F479619

General Info

Members Datasets Scaffolds Average Seq Length
762 346 762 141

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10055528|Ga0070710_100555284
Length 172
Sequence MWTTENRHRYDRDRLRYPSDLTDTEWAHIAPLIPPAKRGGGKRTVNMREVVNGVMYVLSTGCQWRYIPKDLPPRSTVNGYFCLWGWDGTLEKMHHALYVKCRELAEREISPTACIVDSQSVKSAEKRLSCLSRVVPTFHDLSWTAAPQGWRVAPPPSAASALTHRVPRQSGF

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
97 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
98 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
99 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
100 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
101 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
102 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
103 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
104 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
105 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
106 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
107 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
186 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
187 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
194 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
195 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
196 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
197 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
198 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
199 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
200 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
203 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
208 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
209 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
214 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
220 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
225 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
226 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
227 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
242 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
243 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
244 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
245 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
246 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
247 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
248 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
249 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
250 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
251 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
252 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
253 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
254 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
255 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
256 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
257 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
258 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
259 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
293 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
311 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
312 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
336 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
337 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
338 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
339 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
340 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
341 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
342 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
343 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
344 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.17
Rhizosphere 87.8
Stem 0
Stem Tuber 0
Unclassified 6.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c009791 3300000041 Bacteria 814
2 ARcpr5oldR_c018606 3300000041 Bacteria 614
3 ARSoilYngRDRAFT_c01721 3300000042 Bacteria 974
4 CNXas_1008030 3300000545 Bacteria 744
5 JGI24752J21851_1042332 3300001976 Bacteria 611
6 JGI24746J21847_1016837 3300001977 Bacteria 1041
7 JGI24747J21853_1019408 3300001978 Bacteria 733
8 JGI24740J21852_10065131 3300001979 Bacteria 992
9 JGI24739J22299_10082481 3300001989 Bacteria 986
10 JGI24739J22299_10090407 3300001989 Unclassified 933
11 JGI24737J22298_10158940 3300001990 Bacteria 666
12 JGI24735J21928_10074040 3300002067 Bacteria 975
13 JGI24735J21928_10107470 3300002067 Unclassified 802
14 JGI24750J21931_1016855 3300002070 Bacteria 995
15 JGI24745J21846_1011588 3300002073 Bacteria 1008
16 JGI24745J21846_1018261 3300002073 Unclassified 818
17 JGI24738J21930_10037390 3300002075 Unclassified 987
18 JGI24738J21930_10038203 3300002075 Bacteria 976
19 JGI24744J21845_10033284 3300002077 Bacteria 981
20 JGI24742J22300_10028200 3300002244 Bacteria 974
21 Ga0070676_10568279 3300005328 Bacteria 814
22 Ga0070683_100398866 3300005329 Bacteria 1312
23 Ga0068869_100406577 3300005334 Bacteria 1121
24 Ga0070682_100254655 3300005337 Bacteria 1267
25 Ga0070682_100498818 3300005337 Bacteria 943
26 Ga0068868_100328653 3300005338 Bacteria 1304
27 Ga0068868_100608351 3300005338 Bacteria 969
28 Ga0070660_100663280 3300005339 Bacteria 874
29 Ga0070691_10127896 3300005341 Bacteria 1285
30 Ga0070687_100317661 3300005343 Bacteria 994
31 Ga0070661_100431550 3300005344 Bacteria 1046
32 Ga0070668_100073853 3300005347 Bacteria 2659
33 Ga0070675_100409576 3300005354 Bacteria 1211
34 Ga0070675_100459706 3300005354 Bacteria 1142
35 Ga0070671_100509250 3300005355 Bacteria 1036
36 Ga0070674_100102483 3300005356 Bacteria 2087
37 Ga0070659_100538241 3300005366 Bacteria 999
38 Ga0070667_100900131 3300005367 Bacteria 824
39 Ga0070709_10302024 3300005434 Bacteria 1169
40 Ga0070709_10328247 3300005434 Bacteria 1125
41 Ga0070709_10585569 3300005434 Bacteria 857
42 Ga0070714_100272154 3300005435 Bacteria 1571
43 Ga0070714_100579280 3300005435 Bacteria 1076
44 Ga0070714_100640730 3300005435 Unclassified 1022
45 Ga0070714_100850255 3300005435 Bacteria 885
46 Ga0070714_101000789 3300005435 Unclassified 813
47 Ga0070714_101895977 3300005435 Bacteria 582
48 Ga0070713_100144619 3300005436 Unclassified 2109
49 Ga0070713_100322622 3300005436 Bacteria 1427
50 Ga0070713_100364949 3300005436 Bacteria 1342
51 Ga0070713_100403752 3300005436 Bacteria 1276
52 Ga0070713_100421446 3300005436 Bacteria 1250
53 Ga0070713_100650161 3300005436 Bacteria 1004
54 Ga0070713_100687637 3300005436 Bacteria 976
55 Ga0070713_101082672 3300005436 Bacteria 774
56 Ga0070713_101351855 3300005436 Bacteria 690
57 Ga0070710_10055528 3300005437 Bacteria 2238
58 Ga0070710_10121666 3300005437 Bacteria 1581
59 Ga0070710_10123994 3300005437 Bacteria 1567
60 Ga0070710_10202314 3300005437 Bacteria 1255
61 Ga0070710_10292419 3300005437 Bacteria 1061
62 Ga0070710_10300446 3300005437 Bacteria 1048
63 Ga0070710_10360878 3300005437 Unclassified 964
64 Ga0070710_10652947 3300005437 Bacteria 738
65 Ga0070711_100134708 3300005439 Bacteria 1845
66 Ga0070711_100171566 3300005439 Bacteria 1654
67 Ga0070711_100181451 3300005439 Unclassified 1612
68 Ga0070711_100340175 3300005439 Unclassified 1204
69 Ga0070711_100360733 3300005439 Unclassified 1170
70 Ga0070711_100457475 3300005439 Bacteria 1046
71 Ga0070700_100128407 3300005441 Bacteria 1707
72 Ga0070663_100475255 3300005455 Bacteria 1034
73 Ga0070678_100356586 3300005456 Bacteria 1259
74 Ga0070678_100442452 3300005456 Bacteria 1137
75 Ga0070662_100271811 3300005457 Bacteria 1369
76 Ga0070662_100436449 3300005457 Unclassified 1085
77 Ga0070681_10473192 3300005458 Bacteria 1165
78 Ga0070681_11279741 3300005458 Unclassified 656
79 Ga0068867_100091225 3300005459 Bacteria 2313
80 Ga0068867_100591368 3300005459 Bacteria 966
81 Ga0070707_100610224 3300005468 Bacteria 1053
82 Ga0070698_100445183 3300005471 Bacteria 1231
83 Ga0070679_100275559 3300005530 Bacteria 1635
84 Ga0070684_100554462 3300005535 Bacteria 1067
85 Ga0070684_100849019 3300005535 Bacteria 855
86 Ga0070697_101167644 3300005536 Bacteria 686
87 Ga0068853_100580495 3300005539 Bacteria 1064
88 Ga0068853_100742164 3300005539 Unclassified 938
89 Ga0070672_100087229 3300005543 Bacteria 2511
90 Ga0070686_101079539 3300005544 Bacteria 662
91 Ga0070695_100264818 3300005545 Bacteria 1257
92 Ga0070696_100069683 3300005546 Bacteria 2472
93 Ga0070696_101447706 3300005546 Bacteria 587
94 Ga0070693_100034579 3300005547 Bacteria 2797
95 Ga0068855_100460967 3300005563 Bacteria 1386
96 Ga0068855_100560001 3300005563 Unclassified 1237
97 Ga0068855_100579867 3300005563 Bacteria 1211
98 Ga0070664_100481889 3300005564 Bacteria 1141
99 Ga0068857_100470768 3300005577 Bacteria 1176
100 Ga0068854_100212537 3300005578 Bacteria 1526
101 Ga0068854_100370889 3300005578 Bacteria 1177
102 Ga0068856_100208465 3300005614 Unclassified 1969
103 Ga0068856_100341557 3300005614 Bacteria 1515
104 Ga0068856_100495418 3300005614 Unclassified 1243
105 Ga0068856_100901247 3300005614 Bacteria 903
106 Ga0068856_101240481 3300005614 Bacteria 761
107 Ga0068856_101320014 3300005614 Bacteria 737
108 Ga0070702_100296431 3300005615 Bacteria 1117
109 Ga0068852_100636002 3300005616 Bacteria 1073
110 Ga0068861_100206639 3300005719 Bacteria 1651
111 Ga0068863_100367948 3300005841 Bacteria 1402
112 Ga0068858_100310923 3300005842 Bacteria 1505
113 Ga0068858_100503253 3300005842 Bacteria 1171
114 Ga0068860_100333327 3300005843 Bacteria 1491
115 Ga0068860_100368614 3300005843 Bacteria 1416
116 Ga0068862_100344260 3300005844 Bacteria 1382
117 Ga0081455_10092336 3300005937 Bacteria 2449
118 Ga0070717_10173876 3300006028 Bacteria 1874
119 Ga0070717_10388316 3300006028 Bacteria 1252
120 Ga0070717_10472465 3300006028 Bacteria 1132
121 Ga0070717_10506154 3300006028 Bacteria 1092
122 Ga0070717_10754668 3300006028 Bacteria 884
123 Ga0070717_11086736 3300006028 Unclassified 728
124 Ga0075432_10019443 3300006058 Bacteria 2321
125 Ga0075432_10550808 3300006058 Unclassified 521
126 Ga0070715_10059776 3300006163 Bacteria 1668
127 Ga0070715_10176464 3300006163 Unclassified 1068
128 Ga0070716_100243622 3300006173 Bacteria 1221
129 Ga0070716_100378061 3300006173 Bacteria 1011
130 Ga0070716_101117439 3300006173 Unclassified 629
131 Ga0070716_101467215 3300006173 Bacteria 557
132 Ga0070712_100280251 3300006175 Bacteria 1342
133 Ga0070712_100340237 3300006175 Bacteria 1225
134 Ga0070712_100363570 3300006175 Unclassified 1187
135 Ga0070712_100412377 3300006175 Bacteria 1118
136 Ga0097621_100271257 3300006237 Unclassified 1491
137 Ga0097621_100319973 3300006237 Unclassified 1374
138 Ga0097621_100428399 3300006237 Bacteria 1188
139 Ga0097621_100598444 3300006237 Bacteria 1007
140 Ga0068871_100332285 3300006358 Bacteria 1341
141 Ga0068871_100564610 3300006358 Unclassified 1032
142 Ga0068871_101392462 3300006358 Bacteria 661
143 Ga0075433_10417180 3300006852 Bacteria 1184
144 Ga0075434_100447151 3300006871 Unclassified 1313
145 Ga0075429_100650054 3300006880 Bacteria 924
146 Ga0068865_100303466 3300006881 Bacteria 1279
147 Ga0068865_100386439 3300006881 Unclassified 1143
148 Ga0068865_100578953 3300006881 Unclassified 946
149 Ga0075436_100218603 3300006914 Unclassified 1352
150 Ga0075436_100908572 3300006914 Bacteria 659
151 Ga0075435_100469905 3300007076 Unclassified 1086
152 Ga0075435_100546855 3300007076 Bacteria 1002
153 Ga0075435_101620211 3300007076 Bacteria 568
154 Ga0099794_10133476 3300007265 Bacteria 1255
155 Ga0099795_10106961 3300007788 Bacteria 1104
156 Ga0099795_10110451 3300007788 Bacteria 1089
157 Ga0105244_10133403 3300009036 Bacteria 1198
158 Ga0105240_10502721 3300009093 Bacteria 1347
159 Ga0111539_10273114 3300009094 Bacteria 1968
160 Ga0111539_11366615 3300009094 Bacteria 822
161 Ga0105245_10553540 3300009098 Bacteria 1172
162 Ga0105245_11036741 3300009098 Unclassified 865
163 Ga0105247_10262509 3300009101 Unclassified 1184
164 Ga0105247_10872050 3300009101 Bacteria 693
165 Ga0105247_10900153 3300009101 Bacteria 683
166 Ga0105243_10444733 3300009148 Bacteria 1214
167 Ga0105243_11172785 3300009148 Unclassified 780
168 Ga0105243_11589578 3300009148 Bacteria 680
169 Ga0105241_10636922 3300009174 Bacteria 967
170 Ga0105241_10640672 3300009174 Unclassified 964
171 Ga0105242_10401188 3300009176 Bacteria 1280
172 Ga0105242_10423581 3300009176 Unclassified 1248
173 Ga0105242_11418374 3300009176 Bacteria 722
174 Ga0105248_10400801 3300009177 Unclassified 1545
175 Ga0105248_10917251 3300009177 Bacteria 989
176 Ga0105237_10435107 3300009545 Bacteria 1317
177 Ga0105238_10485549 3300009551 Bacteria 1235
178 Ga0105238_11351325 3300009551 Bacteria 739
179 Ga0105249_10314553 3300009553 Bacteria 1575
180 Ga0105249_10356568 3300009553 Unclassified 1483
181 Ga0099796_10098712 3300010159 Bacteria 1096
182 Ga0099796_10163580 3300010159 Bacteria 883
183 Ga0099796_10211494 3300010159 Bacteria 791
184 Ga0105239_10291681 3300010375 Bacteria 1837
185 Ga0105239_10666392 3300010375 Bacteria 1189
186 Ga0105239_10894832 3300010375 Bacteria 1019
187 Ga0105239_11219824 3300010375 Unclassified 867
188 Ga0105246_10318816 3300011119 Bacteria 1262
189 Ga0105246_10702729 3300011119 Unclassified 886
190 Ga0105246_10716348 3300011119 Unclassified 879
191 Ga0105246_10779823 3300011119 Bacteria 846
192 Ga0105246_10789319 3300011119 Bacteria 841
193 Ga0157340_1003418 3300012473 Unclassified 870
194 Ga0157336_1002308 3300012477 Bacteria 1069
195 Ga0157320_1001188 3300012481 Bacteria 1269
196 Ga0157337_1030317 3300012483 Bacteria 551
197 Ga0157325_1003579 3300012485 Bacteria 865
198 Ga0157321_1000527 3300012487 Bacteria 1747
199 Ga0157322_1003049 3300012490 Unclassified 997
200 Ga0157323_1001470 3300012495 Bacteria 1187
201 Ga0157319_1001572 3300012497 Unclassified 1200
202 Ga0157347_1006729 3300012502 Bacteria 1131
203 Ga0157342_1019984 3300012507 Bacteria 771
204 Ga0157338_1004006 3300012515 Bacteria 1253
205 Ga0157371_10256946 3300013102 Unclassified 1259
206 Ga0157371_10447341 3300013102 Unclassified 950
207 Ga0157370_10090670 3300013104 Bacteria 2870
208 Ga0157369_11382160 3300013105 Bacteria 717
209 Ga0157369_11679563 3300013105 Bacteria 645
210 Ga0157374_10327884 3300013296 Bacteria 1518
211 Ga0157374_10393927 3300013296 Unclassified 1381
212 Ga0157374_11657729 3300013296 Unclassified 664
213 Ga0157378_10313310 3300013297 Bacteria 1522
214 Ga0157378_10495091 3300013297 Unclassified 1220
215 Ga0163162_10131572 3300013306 Bacteria 2611
216 Ga0163162_10214035 3300013306 Unclassified 2057
217 Ga0163162_10732127 3300013306 Bacteria 1109
218 Ga0163162_11099922 3300013306 Bacteria 900
219 Ga0157372_10150735 3300013307 Bacteria 2684
220 Ga0157372_10842635 3300013307 Bacteria 1064
221 Ga0157372_11838971 3300013307 Bacteria 696
222 Ga0157375_10692787 3300013308 Unclassified 1173
223 Ga0157375_10762682 3300013308 Unclassified 1118
224 Ga0163163_11903013 3300014325 Bacteria 655
225 Ga0157380_10592783 3300014326 Bacteria 1095
226 Ga0182008_10030177 3300014497 Bacteria 2734
227 Ga0182008_10053297 3300014497 Bacteria 2003
228 Ga0182008_10090742 3300014497 Bacteria 1506
229 Ga0182008_10135606 3300014497 Bacteria 1229
230 Ga0182008_10903815 3300014497 Bacteria 520
231 Ga0157377_10214692 3300014745 Bacteria 1228
232 Ga0157379_10291155 3300014968 Bacteria 1487
233 Ga0157379_10363728 3300014968 Bacteria 1326
234 Ga0157379_10598322 3300014968 Bacteria 1029
235 Ga0157376_10156291 3300014969 Bacteria 2062
236 Ga0157376_10230967 3300014969 Bacteria 1718
237 Ga0157376_10413481 3300014969 Bacteria 1307
238 Ga0157376_10552189 3300014969 Bacteria 1140
239 Ga0163161_10244874 3300017792 Unclassified 1396
240 Ga0163161_10268217 3300017792 Bacteria 1335
241 Ga0206353_11291880 3300020082 Bacteria 773
242 Ga0213873_10076813 3300021358 Bacteria 928
243 Ga0213873_10085351 3300021358 Bacteria 889
244 Ga0213872_10037559 3300021361 Bacteria 2211
245 Ga0213874_10052003 3300021377 Bacteria 1259
246 Ga0213874_10079775 3300021377 Bacteria 1058
247 Ga0213874_10088964 3300021377 Bacteria 1011
248 Ga0213874_10102993 3300021377 Bacteria 951
249 Ga0213874_10107710 3300021377 Bacteria 933
250 Ga0213876_10171733 3300021384 Bacteria 1153
251 Ga0213876_10194414 3300021384 Bacteria 1078
252 Ga0213876_10204175 3300021384 Bacteria 1050
253 Ga0213876_10214462 3300021384 Bacteria 1023
254 Ga0213876_10258873 3300021384 Bacteria 924
255 Ga0213876_10497707 3300021384 Bacteria 648
256 Ga0213875_10021387 3300021388 Bacteria 3099
257 Ga0213875_10141589 3300021388 Bacteria 1125
258 Ga0213875_10182296 3300021388 Bacteria 986
259 Ga0213871_10066702 3300021441 Bacteria 1010
260 Ga0213871_10067506 3300021441 Bacteria 1005
261 Ga0213871_10220210 3300021441 Bacteria 596
262 Ga0213871_10229420 3300021441 Bacteria 585
263 Ga0207656_10228527 3300025321 Bacteria 906
264 Ga0207655_1124449 3300025728 Bacteria 849
265 Ga0207653_10059364 3300025885 Bacteria 1287
266 Ga0207692_10265609 3300025898 Unclassified 1033
267 Ga0207692_10276687 3300025898 Bacteria 1014
268 Ga0207692_10289611 3300025898 Unclassified 993
269 Ga0207692_10725618 3300025898 Bacteria 646
270 Ga0207692_11130548 3300025898 Bacteria 519
271 Ga0207642_10115400 3300025899 Bacteria 1375
272 Ga0207710_10285931 3300025900 Unclassified 831
273 Ga0207688_10064425 3300025901 Bacteria 2069
274 Ga0207688_10099961 3300025901 Bacteria 1674
275 Ga0207685_10003995 3300025905 Bacteria 3679
276 Ga0207685_10125786 3300025905 Bacteria 1132
277 Ga0207685_10178945 3300025905 Unclassified 982
278 Ga0207685_10257921 3300025905 Bacteria 846
279 Ga0207699_10086157 3300025906 Bacteria 1961
280 Ga0207699_10301996 3300025906 Bacteria 1118
281 Ga0207699_10359489 3300025906 Unclassified 1029
282 Ga0207699_10419669 3300025906 Bacteria 955
283 Ga0207699_10496192 3300025906 Unclassified 881
284 Ga0207699_11041624 3300025906 Bacteria 605
285 Ga0207654_10286683 3300025911 Bacteria 1115
286 Ga0207654_10384027 3300025911 Bacteria 973
287 Ga0207707_10461368 3300025912 Bacteria 1086
288 Ga0207707_11170101 3300025912 Bacteria 624
289 Ga0207695_10705245 3300025913 Bacteria 890
290 Ga0207671_10576429 3300025914 Bacteria 897
291 Ga0207671_10628190 3300025914 Bacteria 856
292 Ga0207671_10644018 3300025914 Bacteria 844
293 Ga0207693_10190698 3300025915 Unclassified 1613
294 Ga0207693_10210552 3300025915 Bacteria 1528
295 Ga0207693_10286388 3300025915 Bacteria 1291
296 Ga0207693_10331239 3300025915 Unclassified 1192
297 Ga0207663_10381923 3300025916 Bacteria 1073
298 Ga0207663_10410941 3300025916 Bacteria 1037
299 Ga0207663_10424580 3300025916 Bacteria 1021
300 Ga0207663_10427020 3300025916 Unclassified 1018
301 Ga0207663_10429627 3300025916 Unclassified 1015
302 Ga0207663_11132631 3300025916 Bacteria 629
303 Ga0207660_10444310 3300025917 Bacteria 1048
304 Ga0207662_10229620 3300025918 Bacteria 1211
305 Ga0207657_10347306 3300025919 Bacteria 1170
306 Ga0207652_10687403 3300025921 Bacteria 913
307 Ga0207646_10547631 3300025922 Bacteria 1040
308 Ga0207659_10561732 3300025926 Bacteria 971
309 Ga0207659_11391073 3300025926 Bacteria 602
310 Ga0207687_10447560 3300025927 Unclassified 1071
311 Ga0207687_10476169 3300025927 Bacteria 1039
312 Ga0207687_10519740 3300025927 Bacteria 996
313 Ga0207700_10080272 3300025928 Bacteria 2543
314 Ga0207700_10206222 3300025928 Bacteria 1659
315 Ga0207700_10229061 3300025928 Bacteria 1579
316 Ga0207700_10281252 3300025928 Bacteria 1431
317 Ga0207700_10491448 3300025928 Bacteria 1085
318 Ga0207700_10534692 3300025928 Unclassified 1039
319 Ga0207700_10564300 3300025928 Bacteria 1011
320 Ga0207700_10569349 3300025928 Bacteria 1007
321 Ga0207700_10838948 3300025928 Bacteria 822
322 Ga0207664_10080381 3300025929 Plasmid 2649
323 Ga0207664_10314694 3300025929 Bacteria 1380
324 Ga0207664_10386413 3300025929 Bacteria 1243
325 Ga0207664_10444618 3300025929 Bacteria 1156
326 Ga0207664_10521101 3300025929 Bacteria 1065
327 Ga0207664_10574273 3300025929 Bacteria 1012
328 Ga0207664_10588329 3300025929 Bacteria 999
329 Ga0207664_11247287 3300025929 Bacteria 662
330 Ga0207644_10570571 3300025931 Unclassified 938
331 Ga0207690_10422457 3300025932 Bacteria 1067
332 Ga0207706_10348974 3300025933 Bacteria 1287
333 Ga0207706_10361211 3300025933 Unclassified 1262
334 Ga0207686_10362561 3300025934 Bacteria 1094
335 Ga0207686_10992513 3300025934 Unclassified 681
336 Ga0207709_10270762 3300025935 Bacteria 1250
337 Ga0207704_10339066 3300025938 Bacteria 1166
338 Ga0207704_10475154 3300025938 Bacteria 1002
339 Ga0207704_10908798 3300025938 Bacteria 741
340 Ga0207704_11021519 3300025938 Unclassified 700
341 Ga0207665_10103639 3300025939 Bacteria 1990
342 Ga0207665_10127856 3300025939 Unclassified 1801
343 Ga0207665_10181537 3300025939 Bacteria 1524
344 Ga0207665_10351619 3300025939 Bacteria 1112
345 Ga0207665_10368663 3300025939 Bacteria 1087
346 Ga0207691_10410429 3300025940 Bacteria 1155
347 Ga0207689_10309441 3300025942 Bacteria 1310
348 Ga0207661_10449564 3300025944 Bacteria 1173
349 Ga0207661_10503983 3300025944 Bacteria 1106
350 Ga0207661_11969520 3300025944 Unclassified 530
351 Ga0207679_10527059 3300025945 Bacteria 1057
352 Ga0207667_10397605 3300025949 Unclassified 1403
353 Ga0207667_10435307 3300025949 Bacteria 1333
354 Ga0207667_10686525 3300025949 Bacteria 1027
355 Ga0207712_10527775 3300025961 Bacteria 1013
356 Ga0207668_10563275 3300025972 Bacteria 988
357 Ga0207640_10425139 3300025981 Bacteria 1088
358 Ga0207640_10580413 3300025981 Bacteria 946
359 Ga0207677_10305800 3300026023 Bacteria 1315
360 Ga0207639_10706900 3300026041 Unclassified 935
361 Ga0207639_10797705 3300026041 Bacteria 880
362 Ga0207678_10350612 3300026067 Bacteria 1273
363 Ga0207708_10160956 3300026075 Bacteria 1772
364 Ga0207702_10574838 3300026078 Bacteria 1104
365 Ga0207702_11050811 3300026078 Unclassified 808
366 Ga0207702_11134469 3300026078 Bacteria 776
367 Ga0207641_10690429 3300026088 Bacteria 1004
368 Ga0207641_12221970 3300026088 Unclassified 549
369 Ga0207648_10135967 3300026089 Bacteria 2165
370 Ga0207674_10530041 3300026116 Bacteria 1138
371 Ga0207675_100642835 3300026118 Bacteria 1066
372 Ga0207675_100989725 3300026118 Unclassified 859
373 Ga0207683_10349697 3300026121 Bacteria 1356
374 Ga0207683_10583378 3300026121 Bacteria 1034
375 Ga0207698_10689433 3300026142 Bacteria 1015
376 Ga0207698_10759290 3300026142 Bacteria 969
377 Ga0207698_10842122 3300026142 Bacteria 922
378 Ga0207698_12585186 3300026142 Unclassified 517
379 Ga0209179_1042914 3300027512 Bacteria 955
380 Ga0209588_1088485 3300027671 Bacteria 998
381 Ga0207428_10280109 3300027907 Bacteria 1238
382 Ga0207428_10377972 3300027907 Bacteria 1040
383 Ga0268265_10669357 3300028380 Bacteria 999
384 Ga0268264_10678980 3300028381 Unclassified 1021
385 Ga0268264_10689034 3300028381 Bacteria 1014
386 Ga0265336_10124662 3300028666 Bacteria 767
387 Ga0265324_10101149 3300029957 Unclassified 979
388 Ga0265328_10110287 3300031239 Unclassified 1022
389 Ga0265325_10428752 3300031241 Bacteria 577
390 Ga0265340_10174649 3300031247 Bacteria 972
391 Ga0265331_10173342 3300031250 Unclassified 975
392 Ga0265327_10043144 3300031251 Bacteria 2416
393 Ga0265327_10062032 3300031251 Unclassified 1904
394 Ga0265316_10828379 3300031344 Bacteria 648
395 Ga0316579_10508996 3300031691 Unclassified 583
396 Ga0316578_10234498 3300031728 Bacteria 1102
397 Ga0373930_0026584 3300034816 Bacteria 1167
398 Ga0373930_0152846 3300034816 Bacteria 580
399 Ga0373948_0023337 3300034817 Bacteria 1199
400 Ga0373948_0029747 3300034817 Unclassified 1094
401 Ga0373948_0031062 3300034817 Bacteria 1077
402 Ga0373950_0026741 3300034818 Bacteria 1048
403 Ga0373958_0018192 3300034819 Bacteria 1271
404 Ga0373958_0021363 3300034819 Bacteria 1200
405 Ga0373959_0029794 3300034820 Unclassified 1096
406 Ga0373959_0031082 3300034820 Bacteria 1078
407 Ga0373959_0075094 3300034820 Unclassified 770
408 Ga0373938_0031356 3300034957 Bacteria 1139
409 Ga0373938_0044836 3300034957 Unclassified 993
410 Ga0373926_0088561 3300035083 Unclassified 1149
411 Ga0373926_0106819 3300035083 Bacteria 1050
412 Ga0373926_0314216 3300035083 Unclassified 612
413 Ga0373926_0458046 3300035083 Bacteria 506
414 Ga0373928_0037539 3300035084 Bacteria 1099
415 Ga0373928_0043280 3300035084 Unclassified 1041
416 Ga0373929_0021640 3300035085 Bacteria 1306
417 Ga0373929_0021722 3300035085 Bacteria 1304
418 Ga0373929_0045899 3300035085 Unclassified 985
419 Ga0373934_0131361 3300035086 Unclassified 1021
420 Ga0373934_0142914 3300035086 Bacteria 979
421 Ga0373934_0158544 3300035086 Bacteria 928
422 Ga0373940_0056330 3300035088 Unclassified 1114
423 Ga0373940_0072601 3300035088 Bacteria 1004
424 Ga0373944_0103499 3300035089 Unclassified 964
425 Ga0373949_0049342 3300035090 Bacteria 1056
426 Ga0373951_0022088 3300035091 Bacteria 1463
427 Ga0373951_0061319 3300035091 Bacteria 942
428 Ga0373952_0049726 3300035092 Bacteria 995
429 Ga0373923_0080242 3300035111 Bacteria 1414
430 Ga0373923_0166204 3300035111 Unclassified 1008
431 Ga0373923_0201335 3300035111 Bacteria 920
432 Ga0373923_0244388 3300035111 Bacteria 839
433 Ga0373923_0343941 3300035111 Bacteria 711
434 Ga0373932_0033928 3300035112 Bacteria 1435
435 Ga0373932_0061317 3300035112 Bacteria 1143
436 Ga0373936_0008530 3300035113 Bacteria 3859
437 Ga0373936_0047881 3300035113 Bacteria 1725
438 Ga0373936_0063262 3300035113 Bacteria 1514
439 Ga0373939_0007616 3300035114 Bacteria 2632
440 Ga0373939_0054417 3300035114 Unclassified 1253
441 Ga0373939_0073616 3300035114 Bacteria 1118
442 Ga0373939_0128613 3300035114 Unclassified 901
443 Ga0373941_0064747 3300035115 Bacteria 1198
444 Ga0373941_0132824 3300035115 Bacteria 898
445 Ga0373941_0222344 3300035115 Unclassified 726
446 Ga0373945_0088439 3300035116 Bacteria 1196
447 Ga0373945_0116006 3300035116 Unclassified 1060
448 Ga0373945_0154705 3300035116 Unclassified 931
449 Ga0373953_0079377 3300035117 Unclassified 1362
450 Ga0373953_0141034 3300035117 Bacteria 1031
451 Ga0373954_0116976 3300035118 Unclassified 1292
452 Ga0373954_0456705 3300035118 Bacteria 632
453 Ga0373956_0110031 3300035119 Unclassified 1282
454 Ga0373956_0157188 3300035119 Bacteria 1071
455 Ga0373956_0535526 3300035119 Bacteria 559
456 Ga0373957_0066508 3300035120 Bacteria 1404
457 Ga0373957_0154204 3300035120 Bacteria 944
458 Ga0373957_0207113 3300035120 Unclassified 818
459 Ga0373960_0072761 3300035121 Unclassified 1066
460 Ga0373960_0075012 3300035121 Bacteria 1053
461 Ga0373960_0096310 3300035121 Bacteria 953
462 Ga0373960_0103280 3300035121 Bacteria 926
463 Ga0373943_0137453 3300035170 Bacteria 1313
464 Ga0373943_0168980 3300035170 Bacteria 1195
465 Ga0373943_0287753 3300035170 Unclassified 930
466 Ga0373943_0296394 3300035170 Bacteria 917
467 Ga0373946_0170667 3300035171 Unclassified 1026
468 Ga0373946_0176983 3300035171 Unclassified 1010
469 Ga0373946_0414027 3300035171 Bacteria 682
470 Ga0373955_0301465 3300035172 Bacteria 966
471 Ga0373955_0336125 3300035172 Unclassified 913
472 Ga0373955_0379756 3300035172 Bacteria 857
473 Ga0373955_1045110 3300035172 Unclassified 503
474 Ga0373942_0057901 3300035207 Unclassified 1103
475 Ga0373942_0062579 3300035207 Bacteria 1069
476 Ga0373961_0056090 3300035241 Bacteria 1182
477 Ga0373961_0061569 3300035241 Unclassified 1140
478 Ga0373961_0066879 3300035241 Bacteria 1103
479 Ga0373961_0067174 3300035241 Bacteria 1101
480 Ga0373962_0022858 3300035242 Bacteria 1661
481 Ga0373962_0054276 3300035242 Bacteria 1161
482 Ga0373924_0157027 3300035410 Bacteria 997
483 Ga0373924_0159931 3300035410 Unclassified 987
484 Ga0373924_0169783 3300035410 Bacteria 958
485 Ga0373924_0193610 3300035410 Unclassified 896
486 Ga0373924_0542356 3300035410 Bacteria 523
487 Ga0373931_0049978 3300035691 Unclassified 2223
488 Ga0373931_0280064 3300035691 Bacteria 1023
489 Ga0373931_0283740 3300035691 Bacteria 1017
490 Ga0373931_0296907 3300035691 Bacteria 996
491 Ga0373931_0460060 3300035691 Bacteria 815
492 Ga0373935_0086945 3300035692 Bacteria 2040
493 Ga0373935_0383642 3300035692 Unclassified 1006
494 Ga0373935_0395638 3300035692 Bacteria 991
495 Ga0373927_0103987 3300035695 Bacteria 1848
496 Ga0373927_0110422 3300035695 Bacteria 1791
497 Ga0373927_0250351 3300035695 Unclassified 1164
498 Ga0373927_0666519 3300035695 Bacteria 687
499 Ga0373933_0182840 3300035724 Bacteria 1337
500 Ga0373933_0220174 3300035724 Unclassified 1217
501 Ga0373933_0385458 3300035724 Bacteria 913
502 Ga0373933_0485716 3300035724 Bacteria 809
503 Ga0373947_0056873 3300035725 Bacteria 2365
504 Ga0373947_0066489 3300035725 Bacteria 2200
505 Ga0373947_0122126 3300035725 Unclassified 1655
506 Ga0373947_0347020 3300035725 Unclassified 995
507 Ga0373937_0146918 3300036401 Bacteria 2207
508 Ga0373937_0310266 3300036401 Bacteria 1492
509 Ga0373937_0328846 3300036401 Unclassified 1446
510 Ga0373937_0553741 3300036401 Bacteria 1092
511 Ga0373925_0029492 3300037068 Bacteria 4026
512 Ga0373925_0305656 3300037068 Bacteria 1285
513 Ga0373925_0327560 3300037068 Bacteria 1240
514 Ga0373925_0512436 3300037068 Bacteria 985
515 Ga0373925_0545344 3300037068 Bacteria 953
516 Ga0373925_0642170 3300037068 Bacteria 874
517 Ga0436364_0017074 3300037853 Bacteria 3607
518 Ga0436364_0576899 3300037853 Bacteria 4242
519 Ga0436364_0712397 3300037853 Bacteria 1541
520 Ga0436364_0732245 3300037853 Unclassified 1270
521 Ga0436364_0774991 3300037853 Bacteria 1649
522 Ga0436364_1177754 3300037853 Unclassified 2623
523 Ga0436364_1320027 3300037853 Bacteria 817
524 Ga0436365_0082489 3300039437 Bacteria 3883
525 Ga0436365_0149981 3300039437 Unclassified 788
526 Ga0436365_0668315 3300039437 Bacteria 1278
527 Ga0436365_0706061 3300039437 Bacteria 617
528 Ga0436365_0787104 3300039437 Bacteria 2660
529 Ga0436365_0874702 3300039437 Bacteria 1409
530 Ga0436365_0913963 3300039437 Bacteria 2128
531 Ga0436365_1119317 3300039437 Bacteria 1439
532 Ga0436365_1254859 3300039437 Bacteria 1783
533 Ga0436365_1495534 3300039437 Bacteria 1356
534 Ga0436365_1780607 3300039437 Bacteria 1160
535 Ga0436360_0054504 3300039438 Bacteria 1000
536 Ga0436360_0066264 3300039438 Bacteria 925
537 Ga0436360_0144130 3300039438 Bacteria 1034
538 Ga0436360_0146599 3300039438 Bacteria 3371
539 Ga0436360_0341916 3300039438 Bacteria 610
540 Ga0436360_0352881 3300039438 Bacteria 834
541 Ga0436360_0581270 3300039438 Bacteria 1141
542 Ga0436360_0995301 3300039438 Bacteria 1230
543 Ga0436360_1167367 3300039438 Bacteria 1218
544 Ga0436361_0235806 3300039447 Bacteria 608
545 Ga0436361_0289321 3300039447 Bacteria 1062
546 Ga0436361_0694696 3300039447 Bacteria 1122
547 Ga0436361_0757995 3300039447 Bacteria 1095
548 Ga0436361_0803000 3300039447 Bacteria 732
549 Ga0436361_1078566 3300039447 Unclassified 908
550 Ga0436363_0133069 3300039450 Bacteria 1423
551 Ga0436363_0179411 3300039450 Bacteria 699
552 Ga0436363_0445300 3300039450 Bacteria 1203
553 Ga0436363_0599077 3300039450 Bacteria 712
554 Ga0436363_0626302 3300039450 Bacteria 724
555 Ga0436363_0970346 3300039450 Unclassified 1348
556 Ga0436363_1294053 3300039450 Bacteria 1310
557 Ga0436363_1298650 3300039450 Bacteria 1090
558 Ga0436363_1371860 3300039450 Bacteria 951
559 Ga0436363_1433776 3300039450 Bacteria 3959
560 Ga0436363_1640127 3300039450 Bacteria 993
561 Ga0436362_0015221 3300039453 Bacteria 1296
562 Ga0436362_0079551 3300039453 Bacteria 937
563 Ga0436362_0230309 3300039453 Bacteria 1082
564 Ga0436362_0545750 3300039453 Bacteria 1084
565 Ga0451787_141160 3300041441 Bacteria 1214
566 Ga0451798_0084915 3300041458 Bacteria 1179
567 Ga0451800_1599908 3300041459 Bacteria 1018
568 Ga0451804_0627308 3300041463 Bacteria 974
569 Ga0451807_0548946 3300041486 Bacteria 1062
570 Ga0451839_1021707 3300041496 Bacteria 1740
571 Ga0451849_0889094 3300041505 Bacteria 1161
572 Ga0451853_1385000 3300041512 Bacteria 1243
573 Ga0439443_024505 3300042003 Bacteria 968
574 Ga0439448_0108716 3300042005 Bacteria 946
575 Ga0439450_051404 3300042008 Bacteria 979
576 Ga0439456_122937 3300042013 Bacteria 596
577 Ga0439435_0059212 3300042436 Bacteria 1113
578 Ga0439444_0000592 3300042437 Bacteria 4159
579 Ga0439444_0112893 3300042437 Bacteria 627
580 Ga0439444_0187383 3300042437 Bacteria 516
581 Ga0439464_0124874 3300042439 Bacteria 794
582 Ga0439460_0092546 3300042461 Bacteria 962
583 Ga0466963_0317501 3300044694 Bacteria 1096
584 Ga0466963_0321818 3300044694 Bacteria 1088
585 Ga0466957_0383376 3300044842 Unclassified 959
586 Ga0466957_1410568 3300044842 Unclassified 507
587 Ga0466967_0697499 3300045976 Bacteria 1005
588 Ga0466967_1176814 3300045976 Unclassified 764
589 Ga0495592_0212842 3300046454 Bacteria 1297
590 Ga0495592_0268044 3300046454 Unclassified 1121
591 Ga0495592_0279722 3300046454 Bacteria 1092
592 Ga0495603_0130659 3300046455 Unclassified 1462
593 Ga0495603_0316113 3300046455 Bacteria 896
594 Ga0495603_0682492 3300046455 Bacteria 587
595 Ga0495591_098074 3300046458 Bacteria 729
596 Ga0495629_0060353 3300046459 Bacteria 2650
597 Ga0495629_0076054 3300046459 Bacteria 2344
598 Ga0495641_0147443 3300046461 Unclassified 1051
599 Ga0495651_0042880 3300046462 Bacteria 3511
600 Ga0495653_0118238 3300046463 Bacteria 1893
601 Ga0495653_0394147 3300046463 Unclassified 881
602 Ga0495580_0196582 3300046472 Bacteria 1390
603 Ga0495580_0224745 3300046472 Unclassified 1289
604 Ga0495580_0285667 3300046472 Unclassified 1125
605 Ga0495582_0229184 3300046473 Unclassified 1063
606 Ga0495582_0313579 3300046473 Bacteria 902
607 Ga0495639_0184199 3300046475 Unclassified 1017
608 Ga0495639_0264385 3300046475 Bacteria 853
609 Ga0495662_0151416 3300046476 Unclassified 1142
610 Ga0495662_0306118 3300046476 Bacteria 781
611 Ga0495664_0198321 3300046477 Unclassified 1216
612 Ga0495664_0327618 3300046477 Bacteria 923
613 Ga0495664_0444526 3300046477 Bacteria 776
614 Ga0495594_0154172 3300046499 Bacteria 1304
615 Ga0495594_0217468 3300046499 Unclassified 1089
616 Ga0495594_0394416 3300046499 Unclassified 788
617 Ga0495596_0118924 3300046500 Bacteria 1026
618 Ga0495608_0187680 3300046511 Bacteria 1306
619 Ga0495608_0228507 3300046511 Bacteria 1165
620 Ga0495618_0231042 3300046514 Unclassified 1164
621 Ga0495618_0298949 3300046514 Bacteria 1000
622 Ga0495618_0445827 3300046514 Bacteria 786
623 Ga0495628_0223220 3300046516 Bacteria 1414
624 Ga0495630_0435463 3300046517 Unclassified 1004
625 Ga0495663_0208983 3300046525 Bacteria 683
626 Ga0495666_0033902 3300046526 Bacteria 2492
627 Ga0495666_0535929 3300046526 Bacteria 522
628 Ga0495652_0098312 3300046529 Bacteria 2379
629 Ga0495652_0304748 3300046529 Unclassified 1156
630 Ga0495652_0360735 3300046529 Bacteria 1038
631 Ga0495665_0067874 3300046531 Bacteria 1880
632 Ga0495640_0303316 3300046533 Unclassified 991
633 Ga0495640_0367973 3300046533 Bacteria 885
634 Ga0495640_0678952 3300046533 Bacteria 619
635 Ga0495586_0229334 3300046535 Unclassified 1056
636 Ga0495609_0211944 3300046538 Bacteria 807
637 Ga0495645_0268173 3300046543 Unclassified 1127
638 Ga0495645_0346994 3300046543 Bacteria 957
639 Ga0495622_0207864 3300046557 Unclassified 870
640 Ga0495633_0346122 3300046558 Unclassified 674
641 Ga0495667_0346645 3300046559 Unclassified 938
642 Ga0495668_0295290 3300046616 Bacteria 888
643 Ga0495634_0123272 3300046642 Unclassified 1658
644 Ga0495634_0229872 3300046642 Bacteria 1141
645 Ga0495635_0327542 3300046663 Unclassified 1024
646 Ga0495659_0319739 3300046664 Unclassified 659
647 Ga0495588_0181668 3300046674 Unclassified 1111
648 Ga0495588_0497083 3300046674 Bacteria 639
649 Ga0495657_0208952 3300046675 Bacteria 1187
650 Ga0495657_0396612 3300046675 Unclassified 812
651 Ga0495599_0276645 3300046678 Unclassified 1017
652 Ga0495623_0496153 3300046679 Unclassified 645
653 Ga0495646_0135615 3300046680 Unclassified 1381
654 Ga0495646_0179358 3300046680 Bacteria 1163
655 Ga0495647_0015172 3300046681 Bacteria 2695
656 Ga0495647_0113871 3300046681 Bacteria 1131
657 Ga0495647_0142285 3300046681 Unclassified 1023
658 Ga0495658_0209839 3300046683 Unclassified 1216
659 Ga0495658_0321179 3300046683 Bacteria 981
660 Ga0495658_0583182 3300046683 Bacteria 716
661 Ga0495669_0220656 3300046684 Bacteria 909
662 Ga0495613_0182317 3300046689 Unclassified 1486
663 Ga0495613_0722003 3300046689 Unclassified 655
664 Ga0495624_0177766 3300046690 Unclassified 1297
665 Ga0495624_0284860 3300046690 Bacteria 997
666 Ga0495600_0279792 3300046809 Bacteria 1056
667 Ga0495600_0307935 3300046809 Unclassified 998
668 Ga0495600_0327456 3300046809 Unclassified 962
669 Ga0495581_0149538 3300047315 Unclassified 1363
670 Ga0495581_0415344 3300047315 Bacteria 784
671 Ga0495581_0568672 3300047315 Bacteria 657
672 Ga0495636_0527159 3300047318 Bacteria 573
673 Ga0495674_0099218 3300047319 Bacteria 2479
674 Ga0495674_0195359 3300047319 Bacteria 1680
675 Ga0495674_0269180 3300047319 Bacteria 1398
676 Ga0495674_0440870 3300047319 Bacteria 1047
677 Ga0495674_0929718 3300047319 Bacteria 670
678 Ga0495676_0148064 3300047321 Unclassified 1674
679 Ga0495676_0196426 3300047321 Bacteria 1404
680 Ga0495676_0373536 3300047321 Unclassified 950
681 Ga0495676_0617792 3300047321 Bacteria 705
682 Ga0495680_0248163 3300047322 Unclassified 1262
683 Ga0495680_0413194 3300047322 Bacteria 929
684 Ga0495680_0637566 3300047322 Bacteria 709
685 Ga0495684_0138759 3300047471 Bacteria 1823
686 Ga0495684_0430550 3300047471 Unclassified 920
687 Ga0495684_0911159 3300047471 Bacteria 565
688 Ga0495593_0172663 3300047673 Unclassified 1089
689 Ga0495593_0498479 3300047673 Bacteria 610
690 Ga0495602_0540590 3300048088 Bacteria 809
691 Ga0495602_0626086 3300048088 Unclassified 737
692 Ga0495602_0831527 3300048088 Bacteria 618
693 Ga0495614_0013525 3300048089 Bacteria 3577
694 Ga0495614_0135160 3300048089 Bacteria 1093
695 Ga0496100_0160277 3300048903 Unclassified 1612
696 Ga0496100_0294785 3300048903 Bacteria 1212
697 Ga0496100_0419690 3300048903 Bacteria 1021
698 Ga0496101_0077887 3300048904 Bacteria 2444
699 Ga0496101_0343631 3300048904 Unclassified 1172
700 Ga0496101_0375338 3300048904 Bacteria 1118
701 Ga0496102_0283477 3300048905 Bacteria 1561
702 Ga0496102_0471871 3300048905 Unclassified 1176
703 Ga0496103_0192701 3300048906 Bacteria 1310
704 Ga0496103_0546752 3300048906 Unclassified 739
705 Ga0496104_0471651 3300048907 Bacteria 1166
706 Ga0496104_0547102 3300048907 Bacteria 1068
707 Ga0496105_0399259 3300048908 Bacteria 1091
708 Ga0496105_0446435 3300048908 Bacteria 1021
709 Ga0496105_0511902 3300048908 Unclassified 941
710 Ga0496106_0214880 3300048909 Bacteria 1532
711 Ga0496106_0453213 3300048909 Bacteria 1030
712 Ga0496106_0638810 3300048909 Bacteria 851
713 Ga0496107_0383793 3300048910 Unclassified 1045
714 Ga0496107_0566859 3300048910 Unclassified 840
715 Ga0496107_0970319 3300048910 Bacteria 617
716 Ga0496108_0191953 3300048911 Bacteria 1770
717 Ga0496108_0297094 3300048911 Bacteria 1406
718 Ga0496109_0467881 3300048912 Bacteria 1190
719 Ga0496110_0552348 3300048913 Bacteria 1046
720 Ga0496110_0563001 3300048913 Bacteria 1035
721 Ga0496110_0580262 3300048913 Bacteria 1018
722 Ga0496111_0161731 3300048914 Bacteria 1662
723 Ga0496111_0422765 3300048914 Unclassified 984
724 Ga0496111_0446704 3300048914 Unclassified 954
725 Ga0496111_0652728 3300048914 Unclassified 767
726 Ga0496112_0448734 3300048915 Bacteria 1227
727 Ga0496112_0561933 3300048915 Bacteria 1074
728 Ga0496113_0236427 3300048916 Bacteria 1457
729 Ga0496113_0457548 3300048916 Bacteria 1025
730 Ga0496114_0140191 3300048917 Bacteria 2093
731 Ga0496114_0341252 3300048917 Bacteria 1324
732 Ga0496114_0554151 3300048917 Bacteria 1015
733 Ga0496114_1015393 3300048917 Unclassified 713
734 Ga0496115_0384653 3300048918 Bacteria 1140
735 Ga0496115_0478147 3300048918 Bacteria 1003
736 Ga0496115_0709019 3300048918 Unclassified 790
737 Ga0501033_0117890 3300049570 Bacteria 1928
738 Ga0501037_0070898 3300049573 Bacteria 2535
739 Ga0501038_0294201 3300049574 Bacteria 1275
740 Ga0501048_0399836 3300049582 Bacteria 982
741 Ga0501035_0452069 3300049822 Bacteria 1062
742 Ga0501044_0483871 3300049823 Bacteria 1140
743 nmdc:mga09592_410658_c1 3300050508 Bacteria 1170
744 nmdc:mga08y16_466759_c1 3300050511 Unclassified 1286
745 nmdc:mga0n895_469363_c1 3300050512 Bacteria 1270
746 nmdc:mga0n895_540501_c1 3300050512 Bacteria 1172
747 nmdc:mga0rr50_1206431_c1 3300050513 Bacteria 643
748 nmdc:mga0rr50_124553_c1 3300050513 Bacteria 2056
749 nmdc:mga0rr50_576464_c1 3300050513 Unclassified 959
750 nmdc:mga08x19_242467_c1 3300050514 Unclassified 1243
751 nmdc:mga08x19_264305_c1 3300050514 Bacteria 1190
752 nmdc:mga0a205_497154_c1 3300050515 Bacteria 1077
753 Ga0495601_0287601 3300053077 Bacteria 1072
754 Ga0495601_0339924 3300053077 Unclassified 976
755 Ga0495612_0127335 3300053078 Unclassified 1098
756 Ga0495612_0376203 3300053078 Unclassified 643
757 Ga0495655_0063886 3300053083 Bacteria 1011
758 Ga0495655_0077113 3300053083 Bacteria 945
759 Ga0495595_0264512 3300053084 Unclassified 862
760 Ga0495595_0402811 3300053084 Bacteria 693
761 Ga0495619_0354047 3300053085 Unclassified 1015
762 Ga0466962_0166594 3300061719 Bacteria 1072

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014497 Ga0182008_10030177 Ga0182008_100301771 126
2 3300042437 Ga0439444_0187383 Ga0439444_0187383_13_444 126
3 3300005439 Ga0070711_100181451 Ga0070711_1001814511 129
4 3300005435 Ga0070714_100640730 Ga0070714_1006407301 136
5 3300005614 Ga0068856_100208465 Ga0068856_1002084653 136
6 3300009148 Ga0105243_11589578 Ga0105243_115895781 136
7 3300039447 Ga0436361_0694696 Ga0436361_0694696_527_967 136
8 3300021361 Ga0213872_10037559 Ga0213872_100375594 137
9 3300039447 Ga0436361_0757995 Ga0436361_0757995_300_770 137
10 3300046499 Ga0495594_0394416 Ga0495594_0394416_49_501 138
11 3300028666 Ga0265336_10124662 Ga0265336_101246621 139
12 3300031247 Ga0265340_10174649 Ga0265340_101746491 139
13 3300000041 ARcpr5oldR_c009791 ARcpr5oldR_0097911 140
14 3300000041 ARcpr5oldR_c018606 ARcpr5oldR_0186062 140
15 3300000042 ARSoilYngRDRAFT_c01721 ARSoilYngRDRAFT_017212 140
16 3300000545 CNXas_1008030 CNXas_10080301 140
17 3300001976 JGI24752J21851_1042332 JGI24752J21851_10423321 140
18 3300001977 JGI24746J21847_1016837 JGI24746J21847_10168372 140
19 3300001978 JGI24747J21853_1019408 JGI24747J21853_10194082 140
20 3300001979 JGI24740J21852_10065131 JGI24740J21852_100651312 140
21 3300001989 JGI24739J22299_10082481 JGI24739J22299_100824811 140
22 3300001989 JGI24739J22299_10090407 JGI24739J22299_100904072 140
23 3300001990 JGI24737J22298_10158940 JGI24737J22298_101589401 140
24 3300002067 JGI24735J21928_10074040 JGI24735J21928_100740402 140
25 3300002067 JGI24735J21928_10107470 JGI24735J21928_101074701 140
26 3300002070 JGI24750J21931_1016855 JGI24750J21931_10168552 140
27 3300002073 JGI24745J21846_1011588 JGI24745J21846_10115882 140
28 3300002073 JGI24745J21846_1018261 JGI24745J21846_10182611 140
29 3300002075 JGI24738J21930_10037390 JGI24738J21930_100373902 140
30 3300002075 JGI24738J21930_10038203 JGI24738J21930_100382032 140
31 3300002077 JGI24744J21845_10033284 JGI24744J21845_100332842 140
32 3300002244 JGI24742J22300_10028200 JGI24742J22300_100282002 140
33 3300005328 Ga0070676_10568279 Ga0070676_105682791 140
34 3300005329 Ga0070683_100398866 Ga0070683_1003988663 140
35 3300005334 Ga0068869_100406577 Ga0068869_1004065772 140
36 3300005337 Ga0070682_100254655 Ga0070682_1002546552 140
37 3300005337 Ga0070682_100498818 Ga0070682_1004988182 140
38 3300005338 Ga0068868_100328653 Ga0068868_1003286532 140
39 3300005338 Ga0068868_100608351 Ga0068868_1006083512 140
40 3300005339 Ga0070660_100663280 Ga0070660_1006632802 140
41 3300005341 Ga0070691_10127896 Ga0070691_101278963 140
42 3300005343 Ga0070687_100317661 Ga0070687_1003176612 140
43 3300005344 Ga0070661_100431550 Ga0070661_1004315501 140
44 3300005347 Ga0070668_100073853 Ga0070668_1000738533 140
45 3300005354 Ga0070675_100409576 Ga0070675_1004095762 140
46 3300005354 Ga0070675_100459706 Ga0070675_1004597062 140
47 3300005355 Ga0070671_100509250 Ga0070671_1005092502 140
48 3300005356 Ga0070674_100102483 Ga0070674_1001024832 140
49 3300005366 Ga0070659_100538241 Ga0070659_1005382412 140
50 3300005367 Ga0070667_100900131 Ga0070667_1009001311 140
51 3300005434 Ga0070709_10302024 Ga0070709_103020242 140
52 3300005434 Ga0070709_10328247 Ga0070709_103282472 140
53 3300005434 Ga0070709_10585569 Ga0070709_105855692 140
54 3300005435 Ga0070714_100272154 Ga0070714_1002721544 140
55 3300005435 Ga0070714_100579280 Ga0070714_1005792803 140
56 3300005435 Ga0070714_100850255 Ga0070714_1008502552 140
57 3300005435 Ga0070714_101000789 Ga0070714_1010007891 140
58 3300005435 Ga0070714_101895977 Ga0070714_1018959771 140
59 3300005436 Ga0070713_100144619 Ga0070713_1001446192 140
60 3300005436 Ga0070713_100322622 Ga0070713_1003226222 140
61 3300005436 Ga0070713_100364949 Ga0070713_1003649492 140
62 3300005436 Ga0070713_100403752 Ga0070713_1004037523 140
63 3300005436 Ga0070713_100421446 Ga0070713_1004214461 140
64 3300005436 Ga0070713_100650161 Ga0070713_1006501612 140
65 3300005436 Ga0070713_100687637 Ga0070713_1006876372 140
66 3300005436 Ga0070713_101082672 Ga0070713_1010826721 140
67 3300005436 Ga0070713_101351855 Ga0070713_1013518552 140
68 3300005437 Ga0070710_10055528 Ga0070710_100555284 140
69 3300005437 Ga0070710_10121666 Ga0070710_101216663 140
70 3300005437 Ga0070710_10123994 Ga0070710_101239942 140
71 3300005437 Ga0070710_10202314 Ga0070710_102023142 140
72 3300005437 Ga0070710_10292419 Ga0070710_102924191 140
73 3300005437 Ga0070710_10300446 Ga0070710_103004462 140
74 3300005437 Ga0070710_10360878 Ga0070710_103608782 140
75 3300005437 Ga0070710_10652947 Ga0070710_106529471 140
76 3300005439 Ga0070711_100134708 Ga0070711_1001347083 140
77 3300005439 Ga0070711_100171566 Ga0070711_1001715661 140
78 3300005439 Ga0070711_100340175 Ga0070711_1003401752 140
79 3300005439 Ga0070711_100360733 Ga0070711_1003607332 140
80 3300005439 Ga0070711_100457475 Ga0070711_1004574751 140
81 3300005441 Ga0070700_100128407 Ga0070700_1001284072 140
82 3300005455 Ga0070663_100475255 Ga0070663_1004752551 140
83 3300005456 Ga0070678_100356586 Ga0070678_1003565861 140
84 3300005456 Ga0070678_100442452 Ga0070678_1004424522 140
85 3300005457 Ga0070662_100271811 Ga0070662_1002718112 140
86 3300005457 Ga0070662_100436449 Ga0070662_1004364492 140
87 3300005458 Ga0070681_10473192 Ga0070681_104731923 140
88 3300005458 Ga0070681_11279741 Ga0070681_112797411 140
89 3300005459 Ga0068867_100091225 Ga0068867_1000912254 140
90 3300005459 Ga0068867_100591368 Ga0068867_1005913682 140
91 3300005468 Ga0070707_100610224 Ga0070707_1006102242 140
92 3300005471 Ga0070698_100445183 Ga0070698_1004451832 140
93 3300005530 Ga0070679_100275559 Ga0070679_1002755594 140
94 3300005535 Ga0070684_100554462 Ga0070684_1005544621 140
95 3300005535 Ga0070684_100849019 Ga0070684_1008490191 140
96 3300005536 Ga0070697_101167644 Ga0070697_1011676441 140
97 3300005539 Ga0068853_100580495 Ga0068853_1005804951 140
98 3300005539 Ga0068853_100742164 Ga0068853_1007421641 140
99 3300005543 Ga0070672_100087229 Ga0070672_1000872292 140
100 3300005544 Ga0070686_101079539 Ga0070686_1010795391 140
101 3300005545 Ga0070695_100264818 Ga0070695_1002648181 140
102 3300005546 Ga0070696_100069683 Ga0070696_1000696832 140
103 3300005546 Ga0070696_101447706 Ga0070696_1014477061 140
104 3300005547 Ga0070693_100034579 Ga0070693_1000345793 140
105 3300005563 Ga0068855_100460967 Ga0068855_1004609672 140
106 3300005563 Ga0068855_100560001 Ga0068855_1005600012 140
107 3300005563 Ga0068855_100579867 Ga0068855_1005798672 140
108 3300005564 Ga0070664_100481889 Ga0070664_1004818893 140
109 3300005577 Ga0068857_100470768 Ga0068857_1004707681 140
110 3300005578 Ga0068854_100212537 Ga0068854_1002125373 140
111 3300005578 Ga0068854_100370889 Ga0068854_1003708892 140
112 3300005614 Ga0068856_100341557 Ga0068856_1003415573 140
113 3300005614 Ga0068856_100495418 Ga0068856_1004954182 140
114 3300005614 Ga0068856_100901247 Ga0068856_1009012472 140
115 3300005614 Ga0068856_101240481 Ga0068856_1012404812 140
116 3300005614 Ga0068856_101320014 Ga0068856_1013200141 140
117 3300005615 Ga0070702_100296431 Ga0070702_1002964313 140
118 3300005616 Ga0068852_100636002 Ga0068852_1006360022 140
119 3300005719 Ga0068861_100206639 Ga0068861_1002066393 140
120 3300005841 Ga0068863_100367948 Ga0068863_1003679483 140
121 3300005842 Ga0068858_100310923 Ga0068858_1003109231 140
122 3300005842 Ga0068858_100503253 Ga0068858_1005032532 140
123 3300005843 Ga0068860_100333327 Ga0068860_1003333273 140
124 3300005843 Ga0068860_100368614 Ga0068860_1003686142 140
125 3300005844 Ga0068862_100344260 Ga0068862_1003442603 140
126 3300005937 Ga0081455_10092336 Ga0081455_100923363 140
127 3300006028 Ga0070717_10173876 Ga0070717_101738762 140
128 3300006028 Ga0070717_10388316 Ga0070717_103883163 140
129 3300006028 Ga0070717_10472465 Ga0070717_104724652 140
130 3300006028 Ga0070717_10506154 Ga0070717_105061542 140
131 3300006028 Ga0070717_10754668 Ga0070717_107546682 140
132 3300006028 Ga0070717_11086736 Ga0070717_110867361 140
133 3300006058 Ga0075432_10019443 Ga0075432_100194432 140
134 3300006058 Ga0075432_10550808 Ga0075432_105508081 140
135 3300006163 Ga0070715_10059776 Ga0070715_100597763 140
136 3300006163 Ga0070715_10176464 Ga0070715_101764643 140
137 3300006173 Ga0070716_100243622 Ga0070716_1002436223 140
138 3300006173 Ga0070716_100378061 Ga0070716_1003780611 140
139 3300006173 Ga0070716_101117439 Ga0070716_1011174392 140
140 3300006173 Ga0070716_101467215 Ga0070716_1014672152 140
141 3300006175 Ga0070712_100280251 Ga0070712_1002802513 140
142 3300006175 Ga0070712_100340237 Ga0070712_1003402372 140
143 3300006175 Ga0070712_100363570 Ga0070712_1003635702 140
144 3300006175 Ga0070712_100412377 Ga0070712_1004123772 140
145 3300006237 Ga0097621_100271257 Ga0097621_1002712572 140
146 3300006237 Ga0097621_100319973 Ga0097621_1003199732 140
147 3300006237 Ga0097621_100428399 Ga0097621_1004283991 140
148 3300006237 Ga0097621_100598444 Ga0097621_1005984441 140
149 3300006358 Ga0068871_100332285 Ga0068871_1003322852 140
150 3300006358 Ga0068871_100564610 Ga0068871_1005646102 140
151 3300006358 Ga0068871_101392462 Ga0068871_1013924621 140
152 3300006852 Ga0075433_10417180 Ga0075433_104171802 140
153 3300006871 Ga0075434_100447151 Ga0075434_1004471513 140
154 3300006880 Ga0075429_100650054 Ga0075429_1006500542 140
155 3300006881 Ga0068865_100303466 Ga0068865_1003034662 140
156 3300006881 Ga0068865_100386439 Ga0068865_1003864391 140
157 3300006881 Ga0068865_100578953 Ga0068865_1005789532 140
158 3300006914 Ga0075436_100218603 Ga0075436_1002186033 140
159 3300006914 Ga0075436_100908572 Ga0075436_1009085721 140
160 3300007076 Ga0075435_100469905 Ga0075435_1004699051 140
161 3300007076 Ga0075435_100546855 Ga0075435_1005468552 140
162 3300007076 Ga0075435_101620211 Ga0075435_1016202112 140
163 3300007265 Ga0099794_10133476 Ga0099794_101334762 140
164 3300007788 Ga0099795_10106961 Ga0099795_101069611 140
165 3300007788 Ga0099795_10110451 Ga0099795_101104512 140
166 3300009036 Ga0105244_10133403 Ga0105244_101334033 140
167 3300009093 Ga0105240_10502721 Ga0105240_105027213 140
168 3300009094 Ga0111539_10273114 Ga0111539_102731142 140
169 3300009094 Ga0111539_11366615 Ga0111539_113666152 140
170 3300009098 Ga0105245_10553540 Ga0105245_105535402 140
171 3300009098 Ga0105245_11036741 Ga0105245_110367412 140
172 3300009101 Ga0105247_10262509 Ga0105247_102625091 140
173 3300009101 Ga0105247_10872050 Ga0105247_108720501 140
174 3300009101 Ga0105247_10900153 Ga0105247_109001531 140
175 3300009148 Ga0105243_10444733 Ga0105243_104447333 140
176 3300009148 Ga0105243_11172785 Ga0105243_111727852 140
177 3300009174 Ga0105241_10636922 Ga0105241_106369222 140
178 3300009174 Ga0105241_10640672 Ga0105241_106406721 140
179 3300009176 Ga0105242_10401188 Ga0105242_104011881 140
180 3300009176 Ga0105242_10423581 Ga0105242_104235811 140
181 3300009176 Ga0105242_11418374 Ga0105242_114183741 140
182 3300009177 Ga0105248_10400801 Ga0105248_104008013 140
183 3300009177 Ga0105248_10917251 Ga0105248_109172511 140
184 3300009545 Ga0105237_10435107 Ga0105237_104351073 140
185 3300009551 Ga0105238_10485549 Ga0105238_104855492 140
186 3300009551 Ga0105238_11351325 Ga0105238_113513252 140
187 3300009553 Ga0105249_10314553 Ga0105249_103145532 140
188 3300009553 Ga0105249_10356568 Ga0105249_103565681 140
189 3300010159 Ga0099796_10098712 Ga0099796_100987121 140
190 3300010159 Ga0099796_10163580 Ga0099796_101635801 140
191 3300010159 Ga0099796_10211494 Ga0099796_102114942 140
192 3300010375 Ga0105239_10291681 Ga0105239_102916813 140
193 3300010375 Ga0105239_10666392 Ga0105239_106663924 140
194 3300010375 Ga0105239_10894832 Ga0105239_108948321 140
195 3300010375 Ga0105239_11219824 Ga0105239_112198242 140
196 3300011119 Ga0105246_10318816 Ga0105246_103188163 140
197 3300011119 Ga0105246_10702729 Ga0105246_107027292 140
198 3300011119 Ga0105246_10716348 Ga0105246_107163482 140
199 3300011119 Ga0105246_10779823 Ga0105246_107798232 140
200 3300011119 Ga0105246_10789319 Ga0105246_107893191 140
201 3300012473 Ga0157340_1003418 Ga0157340_10034182 140
202 3300012477 Ga0157336_1002308 Ga0157336_10023082 140
203 3300012481 Ga0157320_1001188 Ga0157320_10011882 140
204 3300012483 Ga0157337_1030317 Ga0157337_10303171 140
205 3300012485 Ga0157325_1003579 Ga0157325_10035792 140
206 3300012487 Ga0157321_1000527 Ga0157321_10005271 140
207 3300012490 Ga0157322_1003049 Ga0157322_10030492 140
208 3300012495 Ga0157323_1001470 Ga0157323_10014702 140
209 3300012497 Ga0157319_1001572 Ga0157319_10015722 140
210 3300012502 Ga0157347_1006729 Ga0157347_10067292 140
211 3300012507 Ga0157342_1019984 Ga0157342_10199842 140
212 3300012515 Ga0157338_1004006 Ga0157338_10040062 140
213 3300013102 Ga0157371_10256946 Ga0157371_102569463 140
214 3300013102 Ga0157371_10447341 Ga0157371_104473411 140
215 3300013104 Ga0157370_10090670 Ga0157370_100906701 140
216 3300013105 Ga0157369_11382160 Ga0157369_113821602 140
217 3300013105 Ga0157369_11679563 Ga0157369_116795631 140
218 3300013296 Ga0157374_10327884 Ga0157374_103278841 140
219 3300013296 Ga0157374_10393927 Ga0157374_103939272 140
220 3300013296 Ga0157374_11657729 Ga0157374_116577292 140
221 3300013297 Ga0157378_10313310 Ga0157378_103133102 140
222 3300013297 Ga0157378_10495091 Ga0157378_104950911 140
223 3300013306 Ga0163162_10131572 Ga0163162_101315723 140
224 3300013306 Ga0163162_10214035 Ga0163162_102140353 140
225 3300013306 Ga0163162_10732127 Ga0163162_107321272 140
226 3300013306 Ga0163162_11099922 Ga0163162_110999222 140
227 3300013307 Ga0157372_10150735 Ga0157372_101507352 140
228 3300013307 Ga0157372_10842635 Ga0157372_108426352 140
229 3300013307 Ga0157372_11838971 Ga0157372_118389712 140
230 3300013308 Ga0157375_10692787 Ga0157375_106927871 140
231 3300013308 Ga0157375_10762682 Ga0157375_107626821 140
232 3300014325 Ga0163163_11903013 Ga0163163_119030131 140
233 3300014326 Ga0157380_10592783 Ga0157380_105927832 140
234 3300014497 Ga0182008_10053297 Ga0182008_100532974 140
235 3300014497 Ga0182008_10090742 Ga0182008_100907423 140
236 3300014497 Ga0182008_10135606 Ga0182008_101356061 140
237 3300014497 Ga0182008_10903815 Ga0182008_109038151 140
238 3300014745 Ga0157377_10214692 Ga0157377_102146921 140
239 3300014968 Ga0157379_10291155 Ga0157379_102911552 140
240 3300014968 Ga0157379_10363728 Ga0157379_103637282 140
241 3300014968 Ga0157379_10598322 Ga0157379_105983221 140
242 3300014969 Ga0157376_10156291 Ga0157376_101562912 140
243 3300014969 Ga0157376_10230967 Ga0157376_102309673 140
244 3300014969 Ga0157376_10413481 Ga0157376_104134812 140
245 3300014969 Ga0157376_10552189 Ga0157376_105521893 140
246 3300017792 Ga0163161_10244874 Ga0163161_102448742 140
247 3300017792 Ga0163161_10268217 Ga0163161_102682172 140
248 3300020082 Ga0206353_11291880 Ga0206353_112918801 140
249 3300021358 Ga0213873_10076813 Ga0213873_100768132 140
250 3300021358 Ga0213873_10085351 Ga0213873_100853511 140
251 3300021377 Ga0213874_10052003 Ga0213874_100520032 140
252 3300021377 Ga0213874_10079775 Ga0213874_100797751 140
253 3300021377 Ga0213874_10088964 Ga0213874_100889641 140
254 3300021377 Ga0213874_10102993 Ga0213874_101029931 140
255 3300021377 Ga0213874_10107710 Ga0213874_101077101 140
256 3300021384 Ga0213876_10171733 Ga0213876_101717332 140
257 3300021384 Ga0213876_10194414 Ga0213876_101944142 140
258 3300021384 Ga0213876_10204175 Ga0213876_102041751 140
259 3300021384 Ga0213876_10214462 Ga0213876_102144622 140
260 3300021384 Ga0213876_10258873 Ga0213876_102588732 140
261 3300021384 Ga0213876_10497707 Ga0213876_104977071 140
262 3300021388 Ga0213875_10021387 Ga0213875_100213875 140
263 3300021388 Ga0213875_10141589 Ga0213875_101415892 140
264 3300021388 Ga0213875_10182296 Ga0213875_101822962 140
265 3300021441 Ga0213871_10066702 Ga0213871_100667021 140
266 3300021441 Ga0213871_10067506 Ga0213871_100675061 140
267 3300021441 Ga0213871_10220210 Ga0213871_102202101 140
268 3300021441 Ga0213871_10229420 Ga0213871_102294201 140
269 3300025321 Ga0207656_10228527 Ga0207656_102285271 140
270 3300025728 Ga0207655_1124449 Ga0207655_11244491 140
271 3300025885 Ga0207653_10059364 Ga0207653_100593642 140
272 3300025898 Ga0207692_10265609 Ga0207692_102656091 140
273 3300025898 Ga0207692_10276687 Ga0207692_102766871 140
274 3300025898 Ga0207692_10289611 Ga0207692_102896111 140
275 3300025898 Ga0207692_10725618 Ga0207692_107256182 140
276 3300025898 Ga0207692_11130548 Ga0207692_111305481 140
277 3300025899 Ga0207642_10115400 Ga0207642_101154001 140
278 3300025900 Ga0207710_10285931 Ga0207710_102859312 140
279 3300025901 Ga0207688_10064425 Ga0207688_100644253 140
280 3300025901 Ga0207688_10099961 Ga0207688_100999613 140
281 3300025905 Ga0207685_10003995 Ga0207685_100039954 140
282 3300025905 Ga0207685_10125786 Ga0207685_101257861 140
283 3300025905 Ga0207685_10178945 Ga0207685_101789451 140
284 3300025905 Ga0207685_10257921 Ga0207685_102579212 140
285 3300025906 Ga0207699_10086157 Ga0207699_100861571 140
286 3300025906 Ga0207699_10301996 Ga0207699_103019962 140
287 3300025906 Ga0207699_10359489 Ga0207699_103594892 140
288 3300025906 Ga0207699_10419669 Ga0207699_104196691 140
289 3300025906 Ga0207699_10496192 Ga0207699_104961922 140
290 3300025906 Ga0207699_11041624 Ga0207699_110416241 140
291 3300025911 Ga0207654_10286683 Ga0207654_102866831 140
292 3300025911 Ga0207654_10384027 Ga0207654_103840272 140
293 3300025912 Ga0207707_10461368 Ga0207707_104613682 140
294 3300025912 Ga0207707_11170101 Ga0207707_111701011 140
295 3300025913 Ga0207695_10705245 Ga0207695_107052452 140
296 3300025914 Ga0207671_10576429 Ga0207671_105764291 140
297 3300025914 Ga0207671_10628190 Ga0207671_106281901 140
298 3300025914 Ga0207671_10644018 Ga0207671_106440181 140
299 3300025915 Ga0207693_10190698 Ga0207693_101906982 140
300 3300025915 Ga0207693_10210552 Ga0207693_102105522 140
301 3300025915 Ga0207693_10286388 Ga0207693_102863882 140
302 3300025915 Ga0207693_10331239 Ga0207693_103312392 140
303 3300025916 Ga0207663_10381923 Ga0207663_103819232 140
304 3300025916 Ga0207663_10410941 Ga0207663_104109411 140
305 3300025916 Ga0207663_10424580 Ga0207663_104245801 140
306 3300025916 Ga0207663_10427020 Ga0207663_104270202 140
307 3300025916 Ga0207663_10429627 Ga0207663_104296272 140
308 3300025916 Ga0207663_11132631 Ga0207663_111326311 140
309 3300025917 Ga0207660_10444310 Ga0207660_104443102 140
310 3300025918 Ga0207662_10229620 Ga0207662_102296202 140
311 3300025919 Ga0207657_10347306 Ga0207657_103473061 140
312 3300025921 Ga0207652_10687403 Ga0207652_106874031 140
313 3300025922 Ga0207646_10547631 Ga0207646_105476312 140
314 3300025926 Ga0207659_10561732 Ga0207659_105617321 140
315 3300025926 Ga0207659_11391073 Ga0207659_113910731 140
316 3300025927 Ga0207687_10447560 Ga0207687_104475602 140
317 3300025927 Ga0207687_10476169 Ga0207687_104761692 140
318 3300025927 Ga0207687_10519740 Ga0207687_105197401 140
319 3300025928 Ga0207700_10080272 Ga0207700_100802723 140
320 3300025928 Ga0207700_10206222 Ga0207700_102062222 140
321 3300025928 Ga0207700_10229061 Ga0207700_102290613 140
322 3300025928 Ga0207700_10281252 Ga0207700_102812521 140
323 3300025928 Ga0207700_10491448 Ga0207700_104914482 140
324 3300025928 Ga0207700_10534692 Ga0207700_105346921 140
325 3300025928 Ga0207700_10564300 Ga0207700_105643002 140
326 3300025928 Ga0207700_10569349 Ga0207700_105693491 140
327 3300025928 Ga0207700_10838948 Ga0207700_108389481 140
328 3300025929 Ga0207664_10080381 Ga0207664_100803812 140
329 3300025929 Ga0207664_10314694 Ga0207664_103146942 140
330 3300025929 Ga0207664_10386413 Ga0207664_103864133 140
331 3300025929 Ga0207664_10444618 Ga0207664_104446181 140
332 3300025929 Ga0207664_10521101 Ga0207664_105211012 140
333 3300025929 Ga0207664_10574273 Ga0207664_105742732 140
334 3300025929 Ga0207664_10588329 Ga0207664_105883292 140
335 3300025929 Ga0207664_11247287 Ga0207664_112472871 140
336 3300025931 Ga0207644_10570571 Ga0207644_105705712 140
337 3300025932 Ga0207690_10422457 Ga0207690_104224572 140
338 3300025933 Ga0207706_10348974 Ga0207706_103489741 140
339 3300025933 Ga0207706_10361211 Ga0207706_103612112 140
340 3300025934 Ga0207686_10362561 Ga0207686_103625611 140
341 3300025934 Ga0207686_10992513 Ga0207686_109925132 140
342 3300025935 Ga0207709_10270762 Ga0207709_102707623 140
343 3300025938 Ga0207704_10339066 Ga0207704_103390662 140
344 3300025938 Ga0207704_10475154 Ga0207704_104751541 140
345 3300025938 Ga0207704_10908798 Ga0207704_109087982 140
346 3300025938 Ga0207704_11021519 Ga0207704_110215191 140
347 3300025939 Ga0207665_10103639 Ga0207665_101036393 140
348 3300025939 Ga0207665_10127856 Ga0207665_101278562 140
349 3300025939 Ga0207665_10181537 Ga0207665_101815374 140
350 3300025939 Ga0207665_10351619 Ga0207665_103516191 140
351 3300025939 Ga0207665_10368663 Ga0207665_103686631 140
352 3300025940 Ga0207691_10410429 Ga0207691_104104293 140
353 3300025942 Ga0207689_10309441 Ga0207689_103094411 140
354 3300025944 Ga0207661_10449564 Ga0207661_104495642 140
355 3300025944 Ga0207661_10503983 Ga0207661_105039831 140
356 3300025944 Ga0207661_11969520 Ga0207661_119695201 140
357 3300025945 Ga0207679_10527059 Ga0207679_105270593 140
358 3300025949 Ga0207667_10397605 Ga0207667_103976051 140
359 3300025949 Ga0207667_10435307 Ga0207667_104353071 140
360 3300025949 Ga0207667_10686525 Ga0207667_106865252 140
361 3300025961 Ga0207712_10527775 Ga0207712_105277752 140
362 3300025972 Ga0207668_10563275 Ga0207668_105632751 140
363 3300025981 Ga0207640_10425139 Ga0207640_104251391 140
364 3300025981 Ga0207640_10580413 Ga0207640_105804132 140
365 3300026023 Ga0207677_10305800 Ga0207677_103058001 140
366 3300026041 Ga0207639_10706900 Ga0207639_107069002 140
367 3300026041 Ga0207639_10797705 Ga0207639_107977051 140
368 3300026067 Ga0207678_10350612 Ga0207678_103506122 140
369 3300026075 Ga0207708_10160956 Ga0207708_101609562 140
370 3300026078 Ga0207702_10574838 Ga0207702_105748381 140
371 3300026078 Ga0207702_11050811 Ga0207702_110508111 140
372 3300026078 Ga0207702_11134469 Ga0207702_111344691 140
373 3300026088 Ga0207641_10690429 Ga0207641_106904291 140
374 3300026088 Ga0207641_12221970 Ga0207641_122219702 140
375 3300026089 Ga0207648_10135967 Ga0207648_101359672 140
376 3300026116 Ga0207674_10530041 Ga0207674_105300412 140
377 3300026118 Ga0207675_100642835 Ga0207675_1006428351 140
378 3300026118 Ga0207675_100989725 Ga0207675_1009897251 140
379 3300026121 Ga0207683_10349697 Ga0207683_103496972 140
380 3300026121 Ga0207683_10583378 Ga0207683_105833782 140
381 3300026142 Ga0207698_10689433 Ga0207698_106894331 140
382 3300026142 Ga0207698_10759290 Ga0207698_107592901 140
383 3300026142 Ga0207698_10842122 Ga0207698_108421222 140
384 3300026142 Ga0207698_12585186 Ga0207698_125851861 140
385 3300027512 Ga0209179_1042914 Ga0209179_10429141 140
386 3300027671 Ga0209588_1088485 Ga0209588_10884852 140
387 3300027907 Ga0207428_10280109 Ga0207428_102801092 140
388 3300027907 Ga0207428_10377972 Ga0207428_103779722 140
389 3300028380 Ga0268265_10669357 Ga0268265_106693571 140
390 3300028381 Ga0268264_10678980 Ga0268264_106789802 140
391 3300028381 Ga0268264_10689034 Ga0268264_106890342 140
392 3300029957 Ga0265324_10101149 Ga0265324_101011491 140
393 3300031239 Ga0265328_10110287 Ga0265328_101102871 140
394 3300031241 Ga0265325_10428752 Ga0265325_104287521 140
395 3300031250 Ga0265331_10173342 Ga0265331_101733421 140
396 3300031251 Ga0265327_10043144 Ga0265327_100431443 140
397 3300031251 Ga0265327_10062032 Ga0265327_100620321 140
398 3300031344 Ga0265316_10828379 Ga0265316_108283792 140
399 3300031691 Ga0316579_10508996 Ga0316579_105089961 140
400 3300031728 Ga0316578_10234498 Ga0316578_102344982 140
401 3300034816 Ga0373930_0026584 Ga0373930_0026584_512_934 140
402 3300034816 Ga0373930_0152846 Ga0373930_0152846_24_446 140
403 3300034817 Ga0373948_0023337 Ga0373948_0023337_278_700 140
404 3300034817 Ga0373948_0029747 Ga0373948_0029747_217_639 140
405 3300034817 Ga0373948_0031062 Ga0373948_0031062_176_598 140
406 3300034818 Ga0373950_0026741 Ga0373950_0026741_498_920 140
407 3300034819 Ga0373958_0018192 Ga0373958_0018192_245_667 140
408 3300034819 Ga0373958_0021363 Ga0373958_0021363_319_741 140
409 3300034820 Ga0373959_0029794 Ga0373959_0029794_416_838 140
410 3300034820 Ga0373959_0031082 Ga0373959_0031082_446_868 140
411 3300034820 Ga0373959_0075094 Ga0373959_0075094_188_610 140
412 3300034957 Ga0373938_0031356 Ga0373938_0031356_278_700 140
413 3300034957 Ga0373938_0044836 Ga0373938_0044836_440_862 140
414 3300035083 Ga0373926_0088561 Ga0373926_0088561_128_550 140
415 3300035083 Ga0373926_0106819 Ga0373926_0106819_194_616 140
416 3300035083 Ga0373926_0314216 Ga0373926_0314216_34_456 140
417 3300035083 Ga0373926_0458046 Ga0373926_0458046_36_458 140
418 3300035084 Ga0373928_0037539 Ga0373928_0037539_445_867 140
419 3300035084 Ga0373928_0043280 Ga0373928_0043280_475_897 140
420 3300035085 Ga0373929_0021640 Ga0373929_0021640_636_1058 140
421 3300035085 Ga0373929_0021722 Ga0373929_0021722_763_1185 140
422 3300035085 Ga0373929_0045899 Ga0373929_0045899_425_847 140
423 3300035086 Ga0373934_0131361 Ga0373934_0131361_181_603 140
424 3300035086 Ga0373934_0142914 Ga0373934_0142914_301_723 140
425 3300035086 Ga0373934_0158544 Ga0373934_0158544_128_550 140
426 3300035088 Ga0373940_0056330 Ga0373940_0056330_257_679 140
427 3300035088 Ga0373940_0072601 Ga0373940_0072601_126_548 140
428 3300035089 Ga0373944_0103499 Ga0373944_0103499_135_557 140
429 3300035090 Ga0373949_0049342 Ga0373949_0049342_482_904 140
430 3300035091 Ga0373951_0022088 Ga0373951_0022088_710_1132 140
431 3300035091 Ga0373951_0061319 Ga0373951_0061319_22_444 140
432 3300035092 Ga0373952_0049726 Ga0373952_0049726_120_542 140
433 3300035111 Ga0373923_0080242 Ga0373923_0080242_123_545 140
434 3300035111 Ga0373923_0166204 Ga0373923_0166204_457_879 140
435 3300035111 Ga0373923_0201335 Ga0373923_0201335_156_578 140
436 3300035111 Ga0373923_0244388 Ga0373923_0244388_392_814 140
437 3300035111 Ga0373923_0343941 Ga0373923_0343941_186_608 140
438 3300035112 Ga0373932_0033928 Ga0373932_0033928_274_696 140
439 3300035112 Ga0373932_0061317 Ga0373932_0061317_197_619 140
440 3300035113 Ga0373936_0008530 Ga0373936_0008530_2583_3005 140
441 3300035113 Ga0373936_0047881 Ga0373936_0047881_949_1401 140
442 3300035113 Ga0373936_0063262 Ga0373936_0063262_964_1386 140
443 3300035114 Ga0373939_0007616 Ga0373939_0007616_1778_2200 140
444 3300035114 Ga0373939_0054417 Ga0373939_0054417_261_683 140
445 3300035114 Ga0373939_0073616 Ga0373939_0073616_555_977 140
446 3300035114 Ga0373939_0128613 Ga0373939_0128613_91_513 140
447 3300035115 Ga0373941_0064747 Ga0373941_0064747_132_554 140
448 3300035115 Ga0373941_0132824 Ga0373941_0132824_336_758 140
449 3300035115 Ga0373941_0222344 Ga0373941_0222344_87_509 140
450 3300035116 Ga0373945_0088439 Ga0373945_0088439_440_862 140
451 3300035116 Ga0373945_0116006 Ga0373945_0116006_494_916 140
452 3300035116 Ga0373945_0154705 Ga0373945_0154705_497_919 140
453 3300035117 Ga0373953_0079377 Ga0373953_0079377_514_936 140
454 3300035117 Ga0373953_0141034 Ga0373953_0141034_173_595 140
455 3300035118 Ga0373954_0116976 Ga0373954_0116976_500_922 140
456 3300035118 Ga0373954_0456705 Ga0373954_0456705_92_514 140
457 3300035119 Ga0373956_0110031 Ga0373956_0110031_591_1013 140
458 3300035119 Ga0373956_0157188 Ga0373956_0157188_491_913 140
459 3300035119 Ga0373956_0535526 Ga0373956_0535526_24_446 140
460 3300035120 Ga0373957_0066508 Ga0373957_0066508_556_978 140
461 3300035120 Ga0373957_0154204 Ga0373957_0154204_16_438 140
462 3300035120 Ga0373957_0207113 Ga0373957_0207113_199_621 140
463 3300035121 Ga0373960_0072761 Ga0373960_0072761_141_563 140
464 3300035121 Ga0373960_0075012 Ga0373960_0075012_507_929 140
465 3300035121 Ga0373960_0096310 Ga0373960_0096310_63_485 140
466 3300035121 Ga0373960_0103280 Ga0373960_0103280_45_467 140
467 3300035170 Ga0373943_0137453 Ga0373943_0137453_469_891 140
468 3300035170 Ga0373943_0168980 Ga0373943_0168980_156_578 140
469 3300035170 Ga0373943_0287753 Ga0373943_0287753_445_867 140
470 3300035170 Ga0373943_0296394 Ga0373943_0296394_373_795 140
471 3300035171 Ga0373946_0170667 Ga0373946_0170667_158_580 140
472 3300035171 Ga0373946_0176983 Ga0373946_0176983_457_879 140
473 3300035171 Ga0373946_0414027 Ga0373946_0414027_40_462 140
474 3300035172 Ga0373955_0301465 Ga0373955_0301465_87_509 140
475 3300035172 Ga0373955_0336125 Ga0373955_0336125_428_850 140
476 3300035172 Ga0373955_0379756 Ga0373955_0379756_109_531 140
477 3300035172 Ga0373955_1045110 Ga0373955_1045110_28_450 140
478 3300035207 Ga0373942_0057901 Ga0373942_0057901_435_857 140
479 3300035207 Ga0373942_0062579 Ga0373942_0062579_134_556 140
480 3300035241 Ga0373961_0056090 Ga0373961_0056090_591_1013 140
481 3300035241 Ga0373961_0061569 Ga0373961_0061569_267_689 140
482 3300035241 Ga0373961_0066879 Ga0373961_0066879_232_654 140
483 3300035241 Ga0373961_0067174 Ga0373961_0067174_500_922 140
484 3300035242 Ga0373962_0022858 Ga0373962_0022858_469_891 140
485 3300035242 Ga0373962_0054276 Ga0373962_0054276_185_607 140
486 3300035410 Ga0373924_0157027 Ga0373924_0157027_103_525 140
487 3300035410 Ga0373924_0159931 Ga0373924_0159931_125_547 140
488 3300035410 Ga0373924_0169783 Ga0373924_0169783_107_529 140
489 3300035410 Ga0373924_0193610 Ga0373924_0193610_341_763 140
490 3300035410 Ga0373924_0542356 Ga0373924_0542356_55_477 140
491 3300035691 Ga0373931_0049978 Ga0373931_0049978_964_1386 140
492 3300035691 Ga0373931_0280064 Ga0373931_0280064_476_898 140
493 3300035691 Ga0373931_0283740 Ga0373931_0283740_139_561 140
494 3300035691 Ga0373931_0296907 Ga0373931_0296907_12_434 140
495 3300035691 Ga0373931_0460060 Ga0373931_0460060_296_718 140
496 3300035692 Ga0373935_0086945 Ga0373935_0086945_64_486 140
497 3300035692 Ga0373935_0383642 Ga0373935_0383642_440_862 140
498 3300035692 Ga0373935_0395638 Ga0373935_0395638_77_499 140
499 3300035695 Ga0373927_0103987 Ga0373927_0103987_1302_1724 140
500 3300035695 Ga0373927_0110422 Ga0373927_0110422_452_874 140
501 3300035695 Ga0373927_0250351 Ga0373927_0250351_679_1101 140
502 3300035695 Ga0373927_0666519 Ga0373927_0666519_145_567 140
503 3300035724 Ga0373933_0182840 Ga0373933_0182840_454_876 140
504 3300035724 Ga0373933_0220174 Ga0373933_0220174_155_577 140
505 3300035724 Ga0373933_0385458 Ga0373933_0385458_135_557 140
506 3300035724 Ga0373933_0485716 Ga0373933_0485716_248_670 140
507 3300035725 Ga0373947_0056873 Ga0373947_0056873_1553_1975 140
508 3300035725 Ga0373947_0066489 Ga0373947_0066489_875_1297 140
509 3300035725 Ga0373947_0122126 Ga0373947_0122126_761_1183 140
510 3300035725 Ga0373947_0347020 Ga0373947_0347020_130_552 140
511 3300036401 Ga0373937_0146918 Ga0373937_0146918_671_1093 140
512 3300036401 Ga0373937_0310266 Ga0373937_0310266_233_808 140
513 3300036401 Ga0373937_0328846 Ga0373937_0328846_705_1127 140
514 3300036401 Ga0373937_0553741 Ga0373937_0553741_205_627 140
515 3300037068 Ga0373925_0029492 Ga0373925_0029492_477_899 140
516 3300037068 Ga0373925_0305656 Ga0373925_0305656_588_1106 140
517 3300037068 Ga0373925_0327560 Ga0373925_0327560_773_1195 140
518 3300037068 Ga0373925_0512436 Ga0373925_0512436_193_615 140
519 3300037068 Ga0373925_0545344 Ga0373925_0545344_94_516 140
520 3300037068 Ga0373925_0642170 Ga0373925_0642170_131_553 140
521 3300037853 Ga0436364_0017074 Ga0436364_0017074_2708_3202 140
522 3300037853 Ga0436364_0576899 Ga0436364_0576899_949_1410 140
523 3300037853 Ga0436364_0712397 Ga0436364_0712397_311_772 140
524 3300037853 Ga0436364_0732245 Ga0436364_0732245_104_526 140
525 3300037853 Ga0436364_0774991 Ga0436364_0774991_797_1219 140
526 3300037853 Ga0436364_1177754 Ga0436364_1177754_1810_2232 140
527 3300037853 Ga0436364_1320027 Ga0436364_1320027_186_608 140
528 3300039437 Ga0436365_0082489 Ga0436365_0082489_3236_3658 140
529 3300039437 Ga0436365_0149981 Ga0436365_0149981_291_713 140
530 3300039437 Ga0436365_0668315 Ga0436365_0668315_587_1054 140
531 3300039437 Ga0436365_0706061 Ga0436365_0706061_163_585 140
532 3300039437 Ga0436365_0787104 Ga0436365_0787104_1699_2121 140
533 3300039437 Ga0436365_0874702 Ga0436365_0874702_631_1053 140
534 3300039437 Ga0436365_0913963 Ga0436365_0913963_31_453 140
535 3300039437 Ga0436365_1119317 Ga0436365_1119317_558_980 140
536 3300039437 Ga0436365_1254859 Ga0436365_1254859_882_1304 140
537 3300039437 Ga0436365_1495534 Ga0436365_1495534_242_664 140
538 3300039437 Ga0436365_1780607 Ga0436365_1780607_191_658 140
539 3300039438 Ga0436360_0054504 Ga0436360_0054504_263_685 140
540 3300039438 Ga0436360_0066264 Ga0436360_0066264_69_491 140
541 3300039438 Ga0436360_0144130 Ga0436360_0144130_56_523 140
542 3300039438 Ga0436360_0146599 Ga0436360_0146599_164_586 140
543 3300039438 Ga0436360_0341916 Ga0436360_0341916_73_495 140
544 3300039438 Ga0436360_0352881 Ga0436360_0352881_44_466 140
545 3300039438 Ga0436360_0581270 Ga0436360_0581270_396_818 140
546 3300039438 Ga0436360_0995301 Ga0436360_0995301_217_639 140
547 3300039438 Ga0436360_1167367 Ga0436360_1167367_596_1018 140
548 3300039447 Ga0436361_0235806 Ga0436361_0235806_98_520 140
549 3300039447 Ga0436361_0289321 Ga0436361_0289321_537_959 140
550 3300039447 Ga0436361_0803000 Ga0436361_0803000_210_677 140
551 3300039447 Ga0436361_1078566 Ga0436361_1078566_244_666 140
552 3300039450 Ga0436363_0133069 Ga0436363_0133069_219_641 140
553 3300039450 Ga0436363_0179411 Ga0436363_0179411_244_666 140
554 3300039450 Ga0436363_0445300 Ga0436363_0445300_581_1003 140
555 3300039450 Ga0436363_0599077 Ga0436363_0599077_163_585 140
556 3300039450 Ga0436363_0626302 Ga0436363_0626302_100_561 140
557 3300039450 Ga0436363_0970346 Ga0436363_0970346_476_898 140
558 3300039450 Ga0436363_1294053 Ga0436363_1294053_225_647 140
559 3300039450 Ga0436363_1298650 Ga0436363_1298650_274_696 140
560 3300039450 Ga0436363_1371860 Ga0436363_1371860_412_834 140
561 3300039450 Ga0436363_1433776 Ga0436363_1433776_3373_3795 140
562 3300039450 Ga0436363_1640127 Ga0436363_1640127_202_624 140
563 3300039453 Ga0436362_0015221 Ga0436362_0015221_441_863 140
564 3300039453 Ga0436362_0079551 Ga0436362_0079551_255_677 140
565 3300039453 Ga0436362_0230309 Ga0436362_0230309_44_466 140
566 3300039453 Ga0436362_0545750 Ga0436362_0545750_294_761 140
567 3300041441 Ga0451787_141160 Ga0451787_141160_556_978 140
568 3300041458 Ga0451798_0084915 Ga0451798_0084915_146_568 140
569 3300041459 Ga0451800_1599908 Ga0451800_1599908_329_751 140
570 3300041463 Ga0451804_0627308 Ga0451804_0627308_165_587 140
571 3300041486 Ga0451807_0548946 Ga0451807_0548946_127_549 140
572 3300041496 Ga0451839_1021707 Ga0451839_1021707_725_1147 140
573 3300041505 Ga0451849_0889094 Ga0451849_0889094_211_633 140
574 3300041512 Ga0451853_1385000 Ga0451853_1385000_530_952 140
575 3300042003 Ga0439443_024505 Ga0439443_024505_139_561 140
576 3300042005 Ga0439448_0108716 Ga0439448_0108716_58_480 140
577 3300042008 Ga0439450_051404 Ga0439450_051404_130_552 140
578 3300042013 Ga0439456_122937 Ga0439456_122937_51_473 140
579 3300042436 Ga0439435_0059212 Ga0439435_0059212_528_950 140
580 3300042437 Ga0439444_0000592 Ga0439444_0000592_3606_4028 140
581 3300042437 Ga0439444_0112893 Ga0439444_0112893_75_497 140
582 3300042439 Ga0439464_0124874 Ga0439464_0124874_230_652 140
583 3300042461 Ga0439460_0092546 Ga0439460_0092546_498_920 140
584 3300044694 Ga0466963_0317501 Ga0466963_0317501_148_570 140
585 3300044694 Ga0466963_0321818 Ga0466963_0321818_524_946 140
586 3300044842 Ga0466957_0383376 Ga0466957_0383376_500_922 140
587 3300044842 Ga0466957_1410568 Ga0466957_1410568_73_495 140
588 3300045976 Ga0466967_0697499 Ga0466967_0697499_485_907 140
589 3300045976 Ga0466967_1176814 Ga0466967_1176814_95_517 140
590 3300046454 Ga0495592_0212842 Ga0495592_0212842_90_512 140
591 3300046454 Ga0495592_0268044 Ga0495592_0268044_511_933 140
592 3300046454 Ga0495592_0279722 Ga0495592_0279722_565_987 140
593 3300046455 Ga0495603_0130659 Ga0495603_0130659_584_1006 140
594 3300046455 Ga0495603_0316113 Ga0495603_0316113_334_756 140
595 3300046455 Ga0495603_0682492 Ga0495603_0682492_64_486 140
596 3300046458 Ga0495591_098074 Ga0495591_098074_208_630 140
597 3300046459 Ga0495629_0060353 Ga0495629_0060353_131_553 140
598 3300046459 Ga0495629_0076054 Ga0495629_0076054_1757_2179 140
599 3300046461 Ga0495641_0147443 Ga0495641_0147443_201_623 140
600 3300046462 Ga0495651_0042880 Ga0495651_0042880_370_792 140
601 3300046463 Ga0495653_0118238 Ga0495653_0118238_962_1384 140
602 3300046463 Ga0495653_0394147 Ga0495653_0394147_148_570 140
603 3300046472 Ga0495580_0196582 Ga0495580_0196582_508_930 140
604 3300046472 Ga0495580_0224745 Ga0495580_0224745_425_847 140
605 3300046472 Ga0495580_0285667 Ga0495580_0285667_494_916 140
606 3300046473 Ga0495582_0229184 Ga0495582_0229184_192_614 140
607 3300046473 Ga0495582_0313579 Ga0495582_0313579_294_716 140
608 3300046475 Ga0495639_0184199 Ga0495639_0184199_442_864 140
609 3300046475 Ga0495639_0264385 Ga0495639_0264385_239_661 140
610 3300046476 Ga0495662_0151416 Ga0495662_0151416_313_735 140
611 3300046476 Ga0495662_0306118 Ga0495662_0306118_95_517 140
612 3300046477 Ga0495664_0198321 Ga0495664_0198321_347_769 140
613 3300046477 Ga0495664_0327618 Ga0495664_0327618_128_550 140
614 3300046477 Ga0495664_0444526 Ga0495664_0444526_317_739 140
615 3300046499 Ga0495594_0154172 Ga0495594_0154172_762_1184 140
616 3300046499 Ga0495594_0217468 Ga0495594_0217468_464_886 140
617 3300046500 Ga0495596_0118924 Ga0495596_0118924_522_944 140
618 3300046511 Ga0495608_0187680 Ga0495608_0187680_82_504 140
619 3300046511 Ga0495608_0228507 Ga0495608_0228507_524_946 140
620 3300046514 Ga0495618_0231042 Ga0495618_0231042_586_1008 140
621 3300046514 Ga0495618_0298949 Ga0495618_0298949_273_695 140
622 3300046514 Ga0495618_0445827 Ga0495618_0445827_169_591 140
623 3300046516 Ga0495628_0223220 Ga0495628_0223220_540_962 140
624 3300046517 Ga0495630_0435463 Ga0495630_0435463_445_867 140
625 3300046525 Ga0495663_0208983 Ga0495663_0208983_171_593 140
626 3300046526 Ga0495666_0033902 Ga0495666_0033902_147_569 140
627 3300046526 Ga0495666_0535929 Ga0495666_0535929_35_457 140
628 3300046529 Ga0495652_0098312 Ga0495652_0098312_516_938 140
629 3300046529 Ga0495652_0304748 Ga0495652_0304748_595_1017 140
630 3300046529 Ga0495652_0360735 Ga0495652_0360735_190_612 140
631 3300046531 Ga0495665_0067874 Ga0495665_0067874_218_640 140
632 3300046533 Ga0495640_0303316 Ga0495640_0303316_162_584 140
633 3300046533 Ga0495640_0367973 Ga0495640_0367973_354_776 140
634 3300046533 Ga0495640_0678952 Ga0495640_0678952_155_577 140
635 3300046535 Ga0495586_0229334 Ga0495586_0229334_504_926 140
636 3300046538 Ga0495609_0211944 Ga0495609_0211944_320_742 140
637 3300046543 Ga0495645_0268173 Ga0495645_0268173_273_695 140
638 3300046543 Ga0495645_0346994 Ga0495645_0346994_392_814 140
639 3300046557 Ga0495622_0207864 Ga0495622_0207864_144_566 140
640 3300046558 Ga0495633_0346122 Ga0495633_0346122_109_531 140
641 3300046559 Ga0495667_0346645 Ga0495667_0346645_322_744 140
642 3300046616 Ga0495668_0295290 Ga0495668_0295290_152_574 140
643 3300046642 Ga0495634_0123272 Ga0495634_0123272_1096_1518 140
644 3300046642 Ga0495634_0229872 Ga0495634_0229872_263_685 140
645 3300046663 Ga0495635_0327542 Ga0495635_0327542_141_563 140
646 3300046664 Ga0495659_0319739 Ga0495659_0319739_117_539 140
647 3300046674 Ga0495588_0181668 Ga0495588_0181668_506_928 140
648 3300046674 Ga0495588_0497083 Ga0495588_0497083_170_592 140
649 3300046675 Ga0495657_0208952 Ga0495657_0208952_688_1110 140
650 3300046675 Ga0495657_0396612 Ga0495657_0396612_270_692 140
651 3300046678 Ga0495599_0276645 Ga0495599_0276645_165_587 140
652 3300046679 Ga0495623_0496153 Ga0495623_0496153_45_467 140
653 3300046680 Ga0495646_0135615 Ga0495646_0135615_818_1240 140
654 3300046680 Ga0495646_0179358 Ga0495646_0179358_503_925 140
655 3300046681 Ga0495647_0015172 Ga0495647_0015172_1830_2252 140
656 3300046681 Ga0495647_0113871 Ga0495647_0113871_577_999 140
657 3300046681 Ga0495647_0142285 Ga0495647_0142285_165_587 140
658 3300046683 Ga0495658_0209839 Ga0495658_0209839_538_960 140
659 3300046683 Ga0495658_0321179 Ga0495658_0321179_196_618 140
660 3300046683 Ga0495658_0583182 Ga0495658_0583182_180_602 140
661 3300046684 Ga0495669_0220656 Ga0495669_0220656_48_470 140
662 3300046689 Ga0495613_0182317 Ga0495613_0182317_459_881 140
663 3300046689 Ga0495613_0722003 Ga0495613_0722003_98_520 140
664 3300046690 Ga0495624_0177766 Ga0495624_0177766_417_839 140
665 3300046690 Ga0495624_0284860 Ga0495624_0284860_109_531 140
666 3300046809 Ga0495600_0279792 Ga0495600_0279792_457_879 140
667 3300046809 Ga0495600_0307935 Ga0495600_0307935_458_880 140
668 3300046809 Ga0495600_0327456 Ga0495600_0327456_190_612 140
669 3300047315 Ga0495581_0149538 Ga0495581_0149538_613_1035 140
670 3300047315 Ga0495581_0415344 Ga0495581_0415344_202_624 140
671 3300047315 Ga0495581_0568672 Ga0495581_0568672_111_533 140
672 3300047318 Ga0495636_0527159 Ga0495636_0527159_131_553 140
673 3300047319 Ga0495674_0099218 Ga0495674_0099218_1203_1625 140
674 3300047319 Ga0495674_0195359 Ga0495674_0195359_360_782 140
675 3300047319 Ga0495674_0269180 Ga0495674_0269180_13_435 140
676 3300047319 Ga0495674_0440870 Ga0495674_0440870_177_599 140
677 3300047319 Ga0495674_0929718 Ga0495674_0929718_25_447 140
678 3300047321 Ga0495676_0148064 Ga0495676_0148064_503_925 140
679 3300047321 Ga0495676_0196426 Ga0495676_0196426_172_594 140
680 3300047321 Ga0495676_0373536 Ga0495676_0373536_33_455 140
681 3300047321 Ga0495676_0617792 Ga0495676_0617792_121_543 140
682 3300047322 Ga0495680_0248163 Ga0495680_0248163_70_492 140
683 3300047322 Ga0495680_0413194 Ga0495680_0413194_141_563 140
684 3300047322 Ga0495680_0637566 Ga0495680_0637566_211_633 140
685 3300047471 Ga0495684_0138759 Ga0495684_0138759_951_1373 140
686 3300047471 Ga0495684_0430550 Ga0495684_0430550_144_566 140
687 3300047471 Ga0495684_0911159 Ga0495684_0911159_86_508 140
688 3300047673 Ga0495593_0172663 Ga0495593_0172663_456_878 140
689 3300047673 Ga0495593_0498479 Ga0495593_0498479_45_467 140
690 3300048088 Ga0495602_0540590 Ga0495602_0540590_277_699 140
691 3300048088 Ga0495602_0626086 Ga0495602_0626086_98_520 140
692 3300048088 Ga0495602_0831527 Ga0495602_0831527_21_443 140
693 3300048089 Ga0495614_0013525 Ga0495614_0013525_2094_2516 140
694 3300048089 Ga0495614_0135160 Ga0495614_0135160_165_587 140
695 3300048903 Ga0496100_0160277 Ga0496100_0160277_632_1054 140
696 3300048903 Ga0496100_0294785 Ga0496100_0294785_337_759 140
697 3300048903 Ga0496100_0419690 Ga0496100_0419690_153_575 140
698 3300048904 Ga0496101_0077887 Ga0496101_0077887_1610_2032 140
699 3300048904 Ga0496101_0343631 Ga0496101_0343631_204_626 140
700 3300048904 Ga0496101_0375338 Ga0496101_0375338_245_667 140
701 3300048905 Ga0496102_0283477 Ga0496102_0283477_134_556 140
702 3300048905 Ga0496102_0471871 Ga0496102_0471871_204_626 140
703 3300048906 Ga0496103_0192701 Ga0496103_0192701_461_883 140
704 3300048906 Ga0496103_0546752 Ga0496103_0546752_117_539 140
705 3300048907 Ga0496104_0471651 Ga0496104_0471651_585_1007 140
706 3300048907 Ga0496104_0547102 Ga0496104_0547102_506_928 140
707 3300048908 Ga0496105_0399259 Ga0496105_0399259_221_643 140
708 3300048908 Ga0496105_0446435 Ga0496105_0446435_140_562 140
709 3300048908 Ga0496105_0511902 Ga0496105_0511902_364_786 140
710 3300048909 Ga0496106_0214880 Ga0496106_0214880_959_1381 140
711 3300048909 Ga0496106_0453213 Ga0496106_0453213_460_882 140
712 3300048909 Ga0496106_0638810 Ga0496106_0638810_395_817 140
713 3300048910 Ga0496107_0383793 Ga0496107_0383793_442_864 140
714 3300048910 Ga0496107_0566859 Ga0496107_0566859_271_693 140
715 3300048910 Ga0496107_0970319 Ga0496107_0970319_121_543 140
716 3300048911 Ga0496108_0191953 Ga0496108_0191953_1284_1706 140
717 3300048911 Ga0496108_0297094 Ga0496108_0297094_782_1204 140
718 3300048912 Ga0496109_0467881 Ga0496109_0467881_479_901 140
719 3300048913 Ga0496110_0552348 Ga0496110_0552348_151_573 140
720 3300048913 Ga0496110_0563001 Ga0496110_0563001_482_904 140
721 3300048913 Ga0496110_0580262 Ga0496110_0580262_521_943 140
722 3300048914 Ga0496111_0161731 Ga0496111_0161731_766_1188 140
723 3300048914 Ga0496111_0422765 Ga0496111_0422765_417_839 140
724 3300048914 Ga0496111_0446704 Ga0496111_0446704_86_508 140
725 3300048914 Ga0496111_0652728 Ga0496111_0652728_26_448 140
726 3300048915 Ga0496112_0448734 Ga0496112_0448734_345_767 140
727 3300048915 Ga0496112_0561933 Ga0496112_0561933_441_863 140
728 3300048916 Ga0496113_0236427 Ga0496113_0236427_440_862 140
729 3300048916 Ga0496113_0457548 Ga0496113_0457548_482_904 140
730 3300048917 Ga0496114_0140191 Ga0496114_0140191_154_576 140
731 3300048917 Ga0496114_0341252 Ga0496114_0341252_878_1300 140
732 3300048917 Ga0496114_0554151 Ga0496114_0554151_464_886 140
733 3300048917 Ga0496114_1015393 Ga0496114_1015393_255_677 140
734 3300048918 Ga0496115_0384653 Ga0496115_0384653_508_930 140
735 3300048918 Ga0496115_0478147 Ga0496115_0478147_142_564 140
736 3300048918 Ga0496115_0709019 Ga0496115_0709019_176_598 140
737 3300049570 Ga0501033_0117890 Ga0501033_0117890_459_881 140
738 3300049573 Ga0501037_0070898 Ga0501037_0070898_1249_1671 140
739 3300049574 Ga0501038_0294201 Ga0501038_0294201_497_919 140
740 3300049582 Ga0501048_0399836 Ga0501048_0399836_389_811 140
741 3300049822 Ga0501035_0452069 Ga0501035_0452069_224_646 140
742 3300049823 Ga0501044_0483871 Ga0501044_0483871_302_724 140
743 3300050508 nmdc:mga09592_410658_c1 nmdc:mga09592_410658_c1_560_982 140
744 3300050511 nmdc:mga08y16_466759_c1 nmdc:mga08y16_466759_c1_362_784 140
745 3300050512 nmdc:mga0n895_469363_c1 nmdc:mga0n895_469363_c1_728_1150 140
746 3300050512 nmdc:mga0n895_540501_c1 nmdc:mga0n895_540501_c1_295_717 140
747 3300050513 nmdc:mga0rr50_1206431_c1 nmdc:mga0rr50_1206431_c1_101_523 140
748 3300050513 nmdc:mga0rr50_124553_c1 nmdc:mga0rr50_124553_c1_1180_1602 140
749 3300050513 nmdc:mga0rr50_576464_c1 nmdc:mga0rr50_576464_c1_246_668 140
750 3300050514 nmdc:mga08x19_242467_c1 nmdc:mga08x19_242467_c1_484_906 140
751 3300050514 nmdc:mga08x19_264305_c1 nmdc:mga08x19_264305_c1_514_936 140
752 3300050515 nmdc:mga0a205_497154_c1 nmdc:mga0a205_497154_c1_131_553 140
753 3300053077 Ga0495601_0287601 Ga0495601_0287601_344_766 140
754 3300053077 Ga0495601_0339924 Ga0495601_0339924_408_830 140
755 3300053078 Ga0495612_0127335 Ga0495612_0127335_545_967 140
756 3300053078 Ga0495612_0376203 Ga0495612_0376203_119_541 140
757 3300053083 Ga0495655_0063886 Ga0495655_0063886_143_565 140
758 3300053083 Ga0495655_0077113 Ga0495655_0077113_274_696 140
759 3300053084 Ga0495595_0264512 Ga0495595_0264512_25_447 140
760 3300053084 Ga0495595_0402811 Ga0495595_0402811_167_589 140
761 3300053085 Ga0495619_0354047 Ga0495619_0354047_530_952 140
762 3300061719 Ga0466962_0166594 Ga0466962_0166594_564_986 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13340

DUF4096

Putative transposase of IS4/5 family (DUF4096)

21

94

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cob-assembly1.cif.gz_A solution structures of the hth domain of human lcor protein 0.5681 33 80
2cob-assembly1.cif.gz_A solution structures of the hth domain of human lcor protein 0.4154 33 80
5i44-assembly4.cif.gz_G-2 structure of raca-dna complex; p21 form 0.3806 24 73
3n2y-assembly1.cif.gz_B crystal structure of tyrosyl-trna synthetase complexed with p-(2-tetrazolyl)-phenylalanine 0.3231 1 61
5wnw-assembly1.cif.gz_A chaperone spy bound to im7 6-45 ensemble 0.3225 18 110
ID Description Score Start End Superfamily
af_A0A0P0Y3M7_58_149_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.6749 19 83 1.10.472.10
af_Q2EEQ8_1_84_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6064 24 77 3.30.420.10
af_A0A0R0JCF1_1_191_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.6034 24 96 1.10.472.10
af_Q6I5V9_32_135_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.5996 24 93 1.10.472.10
af_Q65WX7_129_225_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.5913 21 99 1.10.472.10
ID Description Score Start End GO Terms
AF-A0A3B1E0D2-F1-model_v4 Mobile element protein 0.9297 15 99
AF-L1L6F1-F1-model_v4 Insertion element IS402-like domain-containing protein 0.9292 15 106
AF-A0A552LQ84-F1-model_v4 Transposase 0.9276 16 107
AF-A0A1I5YUV8-F1-model_v4 Transposase 0.9259 15 100
AF-A0A252EDS8-F1-model_v4 Transposase 0.9249 21 99

Feature Viewer

pLDDT pTM Quality
75.92 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map