F479590
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 761 | 342 | 1522 | 119 |
Family's Representative Sequence
| Representative Sequence | 3300046683|Ga0495658_0019018|Ga0495658_0019018_873_1214 |
| Length | 113 |
| Sequence | MNFDIKTEQLADDVYVISLAGEVDLYTAPEFKQQLLEVIGQGGKQVIVDFSSTTFIDSTTLGVLVGGVKRLRLVCSDRNITKIFEITGLDRVFAIYPTREEAISKLDGVSQPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 54 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 81 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 82 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 83 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 84 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 85 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 86 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 155 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 168 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 169 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 181 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 186 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 194 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 195 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 196 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 198 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 199 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 200 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 201 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 202 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 203 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 204 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 205 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 206 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 207 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 208 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 209 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 210 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 215 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 216 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 217 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 218 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 219 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 220 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 221 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 222 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 223 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 290 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 291 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 292 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 293 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 294 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 324 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 342 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.69 |
| Metatranscriptomes | 1.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.79 |
| Nodule | 0 |
| Rhizoplane | 11.96 |
| Rhizosphere | 86.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 22.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495658_0019018 | 3300046683 | Bacteria | 3580 |
| 2 | JGI25406J46586_10112729 | 3300003203 | Unclassified | 804 |
| 3 | Ga0058860_12021824 | 3300004801 | Unclassified | 618 |
| 4 | Ga0058862_12810309 | 3300004803 | Unclassified | 1310 |
| 5 | Ga0070676_10937045 | 3300005328 | Unclassified | 647 |
| 6 | Ga0070683_100006976 | 3300005329 | Bacteria | 9502 |
| 7 | Ga0070683_100029564 | 3300005329 | Bacteria | 4963 |
| 8 | Ga0070683_100045564 | 3300005329 | Bacteria | 4048 |
| 9 | Ga0070683_100049920 | 3300005329 | Bacteria | 3871 |
| 10 | Ga0070670_100295147 | 3300005331 | Bacteria | 1417 |
| 11 | Ga0070680_100083466 | 3300005336 | Bacteria | 2639 |
| 12 | Ga0070680_100189513 | 3300005336 | Bacteria | 1733 |
| 13 | Ga0070682_100100083 | 3300005337 | Bacteria | 1912 |
| 14 | Ga0070660_100285547 | 3300005339 | Bacteria | 1351 |
| 15 | Ga0070689_101364245 | 3300005340 | Unclassified | 640 |
| 16 | Ga0070691_10023001 | 3300005341 | Bacteria | 2893 |
| 17 | Ga0070687_100915420 | 3300005343 | Bacteria | 630 |
| 18 | Ga0070661_101165410 | 3300005344 | Bacteria | 644 |
| 19 | Ga0070692_10038752 | 3300005345 | Bacteria | 2431 |
| 20 | Ga0070675_100938020 | 3300005354 | Bacteria | 794 |
| 21 | Ga0070675_101293585 | 3300005354 | Unclassified | 672 |
| 22 | Ga0070675_101870252 | 3300005354 | Unclassified | 554 |
| 23 | Ga0070671_100234911 | 3300005355 | Bacteria | 1556 |
| 24 | Ga0070671_100462481 | 3300005355 | Bacteria | 1089 |
| 25 | Ga0070674_100391134 | 3300005356 | Bacteria | 1134 |
| 26 | Ga0070674_101021039 | 3300005356 | Unclassified | 727 |
| 27 | Ga0070674_101865563 | 3300005356 | Bacteria | 546 |
| 28 | Ga0070673_100238543 | 3300005364 | Bacteria | 1580 |
| 29 | Ga0070673_101910646 | 3300005364 | Bacteria | 563 |
| 30 | Ga0070688_100053744 | 3300005365 | Unclassified | 2520 |
| 31 | Ga0070688_100983173 | 3300005365 | Bacteria | 669 |
| 32 | Ga0070659_100904160 | 3300005366 | Unclassified | 772 |
| 33 | Ga0070703_10211616 | 3300005406 | Bacteria | 767 |
| 34 | Ga0070713_100664890 | 3300005436 | Unclassified | 993 |
| 35 | Ga0070701_10293851 | 3300005438 | Bacteria | 996 |
| 36 | Ga0070701_10485083 | 3300005438 | Bacteria | 800 |
| 37 | Ga0070705_100073348 | 3300005440 | Bacteria | 2077 |
| 38 | Ga0070705_100268232 | 3300005440 | Bacteria | 1208 |
| 39 | Ga0070700_101445411 | 3300005441 | Bacteria | 583 |
| 40 | Ga0070694_100526537 | 3300005444 | Unclassified | 944 |
| 41 | Ga0070663_100052047 | 3300005455 | Bacteria | 2919 |
| 42 | Ga0070678_101541092 | 3300005456 | Unclassified | 623 |
| 43 | Ga0070662_100442329 | 3300005457 | Bacteria | 1078 |
| 44 | Ga0070681_10068887 | 3300005458 | Bacteria | 3504 |
| 45 | Ga0068867_101052269 | 3300005459 | Bacteria | 740 |
| 46 | Ga0070706_100203777 | 3300005467 | Unclassified | 1848 |
| 47 | Ga0070707_100260000 | 3300005468 | Unclassified | 1689 |
| 48 | Ga0070679_100024358 | 3300005530 | Bacteria | 5930 |
| 49 | Ga0070684_100013151 | 3300005535 | Bacteria | 6660 |
| 50 | Ga0070684_100037099 | 3300005535 | Bacteria | 4178 |
| 51 | Ga0070684_100055470 | 3300005535 | Bacteria | 3455 |
| 52 | Ga0070684_100077710 | 3300005535 | Bacteria | 2932 |
| 53 | Ga0070684_101731210 | 3300005535 | Bacteria | 590 |
| 54 | Ga0070697_100378669 | 3300005536 | Unclassified | 1225 |
| 55 | Ga0070686_100066866 | 3300005544 | Bacteria | 2340 |
| 56 | Ga0070686_100075115 | 3300005544 | Bacteria | 2222 |
| 57 | Ga0070686_100128315 | 3300005544 | Bacteria | 1751 |
| 58 | Ga0070696_100768870 | 3300005546 | Bacteria | 791 |
| 59 | Ga0070693_100038549 | 3300005547 | Bacteria | 2671 |
| 60 | Ga0070704_100709369 | 3300005549 | Unclassified | 893 |
| 61 | Ga0070664_100148667 | 3300005564 | Bacteria | 2067 |
| 62 | Ga0070664_100151289 | 3300005564 | Bacteria | 2049 |
| 63 | Ga0068857_100161791 | 3300005577 | Bacteria | 2031 |
| 64 | Ga0068857_100818257 | 3300005577 | Bacteria | 890 |
| 65 | Ga0068856_100463160 | 3300005614 | Bacteria | 1288 |
| 66 | Ga0068856_101608547 | 3300005614 | Bacteria | 663 |
| 67 | Ga0070702_100051524 | 3300005615 | Bacteria | 2357 |
| 68 | Ga0068864_100229277 | 3300005618 | Unclassified | 1717 |
| 69 | Ga0068864_102643390 | 3300005618 | Unclassified | 508 |
| 70 | Ga0068863_100727051 | 3300005841 | Bacteria | 988 |
| 71 | Ga0068863_102675797 | 3300005841 | Bacteria | 508 |
| 72 | Ga0081455_10005660 | 3300005937 | Bacteria | 13634 |
| 73 | Ga0081455_10022792 | 3300005937 | Bacteria | 5842 |
| 74 | Ga0081455_10076494 | 3300005937 | Unclassified | 2757 |
| 75 | Ga0081538_10103371 | 3300005981 | Bacteria | 1426 |
| 76 | Ga0081540_1000651 | 3300005983 | Bacteria | 32775 |
| 77 | Ga0081540_1006637 | 3300005983 | Bacteria | 8385 |
| 78 | Ga0081540_1007897 | 3300005983 | Bacteria | 7517 |
| 79 | Ga0081540_1015438 | 3300005983 | Bacteria | 4837 |
| 80 | Ga0081539_10004056 | 3300005985 | Bacteria | 16764 |
| 81 | Ga0081539_10005968 | 3300005985 | Bacteria | 12002 |
| 82 | Ga0075365_10306502 | 3300006038 | Unclassified | 1118 |
| 83 | Ga0075368_10455850 | 3300006042 | Bacteria | 567 |
| 84 | Ga0075432_10002661 | 3300006058 | Bacteria | 5964 |
| 85 | Ga0070715_10001706 | 3300006163 | Bacteria | 6530 |
| 86 | Ga0070716_100813244 | 3300006173 | Bacteria | 725 |
| 87 | Ga0070712_100613563 | 3300006175 | Bacteria | 922 |
| 88 | Ga0075367_10219358 | 3300006178 | Bacteria | 1190 |
| 89 | Ga0068871_101733091 | 3300006358 | Bacteria | 593 |
| 90 | Ga0075428_100210940 | 3300006844 | Bacteria | 2098 |
| 91 | Ga0075428_100498733 | 3300006844 | Unclassified | 1303 |
| 92 | Ga0075430_101175954 | 3300006846 | Bacteria | 631 |
| 93 | Ga0075433_10084366 | 3300006852 | Bacteria | 2804 |
| 94 | Ga0075433_10194878 | 3300006852 | Bacteria | 1802 |
| 95 | Ga0075433_10401321 | 3300006852 | Bacteria | 1209 |
| 96 | Ga0075434_101230397 | 3300006871 | Unclassified | 760 |
| 97 | Ga0075429_100223094 | 3300006880 | Unclassified | 1651 |
| 98 | Ga0068865_100054268 | 3300006881 | Bacteria | 2784 |
| 99 | Ga0075436_100023219 | 3300006914 | Bacteria | 4261 |
| 100 | Ga0075436_100531873 | 3300006914 | Bacteria | 862 |
| 101 | Ga0075435_100006240 | 3300007076 | Bacteria | 8418 |
| 102 | Ga0075435_100024522 | 3300007076 | Bacteria | 4683 |
| 103 | Ga0105240_11766911 | 3300009093 | Unclassified | 645 |
| 104 | Ga0111539_10206862 | 3300009094 | Bacteria | 2287 |
| 105 | Ga0111539_10230323 | 3300009094 | Bacteria | 2157 |
| 106 | Ga0111539_10311811 | 3300009094 | Bacteria | 1831 |
| 107 | Ga0105245_10036288 | 3300009098 | Bacteria | 4378 |
| 108 | Ga0105245_10061209 | 3300009098 | Bacteria | 3393 |
| 109 | Ga0105245_10260347 | 3300009098 | Bacteria | 1688 |
| 110 | Ga0105245_10896765 | 3300009098 | Unclassified | 928 |
| 111 | Ga0105245_11083735 | 3300009098 | Bacteria | 847 |
| 112 | Ga0105245_12254103 | 3300009098 | Unclassified | 598 |
| 113 | Ga0105247_10108573 | 3300009101 | Unclassified | 1783 |
| 114 | Ga0114129_10064176 | 3300009147 | Bacteria | 5125 |
| 115 | Ga0114129_10106164 | 3300009147 | Bacteria | 3880 |
| 116 | Ga0114129_10931007 | 3300009147 | Bacteria | 1099 |
| 117 | Ga0105243_10293838 | 3300009148 | Unclassified | 1469 |
| 118 | Ga0105243_10665778 | 3300009148 | Bacteria | 1010 |
| 119 | Ga0105243_11115580 | 3300009148 | Bacteria | 798 |
| 120 | Ga0105241_10039417 | 3300009174 | Bacteria | 3564 |
| 121 | Ga0105241_10043970 | 3300009174 | Bacteria | 3383 |
| 122 | Ga0105242_10065492 | 3300009176 | Bacteria | 2998 |
| 123 | Ga0105242_10294170 | 3300009176 | Bacteria | 1480 |
| 124 | Ga0105242_11894782 | 3300009176 | Bacteria | 636 |
| 125 | Ga0105242_12075103 | 3300009176 | Bacteria | 612 |
| 126 | Ga0105248_10361598 | 3300009177 | Unclassified | 1634 |
| 127 | Ga0105248_10705056 | 3300009177 | Unclassified | 1139 |
| 128 | Ga0105248_11156891 | 3300009177 | Bacteria | 875 |
| 129 | Ga0105249_10169102 | 3300009553 | Unclassified | 2118 |
| 130 | Ga0105249_12254137 | 3300009553 | Unclassified | 617 |
| 131 | Ga0105239_10055093 | 3300010375 | Bacteria | 4362 |
| 132 | Ga0105239_10294630 | 3300010375 | Bacteria | 1827 |
| 133 | Ga0105239_10728302 | 3300010375 | Unclassified | 1135 |
| 134 | Ga0105246_10758024 | 3300011119 | Bacteria | 857 |
| 135 | Ga0105246_11319812 | 3300011119 | Bacteria | 669 |
| 136 | Ga0157328_1016580 | 3300012478 | Bacteria | 581 |
| 137 | Ga0157318_1012606 | 3300012482 | Bacteria | 655 |
| 138 | Ga0157347_1035280 | 3300012502 | Bacteria | 642 |
| 139 | Ga0157342_1031550 | 3300012507 | Bacteria | 670 |
| 140 | Ga0157315_1001906 | 3300012508 | Bacteria | 1237 |
| 141 | Ga0157316_1062537 | 3300012510 | Bacteria | 543 |
| 142 | Ga0157338_1072963 | 3300012515 | Bacteria | 540 |
| 143 | Ga0157373_10226165 | 3300013100 | Unclassified | 1320 |
| 144 | Ga0157374_10184735 | 3300013296 | Unclassified | 2038 |
| 145 | Ga0157378_10248072 | 3300013297 | Bacteria | 1703 |
| 146 | Ga0163162_10407938 | 3300013306 | Unclassified | 1491 |
| 147 | Ga0163162_11177226 | 3300013306 | Bacteria | 870 |
| 148 | Ga0157372_11880023 | 3300013307 | Bacteria | 688 |
| 149 | Ga0157375_10092759 | 3300013308 | Unclassified | 3084 |
| 150 | Ga0157375_10341732 | 3300013308 | Bacteria | 1662 |
| 151 | Ga0157375_12587487 | 3300013308 | Bacteria | 606 |
| 152 | Ga0163163_10059430 | 3300014325 | Bacteria | 3781 |
| 153 | Ga0163163_11357481 | 3300014325 | Bacteria | 773 |
| 154 | Ga0182008_10074307 | 3300014497 | Bacteria | 1673 |
| 155 | Ga0182008_10153967 | 3300014497 | Unclassified | 1154 |
| 156 | Ga0182008_10246029 | 3300014497 | Bacteria | 921 |
| 157 | Ga0157377_10061948 | 3300014745 | Bacteria | 2139 |
| 158 | Ga0157377_10742420 | 3300014745 | Unclassified | 717 |
| 159 | Ga0157379_10873029 | 3300014968 | Bacteria | 852 |
| 160 | Ga0157379_11832882 | 3300014968 | Bacteria | 597 |
| 161 | Ga0157376_10246477 | 3300014969 | Bacteria | 1667 |
| 162 | Ga0157376_10358817 | 3300014969 | Bacteria | 1397 |
| 163 | Ga0163161_11544453 | 3300017792 | Bacteria | 584 |
| 164 | Ga0197907_11141498 | 3300020069 | Bacteria | 1781 |
| 165 | Ga0206356_10807697 | 3300020070 | Bacteria | 805 |
| 166 | Ga0206350_10253165 | 3300020080 | Bacteria | 501 |
| 167 | Ga0206354_10273803 | 3300020081 | Bacteria | 1189 |
| 168 | Ga0224712_10028969 | 3300022467 | Bacteria | 1984 |
| 169 | Ga0224712_10039367 | 3300022467 | Bacteria | 1772 |
| 170 | Ga0207692_10026380 | 3300025898 | Bacteria | 2725 |
| 171 | Ga0207710_10150070 | 3300025900 | Unclassified | 1130 |
| 172 | Ga0207688_10046952 | 3300025901 | Bacteria | 2411 |
| 173 | Ga0207647_10363774 | 3300025904 | Unclassified | 818 |
| 174 | Ga0207699_10394064 | 3300025906 | Bacteria | 985 |
| 175 | Ga0207699_10412712 | 3300025906 | Bacteria | 963 |
| 176 | Ga0207654_10070594 | 3300025911 | Unclassified | 2074 |
| 177 | Ga0207654_10306408 | 3300025911 | Bacteria | 1082 |
| 178 | Ga0207654_10454637 | 3300025911 | Bacteria | 898 |
| 179 | Ga0207707_10174764 | 3300025912 | Unclassified | 1876 |
| 180 | Ga0207707_10374176 | 3300025912 | Unclassified | 1225 |
| 181 | Ga0207671_10317609 | 3300025914 | Unclassified | 1232 |
| 182 | Ga0207693_10004929 | 3300025915 | Bacteria | 11215 |
| 183 | Ga0207693_10053862 | 3300025915 | Bacteria | 3157 |
| 184 | Ga0207693_10081242 | 3300025915 | Bacteria | 2537 |
| 185 | Ga0207693_10450760 | 3300025915 | Bacteria | 1005 |
| 186 | Ga0207693_10632969 | 3300025915 | Bacteria | 832 |
| 187 | Ga0207663_10093942 | 3300025916 | Unclassified | 1997 |
| 188 | Ga0207660_10025295 | 3300025917 | Bacteria | 4028 |
| 189 | Ga0207662_10256322 | 3300025918 | Unclassified | 1150 |
| 190 | Ga0207662_10343257 | 3300025918 | Bacteria | 1001 |
| 191 | Ga0207657_10042356 | 3300025919 | Bacteria | 4018 |
| 192 | Ga0207657_10781221 | 3300025919 | Bacteria | 739 |
| 193 | Ga0207649_10087611 | 3300025920 | Bacteria | 2032 |
| 194 | Ga0207652_10047910 | 3300025921 | Bacteria | 3652 |
| 195 | Ga0207652_10538338 | 3300025921 | Unclassified | 1050 |
| 196 | Ga0207652_10963824 | 3300025921 | Bacteria | 751 |
| 197 | Ga0207646_10001474 | 3300025922 | Bacteria | 29102 |
| 198 | Ga0207694_10335268 | 3300025924 | Bacteria | 1250 |
| 199 | Ga0207650_10663634 | 3300025925 | Bacteria | 879 |
| 200 | Ga0207687_10198309 | 3300025927 | Unclassified | 1567 |
| 201 | Ga0207687_11092933 | 3300025927 | Bacteria | 685 |
| 202 | Ga0207687_11428172 | 3300025927 | Bacteria | 595 |
| 203 | Ga0207700_10403475 | 3300025928 | Bacteria | 1198 |
| 204 | Ga0207700_10660821 | 3300025928 | Bacteria | 932 |
| 205 | Ga0207664_10084355 | 3300025929 | Bacteria | 2591 |
| 206 | Ga0207664_10214689 | 3300025929 | Bacteria | 1666 |
| 207 | Ga0207664_10662564 | 3300025929 | Bacteria | 938 |
| 208 | Ga0207644_10353082 | 3300025931 | Bacteria | 1194 |
| 209 | Ga0207644_10642217 | 3300025931 | Bacteria | 883 |
| 210 | Ga0207690_10062626 | 3300025932 | Bacteria | 2533 |
| 211 | Ga0207690_10529829 | 3300025932 | Unclassified | 956 |
| 212 | Ga0207706_10138334 | 3300025933 | Bacteria | 2142 |
| 213 | Ga0207709_10259336 | 3300025935 | Bacteria | 1274 |
| 214 | Ga0207670_11369017 | 3300025936 | Bacteria | 601 |
| 215 | Ga0207669_10215237 | 3300025937 | Bacteria | 1406 |
| 216 | Ga0207669_10595628 | 3300025937 | Bacteria | 898 |
| 217 | Ga0207704_10014169 | 3300025938 | Bacteria | 4018 |
| 218 | Ga0207704_11035723 | 3300025938 | Unclassified | 695 |
| 219 | Ga0207711_10667739 | 3300025941 | Unclassified | 969 |
| 220 | Ga0207689_10700456 | 3300025942 | Unclassified | 854 |
| 221 | Ga0207661_10008638 | 3300025944 | Bacteria | 7279 |
| 222 | Ga0207661_10044940 | 3300025944 | Bacteria | 3493 |
| 223 | Ga0207661_10086719 | 3300025944 | Bacteria | 2598 |
| 224 | Ga0207661_10330230 | 3300025944 | Bacteria | 1372 |
| 225 | Ga0207679_10277824 | 3300025945 | Bacteria | 1435 |
| 226 | Ga0207679_10868681 | 3300025945 | Bacteria | 824 |
| 227 | Ga0207667_10182851 | 3300025949 | Bacteria | 2152 |
| 228 | Ga0207651_10864992 | 3300025960 | Unclassified | 804 |
| 229 | Ga0207651_11473090 | 3300025960 | Bacteria | 613 |
| 230 | Ga0207712_10497051 | 3300025961 | Bacteria | 1042 |
| 231 | Ga0207640_11193701 | 3300025981 | Bacteria | 676 |
| 232 | Ga0207658_12076882 | 3300025986 | Bacteria | 517 |
| 233 | Ga0207677_10137247 | 3300026023 | Bacteria | 1867 |
| 234 | Ga0207703_11610910 | 3300026035 | Unclassified | 625 |
| 235 | Ga0207639_12082647 | 3300026041 | Bacteria | 529 |
| 236 | Ga0207708_10114937 | 3300026075 | Bacteria | 2092 |
| 237 | Ga0207702_10008111 | 3300026078 | Bacteria | 8887 |
| 238 | Ga0207702_10075650 | 3300026078 | Bacteria | 2909 |
| 239 | Ga0207702_10086051 | 3300026078 | Bacteria | 2740 |
| 240 | Ga0207702_10788566 | 3300026078 | Bacteria | 939 |
| 241 | Ga0207702_11187780 | 3300026078 | Bacteria | 757 |
| 242 | Ga0207641_10589764 | 3300026088 | Bacteria | 1087 |
| 243 | Ga0207648_10737152 | 3300026089 | Bacteria | 915 |
| 244 | Ga0207676_10102783 | 3300026095 | Unclassified | 2373 |
| 245 | Ga0207674_10773581 | 3300026116 | Bacteria | 927 |
| 246 | Ga0207683_10043367 | 3300026121 | Bacteria | 3931 |
| 247 | Ga0207683_11479432 | 3300026121 | Unclassified | 627 |
| 248 | Ga0209966_1064613 | 3300027695 | Bacteria | 795 |
| 249 | Ga0209813_10370166 | 3300027866 | Bacteria | 571 |
| 250 | Ga0207428_10012231 | 3300027907 | Bacteria | 7549 |
| 251 | Ga0207428_10789145 | 3300027907 | Bacteria | 675 |
| 252 | Ga0265319_1070732 | 3300028563 | Bacteria | 1119 |
| 253 | Ga0265318_10047294 | 3300028577 | Unclassified | 1623 |
| 254 | Ga0265318_10115060 | 3300028577 | Bacteria | 989 |
| 255 | Ga0265340_10177341 | 3300031247 | Bacteria | 964 |
| 256 | Ga0307408_100076973 | 3300031548 | Unclassified | 2483 |
| 257 | Ga0265313_10302715 | 3300031595 | Bacteria | 642 |
| 258 | Ga0307405_10028669 | 3300031731 | Unclassified | 3246 |
| 259 | Ga0307410_10236262 | 3300031852 | Bacteria | 1414 |
| 260 | Ga0307410_10579616 | 3300031852 | Bacteria | 933 |
| 261 | Ga0307406_10079358 | 3300031901 | Bacteria | 2177 |
| 262 | Ga0307406_10106826 | 3300031901 | Bacteria | 1918 |
| 263 | Ga0307407_10048284 | 3300031903 | Unclassified | 2422 |
| 264 | Ga0307412_10050177 | 3300031911 | Unclassified | 2753 |
| 265 | Ga0307412_11050720 | 3300031911 | Bacteria | 722 |
| 266 | Ga0307416_100001823 | 3300032002 | Bacteria | 11852 |
| 267 | Ga0307416_100028240 | 3300032002 | Bacteria | 4169 |
| 268 | Ga0307416_100073324 | 3300032002 | Unclassified | 2854 |
| 269 | Ga0307416_100073782 | 3300032002 | Bacteria | 2847 |
| 270 | Ga0307414_10775543 | 3300032004 | Unclassified | 873 |
| 271 | Ga0307411_10437722 | 3300032005 | Bacteria | 1090 |
| 272 | Ga0307415_100000030 | 3300032126 | Bacteria | 60633 |
| 273 | Ga0307415_100400573 | 3300032126 | Bacteria | 1171 |
| 274 | Ga0307415_100641023 | 3300032126 | Bacteria | 951 |
| 275 | Ga0307415_101276380 | 3300032126 | Unclassified | 695 |
| 276 | Ga0373930_0208405 | 3300034816 | Bacteria | 511 |
| 277 | Ga0373958_0023084 | 3300034819 | Bacteria | 1168 |
| 278 | Ga0373934_0068278 | 3300035086 | Bacteria | 1420 |
| 279 | Ga0373940_0164011 | 3300035088 | Bacteria | 715 |
| 280 | Ga0373944_0019387 | 3300035089 | Bacteria | 1951 |
| 281 | Ga0373945_0174020 | 3300035116 | Unclassified | 883 |
| 282 | Ga0373953_0244600 | 3300035117 | Bacteria | 779 |
| 283 | Ga0373956_0047502 | 3300035119 | Unclassified | 1921 |
| 284 | Ga0373960_0077548 | 3300035121 | Bacteria | 1040 |
| 285 | Ga0373943_0002220 | 3300035170 | Bacteria | 8832 |
| 286 | Ga0373946_0015489 | 3300035171 | Bacteria | 2892 |
| 287 | Ga0373955_0124995 | 3300035172 | Unclassified | 1498 |
| 288 | Ga0373962_0347503 | 3300035242 | Bacteria | 536 |
| 289 | Ga0373924_0176746 | 3300035410 | Bacteria | 939 |
| 290 | Ga0373931_0243763 | 3300035691 | Bacteria | 1090 |
| 291 | Ga0373935_0383923 | 3300035692 | Bacteria | 1006 |
| 292 | Ga0373933_0207027 | 3300035724 | Bacteria | 1256 |
| 293 | Ga0373933_0429802 | 3300035724 | Bacteria | 863 |
| 294 | Ga0373947_0853483 | 3300035725 | Bacteria | 622 |
| 295 | Ga0373937_0002538 | 3300036401 | Bacteria | 15163 |
| 296 | Ga0373937_0555722 | 3300036401 | Bacteria | 1090 |
| 297 | Ga0373925_0021760 | 3300037068 | Bacteria | 4674 |
| 298 | Ga0395899_0000773 | 3300037312 | Bacteria | 31614 |
| 299 | Ga0395899_0003571 | 3300037312 | Bacteria | 12313 |
| 300 | Ga0395899_0014353 | 3300037312 | Bacteria | 6047 |
| 301 | Ga0395899_0228463 | 3300037312 | Bacteria | 1286 |
| 302 | Ga0395899_0282047 | 3300037312 | Bacteria | 1130 |
| 303 | Ga0395899_0842762 | 3300037312 | Bacteria | 563 |
| 304 | Ga0395899_0954557 | 3300037312 | Unclassified | 520 |
| 305 | Ga0395900_0001643 | 3300037418 | Bacteria | 26244 |
| 306 | Ga0395900_0002750 | 3300037418 | Bacteria | 19208 |
| 307 | Ga0395900_0013722 | 3300037418 | Bacteria | 8270 |
| 308 | Ga0395900_0014835 | 3300037418 | Bacteria | 7939 |
| 309 | Ga0395900_0085461 | 3300037418 | Unclassified | 3242 |
| 310 | Ga0395900_0093847 | 3300037418 | Bacteria | 3082 |
| 311 | Ga0395900_0203785 | 3300037418 | Bacteria | 2000 |
| 312 | Ga0395900_0219253 | 3300037418 | Unclassified | 1918 |
| 313 | Ga0395900_0230623 | 3300037418 | Bacteria | 1862 |
| 314 | Ga0395900_0289872 | 3300037418 | Unclassified | 1626 |
| 315 | Ga0395900_0354072 | 3300037418 | Bacteria | 1441 |
| 316 | Ga0395900_0434038 | 3300037418 | Bacteria | 1272 |
| 317 | Ga0395900_1440471 | 3300037418 | Unclassified | 601 |
| 318 | Ga0395898_0002319 | 3300037466 | Bacteria | 22735 |
| 319 | Ga0395898_0009102 | 3300037466 | Bacteria | 10458 |
| 320 | Ga0395898_0025098 | 3300037466 | Bacteria | 6009 |
| 321 | Ga0395898_0042682 | 3300037466 | Bacteria | 4473 |
| 322 | Ga0395898_0135324 | 3300037466 | Bacteria | 2359 |
| 323 | Ga0395898_0244663 | 3300037466 | Bacteria | 1711 |
| 324 | Ga0395898_0986738 | 3300037466 | Bacteria | 778 |
| 325 | Ga0395898_1451845 | 3300037466 | Bacteria | 613 |
| 326 | Ga0395905_0004728 | 3300037471 | Bacteria | 14061 |
| 327 | Ga0395905_0013436 | 3300037471 | Bacteria | 7845 |
| 328 | Ga0395905_0026445 | 3300037471 | Bacteria | 5470 |
| 329 | Ga0395905_0045245 | 3300037471 | Bacteria | 4128 |
| 330 | Ga0395905_0144423 | 3300037471 | Bacteria | 2239 |
| 331 | Ga0395905_0145121 | 3300037471 | Bacteria | 2233 |
| 332 | Ga0395905_0671740 | 3300037471 | Unclassified | 938 |
| 333 | Ga0395901_0005663 | 3300038443 | Bacteria | 12641 |
| 334 | Ga0395901_0023398 | 3300038443 | Bacteria | 6333 |
| 335 | Ga0395901_0025324 | 3300038443 | Bacteria | 6090 |
| 336 | Ga0395901_0026305 | 3300038443 | Bacteria | 5974 |
| 337 | Ga0395901_0031450 | 3300038443 | Bacteria | 5473 |
| 338 | Ga0395901_0052437 | 3300038443 | Bacteria | 4239 |
| 339 | Ga0395901_0199895 | 3300038443 | Bacteria | 2095 |
| 340 | Ga0395901_0420064 | 3300038443 | Bacteria | 1371 |
| 341 | Ga0395901_0915012 | 3300038443 | Bacteria | 858 |
| 342 | Ga0395901_1239590 | 3300038443 | Bacteria | 710 |
| 343 | Ga0439439_0002628 | 3300041406 | Bacteria | 3848 |
| 344 | Ga0439461_0120598 | 3300041410 | Bacteria | 655 |
| 345 | Ga0439466_0064855 | 3300041411 | Bacteria | 1171 |
| 346 | Ga0451806_825466 | 3300041462 | Unclassified | 631 |
| 347 | Ga0451847_0445448 | 3300041503 | Bacteria | 1008 |
| 348 | Ga0451855_0622904 | 3300041511 | Unclassified | 800 |
| 349 | Ga0439431_0001261 | 3300041997 | Bacteria | 5552 |
| 350 | Ga0439448_0001283 | 3300042005 | Bacteria | 6421 |
| 351 | Ga0439450_055630 | 3300042008 | Bacteria | 948 |
| 352 | Ga0439455_0078034 | 3300042012 | Bacteria | 897 |
| 353 | Ga0439463_060673 | 3300042016 | Bacteria | 967 |
| 354 | Ga0439463_177251 | 3300042016 | Unclassified | 553 |
| 355 | Ga0450910_066594 | 3300042147 | Bacteria | 614 |
| 356 | Ga0439446_0046630 | 3300042156 | Bacteria | 1287 |
| 357 | Ga0439458_0022602 | 3300042157 | Bacteria | 1462 |
| 358 | Ga0439434_0000964 | 3300042435 | Bacteria | 8283 |
| 359 | Ga0439459_0013397 | 3300042438 | Bacteria | 1475 |
| 360 | Ga0439460_0197426 | 3300042461 | Bacteria | 685 |
| 361 | Ga0466969_0000854 | 3300044656 | Bacteria | 16523 |
| 362 | Ga0466969_0142914 | 3300044656 | Bacteria | 1105 |
| 363 | Ga0466965_0008608 | 3300044683 | Bacteria | 4721 |
| 364 | Ga0466965_0078244 | 3300044683 | Unclassified | 1670 |
| 365 | Ga0466965_0109017 | 3300044683 | Unclassified | 1422 |
| 366 | Ga0466965_0263784 | 3300044683 | Bacteria | 926 |
| 367 | Ga0466966_0005508 | 3300044684 | Bacteria | 8319 |
| 368 | Ga0466966_0080414 | 3300044684 | Bacteria | 2030 |
| 369 | Ga0466966_0285559 | 3300044684 | Unclassified | 992 |
| 370 | Ga0466961_0004980 | 3300044693 | Bacteria | 8354 |
| 371 | Ga0466961_0008360 | 3300044693 | Bacteria | 6591 |
| 372 | Ga0466961_0055402 | 3300044693 | Bacteria | 2528 |
| 373 | Ga0466961_0063001 | 3300044693 | Bacteria | 2356 |
| 374 | Ga0466961_0080897 | 3300044693 | Bacteria | 2056 |
| 375 | Ga0466961_0176192 | 3300044693 | Bacteria | 1328 |
| 376 | Ga0466963_0001284 | 3300044694 | Bacteria | 13335 |
| 377 | Ga0466963_0002433 | 3300044694 | Bacteria | 10415 |
| 378 | Ga0466963_0003860 | 3300044694 | Bacteria | 8650 |
| 379 | Ga0466963_0004960 | 3300044694 | Bacteria | 7762 |
| 380 | Ga0466963_0007986 | 3300044694 | Bacteria | 6333 |
| 381 | Ga0466963_0012642 | 3300044694 | Bacteria | 5171 |
| 382 | Ga0466963_0015118 | 3300044694 | Bacteria | 4772 |
| 383 | Ga0466963_0046173 | 3300044694 | Bacteria | 2871 |
| 384 | Ga0466963_0058284 | 3300044694 | Bacteria | 2574 |
| 385 | Ga0466963_0134417 | 3300044694 | Archaea | 1710 |
| 386 | Ga0466963_0567381 | 3300044694 | Unclassified | 801 |
| 387 | Ga0466964_0001577 | 3300044706 | Bacteria | 7848 |
| 388 | Ga0466964_0040115 | 3300044706 | Unclassified | 1889 |
| 389 | Ga0466964_0390988 | 3300044706 | Unclassified | 724 |
| 390 | Ga0466971_0003583 | 3300044719 | Bacteria | 6634 |
| 391 | Ga0466971_0011788 | 3300044719 | Bacteria | 3829 |
| 392 | Ga0466971_0035161 | 3300044719 | Bacteria | 2246 |
| 393 | Ga0466971_0097157 | 3300044719 | Bacteria | 1351 |
| 394 | Ga0466971_0308103 | 3300044719 | Bacteria | 761 |
| 395 | Ga0466971_0444552 | 3300044719 | Bacteria | 635 |
| 396 | Ga0466968_0011455 | 3300044735 | Bacteria | 3454 |
| 397 | Ga0466968_0037121 | 3300044735 | Unclassified | 2043 |
| 398 | Ga0466968_0075342 | 3300044735 | Unclassified | 1475 |
| 399 | Ga0466968_0121331 | 3300044735 | Unclassified | 1183 |
| 400 | Ga0466968_0368295 | 3300044735 | Unclassified | 700 |
| 401 | Ga0466970_0012064 | 3300044765 | Bacteria | 4414 |
| 402 | Ga0466970_0012611 | 3300044765 | Bacteria | 4324 |
| 403 | Ga0466957_0002456 | 3300044842 | Bacteria | 9949 |
| 404 | Ga0466957_0006430 | 3300044842 | Bacteria | 6635 |
| 405 | Ga0466957_0045638 | 3300044842 | Unclassified | 2658 |
| 406 | Ga0466957_0050892 | 3300044842 | Unclassified | 2521 |
| 407 | Ga0466957_0052115 | 3300044842 | Unclassified | 2491 |
| 408 | Ga0466957_0120588 | 3300044842 | Bacteria | 1671 |
| 409 | Ga0466957_0156552 | 3300044842 | Bacteria | 1477 |
| 410 | Ga0466957_0771766 | 3300044842 | Unclassified | 682 |
| 411 | Ga0466960_0004759 | 3300044901 | Bacteria | 5333 |
| 412 | Ga0466960_0292793 | 3300044901 | Bacteria | 915 |
| 413 | Ga0466959_0001782 | 3300045049 | Bacteria | 13445 |
| 414 | Ga0466959_0003668 | 3300045049 | Bacteria | 10127 |
| 415 | Ga0466959_0005602 | 3300045049 | Bacteria | 8632 |
| 416 | Ga0466959_0053903 | 3300045049 | Bacteria | 2939 |
| 417 | Ga0466959_0062484 | 3300045049 | Unclassified | 2706 |
| 418 | Ga0466959_0200615 | 3300045049 | Unclassified | 1389 |
| 419 | Ga0451576_0035647 | 3300045051 | Bacteria | 5277 |
| 420 | Ga0451576_2482319 | 3300045051 | Unclassified | 530 |
| 421 | Ga0466958_0006859 | 3300045836 | Bacteria | 6226 |
| 422 | Ga0466958_0011620 | 3300045836 | Bacteria | 4962 |
| 423 | Ga0466958_0015231 | 3300045836 | Bacteria | 4402 |
| 424 | Ga0466958_0040297 | 3300045836 | Bacteria | 2807 |
| 425 | Ga0466958_0047668 | 3300045836 | Unclassified | 2587 |
| 426 | Ga0466958_0052880 | 3300045836 | Bacteria | 2462 |
| 427 | Ga0466958_0365916 | 3300045836 | Bacteria | 929 |
| 428 | Ga0466967_0008322 | 3300045976 | Bacteria | 7586 |
| 429 | Ga0466967_0011271 | 3300045976 | Bacteria | 6757 |
| 430 | Ga0466967_0019805 | 3300045976 | Bacteria | 5421 |
| 431 | Ga0466967_0020454 | 3300045976 | Bacteria | 5350 |
| 432 | Ga0466967_0020599 | 3300045976 | Bacteria | 5335 |
| 433 | Ga0466967_0036442 | 3300045976 | Bacteria | 4199 |
| 434 | Ga0466967_0036581 | 3300045976 | Bacteria | 4192 |
| 435 | Ga0466967_0078427 | 3300045976 | Bacteria | 2975 |
| 436 | Ga0466967_0121218 | 3300045976 | Unclassified | 2416 |
| 437 | Ga0466967_0182644 | 3300045976 | Bacteria | 1979 |
| 438 | Ga0466967_0378763 | 3300045976 | Bacteria | 1373 |
| 439 | Ga0466967_0984910 | 3300045976 | Unclassified | 839 |
| 440 | Ga0466967_0986755 | 3300045976 | Unclassified | 838 |
| 441 | Ga0495592_0000037 | 3300046454 | Bacteria | 125143 |
| 442 | Ga0495592_0060684 | 3300046454 | Bacteria | 2781 |
| 443 | Ga0495592_0085746 | 3300046454 | Bacteria | 2269 |
| 444 | Ga0495592_0364500 | 3300046454 | Bacteria | 923 |
| 445 | Ga0495603_0013018 | 3300046455 | Bacteria | 5029 |
| 446 | Ga0495603_0014415 | 3300046455 | Bacteria | 4781 |
| 447 | Ga0495603_0469444 | 3300046455 | Bacteria | 721 |
| 448 | Ga0495603_0479181 | 3300046455 | Unclassified | 713 |
| 449 | Ga0495629_0027531 | 3300046459 | Bacteria | 4036 |
| 450 | Ga0495629_0061041 | 3300046459 | Bacteria | 2634 |
| 451 | Ga0495641_0005321 | 3300046461 | Bacteria | 8733 |
| 452 | Ga0495641_0034340 | 3300046461 | Bacteria | 2398 |
| 453 | Ga0495641_0054990 | 3300046461 | Bacteria | 1808 |
| 454 | Ga0495641_0088515 | 3300046461 | Bacteria | 1385 |
| 455 | Ga0495641_0312320 | 3300046461 | Bacteria | 709 |
| 456 | Ga0495651_0000004 | 3300046462 | Bacteria | 177080 |
| 457 | Ga0495651_0141197 | 3300046462 | Unclassified | 1746 |
| 458 | Ga0495651_0502836 | 3300046462 | Bacteria | 776 |
| 459 | Ga0495651_0566848 | 3300046462 | Bacteria | 720 |
| 460 | Ga0495653_0000847 | 3300046463 | Bacteria | 23560 |
| 461 | Ga0495653_0051992 | 3300046463 | Bacteria | 3142 |
| 462 | Ga0495653_0111178 | 3300046463 | Unclassified | 1968 |
| 463 | Ga0495582_0008211 | 3300046473 | Bacteria | 5762 |
| 464 | Ga0495582_0192970 | 3300046473 | Bacteria | 1162 |
| 465 | Ga0495605_0272111 | 3300046474 | Bacteria | 721 |
| 466 | Ga0495639_0163625 | 3300046475 | Unclassified | 1078 |
| 467 | Ga0495639_0528652 | 3300046475 | Bacteria | 603 |
| 468 | Ga0495662_0013231 | 3300046476 | Bacteria | 4016 |
| 469 | Ga0495664_0021839 | 3300046477 | Bacteria | 3700 |
| 470 | Ga0495594_0002967 | 3300046499 | Bacteria | 8796 |
| 471 | Ga0495594_0191568 | 3300046499 | Bacteria | 1165 |
| 472 | Ga0495596_0157666 | 3300046500 | Bacteria | 882 |
| 473 | Ga0495607_0192250 | 3300046501 | Unclassified | 1016 |
| 474 | Ga0495608_0016362 | 3300046511 | Bacteria | 5131 |
| 475 | Ga0495608_0069183 | 3300046511 | Bacteria | 2307 |
| 476 | Ga0495608_0201054 | 3300046511 | Unclassified | 1255 |
| 477 | Ga0495608_0512244 | 3300046511 | Bacteria | 726 |
| 478 | Ga0495618_0001660 | 3300046514 | Bacteria | 14807 |
| 479 | Ga0495618_0153129 | 3300046514 | Bacteria | 1472 |
| 480 | Ga0495618_0227358 | 3300046514 | Unclassified | 1175 |
| 481 | Ga0495618_0523113 | 3300046514 | Unclassified | 713 |
| 482 | Ga0495628_0001949 | 3300046516 | Bacteria | 18718 |
| 483 | Ga0495628_0020274 | 3300046516 | Bacteria | 5487 |
| 484 | Ga0495628_0557443 | 3300046516 | Bacteria | 822 |
| 485 | Ga0495630_0239468 | 3300046517 | Bacteria | 1386 |
| 486 | Ga0495630_0333985 | 3300046517 | Bacteria | 1159 |
| 487 | Ga0495630_0347254 | 3300046517 | Unclassified | 1135 |
| 488 | Ga0495637_0249004 | 3300046520 | Bacteria | 640 |
| 489 | Ga0495663_0336517 | 3300046525 | Unclassified | 548 |
| 490 | Ga0495666_0042674 | 3300046526 | Bacteria | 2192 |
| 491 | Ga0495666_0062330 | 3300046526 | Bacteria | 1781 |
| 492 | Ga0495652_0000047 | 3300046529 | Bacteria | 121525 |
| 493 | Ga0495652_0016717 | 3300046529 | Bacteria | 6556 |
| 494 | Ga0495652_0325895 | 3300046529 | Bacteria | 1108 |
| 495 | Ga0495665_0052036 | 3300046531 | Unclassified | 2168 |
| 496 | Ga0495665_0103740 | 3300046531 | Bacteria | 1492 |
| 497 | Ga0495640_0039526 | 3300046533 | Bacteria | 3309 |
| 498 | Ga0495640_0333532 | 3300046533 | Unclassified | 938 |
| 499 | Ga0495640_0393144 | 3300046533 | Bacteria | 852 |
| 500 | Ga0495586_0071300 | 3300046535 | Unclassified | 1898 |
| 501 | Ga0495586_0167887 | 3300046535 | Bacteria | 1239 |
| 502 | Ga0495587_0000175 | 3300046536 | Bacteria | 46737 |
| 503 | Ga0495587_0091536 | 3300046536 | Bacteria | 1756 |
| 504 | Ga0495609_0183111 | 3300046538 | Bacteria | 881 |
| 505 | Ga0495645_0000282 | 3300046543 | Bacteria | 37378 |
| 506 | Ga0495645_0043043 | 3300046543 | Bacteria | 3293 |
| 507 | Ga0495645_0253088 | 3300046543 | Bacteria | 1170 |
| 508 | Ga0495667_0044546 | 3300046559 | Bacteria | 2939 |
| 509 | Ga0495667_0080292 | 3300046559 | Unclassified | 2120 |
| 510 | Ga0495656_0389946 | 3300046615 | Bacteria | 727 |
| 511 | Ga0495668_0123773 | 3300046616 | Bacteria | 1415 |
| 512 | Ga0495634_0019802 | 3300046642 | Bacteria | 4777 |
| 513 | Ga0495635_0060079 | 3300046663 | Unclassified | 2613 |
| 514 | Ga0495635_0259867 | 3300046663 | Unclassified | 1169 |
| 515 | Ga0495635_0637512 | 3300046663 | Bacteria | 694 |
| 516 | Ga0495588_0004032 | 3300046674 | Bacteria | 6459 |
| 517 | Ga0495588_0520712 | 3300046674 | Bacteria | 623 |
| 518 | Ga0495657_0020702 | 3300046675 | Bacteria | 4729 |
| 519 | Ga0495657_0166736 | 3300046675 | Unclassified | 1359 |
| 520 | Ga0495657_0228246 | 3300046675 | Unclassified | 1127 |
| 521 | Ga0495657_0900791 | 3300046675 | Bacteria | 503 |
| 522 | Ga0495599_0000073 | 3300046678 | Bacteria | 70685 |
| 523 | Ga0495599_0000767 | 3300046678 | Bacteria | 18059 |
| 524 | Ga0495599_0223299 | 3300046678 | Bacteria | 1152 |
| 525 | Ga0495623_0001239 | 3300046679 | Bacteria | 17338 |
| 526 | Ga0495623_0067925 | 3300046679 | Unclassified | 2224 |
| 527 | Ga0495623_0109820 | 3300046679 | Bacteria | 1673 |
| 528 | Ga0495646_0004862 | 3300046680 | Bacteria | 8490 |
| 529 | Ga0495646_0022665 | 3300046680 | Bacteria | 3959 |
| 530 | Ga0495646_0164779 | 3300046680 | Bacteria | 1225 |
| 531 | Ga0495647_0108889 | 3300046681 | Unclassified | 1154 |
| 532 | Ga0495647_0145391 | 3300046681 | Bacteria | 1013 |
| 533 | Ga0495658_0027770 | 3300046683 | Unclassified | 3049 |
| 534 | Ga0495658_0045320 | 3300046683 | Bacteria | 2468 |
| 535 | Ga0495658_0086012 | 3300046683 | Bacteria | 1854 |
| 536 | Ga0495613_0238997 | 3300046689 | Unclassified | 1270 |
| 537 | Ga0495624_0036141 | 3300046690 | Bacteria | 3187 |
| 538 | Ga0495624_0049142 | 3300046690 | Unclassified | 2675 |
| 539 | Ga0495670_0225950 | 3300046691 | Bacteria | 995 |
| 540 | Ga0495589_0124351 | 3300046794 | Bacteria | 1241 |
| 541 | Ga0495589_0176132 | 3300046794 | Bacteria | 1016 |
| 542 | Ga0495600_0141591 | 3300046809 | Bacteria | 1560 |
| 543 | Ga0495600_0807236 | 3300046809 | Unclassified | 558 |
| 544 | Ga0495581_0013906 | 3300047315 | Bacteria | 4667 |
| 545 | Ga0495604_0000027 | 3300047317 | Bacteria | 143025 |
| 546 | Ga0495604_0026463 | 3300047317 | Bacteria | 4618 |
| 547 | Ga0495604_0085025 | 3300047317 | Bacteria | 2361 |
| 548 | Ga0495674_0030066 | 3300047319 | Bacteria | 4942 |
| 549 | Ga0495674_0178146 | 3300047319 | Unclassified | 1771 |
| 550 | Ga0495674_0198685 | 3300047319 | Bacteria | 1664 |
| 551 | Ga0495674_0414090 | 3300047319 | Bacteria | 1086 |
| 552 | Ga0495676_0001419 | 3300047321 | Bacteria | 20639 |
| 553 | Ga0495676_0034845 | 3300047321 | Bacteria | 4218 |
| 554 | Ga0495676_0684609 | 3300047321 | Unclassified | 664 |
| 555 | Ga0495676_0787035 | 3300047321 | Unclassified | 613 |
| 556 | Ga0495680_0004723 | 3300047322 | Bacteria | 12957 |
| 557 | Ga0495680_0035394 | 3300047322 | Bacteria | 4022 |
| 558 | Ga0495680_0237026 | 3300047322 | Bacteria | 1297 |
| 559 | Ga0495680_0316724 | 3300047322 | Unclassified | 1092 |
| 560 | Ga0495680_0438911 | 3300047322 | Bacteria | 895 |
| 561 | Ga0495675_0000682 | 3300047444 | Bacteria | 21344 |
| 562 | Ga0495675_0310361 | 3300047444 | Unclassified | 935 |
| 563 | Ga0495673_0214099 | 3300047469 | Unclassified | 716 |
| 564 | Ga0495602_0000096 | 3300048088 | Bacteria | 82587 |
| 565 | Ga0495602_0016572 | 3300048088 | Bacteria | 7407 |
| 566 | Ga0495602_0130665 | 3300048088 | Bacteria | 2004 |
| 567 | Ga0495602_0390337 | 3300048088 | Bacteria | 995 |
| 568 | Ga0495614_0298091 | 3300048089 | Bacteria | 745 |
| 569 | Ga0496100_0231396 | 3300048903 | Unclassified | 1360 |
| 570 | Ga0496100_0445438 | 3300048903 | Bacteria | 992 |
| 571 | Ga0496100_0695950 | 3300048903 | Bacteria | 793 |
| 572 | Ga0496100_0709448 | 3300048903 | Unclassified | 785 |
| 573 | Ga0496100_0781728 | 3300048903 | Bacteria | 747 |
| 574 | Ga0496100_1200854 | 3300048903 | Bacteria | 598 |
| 575 | Ga0496100_1234557 | 3300048903 | Bacteria | 590 |
| 576 | Ga0496101_0020475 | 3300048904 | Bacteria | 4530 |
| 577 | Ga0496101_0039463 | 3300048904 | Bacteria | 3358 |
| 578 | Ga0496101_0056281 | 3300048904 | Bacteria | 2843 |
| 579 | Ga0496101_0176598 | 3300048904 | Bacteria | 1643 |
| 580 | Ga0496101_0496442 | 3300048904 | Bacteria | 964 |
| 581 | Ga0496101_1114390 | 3300048904 | Bacteria | 619 |
| 582 | Ga0496101_1474261 | 3300048904 | Unclassified | 530 |
| 583 | Ga0496101_1587569 | 3300048904 | Bacteria | 508 |
| 584 | Ga0496102_0037204 | 3300048905 | Bacteria | 4389 |
| 585 | Ga0496102_0065811 | 3300048905 | Bacteria | 3322 |
| 586 | Ga0496102_0257967 | 3300048905 | Unclassified | 1644 |
| 587 | Ga0496103_0401959 | 3300048906 | Unclassified | 880 |
| 588 | Ga0496103_0615174 | 3300048906 | Bacteria | 691 |
| 589 | Ga0496104_0000188 | 3300048907 | Bacteria | 55678 |
| 590 | Ga0496104_0003064 | 3300048907 | Bacteria | 14407 |
| 591 | Ga0496104_0066765 | 3300048907 | Unclassified | 3415 |
| 592 | Ga0496105_0007757 | 3300048908 | Bacteria | 8327 |
| 593 | Ga0496105_0182206 | 3300048908 | Bacteria | 1719 |
| 594 | Ga0496105_0390880 | 3300048908 | Bacteria | 1105 |
| 595 | Ga0496105_0480976 | 3300048908 | Bacteria | 977 |
| 596 | Ga0496105_0544307 | 3300048908 | Unclassified | 907 |
| 597 | Ga0496105_0961163 | 3300048908 | Bacteria | 641 |
| 598 | Ga0496106_1227603 | 3300048909 | Bacteria | 584 |
| 599 | Ga0496107_0040935 | 3300048910 | Bacteria | 3327 |
| 600 | Ga0496107_0103464 | 3300048910 | Bacteria | 2089 |
| 601 | Ga0496107_0141125 | 3300048910 | Unclassified | 1781 |
| 602 | Ga0496107_0426524 | 3300048910 | Bacteria | 986 |
| 603 | Ga0496107_0496135 | 3300048910 | Bacteria | 906 |
| 604 | Ga0496107_0499454 | 3300048910 | Bacteria | 902 |
| 605 | Ga0496108_0000668 | 3300048911 | Bacteria | 26451 |
| 606 | Ga0496108_0013244 | 3300048911 | Bacteria | 6720 |
| 607 | Ga0496108_0184385 | 3300048911 | Unclassified | 1808 |
| 608 | Ga0496108_0201097 | 3300048911 | Bacteria | 1729 |
| 609 | Ga0496108_0590566 | 3300048911 | Unclassified | 968 |
| 610 | Ga0496109_0002551 | 3300048912 | Bacteria | 15262 |
| 611 | Ga0496109_0002742 | 3300048912 | Bacteria | 14774 |
| 612 | Ga0496109_0077809 | 3300048912 | Unclassified | 3053 |
| 613 | Ga0496109_0099764 | 3300048912 | Bacteria | 2694 |
| 614 | Ga0496109_0106258 | 3300048912 | Bacteria | 2607 |
| 615 | Ga0496109_0496107 | 3300048912 | Bacteria | 1152 |
| 616 | Ga0496109_0580672 | 3300048912 | Unclassified | 1056 |
| 617 | Ga0496109_0692654 | 3300048912 | Bacteria | 956 |
| 618 | Ga0496109_0885923 | 3300048912 | Unclassified | 830 |
| 619 | Ga0496110_0004148 | 3300048913 | Bacteria | 11199 |
| 620 | Ga0496110_0018055 | 3300048913 | Bacteria | 5908 |
| 621 | Ga0496110_0042430 | 3300048913 | Unclassified | 3970 |
| 622 | Ga0496110_0098835 | 3300048913 | Bacteria | 2616 |
| 623 | Ga0496110_0117547 | 3300048913 | Bacteria | 2394 |
| 624 | Ga0496110_0193104 | 3300048913 | Unclassified | 1849 |
| 625 | Ga0496110_0197319 | 3300048913 | Bacteria | 1828 |
| 626 | Ga0496110_0514219 | 3300048913 | Bacteria | 1089 |
| 627 | Ga0496110_0684432 | 3300048913 | Unclassified | 926 |
| 628 | Ga0496110_1031782 | 3300048913 | Bacteria | 730 |
| 629 | Ga0496111_0000433 | 3300048914 | Bacteria | 21184 |
| 630 | Ga0496111_0001044 | 3300048914 | Bacteria | 15252 |
| 631 | Ga0496111_0007530 | 3300048914 | Bacteria | 7143 |
| 632 | Ga0496111_0069135 | 3300048914 | Bacteria | 2568 |
| 633 | Ga0496111_0154482 | 3300048914 | Bacteria | 1703 |
| 634 | Ga0496111_0157688 | 3300048914 | Unclassified | 1684 |
| 635 | Ga0496111_0260646 | 3300048914 | Bacteria | 1286 |
| 636 | Ga0496112_0001632 | 3300048915 | Bacteria | 17371 |
| 637 | Ga0496112_0003066 | 3300048915 | Bacteria | 13688 |
| 638 | Ga0496112_0014189 | 3300048915 | Bacteria | 7384 |
| 639 | Ga0496112_0129922 | 3300048915 | Bacteria | 2490 |
| 640 | Ga0496112_0215994 | 3300048915 | Bacteria | 1874 |
| 641 | Ga0496112_0222346 | 3300048915 | Bacteria | 1844 |
| 642 | Ga0496112_0250127 | 3300048915 | Bacteria | 1724 |
| 643 | Ga0496112_1260218 | 3300048915 | Unclassified | 655 |
| 644 | Ga0496112_1753437 | 3300048915 | Bacteria | 533 |
| 645 | Ga0496113_0002756 | 3300048916 | Bacteria | 10328 |
| 646 | Ga0496113_0003146 | 3300048916 | Bacteria | 9821 |
| 647 | Ga0496113_0147536 | 3300048916 | Bacteria | 1854 |
| 648 | Ga0496113_0156979 | 3300048916 | Unclassified | 1797 |
| 649 | Ga0496113_0184337 | 3300048916 | Bacteria | 1655 |
| 650 | Ga0496113_0555207 | 3300048916 | Bacteria | 921 |
| 651 | Ga0496114_0003843 | 3300048917 | Bacteria | 11583 |
| 652 | Ga0496114_0042747 | 3300048917 | Bacteria | 3756 |
| 653 | Ga0496114_0048797 | 3300048917 | Bacteria | 3522 |
| 654 | Ga0496114_0115877 | 3300048917 | Unclassified | 2299 |
| 655 | Ga0496114_0483643 | 3300048917 | Bacteria | 1095 |
| 656 | Ga0496115_0051449 | 3300048918 | Bacteria | 3303 |
| 657 | Ga0496115_0757043 | 3300048918 | Unclassified | 759 |
| 658 | Ga0496115_0967860 | 3300048918 | Bacteria | 652 |
| 659 | Ga0501031_0036551 | 3300049568 | Bacteria | 3203 |
| 660 | Ga0501032_0045950 | 3300049569 | Bacteria | 2952 |
| 661 | Ga0501032_0211245 | 3300049569 | Unclassified | 1265 |
| 662 | Ga0501032_0762723 | 3300049569 | Bacteria | 612 |
| 663 | Ga0501033_0097624 | 3300049570 | Bacteria | 2146 |
| 664 | Ga0501036_0000770 | 3300049572 | Bacteria | 23736 |
| 665 | Ga0501036_0055061 | 3300049572 | Bacteria | 3370 |
| 666 | Ga0501037_0112147 | 3300049573 | Bacteria | 1964 |
| 667 | Ga0501038_0468337 | 3300049574 | Bacteria | 967 |
| 668 | Ga0501039_0011070 | 3300049575 | Bacteria | 6876 |
| 669 | Ga0501039_0179899 | 3300049575 | Bacteria | 1663 |
| 670 | Ga0501040_0007199 | 3300049576 | Bacteria | 7204 |
| 671 | Ga0501040_0083417 | 3300049576 | Bacteria | 2216 |
| 672 | Ga0501040_0492929 | 3300049576 | Bacteria | 883 |
| 673 | Ga0501041_0010035 | 3300049577 | Bacteria | 5579 |
| 674 | Ga0501042_0006065 | 3300049578 | Bacteria | 7829 |
| 675 | Ga0501042_0028128 | 3300049578 | Bacteria | 3957 |
| 676 | Ga0501042_0450932 | 3300049578 | Bacteria | 933 |
| 677 | Ga0501043_0173071 | 3300049579 | Unclassified | 1684 |
| 678 | Ga0501046_0135882 | 3300049580 | Unclassified | 1862 |
| 679 | Ga0501046_0312952 | 3300049580 | Bacteria | 1145 |
| 680 | Ga0501048_0001984 | 3300049582 | Bacteria | 15558 |
| 681 | Ga0501048_0069560 | 3300049582 | Bacteria | 2486 |
| 682 | Ga0501067_0002903 | 3300049583 | Bacteria | 9441 |
| 683 | Ga0501067_0017901 | 3300049583 | Bacteria | 3923 |
| 684 | Ga0501067_0080948 | 3300049583 | Unclassified | 1800 |
| 685 | Ga0501067_0118605 | 3300049583 | Unclassified | 1472 |
| 686 | Ga0501068_0149260 | 3300049584 | Bacteria | 1468 |
| 687 | Ga0501068_0289186 | 3300049584 | Bacteria | 1048 |
| 688 | Ga0501069_0014617 | 3300049585 | Bacteria | 4197 |
| 689 | Ga0501069_0222893 | 3300049585 | Unclassified | 1096 |
| 690 | Ga0501069_0302899 | 3300049585 | Bacteria | 937 |
| 691 | Ga0501070_0163887 | 3300049586 | Bacteria | 1832 |
| 692 | Ga0501070_0188314 | 3300049586 | Unclassified | 1697 |
| 693 | Ga0501070_0323312 | 3300049586 | Unclassified | 1254 |
| 694 | Ga0501071_0000033 | 3300049587 | Bacteria | 45630 |
| 695 | Ga0501072_0001794 | 3300049588 | Bacteria | 15975 |
| 696 | Ga0501072_0411051 | 3300049588 | Bacteria | 1073 |
| 697 | Ga0501072_0559603 | 3300049588 | Unclassified | 903 |
| 698 | Ga0501073_0389051 | 3300049589 | Bacteria | 963 |
| 699 | Ga0501074_0030910 | 3300049590 | Bacteria | 3880 |
| 700 | Ga0501074_0384754 | 3300049590 | Unclassified | 995 |
| 701 | Ga0501075_0005674 | 3300049591 | Bacteria | 8541 |
| 702 | Ga0501075_0011661 | 3300049591 | Bacteria | 6226 |
| 703 | Ga0501076_0001287 | 3300049592 | Bacteria | 16716 |
| 704 | Ga0501076_0228610 | 3300049592 | Bacteria | 1521 |
| 705 | Ga0501077_0000995 | 3300049593 | Bacteria | 17078 |
| 706 | Ga0501077_0014798 | 3300049593 | Bacteria | 4903 |
| 707 | Ga0501079_0018965 | 3300049741 | Bacteria | 5255 |
| 708 | Ga0501079_0331416 | 3300049741 | Unclassified | 1192 |
| 709 | Ga0501080_0012793 | 3300049742 | Bacteria | 7698 |
| 710 | Ga0501080_0407934 | 3300049742 | Bacteria | 1222 |
| 711 | Ga0501081_0125357 | 3300049743 | Unclassified | 1831 |
| 712 | Ga0501081_0175915 | 3300049743 | Bacteria | 1547 |
| 713 | Ga0501035_0016577 | 3300049822 | Bacteria | 6794 |
| 714 | Ga0501045_0012164 | 3300049824 | Bacteria | 6058 |
| 715 | Ga0501045_0136720 | 3300049824 | Bacteria | 1822 |
| 716 | nmdc:mga0yw44_170690_c1 | 3300050492 | Unclassified | 1428 |
| 717 | nmdc:mga04h51_316921_c1 | 3300050495 | Bacteria | 638 |
| 718 | nmdc:mga05p37_1066546_c1 | 3300050507 | Bacteria | 850 |
| 719 | nmdc:mga05p37_143019_c1 | 3300050507 | Bacteria | 2930 |
| 720 | nmdc:mga05p37_362777_c1 | 3300050507 | Unclassified | 1703 |
| 721 | nmdc:mga09592_1026347_c1 | 3300050508 | Bacteria | 688 |
| 722 | nmdc:mga09592_711026_c1 | 3300050508 | Unclassified | 854 |
| 723 | nmdc:mga06r32_96096_c1 | 3300050510 | Bacteria | 2901 |
| 724 | nmdc:mga08y16_116477_c1 | 3300050511 | Bacteria | 2781 |
| 725 | nmdc:mga08y16_213637_c1 | 3300050511 | Bacteria | 1997 |
| 726 | nmdc:mga08y16_260103_c1 | 3300050511 | Bacteria | 1792 |
| 727 | nmdc:mga08y16_484921_c1 | 3300050511 | Unclassified | 1258 |
| 728 | nmdc:mga0n895_31683_c1 | 3300050512 | Bacteria | 5066 |
| 729 | nmdc:mga0rr50_106015_c1 | 3300050513 | Bacteria | 2217 |
| 730 | nmdc:mga08x19_85247_c1 | 3300050514 | Bacteria | 2079 |
| 731 | nmdc:mga0a205_104893_c1 | 3300050515 | Bacteria | 2726 |
| 732 | nmdc:mga0a205_112448_c1 | 3300050515 | Bacteria | 2622 |
| 733 | nmdc:mga0a205_1199004_c1 | 3300050515 | Bacteria | 607 |
| 734 | nmdc:mga0a205_301830_c1 | 3300050515 | Bacteria | 1186 |
| 735 | Ga0495601_0000265 | 3300053077 | Bacteria | 28256 |
| 736 | Ga0495601_0139403 | 3300053077 | Unclassified | 1581 |
| 737 | Ga0495601_0179074 | 3300053077 | Bacteria | 1386 |
| 738 | Ga0495601_0464393 | 3300053077 | Bacteria | 818 |
| 739 | Ga0495601_0607380 | 3300053077 | Bacteria | 701 |
| 740 | Ga0495612_0149897 | 3300053078 | Bacteria | 1014 |
| 741 | Ga0495595_0221901 | 3300053084 | Unclassified | 943 |
| 742 | Ga0495595_0655274 | 3300053084 | Unclassified | 537 |
| 743 | Ga0495619_0005816 | 3300053085 | Bacteria | 7815 |
| 744 | Ga0495619_0032629 | 3300053085 | Bacteria | 3379 |
| 745 | Ga0495619_0169720 | 3300053085 | Bacteria | 1508 |
| 746 | Ga0495619_0241225 | 3300053085 | Unclassified | 1252 |
| 747 | Ga0495619_0584897 | 3300053085 | Bacteria | 764 |
| 748 | Ga0501084_0018143 | 3300054114 | Bacteria | 5861 |
| 749 | Ga0587080_128197 | 3300059503 | Bacteria | 569 |
| 750 | Ga0587075_105481 | 3300059644 | Unclassified | 567 |
| 751 | Ga0501082_0009411 | 3300060353 | Bacteria | 8412 |
| 752 | Ga0501082_0630045 | 3300060353 | Unclassified | 938 |
| 753 | Ga0501082_1918038 | 3300060353 | Bacteria | 516 |
| 754 | Ga0466962_0000202 | 3300061719 | Bacteria | 24851 |
| 755 | Ga0466962_0000333 | 3300061719 | Bacteria | 20176 |
| 756 | Ga0466962_0014870 | 3300061719 | Bacteria | 3750 |
| 757 | Ga0466962_0060360 | 3300061719 | Unclassified | 1810 |
| 758 | Ga0530510_0020786 | 3300061734 | Bacteria | 4668 |
| 759 | Ga0530510_0031296 | 3300061734 | Bacteria | 3825 |
| 760 | Ga0530510_0282986 | 3300061734 | Bacteria | 1239 |
| 761 | Ga0530510_0285782 | 3300061734 | Unclassified | 1233 |
| 762 | Ga0495658_0019018 | |||
| 763 | JGI25406J46586_10112729 | |||
| 764 | Ga0058860_12021824 | |||
| 765 | Ga0058862_12810309 | |||
| 766 | Ga0070676_10937045 | |||
| 767 | Ga0070683_100006976 | |||
| 768 | Ga0070683_100029564 | |||
| 769 | Ga0070683_100045564 | |||
| 770 | Ga0070683_100049920 | |||
| 771 | Ga0070670_100295147 | |||
| 772 | Ga0070680_100083466 | |||
| 773 | Ga0070680_100189513 | |||
| 774 | Ga0070682_100100083 | |||
| 775 | Ga0070660_100285547 | |||
| 776 | Ga0070689_101364245 | |||
| 777 | Ga0070691_10023001 | |||
| 778 | Ga0070687_100915420 | |||
| 779 | Ga0070661_101165410 | |||
| 780 | Ga0070692_10038752 | |||
| 781 | Ga0070675_100938020 | |||
| 782 | Ga0070675_101293585 | |||
| 783 | Ga0070675_101870252 | |||
| 784 | Ga0070671_100234911 | |||
| 785 | Ga0070671_100462481 | |||
| 786 | Ga0070674_100391134 | |||
| 787 | Ga0070674_101021039 | |||
| 788 | Ga0070674_101865563 | |||
| 789 | Ga0070673_100238543 | |||
| 790 | Ga0070673_101910646 | |||
| 791 | Ga0070688_100053744 | |||
| 792 | Ga0070688_100983173 | |||
| 793 | Ga0070659_100904160 | |||
| 794 | Ga0070703_10211616 | |||
| 795 | Ga0070713_100664890 | |||
| 796 | Ga0070701_10293851 | |||
| 797 | Ga0070701_10485083 | |||
| 798 | Ga0070705_100073348 | |||
| 799 | Ga0070705_100268232 | |||
| 800 | Ga0070700_101445411 | |||
| 801 | Ga0070694_100526537 | |||
| 802 | Ga0070663_100052047 | |||
| 803 | Ga0070678_101541092 | |||
| 804 | Ga0070662_100442329 | |||
| 805 | Ga0070681_10068887 | |||
| 806 | Ga0068867_101052269 | |||
| 807 | Ga0070706_100203777 | |||
| 808 | Ga0070707_100260000 | |||
| 809 | Ga0070679_100024358 | |||
| 810 | Ga0070684_100013151 | |||
| 811 | Ga0070684_100037099 | |||
| 812 | Ga0070684_100055470 | |||
| 813 | Ga0070684_100077710 | |||
| 814 | Ga0070684_101731210 | |||
| 815 | Ga0070697_100378669 | |||
| 816 | Ga0070686_100066866 | |||
| 817 | Ga0070686_100075115 | |||
| 818 | Ga0070686_100128315 | |||
| 819 | Ga0070696_100768870 | |||
| 820 | Ga0070693_100038549 | |||
| 821 | Ga0070704_100709369 | |||
| 822 | Ga0070664_100148667 | |||
| 823 | Ga0070664_100151289 | |||
| 824 | Ga0068857_100161791 | |||
| 825 | Ga0068857_100818257 | |||
| 826 | Ga0068856_100463160 | |||
| 827 | Ga0068856_101608547 | |||
| 828 | Ga0070702_100051524 | |||
| 829 | Ga0068864_100229277 | |||
| 830 | Ga0068864_102643390 | |||
| 831 | Ga0068863_100727051 | |||
| 832 | Ga0068863_102675797 | |||
| 833 | Ga0081455_10005660 | |||
| 834 | Ga0081455_10022792 | |||
| 835 | Ga0081455_10076494 | |||
| 836 | Ga0081538_10103371 | |||
| 837 | Ga0081540_1000651 | |||
| 838 | Ga0081540_1006637 | |||
| 839 | Ga0081540_1007897 | |||
| 840 | Ga0081540_1015438 | |||
| 841 | Ga0081539_10004056 | |||
| 842 | Ga0081539_10005968 | |||
| 843 | Ga0075365_10306502 | |||
| 844 | Ga0075368_10455850 | |||
| 845 | Ga0075432_10002661 | |||
| 846 | Ga0070715_10001706 | |||
| 847 | Ga0070716_100813244 | |||
| 848 | Ga0070712_100613563 | |||
| 849 | Ga0075367_10219358 | |||
| 850 | Ga0068871_101733091 | |||
| 851 | Ga0075428_100210940 | |||
| 852 | Ga0075428_100498733 | |||
| 853 | Ga0075430_101175954 | |||
| 854 | Ga0075433_10084366 | |||
| 855 | Ga0075433_10194878 | |||
| 856 | Ga0075433_10401321 | |||
| 857 | Ga0075434_101230397 | |||
| 858 | Ga0075429_100223094 | |||
| 859 | Ga0068865_100054268 | |||
| 860 | Ga0075436_100023219 | |||
| 861 | Ga0075436_100531873 | |||
| 862 | Ga0075435_100006240 | |||
| 863 | Ga0075435_100024522 | |||
| 864 | Ga0105240_11766911 | |||
| 865 | Ga0111539_10206862 | |||
| 866 | Ga0111539_10230323 | |||
| 867 | Ga0111539_10311811 | |||
| 868 | Ga0105245_10036288 | |||
| 869 | Ga0105245_10061209 | |||
| 870 | Ga0105245_10260347 | |||
| 871 | Ga0105245_10896765 | |||
| 872 | Ga0105245_11083735 | |||
| 873 | Ga0105245_12254103 | |||
| 874 | Ga0105247_10108573 | |||
| 875 | Ga0114129_10064176 | |||
| 876 | Ga0114129_10106164 | |||
| 877 | Ga0114129_10931007 | |||
| 878 | Ga0105243_10293838 | |||
| 879 | Ga0105243_10665778 | |||
| 880 | Ga0105243_11115580 | |||
| 881 | Ga0105241_10039417 | |||
| 882 | Ga0105241_10043970 | |||
| 883 | Ga0105242_10065492 | |||
| 884 | Ga0105242_10294170 | |||
| 885 | Ga0105242_11894782 | |||
| 886 | Ga0105242_12075103 | |||
| 887 | Ga0105248_10361598 | |||
| 888 | Ga0105248_10705056 | |||
| 889 | Ga0105248_11156891 | |||
| 890 | Ga0105249_10169102 | |||
| 891 | Ga0105249_12254137 | |||
| 892 | Ga0105239_10055093 | |||
| 893 | Ga0105239_10294630 | |||
| 894 | Ga0105239_10728302 | |||
| 895 | Ga0105246_10758024 | |||
| 896 | Ga0105246_11319812 | |||
| 897 | Ga0157328_1016580 | |||
| 898 | Ga0157318_1012606 | |||
| 899 | Ga0157347_1035280 | |||
| 900 | Ga0157342_1031550 | |||
| 901 | Ga0157315_1001906 | |||
| 902 | Ga0157316_1062537 | |||
| 903 | Ga0157338_1072963 | |||
| 904 | Ga0157373_10226165 | |||
| 905 | Ga0157374_10184735 | |||
| 906 | Ga0157378_10248072 | |||
| 907 | Ga0163162_10407938 | |||
| 908 | Ga0163162_11177226 | |||
| 909 | Ga0157372_11880023 | |||
| 910 | Ga0157375_10092759 | |||
| 911 | Ga0157375_10341732 | |||
| 912 | Ga0157375_12587487 | |||
| 913 | Ga0163163_10059430 | |||
| 914 | Ga0163163_11357481 | |||
| 915 | Ga0182008_10074307 | |||
| 916 | Ga0182008_10153967 | |||
| 917 | Ga0182008_10246029 | |||
| 918 | Ga0157377_10061948 | |||
| 919 | Ga0157377_10742420 | |||
| 920 | Ga0157379_10873029 | |||
| 921 | Ga0157379_11832882 | |||
| 922 | Ga0157376_10246477 | |||
| 923 | Ga0157376_10358817 | |||
| 924 | Ga0163161_11544453 | |||
| 925 | Ga0197907_11141498 | |||
| 926 | Ga0206356_10807697 | |||
| 927 | Ga0206350_10253165 | |||
| 928 | Ga0206354_10273803 | |||
| 929 | Ga0224712_10028969 | |||
| 930 | Ga0224712_10039367 | |||
| 931 | Ga0207692_10026380 | |||
| 932 | Ga0207710_10150070 | |||
| 933 | Ga0207688_10046952 | |||
| 934 | Ga0207647_10363774 | |||
| 935 | Ga0207699_10394064 | |||
| 936 | Ga0207699_10412712 | |||
| 937 | Ga0207654_10070594 | |||
| 938 | Ga0207654_10306408 | |||
| 939 | Ga0207654_10454637 | |||
| 940 | Ga0207707_10174764 | |||
| 941 | Ga0207707_10374176 | |||
| 942 | Ga0207671_10317609 | |||
| 943 | Ga0207693_10004929 | |||
| 944 | Ga0207693_10053862 | |||
| 945 | Ga0207693_10081242 | |||
| 946 | Ga0207693_10450760 | |||
| 947 | Ga0207693_10632969 | |||
| 948 | Ga0207663_10093942 | |||
| 949 | Ga0207660_10025295 | |||
| 950 | Ga0207662_10256322 | |||
| 951 | Ga0207662_10343257 | |||
| 952 | Ga0207657_10042356 | |||
| 953 | Ga0207657_10781221 | |||
| 954 | Ga0207649_10087611 | |||
| 955 | Ga0207652_10047910 | |||
| 956 | Ga0207652_10538338 | |||
| 957 | Ga0207652_10963824 | |||
| 958 | Ga0207646_10001474 | |||
| 959 | Ga0207694_10335268 | |||
| 960 | Ga0207650_10663634 | |||
| 961 | Ga0207687_10198309 | |||
| 962 | Ga0207687_11092933 | |||
| 963 | Ga0207687_11428172 | |||
| 964 | Ga0207700_10403475 | |||
| 965 | Ga0207700_10660821 | |||
| 966 | Ga0207664_10084355 | |||
| 967 | Ga0207664_10214689 | |||
| 968 | Ga0207664_10662564 | |||
| 969 | Ga0207644_10353082 | |||
| 970 | Ga0207644_10642217 | |||
| 971 | Ga0207690_10062626 | |||
| 972 | Ga0207690_10529829 | |||
| 973 | Ga0207706_10138334 | |||
| 974 | Ga0207709_10259336 | |||
| 975 | Ga0207670_11369017 | |||
| 976 | Ga0207669_10215237 | |||
| 977 | Ga0207669_10595628 | |||
| 978 | Ga0207704_10014169 | |||
| 979 | Ga0207704_11035723 | |||
| 980 | Ga0207711_10667739 | |||
| 981 | Ga0207689_10700456 | |||
| 982 | Ga0207661_10008638 | |||
| 983 | Ga0207661_10044940 | |||
| 984 | Ga0207661_10086719 | |||
| 985 | Ga0207661_10330230 | |||
| 986 | Ga0207679_10277824 | |||
| 987 | Ga0207679_10868681 | |||
| 988 | Ga0207667_10182851 | |||
| 989 | Ga0207651_10864992 | |||
| 990 | Ga0207651_11473090 | |||
| 991 | Ga0207712_10497051 | |||
| 992 | Ga0207640_11193701 | |||
| 993 | Ga0207658_12076882 | |||
| 994 | Ga0207677_10137247 | |||
| 995 | Ga0207703_11610910 | |||
| 996 | Ga0207639_12082647 | |||
| 997 | Ga0207708_10114937 | |||
| 998 | Ga0207702_10008111 | |||
| 999 | Ga0207702_10075650 | |||
| 1000 | Ga0207702_10086051 | |||
| 1001 | Ga0207702_10788566 | |||
| 1002 | Ga0207702_11187780 | |||
| 1003 | Ga0207641_10589764 | |||
| 1004 | Ga0207648_10737152 | |||
| 1005 | Ga0207676_10102783 | |||
| 1006 | Ga0207674_10773581 | |||
| 1007 | Ga0207683_10043367 | |||
| 1008 | Ga0207683_11479432 | |||
| 1009 | Ga0209966_1064613 | |||
| 1010 | Ga0209813_10370166 | |||
| 1011 | Ga0207428_10012231 | |||
| 1012 | Ga0207428_10789145 | |||
| 1013 | Ga0265319_1070732 | |||
| 1014 | Ga0265318_10047294 | |||
| 1015 | Ga0265318_10115060 | |||
| 1016 | Ga0265340_10177341 | |||
| 1017 | Ga0307408_100076973 | |||
| 1018 | Ga0265313_10302715 | |||
| 1019 | Ga0307405_10028669 | |||
| 1020 | Ga0307410_10236262 | |||
| 1021 | Ga0307410_10579616 | |||
| 1022 | Ga0307406_10079358 | |||
| 1023 | Ga0307406_10106826 | |||
| 1024 | Ga0307407_10048284 | |||
| 1025 | Ga0307412_10050177 | |||
| 1026 | Ga0307412_11050720 | |||
| 1027 | Ga0307416_100001823 | |||
| 1028 | Ga0307416_100028240 | |||
| 1029 | Ga0307416_100073324 | |||
| 1030 | Ga0307416_100073782 | |||
| 1031 | Ga0307414_10775543 | |||
| 1032 | Ga0307411_10437722 | |||
| 1033 | Ga0307415_100000030 | |||
| 1034 | Ga0307415_100400573 | |||
| 1035 | Ga0307415_100641023 | |||
| 1036 | Ga0307415_101276380 | |||
| 1037 | Ga0373930_0208405 | |||
| 1038 | Ga0373958_0023084 | |||
| 1039 | Ga0373934_0068278 | |||
| 1040 | Ga0373940_0164011 | |||
| 1041 | Ga0373944_0019387 | |||
| 1042 | Ga0373945_0174020 | |||
| 1043 | Ga0373953_0244600 | |||
| 1044 | Ga0373956_0047502 | |||
| 1045 | Ga0373960_0077548 | |||
| 1046 | Ga0373943_0002220 | |||
| 1047 | Ga0373946_0015489 | |||
| 1048 | Ga0373955_0124995 | |||
| 1049 | Ga0373962_0347503 | |||
| 1050 | Ga0373924_0176746 | |||
| 1051 | Ga0373931_0243763 | |||
| 1052 | Ga0373935_0383923 | |||
| 1053 | Ga0373933_0207027 | |||
| 1054 | Ga0373933_0429802 | |||
| 1055 | Ga0373947_0853483 | |||
| 1056 | Ga0373937_0002538 | |||
| 1057 | Ga0373937_0555722 | |||
| 1058 | Ga0373925_0021760 | |||
| 1059 | Ga0395899_0000773 | |||
| 1060 | Ga0395899_0003571 | |||
| 1061 | Ga0395899_0014353 | |||
| 1062 | Ga0395899_0228463 | |||
| 1063 | Ga0395899_0282047 | |||
| 1064 | Ga0395899_0842762 | |||
| 1065 | Ga0395899_0954557 | |||
| 1066 | Ga0395900_0001643 | |||
| 1067 | Ga0395900_0002750 | |||
| 1068 | Ga0395900_0013722 | |||
| 1069 | Ga0395900_0014835 | |||
| 1070 | Ga0395900_0085461 | |||
| 1071 | Ga0395900_0093847 | |||
| 1072 | Ga0395900_0203785 | |||
| 1073 | Ga0395900_0219253 | |||
| 1074 | Ga0395900_0230623 | |||
| 1075 | Ga0395900_0289872 | |||
| 1076 | Ga0395900_0354072 | |||
| 1077 | Ga0395900_0434038 | |||
| 1078 | Ga0395900_1440471 | |||
| 1079 | Ga0395898_0002319 | |||
| 1080 | Ga0395898_0009102 | |||
| 1081 | Ga0395898_0025098 | |||
| 1082 | Ga0395898_0042682 | |||
| 1083 | Ga0395898_0135324 | |||
| 1084 | Ga0395898_0244663 | |||
| 1085 | Ga0395898_0986738 | |||
| 1086 | Ga0395898_1451845 | |||
| 1087 | Ga0395905_0004728 | |||
| 1088 | Ga0395905_0013436 | |||
| 1089 | Ga0395905_0026445 | |||
| 1090 | Ga0395905_0045245 | |||
| 1091 | Ga0395905_0144423 | |||
| 1092 | Ga0395905_0145121 | |||
| 1093 | Ga0395905_0671740 | |||
| 1094 | Ga0395901_0005663 | |||
| 1095 | Ga0395901_0023398 | |||
| 1096 | Ga0395901_0025324 | |||
| 1097 | Ga0395901_0026305 | |||
| 1098 | Ga0395901_0031450 | |||
| 1099 | Ga0395901_0052437 | |||
| 1100 | Ga0395901_0199895 | |||
| 1101 | Ga0395901_0420064 | |||
| 1102 | Ga0395901_0915012 | |||
| 1103 | Ga0395901_1239590 | |||
| 1104 | Ga0439439_0002628 | |||
| 1105 | Ga0439461_0120598 | |||
| 1106 | Ga0439466_0064855 | |||
| 1107 | Ga0451806_825466 | |||
| 1108 | Ga0451847_0445448 | |||
| 1109 | Ga0451855_0622904 | |||
| 1110 | Ga0439431_0001261 | |||
| 1111 | Ga0439448_0001283 | |||
| 1112 | Ga0439450_055630 | |||
| 1113 | Ga0439455_0078034 | |||
| 1114 | Ga0439463_060673 | |||
| 1115 | Ga0439463_177251 | |||
| 1116 | Ga0450910_066594 | |||
| 1117 | Ga0439446_0046630 | |||
| 1118 | Ga0439458_0022602 | |||
| 1119 | Ga0439434_0000964 | |||
| 1120 | Ga0439459_0013397 | |||
| 1121 | Ga0439460_0197426 | |||
| 1122 | Ga0466969_0000854 | |||
| 1123 | Ga0466969_0142914 | |||
| 1124 | Ga0466965_0008608 | |||
| 1125 | Ga0466965_0078244 | |||
| 1126 | Ga0466965_0109017 | |||
| 1127 | Ga0466965_0263784 | |||
| 1128 | Ga0466966_0005508 | |||
| 1129 | Ga0466966_0080414 | |||
| 1130 | Ga0466966_0285559 | |||
| 1131 | Ga0466961_0004980 | |||
| 1132 | Ga0466961_0008360 | |||
| 1133 | Ga0466961_0055402 | |||
| 1134 | Ga0466961_0063001 | |||
| 1135 | Ga0466961_0080897 | |||
| 1136 | Ga0466961_0176192 | |||
| 1137 | Ga0466963_0001284 | |||
| 1138 | Ga0466963_0002433 | |||
| 1139 | Ga0466963_0003860 | |||
| 1140 | Ga0466963_0004960 | |||
| 1141 | Ga0466963_0007986 | |||
| 1142 | Ga0466963_0012642 | |||
| 1143 | Ga0466963_0015118 | |||
| 1144 | Ga0466963_0046173 | |||
| 1145 | Ga0466963_0058284 | |||
| 1146 | Ga0466963_0134417 | |||
| 1147 | Ga0466963_0567381 | |||
| 1148 | Ga0466964_0001577 | |||
| 1149 | Ga0466964_0040115 | |||
| 1150 | Ga0466964_0390988 | |||
| 1151 | Ga0466971_0003583 | |||
| 1152 | Ga0466971_0011788 | |||
| 1153 | Ga0466971_0035161 | |||
| 1154 | Ga0466971_0097157 | |||
| 1155 | Ga0466971_0308103 | |||
| 1156 | Ga0466971_0444552 | |||
| 1157 | Ga0466968_0011455 | |||
| 1158 | Ga0466968_0037121 | |||
| 1159 | Ga0466968_0075342 | |||
| 1160 | Ga0466968_0121331 | |||
| 1161 | Ga0466968_0368295 | |||
| 1162 | Ga0466970_0012064 | |||
| 1163 | Ga0466970_0012611 | |||
| 1164 | Ga0466957_0002456 | |||
| 1165 | Ga0466957_0006430 | |||
| 1166 | Ga0466957_0045638 | |||
| 1167 | Ga0466957_0050892 | |||
| 1168 | Ga0466957_0052115 | |||
| 1169 | Ga0466957_0120588 | |||
| 1170 | Ga0466957_0156552 | |||
| 1171 | Ga0466957_0771766 | |||
| 1172 | Ga0466960_0004759 | |||
| 1173 | Ga0466960_0292793 | |||
| 1174 | Ga0466959_0001782 | |||
| 1175 | Ga0466959_0003668 | |||
| 1176 | Ga0466959_0005602 | |||
| 1177 | Ga0466959_0053903 | |||
| 1178 | Ga0466959_0062484 | |||
| 1179 | Ga0466959_0200615 | |||
| 1180 | Ga0451576_0035647 | |||
| 1181 | Ga0451576_2482319 | |||
| 1182 | Ga0466958_0006859 | |||
| 1183 | Ga0466958_0011620 | |||
| 1184 | Ga0466958_0015231 | |||
| 1185 | Ga0466958_0040297 | |||
| 1186 | Ga0466958_0047668 | |||
| 1187 | Ga0466958_0052880 | |||
| 1188 | Ga0466958_0365916 | |||
| 1189 | Ga0466967_0008322 | |||
| 1190 | Ga0466967_0011271 | |||
| 1191 | Ga0466967_0019805 | |||
| 1192 | Ga0466967_0020454 | |||
| 1193 | Ga0466967_0020599 | |||
| 1194 | Ga0466967_0036442 | |||
| 1195 | Ga0466967_0036581 | |||
| 1196 | Ga0466967_0078427 | |||
| 1197 | Ga0466967_0121218 | |||
| 1198 | Ga0466967_0182644 | |||
| 1199 | Ga0466967_0378763 | |||
| 1200 | Ga0466967_0984910 | |||
| 1201 | Ga0466967_0986755 | |||
| 1202 | Ga0495592_0000037 | |||
| 1203 | Ga0495592_0060684 | |||
| 1204 | Ga0495592_0085746 | |||
| 1205 | Ga0495592_0364500 | |||
| 1206 | Ga0495603_0013018 | |||
| 1207 | Ga0495603_0014415 | |||
| 1208 | Ga0495603_0469444 | |||
| 1209 | Ga0495603_0479181 | |||
| 1210 | Ga0495629_0027531 | |||
| 1211 | Ga0495629_0061041 | |||
| 1212 | Ga0495641_0005321 | |||
| 1213 | Ga0495641_0034340 | |||
| 1214 | Ga0495641_0054990 | |||
| 1215 | Ga0495641_0088515 | |||
| 1216 | Ga0495641_0312320 | |||
| 1217 | Ga0495651_0000004 | |||
| 1218 | Ga0495651_0141197 | |||
| 1219 | Ga0495651_0502836 | |||
| 1220 | Ga0495651_0566848 | |||
| 1221 | Ga0495653_0000847 | |||
| 1222 | Ga0495653_0051992 | |||
| 1223 | Ga0495653_0111178 | |||
| 1224 | Ga0495582_0008211 | |||
| 1225 | Ga0495582_0192970 | |||
| 1226 | Ga0495605_0272111 | |||
| 1227 | Ga0495639_0163625 | |||
| 1228 | Ga0495639_0528652 | |||
| 1229 | Ga0495662_0013231 | |||
| 1230 | Ga0495664_0021839 | |||
| 1231 | Ga0495594_0002967 | |||
| 1232 | Ga0495594_0191568 | |||
| 1233 | Ga0495596_0157666 | |||
| 1234 | Ga0495607_0192250 | |||
| 1235 | Ga0495608_0016362 | |||
| 1236 | Ga0495608_0069183 | |||
| 1237 | Ga0495608_0201054 | |||
| 1238 | Ga0495608_0512244 | |||
| 1239 | Ga0495618_0001660 | |||
| 1240 | Ga0495618_0153129 | |||
| 1241 | Ga0495618_0227358 | |||
| 1242 | Ga0495618_0523113 | |||
| 1243 | Ga0495628_0001949 | |||
| 1244 | Ga0495628_0020274 | |||
| 1245 | Ga0495628_0557443 | |||
| 1246 | Ga0495630_0239468 | |||
| 1247 | Ga0495630_0333985 | |||
| 1248 | Ga0495630_0347254 | |||
| 1249 | Ga0495637_0249004 | |||
| 1250 | Ga0495663_0336517 | |||
| 1251 | Ga0495666_0042674 | |||
| 1252 | Ga0495666_0062330 | |||
| 1253 | Ga0495652_0000047 | |||
| 1254 | Ga0495652_0016717 | |||
| 1255 | Ga0495652_0325895 | |||
| 1256 | Ga0495665_0052036 | |||
| 1257 | Ga0495665_0103740 | |||
| 1258 | Ga0495640_0039526 | |||
| 1259 | Ga0495640_0333532 | |||
| 1260 | Ga0495640_0393144 | |||
| 1261 | Ga0495586_0071300 | |||
| 1262 | Ga0495586_0167887 | |||
| 1263 | Ga0495587_0000175 | |||
| 1264 | Ga0495587_0091536 | |||
| 1265 | Ga0495609_0183111 | |||
| 1266 | Ga0495645_0000282 | |||
| 1267 | Ga0495645_0043043 | |||
| 1268 | Ga0495645_0253088 | |||
| 1269 | Ga0495667_0044546 | |||
| 1270 | Ga0495667_0080292 | |||
| 1271 | Ga0495656_0389946 | |||
| 1272 | Ga0495668_0123773 | |||
| 1273 | Ga0495634_0019802 | |||
| 1274 | Ga0495635_0060079 | |||
| 1275 | Ga0495635_0259867 | |||
| 1276 | Ga0495635_0637512 | |||
| 1277 | Ga0495588_0004032 | |||
| 1278 | Ga0495588_0520712 | |||
| 1279 | Ga0495657_0020702 | |||
| 1280 | Ga0495657_0166736 | |||
| 1281 | Ga0495657_0228246 | |||
| 1282 | Ga0495657_0900791 | |||
| 1283 | Ga0495599_0000073 | |||
| 1284 | Ga0495599_0000767 | |||
| 1285 | Ga0495599_0223299 | |||
| 1286 | Ga0495623_0001239 | |||
| 1287 | Ga0495623_0067925 | |||
| 1288 | Ga0495623_0109820 | |||
| 1289 | Ga0495646_0004862 | |||
| 1290 | Ga0495646_0022665 | |||
| 1291 | Ga0495646_0164779 | |||
| 1292 | Ga0495647_0108889 | |||
| 1293 | Ga0495647_0145391 | |||
| 1294 | Ga0495658_0027770 | |||
| 1295 | Ga0495658_0045320 | |||
| 1296 | Ga0495658_0086012 | |||
| 1297 | Ga0495613_0238997 | |||
| 1298 | Ga0495624_0036141 | |||
| 1299 | Ga0495624_0049142 | |||
| 1300 | Ga0495670_0225950 | |||
| 1301 | Ga0495589_0124351 | |||
| 1302 | Ga0495589_0176132 | |||
| 1303 | Ga0495600_0141591 | |||
| 1304 | Ga0495600_0807236 | |||
| 1305 | Ga0495581_0013906 | |||
| 1306 | Ga0495604_0000027 | |||
| 1307 | Ga0495604_0026463 | |||
| 1308 | Ga0495604_0085025 | |||
| 1309 | Ga0495674_0030066 | |||
| 1310 | Ga0495674_0178146 | |||
| 1311 | Ga0495674_0198685 | |||
| 1312 | Ga0495674_0414090 | |||
| 1313 | Ga0495676_0001419 | |||
| 1314 | Ga0495676_0034845 | |||
| 1315 | Ga0495676_0684609 | |||
| 1316 | Ga0495676_0787035 | |||
| 1317 | Ga0495680_0004723 | |||
| 1318 | Ga0495680_0035394 | |||
| 1319 | Ga0495680_0237026 | |||
| 1320 | Ga0495680_0316724 | |||
| 1321 | Ga0495680_0438911 | |||
| 1322 | Ga0495675_0000682 | |||
| 1323 | Ga0495675_0310361 | |||
| 1324 | Ga0495673_0214099 | |||
| 1325 | Ga0495602_0000096 | |||
| 1326 | Ga0495602_0016572 | |||
| 1327 | Ga0495602_0130665 | |||
| 1328 | Ga0495602_0390337 | |||
| 1329 | Ga0495614_0298091 | |||
| 1330 | Ga0496100_0231396 | |||
| 1331 | Ga0496100_0445438 | |||
| 1332 | Ga0496100_0695950 | |||
| 1333 | Ga0496100_0709448 | |||
| 1334 | Ga0496100_0781728 | |||
| 1335 | Ga0496100_1200854 | |||
| 1336 | Ga0496100_1234557 | |||
| 1337 | Ga0496101_0020475 | |||
| 1338 | Ga0496101_0039463 | |||
| 1339 | Ga0496101_0056281 | |||
| 1340 | Ga0496101_0176598 | |||
| 1341 | Ga0496101_0496442 | |||
| 1342 | Ga0496101_1114390 | |||
| 1343 | Ga0496101_1474261 | |||
| 1344 | Ga0496101_1587569 | |||
| 1345 | Ga0496102_0037204 | |||
| 1346 | Ga0496102_0065811 | |||
| 1347 | Ga0496102_0257967 | |||
| 1348 | Ga0496103_0401959 | |||
| 1349 | Ga0496103_0615174 | |||
| 1350 | Ga0496104_0000188 | |||
| 1351 | Ga0496104_0003064 | |||
| 1352 | Ga0496104_0066765 | |||
| 1353 | Ga0496105_0007757 | |||
| 1354 | Ga0496105_0182206 | |||
| 1355 | Ga0496105_0390880 | |||
| 1356 | Ga0496105_0480976 | |||
| 1357 | Ga0496105_0544307 | |||
| 1358 | Ga0496105_0961163 | |||
| 1359 | Ga0496106_1227603 | |||
| 1360 | Ga0496107_0040935 | |||
| 1361 | Ga0496107_0103464 | |||
| 1362 | Ga0496107_0141125 | |||
| 1363 | Ga0496107_0426524 | |||
| 1364 | Ga0496107_0496135 | |||
| 1365 | Ga0496107_0499454 | |||
| 1366 | Ga0496108_0000668 | |||
| 1367 | Ga0496108_0013244 | |||
| 1368 | Ga0496108_0184385 | |||
| 1369 | Ga0496108_0201097 | |||
| 1370 | Ga0496108_0590566 | |||
| 1371 | Ga0496109_0002551 | |||
| 1372 | Ga0496109_0002742 | |||
| 1373 | Ga0496109_0077809 | |||
| 1374 | Ga0496109_0099764 | |||
| 1375 | Ga0496109_0106258 | |||
| 1376 | Ga0496109_0496107 | |||
| 1377 | Ga0496109_0580672 | |||
| 1378 | Ga0496109_0692654 | |||
| 1379 | Ga0496109_0885923 | |||
| 1380 | Ga0496110_0004148 | |||
| 1381 | Ga0496110_0018055 | |||
| 1382 | Ga0496110_0042430 | |||
| 1383 | Ga0496110_0098835 | |||
| 1384 | Ga0496110_0117547 | |||
| 1385 | Ga0496110_0193104 | |||
| 1386 | Ga0496110_0197319 | |||
| 1387 | Ga0496110_0514219 | |||
| 1388 | Ga0496110_0684432 | |||
| 1389 | Ga0496110_1031782 | |||
| 1390 | Ga0496111_0000433 | |||
| 1391 | Ga0496111_0001044 | |||
| 1392 | Ga0496111_0007530 | |||
| 1393 | Ga0496111_0069135 | |||
| 1394 | Ga0496111_0154482 | |||
| 1395 | Ga0496111_0157688 | |||
| 1396 | Ga0496111_0260646 | |||
| 1397 | Ga0496112_0001632 | |||
| 1398 | Ga0496112_0003066 | |||
| 1399 | Ga0496112_0014189 | |||
| 1400 | Ga0496112_0129922 | |||
| 1401 | Ga0496112_0215994 | |||
| 1402 | Ga0496112_0222346 | |||
| 1403 | Ga0496112_0250127 | |||
| 1404 | Ga0496112_1260218 | |||
| 1405 | Ga0496112_1753437 | |||
| 1406 | Ga0496113_0002756 | |||
| 1407 | Ga0496113_0003146 | |||
| 1408 | Ga0496113_0147536 | |||
| 1409 | Ga0496113_0156979 | |||
| 1410 | Ga0496113_0184337 | |||
| 1411 | Ga0496113_0555207 | |||
| 1412 | Ga0496114_0003843 | |||
| 1413 | Ga0496114_0042747 | |||
| 1414 | Ga0496114_0048797 | |||
| 1415 | Ga0496114_0115877 | |||
| 1416 | Ga0496114_0483643 | |||
| 1417 | Ga0496115_0051449 | |||
| 1418 | Ga0496115_0757043 | |||
| 1419 | Ga0496115_0967860 | |||
| 1420 | Ga0501031_0036551 | |||
| 1421 | Ga0501032_0045950 | |||
| 1422 | Ga0501032_0211245 | |||
| 1423 | Ga0501032_0762723 | |||
| 1424 | Ga0501033_0097624 | |||
| 1425 | Ga0501036_0000770 | |||
| 1426 | Ga0501036_0055061 | |||
| 1427 | Ga0501037_0112147 | |||
| 1428 | Ga0501038_0468337 | |||
| 1429 | Ga0501039_0011070 | |||
| 1430 | Ga0501039_0179899 | |||
| 1431 | Ga0501040_0007199 | |||
| 1432 | Ga0501040_0083417 | |||
| 1433 | Ga0501040_0492929 | |||
| 1434 | Ga0501041_0010035 | |||
| 1435 | Ga0501042_0006065 | |||
| 1436 | Ga0501042_0028128 | |||
| 1437 | Ga0501042_0450932 | |||
| 1438 | Ga0501043_0173071 | |||
| 1439 | Ga0501046_0135882 | |||
| 1440 | Ga0501046_0312952 | |||
| 1441 | Ga0501048_0001984 | |||
| 1442 | Ga0501048_0069560 | |||
| 1443 | Ga0501067_0002903 | |||
| 1444 | Ga0501067_0017901 | |||
| 1445 | Ga0501067_0080948 | |||
| 1446 | Ga0501067_0118605 | |||
| 1447 | Ga0501068_0149260 | |||
| 1448 | Ga0501068_0289186 | |||
| 1449 | Ga0501069_0014617 | |||
| 1450 | Ga0501069_0222893 | |||
| 1451 | Ga0501069_0302899 | |||
| 1452 | Ga0501070_0163887 | |||
| 1453 | Ga0501070_0188314 | |||
| 1454 | Ga0501070_0323312 | |||
| 1455 | Ga0501071_0000033 | |||
| 1456 | Ga0501072_0001794 | |||
| 1457 | Ga0501072_0411051 | |||
| 1458 | Ga0501072_0559603 | |||
| 1459 | Ga0501073_0389051 | |||
| 1460 | Ga0501074_0030910 | |||
| 1461 | Ga0501074_0384754 | |||
| 1462 | Ga0501075_0005674 | |||
| 1463 | Ga0501075_0011661 | |||
| 1464 | Ga0501076_0001287 | |||
| 1465 | Ga0501076_0228610 | |||
| 1466 | Ga0501077_0000995 | |||
| 1467 | Ga0501077_0014798 | |||
| 1468 | Ga0501079_0018965 | |||
| 1469 | Ga0501079_0331416 | |||
| 1470 | Ga0501080_0012793 | |||
| 1471 | Ga0501080_0407934 | |||
| 1472 | Ga0501081_0125357 | |||
| 1473 | Ga0501081_0175915 | |||
| 1474 | Ga0501035_0016577 | |||
| 1475 | Ga0501045_0012164 | |||
| 1476 | Ga0501045_0136720 | |||
| 1477 | nmdc:mga0yw44_170690_c1 | |||
| 1478 | nmdc:mga04h51_316921_c1 | |||
| 1479 | nmdc:mga05p37_1066546_c1 | |||
| 1480 | nmdc:mga05p37_143019_c1 | |||
| 1481 | nmdc:mga05p37_362777_c1 | |||
| 1482 | nmdc:mga09592_1026347_c1 | |||
| 1483 | nmdc:mga09592_711026_c1 | |||
| 1484 | nmdc:mga06r32_96096_c1 | |||
| 1485 | nmdc:mga08y16_116477_c1 | |||
| 1486 | nmdc:mga08y16_213637_c1 | |||
| 1487 | nmdc:mga08y16_260103_c1 | |||
| 1488 | nmdc:mga08y16_484921_c1 | |||
| 1489 | nmdc:mga0n895_31683_c1 | |||
| 1490 | nmdc:mga0rr50_106015_c1 | |||
| 1491 | nmdc:mga08x19_85247_c1 | |||
| 1492 | nmdc:mga0a205_104893_c1 | |||
| 1493 | nmdc:mga0a205_112448_c1 | |||
| 1494 | nmdc:mga0a205_1199004_c1 | |||
| 1495 | nmdc:mga0a205_301830_c1 | |||
| 1496 | Ga0495601_0000265 | |||
| 1497 | Ga0495601_0139403 | |||
| 1498 | Ga0495601_0179074 | |||
| 1499 | Ga0495601_0464393 | |||
| 1500 | Ga0495601_0607380 | |||
| 1501 | Ga0495612_0149897 | |||
| 1502 | Ga0495595_0221901 | |||
| 1503 | Ga0495595_0655274 | |||
| 1504 | Ga0495619_0005816 | |||
| 1505 | Ga0495619_0032629 | |||
| 1506 | Ga0495619_0169720 | |||
| 1507 | Ga0495619_0241225 | |||
| 1508 | Ga0495619_0584897 | |||
| 1509 | Ga0501084_0018143 | |||
| 1510 | Ga0587080_128197 | |||
| 1511 | Ga0587075_105481 | |||
| 1512 | Ga0501082_0009411 | |||
| 1513 | Ga0501082_0630045 | |||
| 1514 | Ga0501082_1918038 | |||
| 1515 | Ga0466962_0000202 | |||
| 1516 | Ga0466962_0000333 | |||
| 1517 | Ga0466962_0014870 | |||
| 1518 | Ga0466962_0060360 | |||
| 1519 | Ga0530510_0020786 | |||
| 1520 | Ga0530510_0031296 | |||
| 1521 | Ga0530510_0282986 | |||
| 1522 | Ga0530510_0285782 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1th8-assembly1.cif.gz_B | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii | 0.9242 | 2 | 114 |
| 4qtp-assembly3.cif.gz_C | crystal structure of an anti-sigma factor antagonist from mycobacterium paratuberculosis | 0.9114 | 1 | 112 |
| 1til-assembly1.cif.gz_B | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii | 0.9047 | 1 | 114 |
| 3f43-assembly1.cif.gz_A-2 | crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution | 0.9042 | 5 | 112 |
| 6m36-assembly1.cif.gz_H | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.9032 | 2 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tidD00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9166 | 3 | 114 | 3.30.750.24 |
| 4qtpB00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9087 | 2 | 112 | 3.30.750.24 |
| af_P60070_1_106_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9076 | 1 | 106 | 3.30.750.24 |
| af_P60070_1_106_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8918 | 1 | 106 | 3.30.750.24 |
| af_A0A0N7KGR6_2_88_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8917 | 43 | 119 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9GVD6-F1-model_v4 | Anti-sigma factor antagonist | 0.9802 | 1 | 115 |
GO:0043856
|
| AF-A0A838I9W5-F1-model_v4 | Anti-sigma factor antagonist | 0.9763 | 1 | 86 |
GO:0043856
|
| AF-A0A7V9M690-F1-model_v4 | Anti-sigma factor antagonist | 0.9756 | 1 | 112 |
GO:0043856
|
| AF-A0A1V5ILW0-F1-model_v4 | Anti-sigma factor antagonist | 0.9716 | 3 | 114 |
GO:0043856
|
| AF-A0A538KEL9-F1-model_v4 | Anti-sigma factor antagonist | 0.9709 | 3 | 114 |
GO:0043856
|