unclassified | 901 |
| 443 | Ga0373941_0064747 | 3300035115 | Bacteria | 1198 |
| 444 | Ga0373941_0132824 | 3300035115 | Bacteria | 898 |
| 445 | Ga0373941_0222344 | 3300035115 | Unclassified | 726 |
| 446 | Ga0373945_0088439 | 3300035116 | Bacteria | 1196 |
| 447 | Ga0373945_0116006 | 3300035116 | Unclassified | 1060 |
| 448 | Ga0373945_0154705 | 3300035116 | Unclassified | 931 |
| 449 | Ga0373953_0079377 | 3300035117 | Unclassified | 1362 |
| 450 | Ga0373953_0141034 | 3300035117 | Bacteria | 1031 |
| 451 | Ga0373954_0116976 | 3300035118 | Unclassified | 1292 |
| 452 | Ga0373954_0456705 | 3300035118 | Bacteria | 632 |
| 453 | Ga0373956_0110031 | 3300035119 | Unclassified | 1282 |
| 454 | Ga0373956_0157188 | 3300035119 | Bacteria | 1071 |
| 455 | Ga0373956_0535526 | 3300035119 | Bacteria | 559 |
| 456 | Ga0373957_0066508 | 3300035120 | Bacteria | 1404 |
| 457 | Ga0373957_0154204 | 3300035120 | Bacteria | 944 |
| 458 | Ga0373957_0207113 | 3300035120 | Unclassified | 818 |
| 459 | Ga0373960_0072761 | 3300035121 | Unclassified | 1066 |
| 460 | Ga0373960_0075012 | 3300035121 | Bacteria | 1053 |
| 461 | Ga0373960_0096310 | 3300035121 | Bacteria | 953 |
| 462 | Ga0373960_0103280 | 3300035121 | Bacteria | 926 |
| 463 | Ga0373943_0137453 | 3300035170 | Bacteria | 1313 |
| 464 | Ga0373943_0168980 | 3300035170 | Bacteria | 1195 |
| 465 | Ga0373943_0287753 | 3300035170 | Unclassified | 930 |
| 466 | Ga0373943_0296394 | 3300035170 | Bacteria | 917 |
| 467 | Ga0373946_0170667 | 3300035171 | Unclassified | 1026 |
| 468 | Ga0373946_0176983 | 3300035171 | Unclassified | 1010 |
| 469 | Ga0373946_0414027 | 3300035171 | Bacteria | 682 |
| 470 | Ga0373955_0301465 | 3300035172 | Bacteria | 966 |
| 471 | Ga0373955_0336125 | 3300035172 | Unclassified | 913 |
| 472 | Ga0373955_0379756 | 3300035172 | Bacteria | 857 |
| 473 | Ga0373955_1045110 | 3300035172 | Unclassified | 503 |
| 474 | Ga0373942_0057901 | 3300035207 | Unclassified | 1103 |
| 475 | Ga0373942_0062579 | 3300035207 | Bacteria | 1069 |
| 476 | Ga0373961_0056090 | 3300035241 | Bacteria | 1182 |
| 477 | Ga0373961_0061569 | 3300035241 | Unclassified | 1140 |
| 478 | Ga0373961_0066879 | 3300035241 | Bacteria | 1103 |
| 479 | Ga0373961_0067174 | 3300035241 | Bacteria | 1101 |
| 480 | Ga0373962_0022858 | 3300035242 | Bacteria | 1661 |
| 481 | Ga0373962_0054276 | 3300035242 | Bacteria | 1161 |
| 482 | Ga0373924_0157027 | 3300035410 | Bacteria | 997 |
| 483 | Ga0373924_0159931 | 3300035410 | Unclassified | 987 |
| 484 | Ga0373924_0169783 | 3300035410 | Bacteria | 958 |
| 485 | Ga0373924_0193610 | 3300035410 | Unclassified | 896 |
| 486 | Ga0373924_0542356 | 3300035410 | Bacteria | 523 |
| 487 | Ga0373931_0049978 | 3300035691 | Unclassified | 2223 |
| 488 | Ga0373931_0280064 | 3300035691 | Bacteria | 1023 |
| 489 | Ga0373931_0283740 | 3300035691 | Bacteria | 1017 |
| 490 | Ga0373931_0296907 | 3300035691 | Bacteria | 996 |
| 491 | Ga0373931_0460060 | 3300035691 | Bacteria | 815 |
| 492 | Ga0373935_0086945 | 3300035692 | Bacteria | 2040 |
| 493 | Ga0373935_0383642 | 3300035692 | Unclassified | 1006 |
| 494 | Ga0373935_0395638 | 3300035692 | Bacteria | 991 |
| 495 | Ga0373927_0103987 | 3300035695 | Bacteria | 1848 |
| 496 | Ga0373927_0110422 | 3300035695 | Bacteria | 1791 |
| 497 | Ga0373927_0250351 | 3300035695 | Unclassified | 1164 |
| 498 | Ga0373927_0666519 | 3300035695 | Bacteria | 687 |
| 499 | Ga0373933_0182840 | 3300035724 | Bacteria | 1337 |
| 500 | Ga0373933_0220174 | 3300035724 | Unclassified | 1217 |
| 501 | Ga0373933_0385458 | 3300035724 | Bacteria | 913 |
| 502 | Ga0373933_0485716 | 3300035724 | Bacteria | 809 |
| 503 | Ga0373947_0056873 | 3300035725 | Bacteria | 2365 |
| 504 | Ga0373947_0066489 | 3300035725 | Bacteria | 2200 |
| 505 | Ga0373947_0122126 | 3300035725 | Unclassified | 1655 |
| 506 | Ga0373947_0347020 | 3300035725 | Unclassified | 995 |
| 507 | Ga0373937_0146918 | 3300036401 | Bacteria | 2207 |
| 508 | Ga0373937_0310266 | 3300036401 | Bacteria | 1492 |
| 509 | Ga0373937_0328846 | 3300036401 | Unclassified | 1446 |
| 510 | Ga0373937_0553741 | 3300036401 | Bacteria | 1092 |
| 511 | Ga0373925_0029492 | 3300037068 | Bacteria | 4026 |
| 512 | Ga0373925_0305656 | 3300037068 | Bacteria | 1285 |
| 513 | Ga0373925_0327560 | 3300037068 | Bacteria | 1240 |
| 514 | Ga0373925_0512436 | 3300037068 | Bacteria | 985 |
| 515 | Ga0373925_0545344 | 3300037068 | Bacteria | 953 |
| 516 | Ga0373925_0642170 | 3300037068 | Bacteria | 874 |
| 517 | Ga0436364_0017074 | 3300037853 | Bacteria | 3607 |
| 518 | Ga0436364_0576899 | 3300037853 | Bacteria | 4242 |
| 519 | Ga0436364_0712397 | 3300037853 | Bacteria | 1541 |
| 520 | Ga0436364_0732245 | 3300037853 | Unclassified | 1270 |
| 521 | Ga0436364_0774991 | 3300037853 | Bacteria | 1649 |
| 522 | Ga0436364_1177754 | 3300037853 | Unclassified | 2623 |
| 523 | Ga0436364_1320027 | 3300037853 | Bacteria | 817 |
| 524 | Ga0436365_0082489 | 3300039437 | Bacteria | 3883 |
| 525 | Ga0436365_0149981 | 3300039437 | Unclassified | 788 |
| 526 | Ga0436365_0668315 | 3300039437 | Bacteria | 1278 |
| 527 | Ga0436365_0706061 | 3300039437 | Bacteria | 617 |
| 528 | Ga0436365_0787104 | 3300039437 | Bacteria | 2660 |
| 529 | Ga0436365_0874702 | 3300039437 | Bacteria | 1409 |
| 530 | Ga0436365_0913963 | 3300039437 | Bacteria | 2128 |
| 531 | Ga0436365_1119317 | 3300039437 | Bacteria | 1439 |
| 532 | Ga0436365_1254859 | 3300039437 | Bacteria | 1783 |
| 533 | Ga0436365_1495534 | 3300039437 | Bacteria | 1356 |
| 534 | Ga0436365_1780607 | 3300039437 | Bacteria | 1160 |
| 535 | Ga0436360_0054504 | 3300039438 | Bacteria | 1000 |
| 536 | Ga0436360_0066264 | 3300039438 | Bacteria | 925 |
| 537 | Ga0436360_0144130 | 3300039438 | Bacteria | 1034 |
| 538 | Ga0436360_0146599 | 3300039438 | Bacteria | 3371 |
| 539 | Ga0436360_0341916 | 3300039438 | Bacteria | 610 |
| 540 | Ga0436360_0352881 | 3300039438 | Bacteria | 834 |
| 541 | Ga0436360_0581270 | 3300039438 | Bacteria | 1141 |
| 542 | Ga0436360_0995301 | 3300039438 | Bacteria | 1230 |
| 543 | Ga0436360_1167367 | 3300039438 | Bacteria | 1218 |
| 544 | Ga0436361_0235806 | 3300039447 | Bacteria | 608 |
| 545 | Ga0436361_0289321 | 3300039447 | Bacteria | 1062 |
| 546 | Ga0436361_0694696 | 3300039447 | Bacteria | 1122 |
| 547 | Ga0436361_0757995 | 3300039447 | Bacteria | 1095 |
| 548 | Ga0436361_0803000 | 3300039447 | Bacteria | 732 |
| 549 | Ga0436361_1078566 | 3300039447 | Unclassified | 908 |
| 550 | Ga0436363_0133069 | 3300039450 | Bacteria | 1423 |
| 551 | Ga0436363_0179411 | 3300039450 | Bacteria | 699 |
| 552 | Ga0436363_0445300 | 3300039450 | Bacteria | 1203 |
| 553 | Ga0436363_0599077 | 3300039450 | Bacteria | 712 |
| 554 | Ga0436363_0626302 | 3300039450 | Bacteria | 724 |
| 555 | Ga0436363_0970346 | 3300039450 | Unclassified | 1348 |
| 556 | Ga0436363_1294053 | 3300039450 | Bacteria | 1310 |
| 557 | Ga0436363_1298650 | 3300039450 | Bacteria | 1090 |
| 558 | Ga0436363_1371860 | 3300039450 | Bacteria | 951 |
| 559 | Ga0436363_1433776 | 3300039450 | Bacteria | 3959 |
| 560 | Ga0436363_1640127 | 3300039450 | Bacteria | 993 |
| 561 | Ga0436362_0015221 | 3300039453 | Bacteria | 1296 |
| 562 | Ga0436362_0079551 | 3300039453 | Bacteria | 937 |
| 563 | Ga0436362_0230309 | 3300039453 | Bacteria | 1082 |
| 564 | Ga0436362_0545750 | 3300039453 | Bacteria | 1084 |
| 565 | Ga0451787_141160 | 3300041441 | Bacteria | 1214 |
| 566 | Ga0451798_0084915 | 3300041458 | Bacteria | 1179 |
| 567 | Ga0451800_1599908 | 3300041459 | Bacteria | 1018 |
| 568 | Ga0451804_0627308 | 3300041463 | Bacteria | 974 |
| 569 | Ga0451807_0548946 | 3300041486 | Bacteria | 1062 |
| 570 | Ga0451839_1021707 | 3300041496 | Bacteria | 1740 |
| 571 | Ga0451849_0889094 | 3300041505 | Bacteria | 1161 |
| 572 | Ga0451853_1385000 | 3300041512 | Bacteria | 1243 |
| 573 | Ga0439443_024505 | 3300042003 | Bacteria | 968 |
| 574 | Ga0439448_0108716 | 3300042005 | Bacteria | 946 |
| 575 | Ga0439450_051404 | 3300042008 | Bacteria | 979 |
| 576 | Ga0439456_122937 | 3300042013 | Bacteria | 596 |
| 577 | Ga0439435_0059212 | 3300042436 | Bacteria | 1113 |
| 578 | Ga0439444_0000592 | 3300042437 | Bacteria | 4159 |
| 579 | Ga0439444_0112893 | 3300042437 | Bacteria | 627 |
| 580 | Ga0439444_0187383 | 3300042437 | Bacteria | 516 |
| 581 | Ga0439464_0124874 | 3300042439 | Bacteria | 794 |
| 582 | Ga0439460_0092546 | 3300042461 | Bacteria | 962 |
| 583 | Ga0466963_0317501 | 3300044694 | Bacteria | 1096 |
| 584 | Ga0466963_0321818 | 3300044694 | Bacteria | 1088 |
| 585 | Ga0466957_0383376 | 3300044842 | Unclassified | 959 |
| 586 | Ga0466957_1410568 | 3300044842 | Unclassified | 507 |
| 587 | Ga0466967_0697499 | 3300045976 | Bacteria | 1005 |
| 588 | Ga0466967_1176814 | 3300045976 | Unclassified | 764 |
| 589 | Ga0495592_0212842 | 3300046454 | Bacteria | 1297 |
| 590 | Ga0495592_0268044 | 3300046454 | Unclassified | 1121 |
| 591 | Ga0495592_0279722 | 3300046454 | Bacteria | 1092 |
| 592 | Ga0495603_0130659 | 3300046455 | Unclassified | 1462 |
| 593 | Ga0495603_0316113 | 3300046455 | Bacteria | 896 |
| 594 | Ga0495603_0682492 | 3300046455 | Bacteria | 587 |
| 595 | Ga0495591_098074 | 3300046458 | Bacteria | 729 |
| 596 | Ga0495629_0060353 | 3300046459 | Bacteria | 2650 |
| 597 | Ga0495629_0076054 | 3300046459 | Bacteria | 2344 |
| 598 | Ga0495641_0147443 | 3300046461 | Unclassified | 1051 |
| 599 | Ga0495651_0042880 | 3300046462 | Bacteria | 3511 |
| 600 | Ga0495653_0118238 | 3300046463 | Bacteria | 1893 |
| 601 | Ga0495653_0394147 | 3300046463 | Unclassified | 881 |
| 602 | Ga0495580_0196582 | 3300046472 | Bacteria | 1390 |
| 603 | Ga0495580_0224745 | 3300046472 | Unclassified | 1289 |
| 604 | Ga0495580_0285667 | 3300046472 | Unclassified | 1125 |
| 605 | Ga0495582_0229184 | 3300046473 | Unclassified | 1063 |
| 606 | Ga0495582_0313579 | 3300046473 | Bacteria | 902 |
| 607 | Ga0495639_0184199 | 3300046475 | Unclassified | 1017 |
| 608 | Ga0495639_0264385 | 3300046475 | Bacteria | 853 |
| 609 | Ga0495662_0151416 | 3300046476 | Unclassified | 1142 |
| 610 | Ga0495662_0306118 | 3300046476 | Bacteria | 781 |
| 611 | Ga0495664_0198321 | 3300046477 | Unclassified | 1216 |
| 612 | Ga0495664_0327618 | 3300046477 | Bacteria | 923 |
| 613 | Ga0495664_0444526 | 3300046477 | Bacteria | 776 |
| 614 | Ga0495594_0154172 | 3300046499 | Bacteria | 1304 |
| 615 | Ga0495594_0217468 | 3300046499 | Unclassified | 1089 |
| 616 | Ga0495594_0394416 | 3300046499 | Unclassified | 788 |
| 617 | Ga0495596_0118924 | 3300046500 | Bacteria | 1026 |
| 618 | Ga0495608_0187680 | 3300046511 | Bacteria | 1306 |
| 619 | Ga0495608_0228507 | 3300046511 | Bacteria | 1165 |
| 620 | Ga0495618_0231042 | 3300046514 | Unclassified | 1164 |
| 621 | Ga0495618_0298949 | 3300046514 | Bacteria | 1000 |
| 622 | Ga0495618_0445827 | 3300046514 | Bacteria | 786 |
| 623 | Ga0495628_0223220 | 3300046516 | Bacteria | 1414 |
| 624 | Ga0495630_0435463 | 3300046517 | Unclassified | 1004 |
| 625 | Ga0495663_0208983 | 3300046525 | Bacteria | 683 |
| 626 | Ga0495666_0033902 | 3300046526 | Bacteria | 2492 |
| 627 | Ga0495666_0535929 | 3300046526 | Bacteria | 522 |
| 628 | Ga0495652_0098312 | 3300046529 | Bacteria | 2379 |
| 629 | Ga0495652_0304748 | 3300046529 | Unclassified | 1156 |
| 630 | Ga0495652_0360735 | 3300046529 | Bacteria | 1038 |
| 631 | Ga0495665_0067874 | 3300046531 | Bacteria | 1880 |
| 632 | Ga0495640_0303316 | 3300046533 | Unclassified | 991 |
| 633 | Ga0495640_0367973 | 3300046533 | Bacteria | 885 |
| 634 | Ga0495640_0678952 | 3300046533 | Bacteria | 619 |
| 635 | Ga0495586_0229334 | 3300046535 | Unclassified | 1056 |
| 636 | Ga0495609_0211944 | 3300046538 | Bacteria | 807 |
| 637 | Ga0495645_0268173 | 3300046543 | Unclassified | 1127 |
| 638 | Ga0495645_0346994 | 3300046543 | Bacteria | 957 |
| 639 | Ga0495622_0207864 | 3300046557 | Unclassified | 870 |
| 640 | Ga0495633_0346122 | 3300046558 | Unclassified | 674 |
| 641 | Ga0495667_0346645 | 3300046559 | Unclassified | 938 |
| 642 | Ga0495668_0295290 | 3300046616 | Bacteria | 888 |
| 643 | Ga0495634_0123272 | 3300046642 | Unclassified | 1658 |
| 644 | Ga0495634_0229872 | 3300046642 | Bacteria | 1141 |
| 645 | Ga0495635_0327542 | 3300046663 | Unclassified | 1024 |
| 646 | Ga0495659_0319739 | 3300046664 | Unclassified | 659 |
| 647 | Ga0495588_0181668 | 3300046674 | Unclassified | 1111 |
| 648 | Ga0495588_0497083 | 3300046674 | Bacteria | 639 |
| 649 | Ga0495657_0208952 | 3300046675 | Bacteria | 1187 |
| 650 | Ga0495657_0396612 | 3300046675 | Unclassified | 812 |
| 651 | Ga0495599_0276645 | 3300046678 | Unclassified | 1017 |
| 652 | Ga0495623_0496153 | 3300046679 | Unclassified | 645 |
| 653 | Ga0495646_0135615 | 3300046680 | Unclassified | 1381 |
| 654 | Ga0495646_0179358 | 3300046680 | Bacteria | 1163 |
| 655 | Ga0495647_0015172 | 3300046681 | Bacteria | 2695 |
| 656 | Ga0495647_0113871 | 3300046681 | Bacteria | 1131 |
| 657 | Ga0495647_0142285 | 3300046681 | Unclassified | 1023 |
| 658 | Ga0495658_0209839 | 3300046683 | Unclassified | 1216 |
| 659 | Ga0495658_0321179 | 3300046683 | Bacteria | 981 |
| 660 | Ga0495658_0583182 | 3300046683 | Bacteria | 716 |
| 661 | Ga0495669_0220656 | 3300046684 | Bacteria | 909 |
| 662 | Ga0495613_0182317 | 3300046689 | Unclassified | 1486 |
| 663 | Ga0495613_0722003 | 3300046689 | Unclassified | 655 |
| 664 | Ga0495624_0177766 | 3300046690 | Unclassified | 1297 |
| 665 | Ga0495624_0284860 | 3300046690 | Bacteria | 997 |
| 666 | Ga0495600_0279792 | 3300046809 | Bacteria | 1056 |
| 667 | Ga0495600_0307935 | 3300046809 | Unclassified | 998 |
| 668 | Ga0495600_0327456 | 3300046809 | Unclassified | 962 |
| 669 | Ga0495581_0149538 | 3300047315 | Unclassified | 1363 |
| 670 | Ga0495581_0415344 | 3300047315 | Bacteria | 784 |
| 671 | Ga0495581_0568672 | 3300047315 | Bacteria | 657 |
| 672 | Ga0495636_0527159 | 3300047318 | Bacteria | 573 |
| 673 | Ga0495674_0099218 | 3300047319 | Bacteria | 2479 |
| 674 | Ga0495674_0195359 | 3300047319 | Bacteria | 1680 |
| 675 | Ga0495674_0269180 | 3300047319 | Bacteria | 1398 |
| 676 | Ga0495674_0440870 | 3300047319 | Bacteria | 1047 |
| 677 | Ga0495674_0929718 | 3300047319 | Bacteria | 670 |
| 678 | Ga0495676_0148064 | 3300047321 | Unclassified | 1674 |
| 679 | Ga0495676_0196426 | 3300047321 | Bacteria | 1404 |
| 680 | Ga0495676_0373536 | 3300047321 | Unclassified | 950 |
| 681 | Ga0495676_0617792 | 3300047321 | Bacteria | 705 |
| 682 | Ga0495680_0248163 | 3300047322 | Unclassified | 1262 |
| 683 | Ga0495680_0413194 | 3300047322 | Bacteria | 929 |
| 684 | Ga0495680_0637566 | 3300047322 | Bacteria | 709 |
| 685 | Ga0495684_0138759 | 3300047471 | Bacteria | 1823 |
| 686 | Ga0495684_0430550 | 3300047471 | Unclassified | 920 |
| 687 | Ga0495684_0911159 | 3300047471 | Bacteria | 565 |
| 688 | Ga0495593_0172663 | 3300047673 | Unclassified | 1089 |
| 689 | Ga0495593_0498479 | 3300047673 | Bacteria | 610 |
| 690 | Ga0495602_0540590 | 3300048088 | Bacteria | 809 |
| 691 | Ga0495602_0626086 | 3300048088 | Unclassified | 737 |
| 692 | Ga0495602_0831527 | 3300048088 | Bacteria | 618 |
| 693 | Ga0495614_0013525 | 3300048089 | Bacteria | 3577 |
| 694 | Ga0495614_0135160 | 3300048089 | Bacteria | 1093 |
| 695 | Ga0496100_0160277 | 3300048903 | Unclassified | 1612 |
| 696 | Ga0496100_0294785 | 3300048903 | Bacteria | 1212 |
| 697 | Ga0496100_0419690 | 3300048903 | Bacteria | 1021 |
| 698 | Ga0496101_0077887 | 3300048904 | Bacteria | 2444 |
| 699 | Ga0496101_0343631 | 3300048904 | Unclassified | 1172 |
| 700 | Ga0496101_0375338 | 3300048904 | Bacteria | 1118 |
| 701 | Ga0496102_0283477 | 3300048905 | Bacteria | 1561 |
| 702 | Ga0496102_0471871 | 3300048905 | Unclassified | 1176 |
| 703 | Ga0496103_0192701 | 3300048906 | Bacteria | 1310 |
| 704 | Ga0496103_0546752 | 3300048906 | Unclassified | 739 |
| 705 | Ga0496104_0471651 | 3300048907 | Bacteria | 1166 |
| 706 | Ga0496104_0547102 | 3300048907 | Bacteria | 1068 |
| 707 | Ga0496105_0399259 | 3300048908 | Bacteria | 1091 |
| 708 | Ga0496105_0446435 | 3300048908 | Bacteria | 1021 |
| 709 | Ga0496105_0511902 | 3300048908 | Unclassified | 941 |
| 710 | Ga0496106_0214880 | 3300048909 | Bacteria | 1532 |
| 711 | Ga0496106_0453213 | 3300048909 | Bacteria | 1030 |
| 712 | Ga0496106_0638810 | 3300048909 | Bacteria | 851 |
| 713 | Ga0496107_0383793 | 3300048910 | Unclassified | 1045 |
| 714 | Ga0496107_0566859 | 3300048910 | Unclassified | 840 |
| 715 | Ga0496107_0970319 | 3300048910 | Bacteria | 617 |
| 716 | Ga0496108_0191953 | 3300048911 | Bacteria | 1770 |
| 717 | Ga0496108_0297094 | 3300048911 | Bacteria | 1406 |
| 718 | Ga0496109_0467881 | 3300048912 | Bacteria | 1190 |
| 719 | Ga0496110_0552348 | 3300048913 | Bacteria | 1046 |
| 720 | Ga0496110_0563001 | 3300048913 | Bacteria | 1035 |
| 721 | Ga0496110_0580262 | 3300048913 | Bacteria | 1018 |
| 722 | Ga0496111_0161731 | 3300048914 | Bacteria | 1662 |
| 723 | Ga0496111_0422765 | 3300048914 | Unclassified | 984 |
| 724 | Ga0496111_0446704 | 3300048914 | Unclassified | 954 |
| 725 | Ga0496111_0652728 | 3300048914 | Unclassified | 767 |
| 726 | Ga0496112_0448734 | 3300048915 | Bacteria | 1227 |
| 727 | Ga0496112_0561933 | 3300048915 | Bacteria | 1074 |
| 728 | Ga0496113_0236427 | 3300048916 | Bacteria | 1457 |
| 729 | Ga0496113_0457548 | 3300048916 | Bacteria | 1025 |
| 730 | Ga0496114_0140191 | 3300048917 | Bacteria | 2093 |
| 731 | Ga0496114_0341252 | 3300048917 | Bacteria | 1324 |
| 732 | Ga0496114_0554151 | 3300048917 | Bacteria | 1015 |
| 733 | Ga0496114_1015393 | 3300048917 | Unclassified | 713 |
| 734 | Ga0496115_0384653 | 3300048918 | Bacteria | 1140 |
| 735 | Ga0496115_0478147 | 3300048918 | Bacteria | 1003 |
| 736 | Ga0496115_0709019 | 3300048918 | Unclassified | 790 |
| 737 | Ga0501033_0117890 | 3300049570 | Bacteria | 1928 |
| 738 | Ga0501037_0070898 | 3300049573 | Bacteria | 2535 |
| 739 | Ga0501038_0294201 | 3300049574 | Bacteria | 1275 |
| 740 | Ga0501048_0399836 | 3300049582 | Bacteria | 982 |
| 741 | Ga0501035_0452069 | 3300049822 | Bacteria | 1062 |
| 742 | Ga0501044_0483871 | 3300049823 | Bacteria | 1140 |
| 743 | nmdc:mga09592_410658_c1 | 3300050508 | Bacteria | 1170 |
| 744 | nmdc:mga08y16_466759_c1 | 3300050511 | Unclassified | 1286 |
| 745 | nmdc:mga0n895_469363_c1 | 3300050512 | Bacteria | 1270 |
| 746 | nmdc:mga0n895_540501_c1 | 3300050512 | Bacteria | 1172 |
| 747 | nmdc:mga0rr50_1206431_c1 | 3300050513 | Bacteria | 643 |
| 748 | nmdc:mga0rr50_124553_c1 | 3300050513 | Bacteria | 2056 |
| 749 | nmdc:mga0rr50_576464_c1 | 3300050513 | Unclassified | 959 |
| 750 | nmdc:mga08x19_242467_c1 | 3300050514 | Unclassified | 1243 |
| 751 | nmdc:mga08x19_264305_c1 | 3300050514 | Bacteria | 1190 |
| 752 | nmdc:mga0a205_497154_c1 | 3300050515 | Bacteria | 1077 |
| 753 | Ga0495601_0287601 | 3300053077 | Bacteria | 1072 |
| 754 | Ga0495601_0339924 | 3300053077 | Unclassified | 976 |
| 755 | Ga0495612_0127335 | 3300053078 | Unclassified | 1098 |
| 756 | Ga0495612_0376203 | 3300053078 | Unclassified | 643 |
| 757 | Ga0495655_0063886 | 3300053083 | Bacteria | 1011 |
| 758 | Ga0495655_0077113 | 3300053083 | Bacteria | 945 |
| 759 | Ga0495595_0264512 | 3300053084 | Unclassified | 862 |
| 760 | Ga0495595_0402811 | 3300053084 | Bacteria | 693 |
| 761 | Ga0495619_0354047 | 3300053085 | Unclassified | 1015 |
| 762 | Ga0466962_0166594 | 3300061719 | Bacteria | 1072 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014497 | Ga0182008_10030177 | Ga0182008_100301771 | 126 |
| 2 | 3300042437 | Ga0439444_0187383 | Ga0439444_0187383_13_444 | 126 |
| 3 | 3300005439 | Ga0070711_100181451 | Ga0070711_1001814511 | 129 |
| 4 | 3300005435 | Ga0070714_100640730 | Ga0070714_1006407301 | 136 |
| 5 | 3300005614 | Ga0068856_100208465 | Ga0068856_1002084653 | 136 |
| 6 | 3300009148 | Ga0105243_11589578 | Ga0105243_115895781 | 136 |
| 7 | 3300039447 | Ga0436361_0694696 | Ga0436361_0694696_527_967 | 136 |
| 8 | 3300021361 | Ga0213872_10037559 | Ga0213872_100375594 | 137 |
| 9 | 3300039447 | Ga0436361_0757995 | Ga0436361_0757995_300_770 | 137 |
| 10 | 3300046499 | Ga0495594_0394416 | Ga0495594_0394416_49_501 | 138 |
| 11 | 3300028666 | Ga0265336_10124662 | Ga0265336_101246621 | 139 |
| 12 | 3300031247 | Ga0265340_10174649 | Ga0265340_101746491 | 139 |
| 13 | 3300000041 | ARcpr5oldR_c009791 | ARcpr5oldR_0097911 | 140 |
| 14 | 3300000041 | ARcpr5oldR_c018606 | ARcpr5oldR_0186062 | 140 |
| 15 | 3300000042 | ARSoilYngRDRAFT_c01721 | ARSoilYngRDRAFT_017212 | 140 |
| 16 | 3300000545 | CNXas_1008030 | CNXas_10080301 | 140 |
| 17 | 3300001976 | JGI24752J21851_1042332 | JGI24752J21851_10423321 | 140 |
| 18 | 3300001977 | JGI24746J21847_1016837 | JGI24746J21847_10168372 | 140 |
| 19 | 3300001978 | JGI24747J21853_1019408 | JGI24747J21853_10194082 | 140 |
| 20 | 3300001979 | JGI24740J21852_10065131 | JGI24740J21852_100651312 | 140 |
| 21 | 3300001989 | JGI24739J22299_10082481 | JGI24739J22299_100824811 | 140 |
| 22 | 3300001989 | JGI24739J22299_10090407 | JGI24739J22299_100904072 | 140 |
| 23 | 3300001990 | JGI24737J22298_10158940 | JGI24737J22298_101589401 | 140 |
| 24 | 3300002067 | JGI24735J21928_10074040 | JGI24735J21928_100740402 | 140 |
| 25 | 3300002067 | JGI24735J21928_10107470 | JGI24735J21928_101074701 | 140 |
| 26 | 3300002070 | JGI24750J21931_1016855 | JGI24750J21931_10168552 | 140 |
| 27 | 3300002073 | JGI24745J21846_1011588 | JGI24745J21846_10115882 | 140 |
| 28 | 3300002073 | JGI24745J21846_1018261 | JGI24745J21846_10182611 | 140 |
| 29 | 3300002075 | JGI24738J21930_10037390 | JGI24738J21930_100373902 | 140 |
| 30 | 3300002075 | JGI24738J21930_10038203 | JGI24738J21930_100382032 | 140 |
| 31 | 3300002077 | JGI24744J21845_10033284 | JGI24744J21845_100332842 | 140 |
| 32 | 3300002244 | JGI24742J22300_10028200 | JGI24742J22300_100282002 | 140 |
| 33 | 3300005328 | Ga0070676_10568279 | Ga0070676_105682791 | 140 |
| 34 | 3300005329 | Ga0070683_100398866 | Ga0070683_1003988663 | 140 |
| 35 | 3300005334 | Ga0068869_100406577 | Ga0068869_1004065772 | 140 |
| 36 | 3300005337 | Ga0070682_100254655 | Ga0070682_1002546552 | 140 |
| 37 | 3300005337 | Ga0070682_100498818 | Ga0070682_1004988182 | 140 |
| 38 | 3300005338 | Ga0068868_100328653 | Ga0068868_1003286532 | 140 |
| 39 | 3300005338 | Ga0068868_100608351 | Ga0068868_1006083512 | 140 |
| 40 | 3300005339 | Ga0070660_100663280 | Ga0070660_1006632802 | 140 |
| 41 | 3300005341 | Ga0070691_10127896 | Ga0070691_101278963 | 140 |
| 42 | 3300005343 | Ga0070687_100317661 | Ga0070687_1003176612 | 140 |
| 43 | 3300005344 | Ga0070661_100431550 | Ga0070661_1004315501 | 140 |
| 44 | 3300005347 | Ga0070668_100073853 | Ga0070668_1000738533 | 140 |
| 45 | 3300005354 | Ga0070675_100409576 | Ga0070675_1004095762 | 140 |
| 46 | 3300005354 | Ga0070675_100459706 | Ga0070675_1004597062 | 140 |
| 47 | 3300005355 | Ga0070671_100509250 | Ga0070671_1005092502 | 140 |
| 48 | 3300005356 | Ga0070674_100102483 | Ga0070674_1001024832 | 140 |
| 49 | 3300005366 | Ga0070659_100538241 | Ga0070659_1005382412 | 140 |
| 50 | 3300005367 | Ga0070667_100900131 | Ga0070667_1009001311 | 140 |
| 51 | 3300005434 | Ga0070709_10302024 | Ga0070709_103020242 | 140 |
| 52 | 3300005434 | Ga0070709_10328247 | Ga0070709_103282472 | 140 |
| 53 | 3300005434 | Ga0070709_10585569 | Ga0070709_105855692 | 140 |
| 54 | 3300005435 | Ga0070714_100272154 | Ga0070714_1002721544 | 140 |
| 55 | 3300005435 | Ga0070714_100579280 | Ga0070714_1005792803 | 140 |
| 56 | 3300005435 | Ga0070714_100850255 | Ga0070714_1008502552 | 140 |
| 57 | 3300005435 | Ga0070714_101000789 | Ga0070714_1010007891 | 140 |
| 58 | 3300005435 | Ga0070714_101895977 | Ga0070714_1018959771 | 140 |
| 59 | 3300005436 | Ga0070713_100144619 | Ga0070713_1001446192 | 140 |
| 60 | 3300005436 | Ga0070713_100322622 | Ga0070713_1003226222 | 140 |
| 61 | 3300005436 | Ga0070713_100364949 | Ga0070713_1003649492 | 140 |
| 62 | 3300005436 | Ga0070713_100403752 | Ga0070713_1004037523 | 140 |
| 63 | 3300005436 | Ga0070713_100421446 | Ga0070713_1004214461 | 140 |
| 64 | 3300005436 | Ga0070713_100650161 | Ga0070713_1006501612 | 140 |
| 65 | 3300005436 | Ga0070713_100687637 | Ga0070713_1006876372 | 140 |
| 66 | 3300005436 | Ga0070713_101082672 | Ga0070713_1010826721 | 140 |
| 67 | 3300005436 | Ga0070713_101351855 | Ga0070713_1013518552 | 140 |
| 68 | 3300005437 | Ga0070710_10055528 | Ga0070710_100555284 | 140 |
| 69 | 3300005437 | Ga0070710_10121666 | Ga0070710_101216663 | 140 |
| 70 | 3300005437 | Ga0070710_10123994 | Ga0070710_101239942 | 140 |
| 71 | 3300005437 | Ga0070710_10202314 | Ga0070710_102023142 | 140 |
| 72 | 3300005437 | Ga0070710_10292419 | Ga0070710_102924191 | 140 |
| 73 | 3300005437 | Ga0070710_10300446 | Ga0070710_103004462 | 140 |
| 74 | 3300005437 | Ga0070710_10360878 | Ga0070710_103608782 | 140 |
| 75 | 3300005437 | Ga0070710_10652947 | Ga0070710_106529471 | 140 |
| 76 | 3300005439 | Ga0070711_100134708 | Ga0070711_1001347083 | 140 |
| 77 | 3300005439 | Ga0070711_100171566 | Ga0070711_1001715661 | 140 |
| 78 | 3300005439 | Ga0070711_100340175 | Ga0070711_1003401752 | 140 |
| 79 | 3300005439 | Ga0070711_100360733 | Ga0070711_1003607332 | 140 |
| 80 | 3300005439 | Ga0070711_100457475 | Ga0070711_1004574751 | 140 |
| 81 | 3300005441 | Ga0070700_100128407 | Ga0070700_1001284072 | 140 |
| 82 | 3300005455 | Ga0070663_100475255 | Ga0070663_1004752551 | 140 |
| 83 | 3300005456 | Ga0070678_100356586 | Ga0070678_1003565861 | 140 |
| 84 | 3300005456 | Ga0070678_100442452 | Ga0070678_1004424522 | 140 |
| 85 | 3300005457 | Ga0070662_100271811 | Ga0070662_1002718112 | 140 |
| 86 | 3300005457 | Ga0070662_100436449 | Ga0070662_1004364492 | 140 |
| 87 | 3300005458 | Ga0070681_10473192 | Ga0070681_104731923 | 140 |
| 88 | 3300005458 | Ga0070681_11279741 | Ga0070681_112797411 | 140 |
| 89 | 3300005459 | Ga0068867_100091225 | Ga0068867_1000912254 | 140 |
| 90 | 3300005459 | Ga0068867_100591368 | Ga0068867_1005913682 | 140 |
| 91 | 3300005468 | Ga0070707_100610224 | Ga0070707_1006102242 | 140 |
| 92 | 3300005471 | Ga0070698_100445183 | Ga0070698_1004451832 | 140 |
| 93 | 3300005530 | Ga0070679_100275559 | Ga0070679_1002755594 | 140 |
| 94 | 3300005535 | Ga0070684_100554462 | Ga0070684_1005544621 | 140 |
| 95 | 3300005535 | Ga0070684_100849019 | Ga0070684_1008490191 | 140 |
| 96 | 3300005536 | Ga0070697_101167644 | Ga0070697_1011676441 | 140 |
| 97 | 3300005539 | Ga0068853_100580495 | Ga0068853_1005804951 | 140 |
| 98 | 3300005539 | Ga0068853_100742164 | Ga0068853_1007421641 | 140 |
| 99 | 3300005543 | Ga0070672_100087229 | Ga0070672_1000872292 | 140 |
| 100 | 3300005544 | Ga0070686_101079539 | Ga0070686_1010795391 | 140 |
| 101 | 3300005545 | Ga0070695_100264818 | Ga0070695_1002648181 | 140 |
| 102 | 3300005546 | Ga0070696_100069683 | Ga0070696_1000696832 | 140 |
| 103 | 3300005546 | Ga0070696_101447706 | Ga0070696_1014477061 | 140 |
| 104 | 3300005547 | Ga0070693_100034579 | Ga0070693_1000345793 | 140 |
| 105 | 3300005563 | Ga0068855_100460967 | Ga0068855_1004609672 | 140 |
| 106 | 3300005563 | Ga0068855_100560001 | Ga0068855_1005600012 | 140 |
| 107 | 3300005563 | Ga0068855_100579867 | Ga0068855_1005798672 | 140 |
| 108 | 3300005564 | Ga0070664_100481889 | Ga0070664_1004818893 | 140 |
| 109 | 3300005577 | Ga0068857_100470768 | Ga0068857_1004707681 | 140 |
| 110 | 3300005578 | Ga0068854_100212537 | Ga0068854_1002125373 | 140 |
| 111 | 3300005578 | Ga0068854_100370889 | Ga0068854_1003708892 | 140 |
| 112 | 3300005614 | Ga0068856_100341557 | Ga0068856_1003415573 | 140 |
| 113 | 3300005614 | Ga0068856_100495418 | Ga0068856_1004954182 | 140 |
| 114 | 3300005614 | Ga0068856_100901247 | Ga0068856_1009012472 | 140 |
| 115 | 3300005614 | Ga0068856_101240481 | Ga0068856_1012404812 | 140 |
| 116 | 3300005614 | Ga0068856_101320014 | Ga0068856_1013200141 | 140 |
| 117 | 3300005615 | Ga0070702_100296431 | Ga0070702_1002964313 | 140 |
| 118 | 3300005616 | Ga0068852_100636002 | Ga0068852_1006360022 | 140 |
| 119 | 3300005719 | Ga0068861_100206639 | Ga0068861_1002066393 | 140 |
| 120 | 3300005841 | Ga0068863_100367948 | Ga0068863_1003679483 | 140 |
| 121 | 3300005842 | Ga0068858_100310923 | Ga0068858_1003109231 | 140 |
| 122 | 3300005842 | Ga0068858_100503253 | Ga0068858_1005032532 | 140 |
| 123 | 3300005843 | Ga0068860_100333327 | Ga0068860_1003333273 | 140 |
| 124 | 3300005843 | Ga0068860_100368614 | Ga0068860_1003686142 | 140 |
| 125 | 3300005844 | Ga0068862_100344260 | Ga0068862_1003442603 | 140 |
| 126 | 3300005937 | Ga0081455_10092336 | Ga0081455_100923363 | 140 |
| 127 | 3300006028 | Ga0070717_10173876 | Ga0070717_101738762 | 140 |
| 128 | 3300006028 | Ga0070717_10388316 | Ga0070717_103883163 | 140 |
| 129 | 3300006028 | Ga0070717_10472465 | Ga0070717_104724652 | 140 |
| 130 | 3300006028 | Ga0070717_10506154 | Ga0070717_105061542 | 140 |
| 131 | 3300006028 | Ga0070717_10754668 | Ga0070717_107546682 | 140 |
| 132 | 3300006028 | Ga0070717_11086736 | Ga0070717_110867361 | 140 |
| 133 | 3300006058 | Ga0075432_10019443 | Ga0075432_100194432 | 140 |
| 134 | 3300006058 | Ga0075432_10550808 | Ga0075432_105508081 | 140 |
| 135 | 3300006163 | Ga0070715_10059776 | Ga0070715_100597763 | 140 |
| 136 | 3300006163 | Ga0070715_10176464 | Ga0070715_101764643 | 140 |
| 137 | 3300006173 | Ga0070716_100243622 | Ga0070716_1002436223 | 140 |
| 138 | 3300006173 | Ga0070716_100378061 | Ga0070716_1003780611 | 140 |
| 139 | 3300006173 | Ga0070716_101117439 | Ga0070716_1011174392 | 140 |
| 140 | 3300006173 | Ga0070716_101467215 | Ga0070716_1014672152 | 140 |
| 141 | 3300006175 | Ga0070712_100280251 | Ga0070712_1002802513 | 140 |
| 142 | 3300006175 | Ga0070712_100340237 | Ga0070712_1003402372 | 140 |
| 143 | 3300006175 | Ga0070712_100363570 | Ga0070712_1003635702 | 140 |
| 144 | 3300006175 | Ga0070712_100412377 | Ga0070712_1004123772 | 140 |
| 145 | 3300006237 | Ga0097621_100271257 | Ga0097621_1002712572 | 140 |
| 146 | 3300006237 | Ga0097621_100319973 | Ga0097621_1003199732 | 140 |
| 147 | 3300006237 | Ga0097621_100428399 | Ga0097621_1004283991 | 140 |
| 148 | 3300006237 | Ga0097621_100598444 | Ga0097621_1005984441 | 140 |
| 149 | 3300006358 | Ga0068871_100332285 | Ga0068871_1003322852 | 140 |
| 150 | 3300006358 | Ga0068871_100564610 | Ga0068871_1005646102 | 140 |
| 151 | 3300006358 | Ga0068871_101392462 | Ga0068871_1013924621 | 140 |
| 152 | 3300006852 | Ga0075433_10417180 | Ga0075433_104171802 | 140 |
| 153 | 3300006871 | Ga0075434_100447151 | Ga0075434_1004471513 | 140 |
| 154 | 3300006880 | Ga0075429_100650054 | Ga0075429_1006500542 | 140 |
| 155 | 3300006881 | Ga0068865_100303466 | Ga0068865_1003034662 | 140 |
| 156 | 3300006881 | Ga0068865_100386439 | Ga0068865_1003864391 | 140 |
| 157 | 3300006881 | Ga0068865_100578953 | Ga0068865_1005789532 | 140 |
| 158 | 3300006914 | Ga0075436_100218603 | Ga0075436_1002186033 | 140 |
| 159 | 3300006914 | Ga0075436_100908572 | Ga0075436_1009085721 | 140 |
| 160 | 3300007076 | Ga0075435_100469905 | Ga0075435_1004699051 | 140 |
| 161 | 3300007076 | Ga0075435_100546855 | Ga0075435_1005468552 | 140 |
| 162 | 3300007076 | Ga0075435_101620211 | Ga0075435_1016202112 | 140 |
| 163 | 3300007265 | Ga0099794_10133476 | Ga0099794_101334762 | 140 |
| 164 | 3300007788 | Ga0099795_10106961 | Ga0099795_101069611 | 140 |
| 165 | 3300007788 | Ga0099795_10110451 | Ga0099795_101104512 | 140 |
| 166 | 3300009036 | Ga0105244_10133403 | Ga0105244_101334033 | 140 |
| 167 | 3300009093 | Ga0105240_10502721 | Ga0105240_105027213 | 140 |
| 168 | 3300009094 | Ga0111539_10273114 | Ga0111539_102731142 | 140 |
| 169 | 3300009094 | Ga0111539_11366615 | Ga0111539_113666152 | 140 |
| 170 | 3300009098 | Ga0105245_10553540 | Ga0105245_105535402 | 140 |
| 171 | 3300009098 | Ga0105245_11036741 | Ga0105245_110367412 | 140 |
| 172 | 3300009101 | Ga0105247_10262509 | Ga0105247_102625091 | 140 |
| 173 | 3300009101 | Ga0105247_10872050 | Ga0105247_108720501 | 140 |
| 174 | 3300009101 | Ga0105247_10900153 | Ga0105247_109001531 | 140 |
| 175 | 3300009148 | Ga0105243_10444733 | Ga0105243_104447333 | 140 |
| 176 | 3300009148 | Ga0105243_11172785 | Ga0105243_111727852 | 140 |
| 177 | 3300009174 | Ga0105241_10636922 | Ga0105241_106369222 | 140 |
| 178 | 3300009174 | Ga0105241_10640672 | Ga0105241_106406721 | 140 |
| 179 | 3300009176 | Ga0105242_10401188 | Ga0105242_104011881 | 140 |
| 180 | 3300009176 | Ga0105242_10423581 | Ga0105242_104235811 | 140 |
| 181 | 3300009176 | Ga0105242_11418374 | Ga0105242_114183741 | 140 |
| 182 | 3300009177 | Ga0105248_10400801 | Ga0105248_104008013 | 140 |
| 183 | 3300009177 | Ga0105248_10917251 | Ga0105248_109172511 | 140 |
| 184 | 3300009545 | Ga0105237_10435107 | Ga0105237_104351073 | 140 |
| 185 | 3300009551 | Ga0105238_10485549 | Ga0105238_104855492 | 140 |
| 186 | 3300009551 | Ga0105238_11351325 | Ga0105238_113513252 | 140 |
| 187 | 3300009553 | Ga0105249_10314553 | Ga0105249_103145532 | 140 |
| 188 | 3300009553 | Ga0105249_10356568 | Ga0105249_103565681 | 140 |
| 189 | 3300010159 | Ga0099796_10098712 | Ga0099796_100987121 | 140 |
| 190 | 3300010159 | Ga0099796_10163580 | Ga0099796_101635801 | 140 |
| 191 | 3300010159 | Ga0099796_10211494 | Ga0099796_102114942 | 140 |
| 192 | 3300010375 | Ga0105239_10291681 | Ga0105239_102916813 | 140 |
| 193 | 3300010375 | Ga0105239_10666392 | Ga0105239_106663924 | 140 |
| 194 | 3300010375 | Ga0105239_10894832 | Ga0105239_108948321 | 140 |
| 195 | 3300010375 | Ga0105239_11219824 | Ga0105239_112198242 | 140 |
| 196 | 3300011119 | Ga0105246_10318816 | Ga0105246_103188163 | 140 |
| 197 | 3300011119 | Ga0105246_10702729 | Ga0105246_107027292 | 140 |
| 198 | 3300011119 | Ga0105246_10716348 | Ga0105246_107163482 | 140 |
| 199 | 3300011119 | Ga0105246_10779823 | Ga0105246_107798232 | 140 |
| 200 | 3300011119 | Ga0105246_10789319 | Ga0105246_107893191 | 140 |
| 201 | 3300012473 | Ga0157340_1003418 | Ga0157340_10034182 | 140 |
| 202 | 3300012477 | Ga0157336_1002308 | Ga0157336_10023082 | 140 |
| 203 | 3300012481 | Ga0157320_1001188 | Ga0157320_10011882 | 140 |
| 204 | 3300012483 | Ga0157337_1030317 | Ga0157337_10303171 | 140 |
| 205 | 3300012485 | Ga0157325_1003579 | Ga0157325_10035792 | 140 |
| 206 | 3300012487 | Ga0157321_1000527 | Ga0157321_10005271 | 140 |
| 207 | 3300012490 | Ga0157322_1003049 | Ga0157322_10030492 | 140 |
| 208 | 3300012495 | Ga0157323_1001470 | Ga0157323_10014702 | 140 |
| 209 | 3300012497 | Ga0157319_1001572 | Ga0157319_10015722 | 140 |
| 210 | 3300012502 | Ga0157347_1006729 | Ga0157347_10067292 | 140 |
| 211 | 3300012507 | Ga0157342_1019984 | Ga0157342_10199842 | 140 |
| 212 | 3300012515 | Ga0157338_1004006 | Ga0157338_10040062 | 140 |
| 213 | 3300013102 | Ga0157371_10256946 | Ga0157371_102569463 | 140 |
| 214 | 3300013102 | Ga0157371_10447341 | Ga0157371_104473411 | 140 |
| 215 | 3300013104 | Ga0157370_10090670 | Ga0157370_100906701 | 140 |
| 216 | 3300013105 | Ga0157369_11382160 | Ga0157369_113821602 | 140 |
| 217 | 3300013105 | Ga0157369_11679563 | Ga0157369_116795631 | 140 |
| 218 | 3300013296 | Ga0157374_10327884 | Ga0157374_103278841 | 140 |
| 219 | 3300013296 | Ga0157374_10393927 | Ga0157374_103939272 | 140 |
| 220 | 3300013296 | Ga0157374_11657729 | Ga0157374_116577292 | 140 |
| 221 | 3300013297 | Ga0157378_10313310 | Ga0157378_103133102 | 140 |
| 222 | 3300013297 | Ga0157378_10495091 | Ga0157378_104950911 | 140 |
| 223 | 3300013306 | Ga0163162_10131572 | Ga0163162_101315723 | 140 |
| 224 | 3300013306 | Ga0163162_10214035 | Ga0163162_102140353 | 140 |
| 225 | 3300013306 | Ga0163162_10732127 | Ga0163162_107321272 | 140 |
| 226 | 3300013306 | Ga0163162_11099922 | Ga0163162_110999222 | 140 |
| 227 | 3300013307 | Ga0157372_10150735 | Ga0157372_101507352 | 140 |
| 228 | 3300013307 | Ga0157372_10842635 | Ga0157372_108426352 | 140 |
| 229 | 3300013307 | Ga0157372_11838971 | Ga0157372_118389712 | 140 |
| 230 | 3300013308 | Ga0157375_10692787 | Ga0157375_106927871 | 140 |
| 231 | 3300013308 | Ga0157375_10762682 | Ga0157375_107626821 | 140 |
| 232 | 3300014325 | Ga0163163_11903013 | Ga0163163_119030131 | 140 |
| 233 | 3300014326 | Ga0157380_10592783 | Ga0157380_105927832 | 140 |
| 234 | 3300014497 | Ga0182008_10053297 | Ga0182008_100532974 | 140 |
| 235 | 3300014497 | Ga0182008_10090742 | Ga0182008_100907423 | 140 |
| 236 | 3300014497 | Ga0182008_10135606 | Ga0182008_101356061 | 140 |
| 237 | 3300014497 | Ga0182008_10903815 | Ga0182008_109038151 | 140 |
| 238 | 3300014745 | Ga0157377_10214692 | Ga0157377_102146921 | 140 |
| 239 | 3300014968 | Ga0157379_10291155 | Ga0157379_102911552 | 140 |
| 240 | 3300014968 | Ga0157379_10363728 | Ga0157379_103637282 | 140 |
| 241 | 3300014968 | Ga0157379_10598322 | Ga0157379_105983221 | 140 |
| 242 | 3300014969 | Ga0157376_10156291 | Ga0157376_101562912 | 140 |
| 243 | 3300014969 | Ga0157376_10230967 | Ga0157376_102309673 | 140 |
| 244 | 3300014969 | Ga0157376_10413481 | Ga0157376_104134812 | 140 |
| 245 | 3300014969 | Ga0157376_10552189 | Ga0157376_105521893 | 140 |
| 246 | 3300017792 | Ga0163161_10244874 | Ga0163161_102448742 | 140 |
| 247 | 3300017792 | Ga0163161_10268217 | Ga0163161_102682172 | 140 |
| 248 | 3300020082 | Ga0206353_11291880 | Ga0206353_112918801 | 140 |
| 249 | 3300021358 | Ga0213873_10076813 | Ga0213873_100768132 | 140 |
| 250 | 3300021358 | Ga0213873_10085351 | Ga0213873_100853511 | 140 |
| 251 | 3300021377 | Ga0213874_10052003 | Ga0213874_100520032 | 140 |
| 252 | 3300021377 | Ga0213874_10079775 | Ga0213874_100797751 | 140 |
| 253 | 3300021377 | Ga0213874_10088964 | Ga0213874_100889641 | 140 |
| 254 | 3300021377 | Ga0213874_10102993 | Ga0213874_101029931 | 140 |
| 255 | 3300021377 | Ga0213874_10107710 | Ga0213874_101077101 | 140 |
| 256 | 3300021384 | Ga0213876_10171733 | Ga0213876_101717332 | 140 |
| 257 | 3300021384 | Ga0213876_10194414 | Ga0213876_101944142 | 140 |
| 258 | 3300021384 | Ga0213876_10204175 | Ga0213876_102041751 | 140 |
| 259 | 3300021384 | Ga0213876_10214462 | Ga0213876_102144622 | 140 |
| 260 | 3300021384 | Ga0213876_10258873 | Ga0213876_102588732 | 140 |
| 261 | 3300021384 | Ga0213876_10497707 | Ga0213876_104977071 | 140 |
| 262 | 3300021388 | Ga0213875_10021387 | Ga0213875_100213875 | 140 |
| 263 | 3300021388 | Ga0213875_10141589 | Ga0213875_101415892 | 140 |
| 264 | 3300021388 | Ga0213875_10182296 | Ga0213875_101822962 | 140 |
| 265 | 3300021441 | Ga0213871_10066702 | Ga0213871_100667021 | 140 |
| 266 | 3300021441 | Ga0213871_10067506 | Ga0213871_100675061 | 140 |
| 267 | 3300021441 | Ga0213871_10220210 | Ga0213871_102202101 | 140 |
| 268 | 3300021441 | Ga0213871_10229420 | Ga0213871_102294201 | 140 |
| 269 | 3300025321 | Ga0207656_10228527 | Ga0207656_102285271 | 140 |
| 270 | 3300025728 | Ga0207655_1124449 | Ga0207655_11244491 | 140 |
| 271 | 3300025885 | Ga0207653_10059364 | Ga0207653_100593642 | 140 |
| 272 | 3300025898 | Ga0207692_10265609 | Ga0207692_102656091 | 140 |
| 273 | 3300025898 | Ga0207692_10276687 | Ga0207692_102766871 | 140 |
| 274 | 3300025898 | Ga0207692_10289611 | Ga0207692_102896111 | 140 |
| 275 | 3300025898 | Ga0207692_10725618 | Ga0207692_107256182 | 140 |
| 276 | 3300025898 | Ga0207692_11130548 | Ga0207692_111305481 | 140 |
| 277 | 3300025899 | Ga0207642_10115400 | Ga0207642_101154001 | 140 |
| 278 | 3300025900 | Ga0207710_10285931 | Ga0207710_102859312 | 140 |
| 279 | 3300025901 | Ga0207688_10064425 | Ga0207688_100644253 | 140 |
| 280 | 3300025901 | Ga0207688_10099961 | Ga0207688_100999613 | 140 |
| 281 | 3300025905 | Ga0207685_10003995 | Ga0207685_100039954 | 140 |
| 282 | 3300025905 | Ga0207685_10125786 | Ga0207685_101257861 | 140 |
| 283 | 3300025905 | Ga0207685_10178945 | Ga0207685_101789451 | 140 |
| 284 | 3300025905 | Ga0207685_10257921 | Ga0207685_102579212 | 140 |
| 285 | 3300025906 | Ga0207699_10086157 | Ga0207699_100861571 | 140 |
| 286 | 3300025906 | Ga0207699_10301996 | Ga0207699_103019962 | 140 |
| 287 | 3300025906 | Ga0207699_10359489 | Ga0207699_103594892 | 140 |
| 288 | 3300025906 | Ga0207699_10419669 | Ga0207699_104196691 | 140 |
| 289 | 3300025906 | Ga0207699_10496192 | Ga0207699_104961922 | 140 |
| 290 | 3300025906 | Ga0207699_11041624 | Ga0207699_110416241 | 140 |
| 291 | 3300025911 | Ga0207654_10286683 | Ga0207654_102866831 | 140 |
| 292 | 3300025911 | Ga0207654_10384027 | Ga0207654_103840272 | 140 |
| 293 | 3300025912 | Ga0207707_10461368 | Ga0207707_104613682 | 140 |
| 294 | 3300025912 | Ga0207707_11170101 | Ga0207707_111701011 | 140 |
| 295 | 3300025913 | Ga0207695_10705245 | Ga0207695_107052452 | 140 |
| 296 | 3300025914 | Ga0207671_10576429 | Ga0207671_105764291 | 140 |
| 297 | 3300025914 | Ga0207671_10628190 | Ga0207671_106281901 | 140 |
| 298 | 3300025914 | Ga0207671_10644018 | Ga0207671_106440181 | 140 |
| 299 | 3300025915 | Ga0207693_10190698 | Ga0207693_101906982 | 140 |
| 300 | 3300025915 | Ga0207693_10210552 | Ga0207693_102105522 | 140 |
| 301 | 3300025915 | Ga0207693_10286388 | Ga0207693_102863882 | 140 |
| 302 | 3300025915 | Ga0207693_10331239 | Ga0207693_103312392 | 140 |
| 303 | 3300025916 | Ga0207663_10381923 | Ga0207663_103819232 | 140 |
| 304 | 3300025916 | Ga0207663_10410941 | Ga0207663_104109411 | 140 |
| 305 | 3300025916 | Ga0207663_10424580 | Ga0207663_104245801 | 140 |
| 306 | 3300025916 | Ga0207663_10427020 | Ga0207663_104270202 | 140 |
| 307 | 3300025916 | Ga0207663_10429627 | Ga0207663_104296272 | 140 |
| 308 | 3300025916 | Ga0207663_11132631 | Ga0207663_111326311 | 140 |
| 309 | 3300025917 | Ga0207660_10444310 | Ga0207660_104443102 | 140 |
| 310 | 3300025918 | Ga0207662_10229620 | Ga0207662_102296202 | 140 |
| 311 | 3300025919 | Ga0207657_10347306 | Ga0207657_103473061 | 140 |
| 312 | 3300025921 | Ga0207652_10687403 | Ga0207652_106874031 | 140 |
| 313 | 3300025922 | Ga0207646_10547631 | Ga0207646_105476312 | 140 |
| 314 | 3300025926 | Ga0207659_10561732 | Ga0207659_105617321 | 140 |
| 315 | 3300025926 | Ga0207659_11391073 | Ga0207659_113910731 | 140 |
| 316 | 3300025927 | Ga0207687_10447560 | Ga0207687_104475602 | 140 |
| 317 | 3300025927 | Ga0207687_10476169 | Ga0207687_104761692 | 140 |
| 318 | 3300025927 | Ga0207687_10519740 | Ga0207687_105197401 | 140 |
| 319 | 3300025928 | Ga0207700_10080272 | Ga0207700_100802723 | 140 |
| 320 | 3300025928 | Ga0207700_10206222 | Ga0207700_102062222 | 140 |
| 321 | 3300025928 | Ga0207700_10229061 | Ga0207700_102290613 | 140 |
| 322 | 3300025928 | Ga0207700_10281252 | Ga0207700_102812521 | 140 |
| 323 | 3300025928 | Ga0207700_10491448 | Ga0207700_104914482 | 140 |
| 324 | 3300025928 | Ga0207700_10534692 | Ga0207700_105346921 | 140 |
| 325 | 3300025928 | Ga0207700_10564300 | Ga0207700_105643002 | 140 |
| 326 | 3300025928 | Ga0207700_10569349 | Ga0207700_105693491 | 140 |
| 327 | 3300025928 | Ga0207700_10838948 | Ga0207700_108389481 | 140 |
| 328 | 3300025929 | Ga0207664_10080381 | Ga0207664_100803812 | 140 |
| 329 | 3300025929 | Ga0207664_10314694 | Ga0207664_103146942 | 140 |
| 330 | 3300025929 | Ga0207664_10386413 | Ga0207664_103864133 | 140 |
| 331 | 3300025929 | Ga0207664_10444618 | Ga0207664_104446181 | 140 |
| 332 | 3300025929 | Ga0207664_10521101 | Ga0207664_105211012 | 140 |
| 333 | 3300025929 | Ga0207664_10574273 | Ga0207664_105742732 | 140 |
| 334 | 3300025929 | Ga0207664_10588329 | Ga0207664_105883292 | 140 |
| 335 | 3300025929 | Ga0207664_11247287 | Ga0207664_112472871 | 140 |
| 336 | 3300025931 | Ga0207644_10570571 | Ga0207644_105705712 | 140 |
| 337 | 3300025932 | Ga0207690_10422457 | Ga0207690_104224572 | 140 |
| 338 | 3300025933 | Ga0207706_10348974 | Ga0207706_103489741 | 140 |
| 339 | 3300025933 | Ga0207706_10361211 | Ga0207706_103612112 | 140 |
| 340 | 3300025934 | Ga0207686_10362561 | Ga0207686_103625611 | 140 |
| 341 | 3300025934 | Ga0207686_10992513 | Ga0207686_109925132 | 140 |
| 342 | 3300025935 | Ga0207709_10270762 | Ga0207709_102707623 | 140 |
| 343 | 3300025938 | Ga0207704_10339066 | Ga0207704_103390662 | 140 |
| 344 | 3300025938 | Ga0207704_10475154 | Ga0207704_104751541 | 140 |
| 345 | 3300025938 | Ga0207704_10908798 | Ga0207704_109087982 | 140 |
| 346 | 3300025938 | Ga0207704_11021519 | Ga0207704_110215191 | 140 |
| 347 | 3300025939 | Ga0207665_10103639 | Ga0207665_101036393 | 140 |
| 348 | 3300025939 | Ga0207665_10127856 | Ga0207665_101278562 | 140 |
| 349 | 3300025939 | Ga0207665_10181537 | Ga0207665_101815374 | 140 |
| 350 | 3300025939 | Ga0207665_10351619 | Ga0207665_103516191 | 140 |
| 351 | 3300025939 | Ga0207665_10368663 | Ga0207665_103686631 | 140 |
| 352 | 3300025940 | Ga0207691_10410429 | Ga0207691_104104293 | 140 |
| 353 | 3300025942 | Ga0207689_10309441 | Ga0207689_103094411 | 140 |
| 354 | 3300025944 | Ga0207661_10449564 | Ga0207661_104495642 | 140 |
| 355 | 3300025944 | Ga0207661_10503983 | Ga0207661_105039831 | 140 |
| 356 | 3300025944 | Ga0207661_11969520 | Ga0207661_119695201 | 140 |
| 357 | 3300025945 | Ga0207679_10527059 | Ga0207679_105270593 | 140 |
| 358 | 3300025949 | Ga0207667_10397605 | Ga0207667_103976051 | 140 |
| 359 | 3300025949 | Ga0207667_10435307 | Ga0207667_104353071 | 140 |
| 360 | 3300025949 | Ga0207667_10686525 | Ga0207667_106865252 | 140 |
| 361 | 3300025961 | Ga0207712_10527775 | Ga0207712_105277752 | 140 |
| 362 | 3300025972 | Ga0207668_10563275 | Ga0207668_105632751 | 140 |
| 363 | 3300025981 | Ga0207640_10425139 | Ga0207640_104251391 | 140 |
| 364 | 3300025981 | Ga0207640_10580413 | Ga0207640_105804132 | 140 |
| 365 | 3300026023 | Ga0207677_10305800 | Ga0207677_103058001 | 140 |
| 366 | 3300026041 | Ga0207639_10706900 | Ga0207639_107069002 | 140 |
| 367 | 3300026041 | Ga0207639_10797705 | Ga0207639_107977051 | 140 |
| 368 | 3300026067 | Ga0207678_10350612 | Ga0207678_103506122 | 140 |
| 369 | 3300026075 | Ga0207708_10160956 | Ga0207708_101609562 | 140 |
| 370 | 3300026078 | Ga0207702_10574838 | Ga0207702_105748381 | 140 |
| 371 | 3300026078 | Ga0207702_11050811 | Ga0207702_110508111 | 140 |
| 372 | 3300026078 | Ga0207702_11134469 | Ga0207702_111344691 | 140 |
| 373 | 3300026088 | Ga0207641_10690429 | Ga0207641_106904291 | 140 |
| 374 | 3300026088 | Ga0207641_12221970 | Ga0207641_122219702 | 140 |
| 375 | 3300026089 | Ga0207648_10135967 | Ga0207648_101359672 | 140 |
| 376 | 3300026116 | Ga0207674_10530041 | Ga0207674_105300412 | 140 |
| 377 | 3300026118 | Ga0207675_100642835 | Ga0207675_1006428351 | 140 |
| 378 | 3300026118 | Ga0207675_100989725 | Ga0207675_1009897251 | 140 |
| 379 | 3300026121 | Ga0207683_10349697 | Ga0207683_103496972 | 140 |
| 380 | 3300026121 | Ga0207683_10583378 | Ga0207683_105833782 | 140 |
| 381 | 3300026142 | Ga0207698_10689433 | Ga0207698_106894331 | 140 |
| 382 | 3300026142 | Ga0207698_10759290 | Ga0207698_107592901 | 140 |
| 383 | 3300026142 | Ga0207698_10842122 | Ga0207698_108421222 | 140 |
| 384 | 3300026142 | Ga0207698_12585186 | Ga0207698_125851861 | 140 |
| 385 | 3300027512 | Ga0209179_1042914 | Ga0209179_10429141 | 140 |
| 386 | 3300027671 | Ga0209588_1088485 | Ga0209588_10884852 | 140 |
| 387 | 3300027907 | Ga0207428_10280109 | Ga0207428_102801092 | 140 |
| 388 | 3300027907 | Ga0207428_10377972 | Ga0207428_103779722 | 140 |
| 389 | 3300028380 | Ga0268265_10669357 | Ga0268265_106693571 | 140 |
| 390 | 3300028381 | Ga0268264_10678980 | Ga0268264_106789802 | 140 |
| 391 | 3300028381 | Ga0268264_10689034 | Ga0268264_106890342 | 140 |
| 392 | 3300029957 | Ga0265324_10101149 | Ga0265324_101011491 | 140 |
| 393 | 3300031239 | Ga0265328_10110287 | Ga0265328_101102871 | 140 |
| 394 | 3300031241 | Ga0265325_10428752 | Ga0265325_104287521 | 140 |
| 395 | 3300031250 | Ga0265331_10173342 | Ga0265331_101733421 | 140 |
| 396 | 3300031251 | Ga0265327_10043144 | Ga0265327_100431443 | 140 |
| 397 | 3300031251 | Ga0265327_10062032 | Ga0265327_100620321 | 140 |
| 398 | 3300031344 | Ga0265316_10828379 | Ga0265316_108283792 | 140 |
| 399 | 3300031691 | Ga0316579_10508996 | Ga0316579_105089961 | 140 |
| 400 | 3300031728 | Ga0316578_10234498 | Ga0316578_102344982 | 140 |
| 401 | 3300034816 | Ga0373930_0026584 | Ga0373930_0026584_512_934 | 140 |
| 402 | 3300034816 | Ga0373930_0152846 | Ga0373930_0152846_24_446 | 140 |
| 403 | 3300034817 | Ga0373948_0023337 | Ga0373948_0023337_278_700 | 140 |
| 404 | 3300034817 | Ga0373948_0029747 | Ga0373948_0029747_217_639 | 140 |
| 405 | 3300034817 | Ga0373948_0031062 | Ga0373948_0031062_176_598 | 140 |
| 406 | 3300034818 | Ga0373950_0026741 | Ga0373950_0026741_498_920 | 140 |
| 407 | 3300034819 | Ga0373958_0018192 | Ga0373958_0018192_245_667 | 140 |
| 408 | 3300034819 | Ga0373958_0021363 | Ga0373958_0021363_319_741 | 140 |
| 409 | 3300034820 | Ga0373959_0029794 | Ga0373959_0029794_416_838 | 140 |
| 410 | 3300034820 | Ga0373959_0031082 | Ga0373959_0031082_446_868 | 140 |
| 411 | 3300034820 | Ga0373959_0075094 | Ga0373959_0075094_188_610 | 140 |
| 412 | 3300034957 | Ga0373938_0031356 | Ga0373938_0031356_278_700 | 140 |
| 413 | 3300034957 | Ga0373938_0044836 | Ga0373938_0044836_440_862 | 140 |
| 414 | 3300035083 | Ga0373926_0088561 | Ga0373926_0088561_128_550 | 140 |
| 415 | 3300035083 | Ga0373926_0106819 | Ga0373926_0106819_194_616 | 140 |
| 416 | 3300035083 | Ga0373926_0314216 | Ga0373926_0314216_34_456 | 140 |
| 417 | 3300035083 | Ga0373926_0458046 | Ga0373926_0458046_36_458 | 140 |
| 418 | 3300035084 | Ga0373928_0037539 | Ga0373928_0037539_445_867 | 140 |
| 419 | 3300035084 | Ga0373928_0043280 | Ga0373928_0043280_475_897 | 140 |
| 420 | 3300035085 | Ga0373929_0021640 | Ga0373929_0021640_636_1058 | 140 |
| 421 | 3300035085 | Ga0373929_0021722 | Ga0373929_0021722_763_1185 | 140 |
| 422 | 3300035085 | Ga0373929_0045899 | Ga0373929_0045899_425_847 | 140 |
| 423 | 3300035086 | Ga0373934_0131361 | Ga0373934_0131361_181_603 | 140 |
| 424 | 3300035086 | Ga0373934_0142914 | Ga0373934_0142914_301_723 | 140 |
| 425 | 3300035086 | Ga0373934_0158544 | Ga0373934_0158544_128_550 | 140 |
| 426 | 3300035088 | Ga0373940_0056330 | Ga0373940_0056330_257_679 | 140 |
| 427 | 3300035088 | Ga0373940_0072601 | Ga0373940_0072601_126_548 | 140 |
| 428 | 3300035089 | Ga0373944_0103499 | Ga0373944_0103499_135_557 | 140 |
| 429 | 3300035090 | Ga0373949_0049342 | Ga0373949_0049342_482_904 | 140 |
| 430 | 3300035091 | Ga0373951_0022088 | Ga0373951_0022088_710_1132 | 140 |
| 431 | 3300035091 | Ga0373951_0061319 | Ga0373951_0061319_22_444 | 140 |
| 432 | 3300035092 | Ga0373952_0049726 | Ga0373952_0049726_120_542 | 140 |
| 433 | 3300035111 | Ga0373923_0080242 | Ga0373923_0080242_123_545 | 140 |
| 434 | 3300035111 | Ga0373923_0166204 | Ga0373923_0166204_457_879 | 140 |
| 435 | 3300035111 | Ga0373923_0201335 | Ga0373923_0201335_156_578 | 140 |
| 436 | 3300035111 | Ga0373923_0244388 | Ga0373923_0244388_392_814 | 140 |
| 437 | 3300035111 | Ga0373923_0343941 | Ga0373923_0343941_186_608 | 140 |
| 438 | 3300035112 | Ga0373932_0033928 | Ga0373932_0033928_274_696 | 140 |
| 439 | 3300035112 | Ga0373932_0061317 | Ga0373932_0061317_197_619 | 140 |
| 440 | 3300035113 | Ga0373936_0008530 | Ga0373936_0008530_2583_3005 | 140 |
| 441 | 3300035113 | Ga0373936_0047881 | Ga0373936_0047881_949_1401 | 140 |
| 442 | 3300035113 | Ga0373936_0063262 | Ga0373936_0063262_964_1386 | 140 |
| 443 | 3300035114 | Ga0373939_0007616 | Ga0373939_0007616_1778_2200 | 140 |
| 444 | 3300035114 | Ga0373939_0054417 | Ga0373939_0054417_261_683 | 140 |
| 445 | 3300035114 | Ga0373939_0073616 | Ga0373939_0073616_555_977 | 140 |
| 446 | 3300035114 | Ga0373939_0128613 | Ga0373939_0128613_91_513 | 140 |
| 447 | 3300035115 | Ga0373941_0064747 | Ga0373941_0064747_132_554 | 140 |
| 448 | 3300035115 | Ga0373941_0132824 | Ga0373941_0132824_336_758 | 140 |
| 449 | 3300035115 | Ga0373941_0222344 | Ga0373941_0222344_87_509 | 140 |
| 450 | 3300035116 | Ga0373945_0088439 | Ga0373945_0088439_440_862 | 140 |
| 451 | 3300035116 | Ga0373945_0116006 | Ga0373945_0116006_494_916 | 140 |
| 452 | 3300035116 | Ga0373945_0154705 | Ga0373945_0154705_497_919 | 140 |
| 453 | 3300035117 | Ga0373953_0079377 | Ga0373953_0079377_514_936 | 140 |
| 454 | 3300035117 | Ga0373953_0141034 | Ga0373953_0141034_173_595 | 140 |
| 455 | 3300035118 | Ga0373954_0116976 | Ga0373954_0116976_500_922 | 140 |
| 456 | 3300035118 | Ga0373954_0456705 | Ga0373954_0456705_92_514 | 140 |
| 457 | 3300035119 | Ga0373956_0110031 | Ga0373956_0110031_591_1013 | 140 |
| 458 | 3300035119 | Ga0373956_0157188 | Ga0373956_0157188_491_913 | 140 |
| 459 | 3300035119 | Ga0373956_0535526 | Ga0373956_0535526_24_446 | 140 |
| 460 | 3300035120 | Ga0373957_0066508 | Ga0373957_0066508_556_978 | 140 |
| 461 | 3300035120 | Ga0373957_0154204 | Ga0373957_0154204_16_438 | 140 |
| 462 | 3300035120 | Ga0373957_0207113 | Ga0373957_0207113_199_621 | 140 |
| 463 | 3300035121 | Ga0373960_0072761 | Ga0373960_0072761_141_563 | 140 |
| 464 | 3300035121 | Ga0373960_0075012 | Ga0373960_0075012_507_929 | 140 |
| 465 | 3300035121 | Ga0373960_0096310 | Ga0373960_0096310_63_485 | 140 |
| 466 | 3300035121 | Ga0373960_0103280 | Ga0373960_0103280_45_467 | 140 |
| 467 | 3300035170 | Ga0373943_0137453 | Ga0373943_0137453_469_891 | 140 |
| 468 | 3300035170 | Ga0373943_0168980 | Ga0373943_0168980_156_578 | 140 |
| 469 | 3300035170 | Ga0373943_0287753 | Ga0373943_0287753_445_867 | 140 |
| 470 | 3300035170 | Ga0373943_0296394 | Ga0373943_0296394_373_795 | 140 |
| 471 | 3300035171 | Ga0373946_0170667 | Ga0373946_0170667_158_580 | 140 |
| 472 | 3300035171 | Ga0373946_0176983 | Ga0373946_0176983_457_879 | 140 |
| 473 | 3300035171 | Ga0373946_0414027 | Ga0373946_0414027_40_462 | 140 |
| 474 | 3300035172 | Ga0373955_0301465 | Ga0373955_0301465_87_509 | 140 |
| 475 | 3300035172 | Ga0373955_0336125 | Ga0373955_0336125_428_850 | 140 |
| 476 | 3300035172 | Ga0373955_0379756 | Ga0373955_0379756_109_531 | 140 |
| 477 | 3300035172 | Ga0373955_1045110 | Ga0373955_1045110_28_450 | 140 |
| 478 | 3300035207 | Ga0373942_0057901 | Ga0373942_0057901_435_857 | 140 |
| 479 | 3300035207 | Ga0373942_0062579 | Ga0373942_0062579_134_556 | 140 |
| 480 | 3300035241 | Ga0373961_0056090 | Ga0373961_0056090_591_1013 | 140 |
| 481 | 3300035241 | Ga0373961_0061569 | Ga0373961_0061569_267_689 | 140 |
| 482 | 3300035241 | Ga0373961_0066879 | Ga0373961_0066879_232_654 | 140 |
| 483 | 3300035241 | Ga0373961_0067174 | Ga0373961_0067174_500_922 | 140 |
| 484 | 3300035242 | Ga0373962_0022858 | Ga0373962_0022858_469_891 | 140 |
| 485 | 3300035242 | Ga0373962_0054276 | Ga0373962_0054276_185_607 | 140 |
| 486 | 3300035410 | Ga0373924_0157027 | Ga0373924_0157027_103_525 | 140 |
| 487 | 3300035410 | Ga0373924_0159931 | Ga0373924_0159931_125_547 | 140 |
| 488 | 3300035410 | Ga0373924_0169783 | Ga0373924_0169783_107_529 | 140 |
| 489 | 3300035410 | Ga0373924_0193610 | Ga0373924_0193610_341_763 | 140 |
| 490 | 3300035410 | Ga0373924_0542356 | Ga0373924_0542356_55_477 | 140 |
| 491 | 3300035691 | Ga0373931_0049978 | Ga0373931_0049978_964_1386 | 140 |
| 492 | 3300035691 | Ga0373931_0280064 | Ga0373931_0280064_476_898 | 140 |
| 493 | 3300035691 | Ga0373931_0283740 | Ga0373931_0283740_139_561 | 140 |
| 494 | 3300035691 | Ga0373931_0296907 | Ga0373931_0296907_12_434 | 140 |
| 495 | 3300035691 | Ga0373931_0460060 | Ga0373931_0460060_296_718 | 140 |
| 496 | 3300035692 | Ga0373935_0086945 | Ga0373935_0086945_64_486 | 140 |
| 497 | 3300035692 | Ga0373935_0383642 | Ga0373935_0383642_440_862 | 140 |
| 498 | 3300035692 | Ga0373935_0395638 | Ga0373935_0395638_77_499 | 140 |
| 499 | 3300035695 | Ga0373927_0103987 | Ga0373927_0103987_1302_1724 | 140 |
| 500 | 3300035695 | Ga0373927_0110422 | Ga0373927_0110422_452_874 | 140 |
| 501 | 3300035695 | Ga0373927_0250351 | Ga0373927_0250351_679_1101 | 140 |
| 502 | 3300035695 | Ga0373927_0666519 | Ga0373927_0666519_145_567 | 140 |
| 503 | 3300035724 | Ga0373933_0182840 | Ga0373933_0182840_454_876 | 140 |
| 504 | 3300035724 | Ga0373933_0220174 | Ga0373933_0220174_155_577 | 140 |
| 505 | 3300035724 | Ga0373933_0385458 | Ga0373933_0385458_135_557 | 140 |
| 506 | 3300035724 | Ga0373933_0485716 | Ga0373933_0485716_248_670 | 140 |
| 507 | 3300035725 | Ga0373947_0056873 | Ga0373947_0056873_1553_1975 | 140 |
| 508 | 3300035725 | Ga0373947_0066489 | Ga0373947_0066489_875_1297 | 140 |
| 509 | 3300035725 | Ga0373947_0122126 | Ga0373947_0122126_761_1183 | 140 |
| 510 | 3300035725 | Ga0373947_0347020 | Ga0373947_0347020_130_552 | 140 |
| 511 | 3300036401 | Ga0373937_0146918 | Ga0373937_0146918_671_1093 | 140 |
| 512 | 3300036401 | Ga0373937_0310266 | Ga0373937_0310266_233_808 | 140 |
| 513 | 3300036401 | Ga0373937_0328846 | Ga0373937_0328846_705_1127 | 140 |
| 514 | 3300036401 | Ga0373937_0553741 | Ga0373937_0553741_205_627 | 140 |
| 515 | 3300037068 | Ga0373925_0029492 | Ga0373925_0029492_477_899 | 140 |
| 516 | 3300037068 | Ga0373925_0305656 | Ga0373925_0305656_588_1106 | 140 |
| 517 | 3300037068 | Ga0373925_0327560 | Ga0373925_0327560_773_1195 | 140 |
| 518 | 3300037068 | Ga0373925_0512436 | Ga0373925_0512436_193_615 | 140 |
| 519 | 3300037068 | Ga0373925_0545344 | Ga0373925_0545344_94_516 | 140 |
| 520 | 3300037068 | Ga0373925_0642170 | Ga0373925_0642170_131_553 | 140 |
| 521 | 3300037853 | Ga0436364_0017074 | Ga0436364_0017074_2708_3202 | 140 |
| 522 | 3300037853 | Ga0436364_0576899 | Ga0436364_0576899_949_1410 | 140 |
| 523 | 3300037853 | Ga0436364_0712397 | Ga0436364_0712397_311_772 | 140 |
| 524 | 3300037853 | Ga0436364_0732245 | Ga0436364_0732245_104_526 | 140 |
| 525 | 3300037853 | Ga0436364_0774991 | Ga0436364_0774991_797_1219 | 140 |
| 526 | 3300037853 | Ga0436364_1177754 | Ga0436364_1177754_1810_2232 | 140 |
| 527 | 3300037853 | Ga0436364_1320027 | Ga0436364_1320027_186_608 | 140 |
| 528 | 3300039437 | Ga0436365_0082489 | Ga0436365_0082489_3236_3658 | 140 |
| 529 | 3300039437 | Ga0436365_0149981 | Ga0436365_0149981_291_713 | 140 |
| 530 | 3300039437 | Ga0436365_0668315 | Ga0436365_0668315_587_1054 | 140 |
| 531 | 3300039437 | Ga0436365_0706061 | Ga0436365_0706061_163_585 | 140 |
| 532 | 3300039437 | Ga0436365_0787104 | Ga0436365_0787104_1699_2121 | 140 |
| 533 | 3300039437 | Ga0436365_0874702 | Ga0436365_0874702_631_1053 | 140 |
| 534 | 3300039437 | Ga0436365_0913963 | Ga0436365_0913963_31_453 | 140 |
| 535 | 3300039437 | Ga0436365_1119317 | Ga0436365_1119317_558_980 | 140 |
| 536 | 3300039437 | Ga0436365_1254859 | Ga0436365_1254859_882_1304 | 140 |
| 537 | 3300039437 | Ga0436365_1495534 | Ga0436365_1495534_242_664 | 140 |
| 538 | 3300039437 | Ga0436365_1780607 | Ga0436365_1780607_191_658 | 140 |
| 539 | 3300039438 | Ga0436360_0054504 | Ga0436360_0054504_263_685 | 140 |
| 540 | 3300039438 | Ga0436360_0066264 | Ga0436360_0066264_69_491 | 140 |
| 541 | 3300039438 | Ga0436360_0144130 | Ga0436360_0144130_56_523 | 140 |
| 542 | 3300039438 | Ga0436360_0146599 | Ga0436360_0146599_164_586 | 140 |
| 543 | 3300039438 | Ga0436360_0341916 | Ga0436360_0341916_73_495 | 140 |
| 544 | 3300039438 | Ga0436360_0352881 | Ga0436360_0352881_44_466 | 140 |
| 545 | 3300039438 | Ga0436360_0581270 | Ga0436360_0581270_396_818 | 140 |
| 546 | 3300039438 | Ga0436360_0995301 | Ga0436360_0995301_217_639 | 140 |
| 547 | 3300039438 | Ga0436360_1167367 | Ga0436360_1167367_596_1018 | 140 |
| 548 | 3300039447 | Ga0436361_0235806 | Ga0436361_0235806_98_520 | 140 |
| 549 | 3300039447 | Ga0436361_0289321 | Ga0436361_0289321_537_959 | 140 |
| 550 | 3300039447 | Ga0436361_0803000 | Ga0436361_0803000_210_677 | 140 |
| 551 | 3300039447 | Ga0436361_1078566 | Ga0436361_1078566_244_666 | 140 |
| 552 | 3300039450 | Ga0436363_0133069 | Ga0436363_0133069_219_641 | 140 |
| 553 | 3300039450 | Ga0436363_0179411 | Ga0436363_0179411_244_666 | 140 |
| 554 | 3300039450 | Ga0436363_0445300 | Ga0436363_0445300_581_1003 | 140 |
| 555 | 3300039450 | Ga0436363_0599077 | Ga0436363_0599077_163_585 | 140 |
| 556 | 3300039450 | Ga0436363_0626302 | Ga0436363_0626302_100_561 | 140 |
| 557 | 3300039450 | Ga0436363_0970346 | Ga0436363_0970346_476_898 | 140 |
| 558 | 3300039450 | Ga0436363_1294053 | Ga0436363_1294053_225_647 | 140 |
| 559 | 3300039450 | Ga0436363_1298650 | Ga0436363_1298650_274_696 | 140 |
| 560 | 3300039450 | Ga0436363_1371860 | Ga0436363_1371860_412_834 | 140 |
| 561 | 3300039450 | Ga0436363_1433776 | Ga0436363_1433776_3373_3795 | 140 |
| 562 | 3300039450 | Ga0436363_1640127 | Ga0436363_1640127_202_624 | 140 |
| 563 | 3300039453 | Ga0436362_0015221 | Ga0436362_0015221_441_863 | 140 |
| 564 | 3300039453 | Ga0436362_0079551 | Ga0436362_0079551_255_677 | 140 |
| 565 | 3300039453 | Ga0436362_0230309 | Ga0436362_0230309_44_466 | 140 |
| 566 | 3300039453 | Ga0436362_0545750 | Ga0436362_0545750_294_761 | 140 |
| 567 | 3300041441 | Ga0451787_141160 | Ga0451787_141160_556_978 | 140 |
| 568 | 3300041458 | Ga0451798_0084915 | Ga0451798_0084915_146_568 | 140 |
| 569 | 3300041459 | Ga0451800_1599908 | Ga0451800_1599908_329_751 | 140 |
| 570 | 3300041463 | Ga0451804_0627308 | Ga0451804_0627308_165_587 | 140 |
| 571 | 3300041486 | Ga0451807_0548946 | Ga0451807_0548946_127_549 | 140 |
| 572 | 3300041496 | Ga0451839_1021707 | Ga0451839_1021707_725_1147 | 140 |
| 573 | 3300041505 | Ga0451849_0889094 | Ga0451849_0889094_211_633 | 140 |
| 574 | 3300041512 | Ga0451853_1385000 | Ga0451853_1385000_530_952 | 140 |
| 575 | 3300042003 | Ga0439443_024505 | Ga0439443_024505_139_561 | 140 |
| 576 | 3300042005 | Ga0439448_0108716 | Ga0439448_0108716_58_480 | 140 |
| 577 | 3300042008 | Ga0439450_051404 | Ga0439450_051404_130_552 | 140 |
| 578 | 3300042013 | Ga0439456_122937 | Ga0439456_122937_51_473 | 140 |
| 579 | 3300042436 | Ga0439435_0059212 | Ga0439435_0059212_528_950 | 140 |
| 580 | 3300042437 | Ga0439444_0000592 | Ga0439444_0000592_3606_4028 | 140 |
| 581 | 3300042437 | Ga0439444_0112893 | Ga0439444_0112893_75_497 | 140 |
| 582 | 3300042439 | Ga0439464_0124874 | Ga0439464_0124874_230_652 | 140 |
| 583 | 3300042461 | Ga0439460_0092546 | Ga0439460_0092546_498_920 | 140 |
| 584 | 3300044694 | Ga0466963_0317501 | Ga0466963_0317501_148_570 | 140 |
| 585 | 3300044694 | Ga0466963_0321818 | Ga0466963_0321818_524_946 | 140 |
| 586 | 3300044842 | Ga0466957_0383376 | Ga0466957_0383376_500_922 | 140 |
| 587 | 3300044842 | Ga0466957_1410568 | Ga0466957_1410568_73_495 | 140 |
| 588 | 3300045976 | Ga0466967_0697499 | Ga0466967_0697499_485_907 | 140 |
| 589 | 3300045976 | Ga0466967_1176814 | Ga0466967_1176814_95_517 | 140 |
| 590 | 3300046454 | Ga0495592_0212842 | Ga0495592_0212842_90_512 | 140 |
| 591 | 3300046454 | Ga0495592_0268044 | Ga0495592_0268044_511_933 | 140 |
| 592 | 3300046454 | Ga0495592_0279722 | Ga0495592_0279722_565_987 | 140 |
| 593 | 3300046455 | Ga0495603_0130659 | Ga0495603_0130659_584_1006 | 140 |
| 594 | 3300046455 | Ga0495603_0316113 | Ga0495603_0316113_334_756 | 140 |
| 595 | 3300046455 | Ga0495603_0682492 | Ga0495603_0682492_64_486 | 140 |
| 596 | 3300046458 | Ga0495591_098074 | Ga0495591_098074_208_630 | 140 |
| 597 | 3300046459 | Ga0495629_0060353 | Ga0495629_0060353_131_553 | 140 |
| 598 | 3300046459 | Ga0495629_0076054 | Ga0495629_0076054_1757_2179 | 140 |
| 599 | 3300046461 | Ga0495641_0147443 | Ga0495641_0147443_201_623 | 140 |
| 600 | 3300046462 | Ga0495651_0042880 | Ga0495651_0042880_370_792 | 140 |
| 601 | 3300046463 | Ga0495653_0118238 | Ga0495653_0118238_962_1384 | 140 |
| 602 | 3300046463 | Ga0495653_0394147 | Ga0495653_0394147_148_570 | 140 |
| 603 | 3300046472 | Ga0495580_0196582 | Ga0495580_0196582_508_930 | 140 |
| 604 | 3300046472 | Ga0495580_0224745 | Ga0495580_0224745_425_847 | 140 |
| 605 | 3300046472 | Ga0495580_0285667 | Ga0495580_0285667_494_916 | 140 |
| 606 | 3300046473 | Ga0495582_0229184 | Ga0495582_0229184_192_614 | 140 |
| 607 | 3300046473 | Ga0495582_0313579 | Ga0495582_0313579_294_716 | 140 |
| 608 | 3300046475 | Ga0495639_0184199 | Ga0495639_0184199_442_864 | 140 |
| 609 | 3300046475 | Ga0495639_0264385 | Ga0495639_0264385_239_661 | 140 |
| 610 | 3300046476 | Ga0495662_0151416 | Ga0495662_0151416_313_735 | 140 |
| 611 | 3300046476 | Ga0495662_0306118 | Ga0495662_0306118_95_517 | 140 |
| 612 | 3300046477 | Ga0495664_0198321 | Ga0495664_0198321_347_769 | 140 |
| 613 | 3300046477 | Ga0495664_0327618 | Ga0495664_0327618_128_550 | 140 |
| 614 | 3300046477 | Ga0495664_0444526 | Ga0495664_0444526_317_739 | 140 |
| 615 | 3300046499 | Ga0495594_0154172 | Ga0495594_0154172_762_1184 | 140 |
| 616 | 3300046499 | Ga0495594_0217468 | Ga0495594_0217468_464_886 | 140 |
| 617 | 3300046500 | Ga0495596_0118924 | Ga0495596_0118924_522_944 | 140 |
| 618 | 3300046511 | Ga0495608_0187680 | Ga0495608_0187680_82_504 | 140 |
| 619 | 3300046511 | Ga0495608_0228507 | Ga0495608_0228507_524_946 | 140 |
| 620 | 3300046514 | Ga0495618_0231042 | Ga0495618_0231042_586_1008 | 140 |
| 621 | 3300046514 | Ga0495618_0298949 | Ga0495618_0298949_273_695 | 140 |
| 622 | 3300046514 | Ga0495618_0445827 | Ga0495618_0445827_169_591 | 140 |
| 623 | 3300046516 | Ga0495628_0223220 | Ga0495628_0223220_540_962 | 140 |
| 624 | 3300046517 | Ga0495630_0435463 | Ga0495630_0435463_445_867 | 140 |
| 625 | 3300046525 | Ga0495663_0208983 | Ga0495663_0208983_171_593 | 140 |
| 626 | 3300046526 | Ga0495666_0033902 | Ga0495666_0033902_147_569 | 140 |
| 627 | 3300046526 | Ga0495666_0535929 | Ga0495666_0535929_35_457 | 140 |
| 628 | 3300046529 | Ga0495652_0098312 | Ga0495652_0098312_516_938 | 140 |
| 629 | 3300046529 | Ga0495652_0304748 | Ga0495652_0304748_595_1017 | 140 |
| 630 | 3300046529 | Ga0495652_0360735 | Ga0495652_0360735_190_612 | 140 |
| 631 | 3300046531 | Ga0495665_0067874 | Ga0495665_0067874_218_640 | 140 |
| 632 | 3300046533 | Ga0495640_0303316 | Ga0495640_0303316_162_584 | 140 |
| 633 | 3300046533 | Ga0495640_0367973 | Ga0495640_0367973_354_776 | 140 |
| 634 | 3300046533 | Ga0495640_0678952 | Ga0495640_0678952_155_577 | 140 |
| 635 | 3300046535 | Ga0495586_0229334 | Ga0495586_0229334_504_926 | 140 |
| 636 | 3300046538 | Ga0495609_0211944 | Ga0495609_0211944_320_742 | 140 |
| 637 | 3300046543 | Ga0495645_0268173 | Ga0495645_0268173_273_695 | 140 |
| 638 | 3300046543 | Ga0495645_0346994 | Ga0495645_0346994_392_814 | 140 |
| 639 | 3300046557 | Ga0495622_0207864 | Ga0495622_0207864_144_566 | 140 |
| 640 | 3300046558 | Ga0495633_0346122 | Ga0495633_0346122_109_531 | 140 |
| 641 | 3300046559 | Ga0495667_0346645 | Ga0495667_0346645_322_744 | 140 |
| 642 | 3300046616 | Ga0495668_0295290 | Ga0495668_0295290_152_574 | 140 |
| 643 | 3300046642 | Ga0495634_0123272 | Ga0495634_0123272_1096_1518 | 140 |
| 644 | 3300046642 | Ga0495634_0229872 | Ga0495634_0229872_263_685 | 140 |
| 645 | 3300046663 | Ga0495635_0327542 | Ga0495635_0327542_141_563 | 140 |
| 646 | 3300046664 | Ga0495659_0319739 | Ga0495659_0319739_117_539 | 140 |
| 647 | 3300046674 | Ga0495588_0181668 | Ga0495588_0181668_506_928 | 140 |
| 648 | 3300046674 | Ga0495588_0497083 | Ga0495588_0497083_170_592 | 140 |
| 649 | 3300046675 | Ga0495657_0208952 | Ga0495657_0208952_688_1110 | 140 |
| 650 | 3300046675 | Ga0495657_0396612 | Ga0495657_0396612_270_692 | 140 |
| 651 | 3300046678 | Ga0495599_0276645 | Ga0495599_0276645_165_587 | 140 |
| 652 | 3300046679 | Ga0495623_0496153 | Ga0495623_0496153_45_467 | 140 |
| 653 | 3300046680 | Ga0495646_0135615 | Ga0495646_0135615_818_1240 | 140 |
| 654 | 3300046680 | Ga0495646_0179358 | Ga0495646_0179358_503_925 | 140 |
| 655 | 3300046681 | Ga0495647_0015172 | Ga0495647_0015172_1830_2252 | 140 |
| 656 | 3300046681 | Ga0495647_0113871 | Ga0495647_0113871_577_999 | 140 |
| 657 | 3300046681 | Ga0495647_0142285 | Ga0495647_0142285_165_587 | 140 |
| 658 | 3300046683 | Ga0495658_0209839 | Ga0495658_0209839_538_960 | 140 |
| 659 | 3300046683 | Ga0495658_0321179 | Ga0495658_0321179_196_618 | 140 |
| 660 | 3300046683 | Ga0495658_0583182 | Ga0495658_0583182_180_602 | 140 |
| 661 | 3300046684 | Ga0495669_0220656 | Ga0495669_0220656_48_470 | 140 |
| 662 | 3300046689 | Ga0495613_0182317 | Ga0495613_0182317_459_881 | 140 |
| 663 | 3300046689 | Ga0495613_0722003 | Ga0495613_0722003_98_520 | 140 |
| 664 | 3300046690 | Ga0495624_0177766 | Ga0495624_0177766_417_839 | 140 |
| 665 | 3300046690 | Ga0495624_0284860 | Ga0495624_0284860_109_531 | 140 |
| 666 | 3300046809 | Ga0495600_0279792 | Ga0495600_0279792_457_879 | 140 |
| 667 | 3300046809 | Ga0495600_0307935 | Ga0495600_0307935_458_880 | 140 |
| 668 | 3300046809 | Ga0495600_0327456 | Ga0495600_0327456_190_612 | 140 |
| 669 | 3300047315 | Ga0495581_0149538 | Ga0495581_0149538_613_1035 | 140 |
| 670 | 3300047315 | Ga0495581_0415344 | Ga0495581_0415344_202_624 | 140 |
| 671 | 3300047315 | Ga0495581_0568672 | Ga0495581_0568672_111_533 | 140 |
| 672 | 3300047318 | Ga0495636_0527159 | Ga0495636_0527159_131_553 | 140 |
| 673 | 3300047319 | Ga0495674_0099218 | Ga0495674_0099218_1203_1625 | 140 |
| 674 | 3300047319 | Ga0495674_0195359 | Ga0495674_0195359_360_782 | 140 |
| 675 | 3300047319 | Ga0495674_0269180 | Ga0495674_0269180_13_435 | 140 |
| 676 | 3300047319 | Ga0495674_0440870 | Ga0495674_0440870_177_599 | 140 |
| 677 | 3300047319 | Ga0495674_0929718 | Ga0495674_0929718_25_447 | 140 |
| 678 | 3300047321 | Ga0495676_0148064 | Ga0495676_0148064_503_925 | 140 |
| 679 | 3300047321 | Ga0495676_0196426 | Ga0495676_0196426_172_594 | 140 |
| 680 | 3300047321 | Ga0495676_0373536 | Ga0495676_0373536_33_455 | 140 |
| 681 | 3300047321 | Ga0495676_0617792 | Ga0495676_0617792_121_543 | 140 |
| 682 | 3300047322 | Ga0495680_0248163 | Ga0495680_0248163_70_492 | 140 |
| 683 | 3300047322 | Ga0495680_0413194 | Ga0495680_0413194_141_563 | 140 |
| 684 | 3300047322 | Ga0495680_0637566 | Ga0495680_0637566_211_633 | 140 |
| 685 | 3300047471 | Ga0495684_0138759 | Ga0495684_0138759_951_1373 | 140 |
| 686 | 3300047471 | Ga0495684_0430550 | Ga0495684_0430550_144_566 | 140 |
| 687 | 3300047471 | Ga0495684_0911159 | Ga0495684_0911159_86_508 | 140 |
| 688 | 3300047673 | Ga0495593_0172663 | Ga0495593_0172663_456_878 | 140 |
| 689 | 3300047673 | Ga0495593_0498479 | Ga0495593_0498479_45_467 | 140 |
| 690 | 3300048088 | Ga0495602_0540590 | Ga0495602_0540590_277_699 | 140 |
| 691 | 3300048088 | Ga0495602_0626086 | Ga0495602_0626086_98_520 | 140 |
| 692 | 3300048088 | Ga0495602_0831527 | Ga0495602_0831527_21_443 | 140 |
| 693 | 3300048089 | Ga0495614_0013525 | Ga0495614_0013525_2094_2516 | 140 |
| 694 | 3300048089 | Ga0495614_0135160 | Ga0495614_0135160_165_587 | 140 |
| 695 | 3300048903 | Ga0496100_0160277 | Ga0496100_0160277_632_1054 | 140 |
| 696 | 3300048903 | Ga0496100_0294785 | Ga0496100_0294785_337_759 | 140 |
| 697 | 3300048903 | Ga0496100_0419690 | Ga0496100_0419690_153_575 | 140 |
| 698 | 3300048904 | Ga0496101_0077887 | Ga0496101_0077887_1610_2032 | 140 |
| 699 | 3300048904 | Ga0496101_0343631 | Ga0496101_0343631_204_626 | 140 |
| 700 | 3300048904 | Ga0496101_0375338 | Ga0496101_0375338_245_667 | 140 |
| 701 | 3300048905 | Ga0496102_0283477 | Ga0496102_0283477_134_556 | 140 |
| 702 | 3300048905 | Ga0496102_0471871 | Ga0496102_0471871_204_626 | 140 |
| 703 | 3300048906 | Ga0496103_0192701 | Ga0496103_0192701_461_883 | 140 |
| 704 | 3300048906 | Ga0496103_0546752 | Ga0496103_0546752_117_539 | 140 |
| 705 | 3300048907 | Ga0496104_0471651 | Ga0496104_0471651_585_1007 | 140 |
| 706 | 3300048907 | Ga0496104_0547102 | Ga0496104_0547102_506_928 | 140 |
| 707 | 3300048908 | Ga0496105_0399259 | Ga0496105_0399259_221_643 | 140 |
| 708 | 3300048908 | Ga0496105_0446435 | Ga0496105_0446435_140_562 | 140 |
| 709 | 3300048908 | Ga0496105_0511902 | Ga0496105_0511902_364_786 | 140 |
| 710 | 3300048909 | Ga0496106_0214880 | Ga0496106_0214880_959_1381 | 140 |
| 711 | 3300048909 | Ga0496106_0453213 | Ga0496106_0453213_460_882 | 140 |
| 712 | 3300048909 | Ga0496106_0638810 | Ga0496106_0638810_395_817 | 140 |
| 713 | 3300048910 | Ga0496107_0383793 | Ga0496107_0383793_442_864 | 140 |
| 714 | 3300048910 | Ga0496107_0566859 | Ga0496107_0566859_271_693 | 140 |
| 715 | 3300048910 | Ga0496107_0970319 | Ga0496107_0970319_121_543 | 140 |
| 716 | 3300048911 | Ga0496108_0191953 | Ga0496108_0191953_1284_1706 | 140 |
| 717 | 3300048911 | Ga0496108_0297094 | Ga0496108_0297094_782_1204 | 140 |
| 718 | 3300048912 | Ga0496109_0467881 | Ga0496109_0467881_479_901 | 140 |
| 719 | 3300048913 | Ga0496110_0552348 | Ga0496110_0552348_151_573 | 140 |
| 720 | 3300048913 | Ga0496110_0563001 | Ga0496110_0563001_482_904 | 140 |
| 721 | 3300048913 | Ga0496110_0580262 | Ga0496110_0580262_521_943 | 140 |
| 722 | 3300048914 | Ga0496111_0161731 | Ga0496111_0161731_766_1188 | 140 |
| 723 | 3300048914 | Ga0496111_0422765 | Ga0496111_0422765_417_839 | 140 |
| 724 | 3300048914 | Ga0496111_0446704 | Ga0496111_0446704_86_508 | 140 |
| 725 | 3300048914 | Ga0496111_0652728 | Ga0496111_0652728_26_448 | 140 |
| 726 | 3300048915 | Ga0496112_0448734 | Ga0496112_0448734_345_767 | 140 |
| 727 | 3300048915 | Ga0496112_0561933 | Ga0496112_0561933_441_863 | 140 |
| 728 | 3300048916 | Ga0496113_0236427 | Ga0496113_0236427_440_862 | 140 |
| 729 | 3300048916 | Ga0496113_0457548 | Ga0496113_0457548_482_904 | 140 |
| 730 | 3300048917 | Ga0496114_0140191 | Ga0496114_0140191_154_576 | 140 |
| 731 | 3300048917 | Ga0496114_0341252 | Ga0496114_0341252_878_1300 | 140 |
| 732 | 3300048917 | Ga0496114_0554151 | Ga0496114_0554151_464_886 | 140 |
| 733 | 3300048917 | Ga0496114_1015393 | Ga0496114_1015393_255_677 | 140 |
| 734 | 3300048918 | Ga0496115_0384653 | Ga0496115_0384653_508_930 | 140 |
| 735 | 3300048918 | Ga0496115_0478147 | Ga0496115_0478147_142_564 | 140 |
| 736 | 3300048918 | Ga0496115_0709019 | Ga0496115_0709019_176_598 | 140 |
| 737 | 3300049570 | Ga0501033_0117890 | Ga0501033_0117890_459_881 | 140 |
| 738 | 3300049573 | Ga0501037_0070898 | Ga0501037_0070898_1249_1671 | 140 |
| 739 | 3300049574 | Ga0501038_0294201 | Ga0501038_0294201_497_919 | 140 |
| 740 | 3300049582 | Ga0501048_0399836 | Ga0501048_0399836_389_811 | 140 |
| 741 | 3300049822 | Ga0501035_0452069 | Ga0501035_0452069_224_646 | 140 |
| 742 | 3300049823 | Ga0501044_0483871 | Ga0501044_0483871_302_724 | 140 |
| 743 | 3300050508 | nmdc:mga09592_410658_c1 | nmdc:mga09592_410658_c1_560_982 | 140 |
| 744 | 3300050511 | nmdc:mga08y16_466759_c1 | nmdc:mga08y16_466759_c1_362_784 | 140 |
| 745 | 3300050512 | nmdc:mga0n895_469363_c1 | nmdc:mga0n895_469363_c1_728_1150 | 140 |
| 746 | 3300050512 | nmdc:mga0n895_540501_c1 | nmdc:mga0n895_540501_c1_295_717 | 140 |
| 747 | 3300050513 | nmdc:mga0rr50_1206431_c1 | nmdc:mga0rr50_1206431_c1_101_523 | 140 |
| 748 | 3300050513 | nmdc:mga0rr50_124553_c1 | nmdc:mga0rr50_124553_c1_1180_1602 | 140 |
| 749 | 3300050513 | nmdc:mga0rr50_576464_c1 | nmdc:mga0rr50_576464_c1_246_668 | 140 |
| 750 | 3300050514 | nmdc:mga08x19_242467_c1 | nmdc:mga08x19_242467_c1_484_906 | 140 |
| 751 | 3300050514 | nmdc:mga08x19_264305_c1 | nmdc:mga08x19_264305_c1_514_936 | 140 |
| 752 | 3300050515 | nmdc:mga0a205_497154_c1 | nmdc:mga0a205_497154_c1_131_553 | 140 |
| 753 | 3300053077 | Ga0495601_0287601 | Ga0495601_0287601_344_766 | 140 |
| 754 | 3300053077 | Ga0495601_0339924 | Ga0495601_0339924_408_830 | 140 |
| 755 | 3300053078 | Ga0495612_0127335 | Ga0495612_0127335_545_967 | 140 |
| 756 | 3300053078 | Ga0495612_0376203 | Ga0495612_0376203_119_541 | 140 |
| 757 | 3300053083 | Ga0495655_0063886 | Ga0495655_0063886_143_565 | 140 |
| 758 | 3300053083 | Ga0495655_0077113 | Ga0495655_0077113_274_696 | 140 |
| 759 | 3300053084 | Ga0495595_0264512 | Ga0495595_0264512_25_447 | 140 |
| 760 | 3300053084 | Ga0495595_0402811 | Ga0495595_0402811_167_589 | 140 |
| 761 | 3300053085 | Ga0495619_0354047 | Ga0495619_0354047_530_952 | 140 |
| 762 | 3300061719 | Ga0466962_0166594 | Ga0466962_0166594_564_986 | 140 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cob-assembly1.cif.gz_A | solution structures of the hth domain of human lcor protein | 0.5681 | 33 | 80 |
| 2cob-assembly1.cif.gz_A | solution structures of the hth domain of human lcor protein | 0.4154 | 33 | 80 |
| 5i44-assembly4.cif.gz_G-2 | structure of raca-dna complex; p21 form | 0.3806 | 24 | 73 |
| 3n2y-assembly1.cif.gz_B | crystal structure of tyrosyl-trna synthetase complexed with p-(2-tetrazolyl)-phenylalanine | 0.3231 | 1 | 61 |
| 5wnw-assembly1.cif.gz_A | chaperone spy bound to im7 6-45 ensemble | 0.3225 | 18 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0Y3M7_58_149_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.6749 | 19 | 83 | 1.10.472.10 |
| af_Q2EEQ8_1_84_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.6064 | 24 | 77 | 3.30.420.10 |
| af_A0A0R0JCF1_1_191_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.6034 | 24 | 96 | 1.10.472.10 |
| af_Q6I5V9_32_135_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.5996 | 24 | 93 | 1.10.472.10 |
| af_Q65WX7_129_225_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.5913 | 21 | 99 | 1.10.472.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B1E0D2-F1-model_v4 | Mobile element protein | 0.9297 | 15 | 99 |
|
| AF-L1L6F1-F1-model_v4 | Insertion element IS402-like domain-containing protein | 0.9292 | 15 | 106 |
|
| AF-A0A552LQ84-F1-model_v4 | Transposase | 0.9276 | 16 | 107 |
|
| AF-A0A1I5YUV8-F1-model_v4 | Transposase | 0.9259 | 15 | 100 |
|
| AF-A0A252EDS8-F1-model_v4 | Transposase | 0.9249 | 21 | 99 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar