F479587
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 761 | 585 | 364 | 413 |
Family's Representative Sequence
| Representative Sequence | 3300046530|Ga0495654_0000912|Ga0495654_0000912_19304_20758 |
| Length | 484 |
| Sequence | VTIFSLSDAAEFVSFYQAVKLSATSKTKAMPIFRPGRLDHRQASGKTTGNNKQAAIAQSINRVRTKNMVAAPGENLRVNGDRLWDMLMDMAKIGPGIAGGNNRQTLTDADGEGRHLFKTWCEAAGLTVGVDRMGTMFATRPGTDPDALPVYIGSHLDTQPTGGKFDGVLGVLAALEVVRSMNDLGITTKHPIVVTNWANEEGARFAPAMLASGVFAGVHSLDYAYGRKDPDGKTYGDELKRIGWLGDEEVGARKMHAYFEYHIEQGPILEADNKQIGVVTHCQGLWWLEFTLTGREAHTGSTPMAMRVNAGLAFGRILEMAQDVAMAEQPGAVAGVGQAFFSPNSRNVLPGTVVFTVDMRTPSQEKLDRMRARIESAAAEICDALGVGCSVEAVGHFDPITFDPTLVGRVRSAAEKLGYSHMDIISGAGHDACWAAKVAPATMIMCPCVGGLSHNEAEEISRDWAAAGCDVLFHAVVETAEIVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 2 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 3 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 4 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 5 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 6 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 7 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 8 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 9 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 10 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 11 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 12 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 13 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 14 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 15 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 16 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 17 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 18 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 19 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 20 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 21 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 22 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 23 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 24 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 25 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 26 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 27 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 28 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 29 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 30 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 31 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 32 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 33 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 34 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 35 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 36 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 37 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 38 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 39 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 40 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 41 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 42 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 43 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 44 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 45 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 46 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 47 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 48 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 49 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 50 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 51 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 52 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 53 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 54 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 55 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 56 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 57 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 58 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 59 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 60 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 61 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 62 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 63 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 64 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 65 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 66 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 67 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 68 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 69 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 70 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 71 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 72 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 73 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 74 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 75 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 76 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 77 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 78 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 79 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 80 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 81 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 82 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 83 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 84 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 85 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 86 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 87 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 88 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 89 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 90 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 91 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 92 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 93 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 94 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 95 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 96 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 97 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 98 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 99 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 100 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 101 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 102 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 103 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 104 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 105 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 106 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 107 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 108 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 109 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 110 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 111 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 112 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 113 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 114 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 115 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 116 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 117 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 118 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 119 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 120 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 121 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 122 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 123 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 124 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 125 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 126 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 127 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 128 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 129 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 130 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 131 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 132 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 133 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 134 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 135 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 136 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 137 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 138 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 139 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 140 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 141 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 142 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 143 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 144 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 145 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 146 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 147 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 148 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 149 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 150 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 151 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 152 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 153 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 154 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 155 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 156 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 157 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 158 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 159 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 160 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 161 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 162 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 163 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 164 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 165 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 166 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 167 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 168 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 169 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 170 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 171 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 172 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 173 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 174 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 175 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 176 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 177 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 178 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 179 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 180 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 181 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 182 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 183 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 184 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 185 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 186 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 187 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 188 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 189 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 190 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 191 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 192 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 193 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 194 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 195 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 196 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 197 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 198 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 199 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 200 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 201 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 202 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 203 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 204 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 205 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 206 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 207 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 208 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 209 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 210 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 211 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 212 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 213 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 214 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 215 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 216 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 217 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 218 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 219 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 220 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 221 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 222 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 223 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 224 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 225 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 226 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 227 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 228 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 229 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 230 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 231 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 232 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 233 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 234 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 235 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 236 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 237 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 238 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 239 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 240 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 241 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 242 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 243 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 244 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 245 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 246 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 247 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 248 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 249 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 250 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 251 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 252 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 253 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 254 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 255 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 256 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 257 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 258 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 259 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 260 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 261 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 262 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 263 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 264 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 265 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 266 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 267 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 268 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 269 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 270 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 271 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 272 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 273 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 274 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 275 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 276 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 277 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 278 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 279 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 280 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 281 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 282 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 283 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 284 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 285 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 286 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 287 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 288 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 289 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 290 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 291 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 292 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 293 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 294 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 295 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 296 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 297 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 298 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 299 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 300 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 301 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 302 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 303 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 304 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 305 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 306 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 307 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 308 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 309 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 310 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 311 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 312 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 313 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 314 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 315 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 316 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 317 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 318 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 319 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 320 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 321 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 322 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 323 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 324 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 325 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 326 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 327 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 328 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 329 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 330 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 331 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 332 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 333 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 334 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 335 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 336 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 337 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 338 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 339 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 340 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 341 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 342 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 343 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 344 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 345 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 346 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 347 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 348 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 349 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 350 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 351 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 352 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 353 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 354 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 355 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 356 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 357 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 358 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 359 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 360 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 361 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 362 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 363 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 364 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 365 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 366 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 367 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 368 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 369 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 370 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 371 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 372 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 373 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 374 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 375 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 376 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 377 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 378 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 379 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 380 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 381 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 382 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 383 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 384 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 385 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 386 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 387 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 388 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 389 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 391 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 392 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 393 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 394 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 395 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 396 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 397 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 398 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 399 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 400 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 401 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 402 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 403 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 404 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 405 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 406 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 407 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 408 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 409 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 410 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 411 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 412 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 413 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 414 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 415 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 416 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 417 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 418 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 419 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 420 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 421 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 422 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 423 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 424 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 425 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 444 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 447 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 448 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 449 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 450 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 451 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 452 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 453 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 454 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 455 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 456 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 457 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 458 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 459 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 460 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 461 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 462 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 463 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 464 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 465 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 466 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 467 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 468 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 469 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 470 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 482 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 483 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 484 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 485 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 486 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 487 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 488 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 489 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 490 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 491 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 492 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 493 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 508 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 510 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 513 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 515 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 517 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 518 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 519 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 520 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 521 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 522 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 523 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 526 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 527 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 529 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 530 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 531 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 532 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 533 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 534 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 536 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 537 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 538 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 539 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 540 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 541 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 542 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 543 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 544 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 545 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 546 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 547 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 548 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 549 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 550 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 551 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 552 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 553 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 554 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 555 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 556 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 557 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 558 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 559 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 560 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 561 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 562 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 563 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 564 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 565 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 566 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 567 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 568 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 569 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 570 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 571 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 572 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 573 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 574 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 575 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 576 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 577 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 578 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 579 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 580 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 581 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 582 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 583 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 584 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 585 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 47.7 |
| Metatranscriptomes | 0.13 |
| Isolates | 52.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.53 |
| Bulb | 0 |
| Endosphere | 17.08 |
| Nodule | 35.48 |
| Rhizoplane | 1.05 |
| Rhizosphere | 29.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000066 | 3300002704 | Bacteria | 69429 |
| 2 | JGI25156J39149_1000075 | 3300002705 | Bacteria | 76505 |
| 3 | JGI25162J39368_1000149 | 3300002737 | Bacteria | 76227 |
| 4 | JGI25162J39368_1000211 | 3300002737 | Bacteria | 61063 |
| 5 | JGI25154J39366_1000075 | 3300002738 | Bacteria | 91249 |
| 6 | JGI25158J39367_1000194 | 3300002739 | Bacteria | 14540 |
| 7 | JGI25157J39369_1000051 | 3300002741 | Bacteria | 111770 |
| 8 | JGI25157J39369_1000077 | 3300002741 | Bacteria | 86251 |
| 9 | JGI25152J39213_1001494 | 3300002773 | Bacteria | 9965 |
| 10 | JGI25152J39213_1005813 | 3300002773 | Bacteria | 3500 |
| 11 | JGI25159J45721_1000108 | 3300002987 | Bacteria | 39183 |
| 12 | JGI25151J46595_10002158 | 3300003187 | Bacteria | 12188 |
| 13 | JGI25151J46595_10002818 | 3300003187 | Bacteria | 10046 |
| 14 | JGI25151J46595_10004382 | 3300003187 | Bacteria | 7481 |
| 15 | JGI25151J46595_10012482 | 3300003187 | Bacteria | 3863 |
| 16 | JGI25165J46597_1000938 | 3300003214 | Bacteria | 19980 |
| 17 | JGI25165J46597_1003676 | 3300003214 | Bacteria | 3661 |
| 18 | JGI25165J46597_1004248 | 3300003214 | Bacteria | 3148 |
| 19 | JGI25153J46596_10012364 | 3300003215 | Bacteria | 3689 |
| 20 | JGI25153J46596_10025006 | 3300003215 | Bacteria | 2142 |
| 21 | JGI25153J46596_10035257 | 3300003215 | Bacteria | 1623 |
| 22 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 23 | JGI25160J50197_1004300 | 3300003354 | Bacteria | 6173 |
| 24 | JGI25160J50197_1008515 | 3300003354 | Bacteria | 3902 |
| 25 | JGI25160J50197_1008936 | 3300003354 | Bacteria | 3763 |
| 26 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 27 | JGI25161J50226_1000163 | 3300003374 | Bacteria | 46470 |
| 28 | Ga0055526_1004503 | 3300003771 | Bacteria | 8344 |
| 29 | Ga0055526_1009408 | 3300003771 | Bacteria | 4703 |
| 30 | Ga0055526_1009759 | 3300003771 | Bacteria | 4567 |
| 31 | Ga0055524_1001395 | 3300003775 | Bacteria | 13921 |
| 32 | Ga0055524_1003836 | 3300003775 | Bacteria | 7138 |
| 33 | Ga0055524_1011581 | 3300003775 | Bacteria | 3440 |
| 34 | Ga0055536_1015425 | 3300003781 | Bacteria | 2615 |
| 35 | Ga0055528_1000662 | 3300003790 | Bacteria | 25014 |
| 36 | Ga0055528_1013493 | 3300003790 | Bacteria | 3090 |
| 37 | Ga0055528_1013735 | 3300003790 | Bacteria | 3049 |
| 38 | Ga0055528_1017225 | 3300003790 | Bacteria | 2515 |
| 39 | Ga0055540_1001547 | 3300003792 | Bacteria | 13472 |
| 40 | Ga0055531_10007648 | 3300003794 | Bacteria | 5850 |
| 41 | Ga0058692_1001033 | 3300003856 | Bacteria | 10914 |
| 42 | Ga0055543_1000007 | 3300004625 | Bacteria | 204042 |
| 43 | Ga0055543_1000104 | 3300004625 | Bacteria | 73576 |
| 44 | Ga0055543_1000108 | 3300004625 | Bacteria | 71519 |
| 45 | Ga0065165_1000008 | 3300005262 | Bacteria | 334429 |
| 46 | Ga0065165_1005090 | 3300005262 | Bacteria | 7640 |
| 47 | Ga0065165_1012225 | 3300005262 | Bacteria | 3511 |
| 48 | Ga0065165_1040336 | 3300005262 | Bacteria | 1393 |
| 49 | Ga0070670_100001446 | 3300005331 | Bacteria | 19064 |
| 50 | Ga0070668_100209700 | 3300005347 | Bacteria | 1602 |
| 51 | Ga0070674_100057957 | 3300005356 | Bacteria | 2691 |
| 52 | Ga0070659_100058483 | 3300005366 | Bacteria | 3042 |
| 53 | Ga0068853_100046936 | 3300005539 | Bacteria | 3706 |
| 54 | Ga0070664_100081573 | 3300005564 | Bacteria | 2788 |
| 55 | Ga0068856_100048755 | 3300005614 | Bacteria | 4174 |
| 56 | Ga0068856_100094678 | 3300005614 | Bacteria | 2973 |
| 57 | Ga0068856_100097257 | 3300005614 | Bacteria | 2933 |
| 58 | Ga0081455_10018499 | 3300005937 | Bacteria | 6634 |
| 59 | Ga0075365_10000510 | 3300006038 | Bacteria | 14791 |
| 60 | Ga0075365_10003643 | 3300006038 | Bacteria | 7985 |
| 61 | Ga0075363_100041270 | 3300006048 | Bacteria | 2433 |
| 62 | Ga0075364_10087149 | 3300006051 | Bacteria | 2069 |
| 63 | Ga0075362_10008871 | 3300006177 | Bacteria | 3865 |
| 64 | Ga0075367_10001877 | 3300006178 | Bacteria | 9292 |
| 65 | Ga0075366_10014942 | 3300006195 | Bacteria | 4439 |
| 66 | Ga0075366_10028507 | 3300006195 | Bacteria | 3277 |
| 67 | Ga0075370_10015910 | 3300006353 | Bacteria | 4038 |
| 68 | Ga0075370_10016018 | 3300006353 | Bacteria | 4027 |
| 69 | Ga0075370_10016383 | 3300006353 | Bacteria | 3988 |
| 70 | Ga0075430_100067112 | 3300006846 | Bacteria | 3012 |
| 71 | Ga0068865_100214514 | 3300006881 | Bacteria | 1502 |
| 72 | Ga0079104_1000015 | 3300006946 | Bacteria | 321803 |
| 73 | Ga0105240_10000014 | 3300009093 | Bacteria | 482033 |
| 74 | Ga0114129_10124864 | 3300009147 | Bacteria | 3539 |
| 75 | Ga0114129_10230519 | 3300009147 | Bacteria | 2494 |
| 76 | Ga0105243_10004033 | 3300009148 | Bacteria | 11688 |
| 77 | Ga0105248_10080268 | 3300009177 | Bacteria | 3666 |
| 78 | Ga0105248_10389876 | 3300009177 | Bacteria | 1568 |
| 79 | Ga0105237_10008351 | 3300009545 | Bacteria | 11227 |
| 80 | Ga0105237_10034929 | 3300009545 | Bacteria | 5088 |
| 81 | Ga0123341_1000018 | 3300009765 | Bacteria | 81421 |
| 82 | Ga0123342_1021678 | 3300009766 | Bacteria | 4474 |
| 83 | Ga0105239_10000552 | 3300010375 | Bacteria | 53680 |
| 84 | Ga0105239_10024598 | 3300010375 | Bacteria | 6634 |
| 85 | Ga0105239_10106601 | 3300010375 | Bacteria | 3104 |
| 86 | Ga0105239_10133420 | 3300010375 | Bacteria | 2763 |
| 87 | Ga0157371_10000165 | 3300013102 | Bacteria | 96321 |
| 88 | Ga0157370_10000015 | 3300013104 | Bacteria | 185771 |
| 89 | Ga0157378_10208885 | 3300013297 | Bacteria | 1850 |
| 90 | Ga0182008_10015373 | 3300014497 | Bacteria | 3994 |
| 91 | Ga0182007_10000385 | 3300015262 | Bacteria | 27600 |
| 92 | Ga0214542_1000023 | 3300021321 | Bacteria | 191557 |
| 93 | Ga0214543_1000019 | 3300021327 | Bacteria | 267908 |
| 94 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 95 | Ga0209760_103244 | 3300025207 | Bacteria | 1454 |
| 96 | Ga0209436_100058 | 3300025208 | Bacteria | 60755 |
| 97 | Ga0209437_100058 | 3300025233 | Bacteria | 357279 |
| 98 | Ga0209437_100060 | 3300025233 | Bacteria | 355034 |
| 99 | Ga0207425_1000436 | 3300025245 | Bacteria | 27617 |
| 100 | Ga0207425_1009106 | 3300025245 | Bacteria | 2492 |
| 101 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 102 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 103 | Ga0209677_100289 | 3300025253 | Bacteria | 33302 |
| 104 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 105 | Ga0209129_1000128 | 3300025258 | Bacteria | 130420 |
| 106 | Ga0209129_1000976 | 3300025258 | Bacteria | 17199 |
| 107 | Ga0209129_1002097 | 3300025258 | Bacteria | 10213 |
| 108 | Ga0209129_1002855 | 3300025258 | Bacteria | 7982 |
| 109 | Ga0209129_1003400 | 3300025258 | Bacteria | 6972 |
| 110 | Ga0209129_1014582 | 3300025258 | Bacteria | 1667 |
| 111 | Ga0209233_1000137 | 3300025261 | Bacteria | 200314 |
| 112 | Ga0209233_1000149 | 3300025261 | Bacteria | 181183 |
| 113 | Ga0209233_1000160 | 3300025261 | Bacteria | 159035 |
| 114 | Ga0209233_1000391 | 3300025261 | Bacteria | 37267 |
| 115 | Ga0209673_1000125 | 3300025273 | Bacteria | 168465 |
| 116 | Ga0209673_1000256 | 3300025273 | Bacteria | 100514 |
| 117 | Ga0209673_1001124 | 3300025273 | Bacteria | 29604 |
| 118 | Ga0209673_1001756 | 3300025273 | Bacteria | 18064 |
| 119 | Ga0209673_1002455 | 3300025273 | Bacteria | 12830 |
| 120 | Ga0209673_1003474 | 3300025273 | Bacteria | 9256 |
| 121 | Ga0209673_1008164 | 3300025273 | Bacteria | 4703 |
| 122 | Ga0209673_1008302 | 3300025273 | Bacteria | 4634 |
| 123 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 124 | Ga0209130_1000023 | 3300025284 | Bacteria | 359355 |
| 125 | Ga0209130_1009056 | 3300025284 | Bacteria | 2873 |
| 126 | Ga0209130_1012131 | 3300025284 | Bacteria | 2272 |
| 127 | Ga0209676_1006852 | 3300025292 | Bacteria | 5518 |
| 128 | Ga0209025_1000154 | 3300025294 | Bacteria | 170288 |
| 129 | Ga0209025_1000451 | 3300025294 | Bacteria | 80470 |
| 130 | Ga0209025_1000537 | 3300025294 | Bacteria | 71838 |
| 131 | Ga0209025_1001209 | 3300025294 | Bacteria | 36250 |
| 132 | Ga0209025_1003817 | 3300025294 | Bacteria | 13758 |
| 133 | Ga0209025_1005577 | 3300025294 | Bacteria | 10192 |
| 134 | Ga0209564_1000259 | 3300025295 | Bacteria | 112570 |
| 135 | Ga0209564_1000841 | 3300025295 | Bacteria | 41363 |
| 136 | Ga0209564_1002070 | 3300025295 | Bacteria | 17245 |
| 137 | Ga0209564_1002604 | 3300025295 | Bacteria | 13811 |
| 138 | Ga0209758_1000058 | 3300025297 | Bacteria | 331603 |
| 139 | Ga0209758_1000254 | 3300025297 | Bacteria | 107330 |
| 140 | Ga0209758_1000592 | 3300025297 | Bacteria | 56476 |
| 141 | Ga0209758_1000678 | 3300025297 | Bacteria | 50806 |
| 142 | Ga0209758_1002403 | 3300025297 | Bacteria | 19211 |
| 143 | Ga0209758_1003028 | 3300025297 | Bacteria | 16025 |
| 144 | Ga0209758_1029977 | 3300025297 | Bacteria | 2262 |
| 145 | Ga0209050_1005160 | 3300025298 | Bacteria | 8364 |
| 146 | Ga0209256_1000283 | 3300025299 | Bacteria | 89387 |
| 147 | Ga0209256_1000669 | 3300025299 | Bacteria | 46351 |
| 148 | Ga0209256_1001412 | 3300025299 | Bacteria | 24978 |
| 149 | Ga0209256_1003656 | 3300025299 | Bacteria | 10516 |
| 150 | Ga0209256_1016918 | 3300025299 | Bacteria | 2454 |
| 151 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 152 | Ga0207426_1000087 | 3300025302 | Bacteria | 288870 |
| 153 | Ga0207426_1000208 | 3300025302 | Bacteria | 140385 |
| 154 | Ga0207426_1000936 | 3300025302 | Bacteria | 29086 |
| 155 | Ga0209051_1000434 | 3300025303 | Bacteria | 56673 |
| 156 | Ga0209051_1002705 | 3300025303 | Bacteria | 12332 |
| 157 | Ga0209051_1004907 | 3300025303 | Bacteria | 8010 |
| 158 | Ga0209051_1011248 | 3300025303 | Bacteria | 4437 |
| 159 | Ga0209051_1032772 | 3300025303 | Bacteria | 1976 |
| 160 | Ga0209257_1004213 | 3300025304 | Bacteria | 11397 |
| 161 | Ga0207656_10026758 | 3300025321 | Bacteria | 2354 |
| 162 | Ga0207705_10016659 | 3300025909 | Bacteria | 5264 |
| 163 | Ga0207695_10000037 | 3300025913 | Bacteria | 476303 |
| 164 | Ga0207671_10000080 | 3300025914 | Bacteria | 148567 |
| 165 | Ga0207671_10001343 | 3300025914 | Bacteria | 28757 |
| 166 | Ga0207671_10019105 | 3300025914 | Bacteria | 5249 |
| 167 | Ga0207657_10022185 | 3300025919 | Bacteria | 5954 |
| 168 | Ga0207649_10001014 | 3300025920 | Bacteria | 17344 |
| 169 | Ga0207694_10201043 | 3300025924 | Bacteria | 1621 |
| 170 | Ga0207650_10000624 | 3300025925 | Bacteria | 28219 |
| 171 | Ga0207644_10027543 | 3300025931 | Bacteria | 3927 |
| 172 | Ga0207669_10039648 | 3300025937 | Bacteria | 2724 |
| 173 | Ga0207711_10050887 | 3300025941 | Bacteria | 3547 |
| 174 | Ga0207711_10347149 | 3300025941 | Bacteria | 1374 |
| 175 | Ga0207667_10027587 | 3300025949 | Bacteria | 6177 |
| 176 | Ga0207667_10064549 | 3300025949 | Bacteria | 3822 |
| 177 | Ga0207667_10094888 | 3300025949 | Bacteria | 3080 |
| 178 | Ga0207668_10150444 | 3300025972 | Bacteria | 1801 |
| 179 | Ga0207658_10227411 | 3300025986 | Bacteria | 1573 |
| 180 | Ga0207639_10001237 | 3300026041 | Bacteria | 17295 |
| 181 | Ga0207639_10002277 | 3300026041 | Bacteria | 12907 |
| 182 | Ga0207678_10012369 | 3300026067 | Bacteria | 7491 |
| 183 | Ga0207702_10054621 | 3300026078 | Bacteria | 3385 |
| 184 | Ga0207702_10061226 | 3300026078 | Bacteria | 3210 |
| 185 | Ga0207648_10176900 | 3300026089 | Bacteria | 1887 |
| 186 | Ga0209281_1000068 | 3300027111 | Bacteria | 280238 |
| 187 | Ga0209371_1000022 | 3300027312 | Bacteria | 536342 |
| 188 | Ga0209371_1016380 | 3300027312 | Bacteria | 1957 |
| 189 | Ga0268266_10000753 | 3300028379 | Bacteria | 43310 |
| 190 | Ga0265318_10026903 | 3300028577 | Bacteria | 2263 |
| 191 | Ga0307515_10042022 | 3300028794 | Bacteria | 7169 |
| 192 | Ga0265338_10055133 | 3300028800 | Bacteria | 3538 |
| 193 | Ga0268256_1000019 | 3300030500 | Bacteria | 587949 |
| 194 | Ga0268256_1002919 | 3300030500 | Bacteria | 8174 |
| 195 | Ga0268256_1016660 | 3300030500 | Bacteria | 2096 |
| 196 | Ga0265330_10052584 | 3300031235 | Bacteria | 1784 |
| 197 | Ga0265325_10017179 | 3300031241 | Bacteria | 4024 |
| 198 | Ga0265325_10050957 | 3300031241 | Bacteria | 2130 |
| 199 | Ga0265340_10021572 | 3300031247 | Bacteria | 3303 |
| 200 | Ga0265339_10002355 | 3300031249 | Bacteria | 13581 |
| 201 | Ga0265316_10195925 | 3300031344 | Bacteria | 1499 |
| 202 | Ga0307513_10056156 | 3300031456 | Bacteria | 4206 |
| 203 | Ga0307513_10224220 | 3300031456 | Bacteria | 1698 |
| 204 | Ga0265313_10000048 | 3300031595 | Bacteria | 112723 |
| 205 | Ga0265313_10016705 | 3300031595 | Bacteria | 4208 |
| 206 | Ga0265314_10025741 | 3300031711 | Bacteria | 4432 |
| 207 | Ga0307414_10214947 | 3300032004 | Bacteria | 1574 |
| 208 | Ga0307414_10300625 | 3300032004 | Bacteria | 1357 |
| 209 | Ga0395899_0026042 | 3300037312 | Bacteria | 4413 |
| 210 | Ga0395900_0118984 | 3300037418 | Bacteria | 2711 |
| 211 | Ga0395898_0321675 | 3300037466 | Bacteria | 1476 |
| 212 | Ga0395905_0002480 | 3300037471 | Bacteria | 20425 |
| 213 | Ga0395905_0002698 | 3300037471 | Bacteria | 19454 |
| 214 | Ga0395905_0079057 | 3300037471 | Bacteria | 3082 |
| 215 | Ga0395905_0243271 | 3300037471 | Bacteria | 1681 |
| 216 | Ga0395901_0128521 | 3300038443 | Bacteria | 2663 |
| 217 | Ga0395901_0239783 | 3300038443 | Bacteria | 1891 |
| 218 | Ga0395901_0259976 | 3300038443 | Bacteria | 1807 |
| 219 | Ga0451787_267633 | 3300041441 | Bacteria | 2959 |
| 220 | Ga0451835_0620589 | 3300041492 | Bacteria | 2148 |
| 221 | Ga0451839_1069755 | 3300041496 | Bacteria | 2170 |
| 222 | Ga0451851_0685669 | 3300041507 | Bacteria | 5290 |
| 223 | Ga0451853_3017342 | 3300041512 | Bacteria | 3753 |
| 224 | Ga0466970_0060481 | 3300044765 | Bacteria | 2029 |
| 225 | Ga0495638_0000746 | 3300046460 | Bacteria | 34841 |
| 226 | Ga0495638_0040547 | 3300046460 | Bacteria | 2950 |
| 227 | Ga0495605_0033036 | 3300046474 | Bacteria | 2630 |
| 228 | Ga0495606_0003935 | 3300046507 | Bacteria | 15284 |
| 229 | Ga0495606_0020624 | 3300046507 | Bacteria | 4851 |
| 230 | Ga0495610_0006541 | 3300046512 | Bacteria | 7984 |
| 231 | Ga0495632_0026990 | 3300046519 | Bacteria | 3014 |
| 232 | Ga0495654_0000912 | 3300046530 | Bacteria | 21951 |
| 233 | Ga0495609_0010907 | 3300046538 | Bacteria | 4341 |
| 234 | Ga0495668_0006000 | 3300046616 | Bacteria | 8064 |
| 235 | Ga0495625_0047808 | 3300046660 | Bacteria | 3084 |
| 236 | Ga0495588_0002287 | 3300046674 | Bacteria | 8201 |
| 237 | Ga0495588_0053761 | 3300046674 | Bacteria | 2077 |
| 238 | Ga0495686_0003605 | 3300047472 | Bacteria | 13275 |
| 239 | Ga0496106_0000206 | 3300048909 | Bacteria | 41054 |
| 240 | Ga0496116_0032986 | 3300048919 | Bacteria | 3682 |
| 241 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 242 | Ga0496117_0094014 | 3300048920 | Bacteria | 1920 |
| 243 | Ga0496118_0000736 | 3300048921 | Bacteria | 52853 |
| 244 | Ga0496118_0003614 | 3300048921 | Bacteria | 19207 |
| 245 | Ga0496119_0041157 | 3300048922 | Bacteria | 2946 |
| 246 | Ga0496120_0000534 | 3300048923 | Bacteria | 58507 |
| 247 | Ga0496120_0005660 | 3300048923 | Bacteria | 9880 |
| 248 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 249 | Ga0496121_0015046 | 3300048924 | Bacteria | 8142 |
| 250 | Ga0496122_0000004 | 3300048925 | Bacteria | 645283 |
| 251 | Ga0496122_0000042 | 3300048925 | Bacteria | 280482 |
| 252 | Ga0496122_0066336 | 3300048925 | Bacteria | 2608 |
| 253 | Ga0496122_0096538 | 3300048925 | Bacteria | 1992 |
| 254 | Ga0496123_0000007 | 3300048926 | Bacteria | 645283 |
| 255 | Ga0496123_0000030 | 3300048926 | Bacteria | 291764 |
| 256 | Ga0496124_0000067 | 3300048927 | Bacteria | 222576 |
| 257 | Ga0496124_0048453 | 3300048927 | Bacteria | 3630 |
| 258 | Ga0496124_0122407 | 3300048927 | Bacteria | 2077 |
| 259 | Ga0496124_0169591 | 3300048927 | Bacteria | 1692 |
| 260 | Ga0496124_0206341 | 3300048927 | Bacteria | 1490 |
| 261 | Ga0496125_0000262 | 3300048928 | Bacteria | 108389 |
| 262 | Ga0496125_0000270 | 3300048928 | Bacteria | 106118 |
| 263 | Ga0496125_0090489 | 3300048928 | Bacteria | 2296 |
| 264 | Ga0496125_0127921 | 3300048928 | Bacteria | 1796 |
| 265 | Ga0496126_0023200 | 3300048929 | Bacteria | 6015 |
| 266 | Ga0495678_007866 | 3300049459 | Bacteria | 5476 |
| 267 | Ga0501031_0000010 | 3300049568 | Bacteria | 146435 |
| 268 | Ga0501031_0036746 | 3300049568 | Bacteria | 3196 |
| 269 | Ga0501032_0000023 | 3300049569 | Bacteria | 146435 |
| 270 | Ga0501032_0000075 | 3300049569 | Bacteria | 84153 |
| 271 | Ga0501032_0091327 | 3300049569 | Bacteria | 2020 |
| 272 | Ga0501032_0100942 | 3300049569 | Bacteria | 1911 |
| 273 | Ga0501033_0000216 | 3300049570 | Bacteria | 55449 |
| 274 | Ga0501033_0000308 | 3300049570 | Bacteria | 46219 |
| 275 | Ga0501033_0041133 | 3300049570 | Bacteria | 3450 |
| 276 | Ga0501033_0112933 | 3300049570 | Bacteria | 1976 |
| 277 | Ga0501034_0000116 | 3300049571 | Bacteria | 146442 |
| 278 | Ga0501034_0000476 | 3300049571 | Bacteria | 65960 |
| 279 | Ga0501034_0040163 | 3300049571 | Bacteria | 4737 |
| 280 | Ga0501034_0049018 | 3300049571 | Bacteria | 4262 |
| 281 | Ga0501034_0075227 | 3300049571 | Bacteria | 3385 |
| 282 | Ga0501034_0125726 | 3300049571 | Bacteria | 2549 |
| 283 | Ga0501034_0126173 | 3300049571 | Bacteria | 2544 |
| 284 | Ga0501034_0134746 | 3300049571 | Bacteria | 2451 |
| 285 | Ga0501034_0149848 | 3300049571 | Bacteria | 2309 |
| 286 | Ga0501036_0000015 | 3300049572 | Bacteria | 146442 |
| 287 | Ga0501036_0000540 | 3300049572 | Bacteria | 27084 |
| 288 | Ga0501036_0129866 | 3300049572 | Bacteria | 2127 |
| 289 | Ga0501037_0000021 | 3300049573 | Bacteria | 150037 |
| 290 | Ga0501037_0000023 | 3300049573 | Bacteria | 146542 |
| 291 | Ga0501037_0068868 | 3300049573 | Bacteria | 2576 |
| 292 | Ga0501038_0000025 | 3300049574 | Bacteria | 146542 |
| 293 | Ga0501038_0000032 | 3300049574 | Bacteria | 131432 |
| 294 | Ga0501038_0121196 | 3300049574 | Bacteria | 2156 |
| 295 | Ga0501038_0146276 | 3300049574 | Bacteria | 1929 |
| 296 | Ga0501039_0000025 | 3300049575 | Bacteria | 152236 |
| 297 | Ga0501039_0000037 | 3300049575 | Bacteria | 122286 |
| 298 | Ga0501039_0018288 | 3300049575 | Bacteria | 5378 |
| 299 | Ga0501040_0012464 | 3300049576 | Bacteria | 5571 |
| 300 | Ga0501043_0000570 | 3300049579 | Bacteria | 32944 |
| 301 | Ga0501043_0008991 | 3300049579 | Bacteria | 7860 |
| 302 | Ga0501043_0011454 | 3300049579 | Bacteria | 6943 |
| 303 | Ga0501043_0058885 | 3300049579 | Bacteria | 3014 |
| 304 | Ga0501046_0047765 | 3300049580 | Bacteria | 3393 |
| 305 | Ga0501046_0067979 | 3300049580 | Bacteria | 2774 |
| 306 | Ga0501046_0072957 | 3300049580 | Bacteria | 2664 |
| 307 | Ga0501047_0005004 | 3300049581 | Bacteria | 12438 |
| 308 | Ga0501047_0025729 | 3300049581 | Bacteria | 5659 |
| 309 | Ga0501047_0053396 | 3300049581 | Bacteria | 3907 |
| 310 | Ga0501048_0007452 | 3300049582 | Bacteria | 8293 |
| 311 | Ga0501067_0002349 | 3300049583 | Bacteria | 10468 |
| 312 | Ga0501069_0004804 | 3300049585 | Bacteria | 6995 |
| 313 | Ga0501070_0005027 | 3300049586 | Bacteria | 11280 |
| 314 | Ga0501070_0010394 | 3300049586 | Bacteria | 7867 |
| 315 | Ga0501070_0021657 | 3300049586 | Bacteria | 5390 |
| 316 | Ga0501070_0054870 | 3300049586 | Bacteria | 3304 |
| 317 | Ga0501070_0099045 | 3300049586 | Bacteria | 2411 |
| 318 | Ga0501073_0002930 | 3300049589 | Bacteria | 12804 |
| 319 | Ga0501073_0007316 | 3300049589 | Bacteria | 8218 |
| 320 | Ga0501073_0048136 | 3300049589 | Bacteria | 2994 |
| 321 | Ga0501074_0020559 | 3300049590 | Bacteria | 4797 |
| 322 | Ga0501076_0122163 | 3300049592 | Bacteria | 2109 |
| 323 | Ga0501077_0047815 | 3300049593 | Bacteria | 2718 |
| 324 | Ga0501080_0000429 | 3300049742 | Bacteria | 32423 |
| 325 | Ga0501080_0028634 | 3300049742 | Bacteria | 5185 |
| 326 | Ga0501083_0010993 | 3300049744 | Bacteria | 6362 |
| 327 | Ga0501083_0033085 | 3300049744 | Bacteria | 3541 |
| 328 | Ga0501083_0088339 | 3300049744 | Bacteria | 2049 |
| 329 | Ga0501035_0000074 | 3300049822 | Bacteria | 122269 |
| 330 | Ga0501035_0000085 | 3300049822 | Bacteria | 116189 |
| 331 | Ga0501035_0003697 | 3300049822 | Bacteria | 14584 |
| 332 | Ga0501035_0044853 | 3300049822 | Bacteria | 3979 |
| 333 | Ga0501035_0047191 | 3300049822 | Bacteria | 3868 |
| 334 | Ga0501035_0062977 | 3300049822 | Bacteria | 3299 |
| 335 | Ga0501035_0135392 | 3300049822 | Bacteria | 2145 |
| 336 | Ga0501035_0153649 | 3300049822 | Bacteria | 1996 |
| 337 | Ga0501044_0000069 | 3300049823 | Bacteria | 125974 |
| 338 | Ga0501044_0009602 | 3300049823 | Bacteria | 10529 |
| 339 | Ga0501044_0046671 | 3300049823 | Bacteria | 4484 |
| 340 | Ga0501044_0099994 | 3300049823 | Bacteria | 2918 |
| 341 | Ga0501044_0143512 | 3300049823 | Bacteria | 2375 |
| 342 | Ga0501044_0260565 | 3300049823 | Bacteria | 1672 |
| 343 | Ga0501045_0017706 | 3300049824 | Bacteria | 5059 |
| 344 | nmdc:mga03683_17941_c1 | 3300050489 | Bacteria | 2684 |
| 345 | nmdc:mga00v17_15220_c1 | 3300050491 | Bacteria | 4313 |
| 346 | nmdc:mga00v17_7_c1 | 3300050491 | Bacteria | 167228 |
| 347 | nmdc:mga00v17_81851_c1 | 3300050491 | Bacteria | 2017 |
| 348 | nmdc:mga0yw44_52596_c1 | 3300050492 | Bacteria | 2470 |
| 349 | nmdc:mga0k408_21953_c1 | 3300050493 | Bacteria | 3590 |
| 350 | nmdc:mga05p37_462250_c1 | 3300050507 | Bacteria | 1466 |
| 351 | nmdc:mga0qj67_2433_c1 | 3300050509 | Bacteria | 13256 |
| 352 | nmdc:mga0n895_15824_c1 | 3300050512 | Bacteria | 6896 |
| 353 | Ga0500560_005310 | 3300053107 | Bacteria | 2840 |
| 354 | Ga0500618_003259 | 3300053125 | Bacteria | 5642 |
| 355 | Ga0500658_0005826 | 3300053134 | Bacteria | 4589 |
| 356 | Ga0500561_0001746 | 3300053137 | Bacteria | 3579 |
| 357 | Ga0500616_0002773 | 3300053153 | Bacteria | 14146 |
| 358 | Ga0500634_0000003 | 3300053161 | Bacteria | 245536 |
| 359 | Ga0500634_0014987 | 3300053161 | Bacteria | 4105 |
| 360 | Ga0500636_0001803 | 3300053177 | Bacteria | 11727 |
| 361 | Ga0501084_0017036 | 3300054114 | Bacteria | 6037 |
| 362 | Ga0501084_0169052 | 3300054114 | Bacteria | 1845 |
| 363 | Ga0587072_007591 | 3300059643 | Bacteria | 1692 |
| 364 | Ga0501082_0007985 | 3300060353 | Bacteria | 9137 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025207 | Ga0209760_103244 | Ga0209760_1032442 | 369 |
| 2 | 3300050507 | nmdc:mga05p37_462250_c1 | nmdc:mga05p37_462250_c1_119_1360 | 385 |
| 3 | 3300050512 | nmdc:mga0n895_15824_c1 | nmdc:mga0n895_15824_c1_4730_5971 | 385 |
| 4 | iso_pu_bacteria | 2882632389 | 2882636258 | 391 |
| 5 | iso_pu_bacteria | 2885305155 | 2885309416 | 391 |
| 6 | iso_pu_bacteria | 2885334103 | 2885342090 | 391 |
| 7 | iso_pu_bacteria | 2643221674 | 2644412074 | 393 |
| 8 | iso_pu_bacteria | 2847686936 | 2847692243 | 393 |
| 9 | iso_pu_bacteria | 2857349434 | 2857351166 | 393 |
| 10 | iso_pu_bacteria | 2871444079 | 2871447558 | 393 |
| 11 | iso_pu_bacteria | 2871495908 | 2871501413 | 393 |
| 12 | iso_pu_bacteria | 2874102143 | 2874109025 | 393 |
| 13 | iso_pu_bacteria | 2874155637 | 2874158101 | 393 |
| 14 | iso_pu_bacteria | 2878035449 | 2878040717 | 393 |
| 15 | iso_pu_bacteria | 2878760144 | 2878765393 | 393 |
| 16 | iso_pu_bacteria | 2878767105 | 2878773101 | 393 |
| 17 | iso_pu_bacteria | 2885326080 | 2885327189 | 393 |
| 18 | iso_pu_bacteria | 2903540706 | 2903546224 | 393 |
| 19 | iso_pu_bacteria | 2922158528 | 2922161112 | 393 |
| 20 | iso_pu_bacteria | 2924726620 | 2924727566 | 393 |
| 21 | 3300049744 | Ga0501083_0088339 | Ga0501083_0088339_832_2019 | 395 |
| 22 | 3300037471 | Ga0395905_0079057 | Ga0395905_0079057_1098_2291 | 397 |
| 23 | 3300038443 | Ga0395901_0259976 | Ga0395901_0259976_97_1290 | 397 |
| 24 | 3300041492 | Ga0451835_0620589 | Ga0451835_0620589_14_1207 | 397 |
| 25 | 3300049579 | Ga0501043_0058885 | Ga0501043_0058885_22_1215 | 397 |
| 26 | 3300049580 | Ga0501046_0072957 | Ga0501046_0072957_1450_2643 | 397 |
| 27 | 3300003354 | JGI25160J50197_1008515 | JGI25160J50197_10085153 | 399 |
| 28 | 3300005347 | Ga0070668_100209700 | Ga0070668_1002097001 | 399 |
| 29 | 3300025273 | Ga0209673_1001756 | Ga0209673_10017562 | 399 |
| 30 | 3300025284 | Ga0209130_1009056 | Ga0209130_10090562 | 399 |
| 31 | 3300025299 | Ga0209256_1003656 | Ga0209256_10036562 | 399 |
| 32 | 3300025302 | Ga0207426_1000936 | Ga0207426_10009368 | 399 |
| 33 | 3300025972 | Ga0207668_10150444 | Ga0207668_101504442 | 399 |
| 34 | 3300048927 | Ga0496124_0206341 | Ga0496124_0206341_277_1476 | 399 |
| 35 | 3300049574 | Ga0501038_0121196 | Ga0501038_0121196_625_1860 | 404 |
| 36 | 3300005937 | Ga0081455_10018499 | Ga0081455_100184996 | 405 |
| 37 | 3300006846 | Ga0075430_100067112 | Ga0075430_1000671121 | 405 |
| 38 | 3300009147 | Ga0114129_10124864 | Ga0114129_101248642 | 405 |
| 39 | 3300009147 | Ga0114129_10230519 | Ga0114129_102305192 | 405 |
| 40 | 3300050509 | nmdc:mga0qj67_2433_c1 | nmdc:mga0qj67_2433_c1_6146_7387 | 405 |
| 41 | iso_pu_bacteria | 2510917022 | 2511131939 | 405 |
| 42 | iso_pu_bacteria | 2524023209 | 2524459022 | 405 |
| 43 | iso_pu_bacteria | 2582581307 | 2585273979 | 405 |
| 44 | iso_pu_bacteria | 2582581308 | 2585279440 | 405 |
| 45 | iso_pu_bacteria | 2582581315 | 2585322900 | 405 |
| 46 | iso_pu_bacteria | 2585427530 | 2585553003 | 405 |
| 47 | iso_pu_bacteria | 2585427531 | 2585560430 | 405 |
| 48 | iso_pu_bacteria | 2617270742 | 2617384873 | 405 |
| 49 | iso_pu_bacteria | 2667528174 | 2671111871 | 405 |
| 50 | iso_pu_bacteria | 2775507266 | 2778173393 | 405 |
| 51 | iso_pu_bacteria | 2818991448 | 2819609916 | 405 |
| 52 | iso_pu_bacteria | 2818991453 | 2819640027 | 405 |
| 53 | iso_pu_bacteria | 2838029111 | 2838033228 | 405 |
| 54 | iso_pu_bacteria | 2842298080 | 2842298374 | 405 |
| 55 | iso_pu_bacteria | 2842357229 | 2842360386 | 405 |
| 56 | iso_pu_bacteria | 2842475841 | 2842480107 | 405 |
| 57 | iso_pu_bacteria | 2842482326 | 2842483698 | 405 |
| 58 | iso_pu_bacteria | 2842502639 | 2842505108 | 405 |
| 59 | iso_pu_bacteria | 2842509118 | 2842510390 | 405 |
| 60 | iso_pu_bacteria | 2919408235 | 2919410371 | 405 |
| 61 | iso_pu_bacteria | 3005416602 | 3005418805 | 405 |
| 62 | iso_pu_bacteria | 8005314921 | 8005318303 | 405 |
| 63 | iso_pu_bacteria | 8005484373 | 8005488816 | 405 |
| 64 | iso_pu_bacteria | 8005645114 | 8005645808 | 405 |
| 65 | iso_pu_bacteria | 8005682033 | 8005682510 | 405 |
| 66 | iso_pu_bacteria | 8046767195 | 8046772631 | 405 |
| 67 | iso_pu_bacteria | 8057575449 | 8057576910 | 405 |
| 68 | 3300003215 | JGI25153J46596_10012364 | JGI25153J46596_100123643 | 406 |
| 69 | 3300031456 | Ga0307513_10224220 | Ga0307513_102242202 | 408 |
| 70 | 3300002704 | JGI25155J39150_1000066 | JGI25155J39150_100006626 | 409 |
| 71 | 3300002705 | JGI25156J39149_1000075 | JGI25156J39149_100007541 | 409 |
| 72 | 3300002737 | JGI25162J39368_1000149 | JGI25162J39368_100014928 | 409 |
| 73 | 3300002737 | JGI25162J39368_1000211 | JGI25162J39368_100021130 | 409 |
| 74 | 3300002738 | JGI25154J39366_1000075 | JGI25154J39366_100007542 | 409 |
| 75 | 3300002739 | JGI25158J39367_1000194 | JGI25158J39367_10001942 | 409 |
| 76 | 3300002741 | JGI25157J39369_1000051 | JGI25157J39369_100005179 | 409 |
| 77 | 3300002741 | JGI25157J39369_1000077 | JGI25157J39369_100007753 | 409 |
| 78 | 3300002773 | JGI25152J39213_1001494 | JGI25152J39213_10014943 | 409 |
| 79 | 3300002773 | JGI25152J39213_1005813 | JGI25152J39213_10058133 | 409 |
| 80 | 3300002987 | JGI25159J45721_1000108 | JGI25159J45721_100010817 | 409 |
| 81 | 3300003187 | JGI25151J46595_10002158 | JGI25151J46595_100021588 | 409 |
| 82 | 3300003187 | JGI25151J46595_10002818 | JGI25151J46595_100028182 | 409 |
| 83 | 3300003187 | JGI25151J46595_10004382 | JGI25151J46595_100043822 | 409 |
| 84 | 3300003187 | JGI25151J46595_10012482 | JGI25151J46595_100124821 | 409 |
| 85 | 3300003214 | JGI25165J46597_1000938 | JGI25165J46597_100093824 | 409 |
| 86 | 3300003214 | JGI25165J46597_1003676 | JGI25165J46597_10036763 | 409 |
| 87 | 3300003214 | JGI25165J46597_1004248 | JGI25165J46597_10042483 | 409 |
| 88 | 3300003215 | JGI25153J46596_10025006 | JGI25153J46596_100250061 | 409 |
| 89 | 3300003215 | JGI25153J46596_10035257 | JGI25153J46596_100352571 | 409 |
| 90 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_1000001174 | 409 |
| 91 | 3300003354 | JGI25160J50197_1004300 | JGI25160J50197_10043003 | 409 |
| 92 | 3300003354 | JGI25160J50197_1008936 | JGI25160J50197_10089362 | 409 |
| 93 | 3300003374 | JGI25161J50226_1000001 | JGI25161J50226_1000001594 | 409 |
| 94 | 3300003374 | JGI25161J50226_1000163 | JGI25161J50226_100016332 | 409 |
| 95 | 3300003771 | Ga0055526_1004503 | Ga0055526_10045036 | 409 |
| 96 | 3300003771 | Ga0055526_1009408 | Ga0055526_10094082 | 409 |
| 97 | 3300003771 | Ga0055526_1009759 | Ga0055526_10097591 | 409 |
| 98 | 3300003775 | Ga0055524_1001395 | Ga0055524_10013954 | 409 |
| 99 | 3300003775 | Ga0055524_1003836 | Ga0055524_10038366 | 409 |
| 100 | 3300003775 | Ga0055524_1011581 | Ga0055524_10115813 | 409 |
| 101 | 3300003781 | Ga0055536_1015425 | Ga0055536_10154252 | 409 |
| 102 | 3300003790 | Ga0055528_1000662 | Ga0055528_100066210 | 409 |
| 103 | 3300003790 | Ga0055528_1013493 | Ga0055528_10134931 | 409 |
| 104 | 3300003790 | Ga0055528_1013735 | Ga0055528_10137353 | 409 |
| 105 | 3300003790 | Ga0055528_1017225 | Ga0055528_10172251 | 409 |
| 106 | 3300003792 | Ga0055540_1001547 | Ga0055540_10015471 | 409 |
| 107 | 3300003794 | Ga0055531_10007648 | Ga0055531_100076488 | 409 |
| 108 | 3300003856 | Ga0058692_1001033 | Ga0058692_100103311 | 409 |
| 109 | 3300004625 | Ga0055543_1000007 | Ga0055543_100000721 | 409 |
| 110 | 3300004625 | Ga0055543_1000104 | Ga0055543_100010472 | 409 |
| 111 | 3300004625 | Ga0055543_1000108 | Ga0055543_100010845 | 409 |
| 112 | 3300005262 | Ga0065165_1000008 | Ga0065165_1000008289 | 409 |
| 113 | 3300005262 | Ga0065165_1005090 | Ga0065165_10050903 | 409 |
| 114 | 3300005262 | Ga0065165_1012225 | Ga0065165_10122253 | 409 |
| 115 | 3300005262 | Ga0065165_1040336 | Ga0065165_10403361 | 409 |
| 116 | 3300005331 | Ga0070670_100001446 | Ga0070670_10000144619 | 409 |
| 117 | 3300005356 | Ga0070674_100057957 | Ga0070674_1000579572 | 409 |
| 118 | 3300005366 | Ga0070659_100058483 | Ga0070659_1000584835 | 409 |
| 119 | 3300005539 | Ga0068853_100046936 | Ga0068853_1000469363 | 409 |
| 120 | 3300005564 | Ga0070664_100081573 | Ga0070664_1000815732 | 409 |
| 121 | 3300005614 | Ga0068856_100048755 | Ga0068856_1000487553 | 409 |
| 122 | 3300005614 | Ga0068856_100094678 | Ga0068856_1000946782 | 409 |
| 123 | 3300005614 | Ga0068856_100097257 | Ga0068856_1000972572 | 409 |
| 124 | 3300006038 | Ga0075365_10000510 | Ga0075365_1000051013 | 409 |
| 125 | 3300006038 | Ga0075365_10003643 | Ga0075365_100036438 | 409 |
| 126 | 3300006048 | Ga0075363_100041270 | Ga0075363_1000412703 | 409 |
| 127 | 3300006051 | Ga0075364_10087149 | Ga0075364_100871492 | 409 |
| 128 | 3300006177 | Ga0075362_10008871 | Ga0075362_100088712 | 409 |
| 129 | 3300006178 | Ga0075367_10001877 | Ga0075367_100018779 | 409 |
| 130 | 3300006195 | Ga0075366_10014942 | Ga0075366_100149423 | 409 |
| 131 | 3300006195 | Ga0075366_10028507 | Ga0075366_100285073 | 409 |
| 132 | 3300006353 | Ga0075370_10015910 | Ga0075370_100159102 | 409 |
| 133 | 3300006353 | Ga0075370_10016018 | Ga0075370_100160183 | 409 |
| 134 | 3300006353 | Ga0075370_10016383 | Ga0075370_100163834 | 409 |
| 135 | 3300006881 | Ga0068865_100214514 | Ga0068865_1002145142 | 409 |
| 136 | 3300006946 | Ga0079104_1000015 | Ga0079104_1000015150 | 409 |
| 137 | 3300009093 | Ga0105240_10000014 | Ga0105240_10000014122 | 409 |
| 138 | 3300009148 | Ga0105243_10004033 | Ga0105243_100040334 | 409 |
| 139 | 3300009177 | Ga0105248_10080268 | Ga0105248_100802682 | 409 |
| 140 | 3300009177 | Ga0105248_10389876 | Ga0105248_103898761 | 409 |
| 141 | 3300009545 | Ga0105237_10008351 | Ga0105237_100083517 | 409 |
| 142 | 3300009545 | Ga0105237_10034929 | Ga0105237_100349294 | 409 |
| 143 | 3300009765 | Ga0123341_1000018 | Ga0123341_100001855 | 409 |
| 144 | 3300009766 | Ga0123342_1021678 | Ga0123342_10216783 | 409 |
| 145 | 3300010375 | Ga0105239_10000552 | Ga0105239_1000055220 | 409 |
| 146 | 3300010375 | Ga0105239_10024598 | Ga0105239_100245984 | 409 |
| 147 | 3300010375 | Ga0105239_10106601 | Ga0105239_101066012 | 409 |
| 148 | 3300010375 | Ga0105239_10133420 | Ga0105239_101334201 | 409 |
| 149 | 3300013102 | Ga0157371_10000165 | Ga0157371_1000016580 | 409 |
| 150 | 3300013104 | Ga0157370_10000015 | Ga0157370_10000015122 | 409 |
| 151 | 3300013297 | Ga0157378_10208885 | Ga0157378_102088851 | 409 |
| 152 | 3300014497 | Ga0182008_10015373 | Ga0182008_100153732 | 409 |
| 153 | 3300015262 | Ga0182007_10000385 | Ga0182007_1000038523 | 409 |
| 154 | 3300021321 | Ga0214542_1000023 | Ga0214542_1000023106 | 409 |
| 155 | 3300021327 | Ga0214543_1000019 | Ga0214543_1000019181 | 409 |
| 156 | 3300025206 | Ga0209435_100005 | Ga0209435_100005471 | 409 |
| 157 | 3300025208 | Ga0209436_100058 | Ga0209436_10005868 | 409 |
| 158 | 3300025233 | Ga0209437_100058 | Ga0209437_100058114 | 409 |
| 159 | 3300025233 | Ga0209437_100060 | Ga0209437_100060146 | 409 |
| 160 | 3300025245 | Ga0207425_1000436 | Ga0207425_100043627 | 409 |
| 161 | 3300025245 | Ga0207425_1009106 | Ga0207425_10091062 | 409 |
| 162 | 3300025246 | Ga0209646_1000011 | Ga0209646_1000011471 | 409 |
| 163 | 3300025250 | Ga0209026_1000008 | Ga0209026_1000008471 | 409 |
| 164 | 3300025253 | Ga0209677_100289 | Ga0209677_1002892 | 409 |
| 165 | 3300025256 | Ga0209759_1000004 | Ga0209759_1000004471 | 409 |
| 166 | 3300025258 | Ga0209129_1000128 | Ga0209129_100012884 | 409 |
| 167 | 3300025258 | Ga0209129_1000976 | Ga0209129_100097610 | 409 |
| 168 | 3300025258 | Ga0209129_1002097 | Ga0209129_10020978 | 409 |
| 169 | 3300025258 | Ga0209129_1002855 | Ga0209129_10028558 | 409 |
| 170 | 3300025258 | Ga0209129_1003400 | Ga0209129_10034002 | 409 |
| 171 | 3300025258 | Ga0209129_1014582 | Ga0209129_10145822 | 409 |
| 172 | 3300025261 | Ga0209233_1000137 | Ga0209233_1000137123 | 409 |
| 173 | 3300025261 | Ga0209233_1000149 | Ga0209233_100014970 | 409 |
| 174 | 3300025261 | Ga0209233_1000160 | Ga0209233_100016085 | 409 |
| 175 | 3300025261 | Ga0209233_1000391 | Ga0209233_100039111 | 409 |
| 176 | 3300025273 | Ga0209673_1000125 | Ga0209673_100012598 | 409 |
| 177 | 3300025273 | Ga0209673_1000256 | Ga0209673_100025659 | 409 |
| 178 | 3300025273 | Ga0209673_1001124 | Ga0209673_10011241 | 409 |
| 179 | 3300025273 | Ga0209673_1002455 | Ga0209673_100245510 | 409 |
| 180 | 3300025273 | Ga0209673_1003474 | Ga0209673_10034747 | 409 |
| 181 | 3300025273 | Ga0209673_1008164 | Ga0209673_10081643 | 409 |
| 182 | 3300025273 | Ga0209673_1008302 | Ga0209673_10083023 | 409 |
| 183 | 3300025284 | Ga0209130_1000003 | Ga0209130_1000003600 | 409 |
| 184 | 3300025284 | Ga0209130_1000023 | Ga0209130_1000023144 | 409 |
| 185 | 3300025284 | Ga0209130_1012131 | Ga0209130_10121311 | 409 |
| 186 | 3300025292 | Ga0209676_1006852 | Ga0209676_10068524 | 409 |
| 187 | 3300025294 | Ga0209025_1000154 | Ga0209025_100015432 | 409 |
| 188 | 3300025294 | Ga0209025_1000451 | Ga0209025_100045125 | 409 |
| 189 | 3300025294 | Ga0209025_1000537 | Ga0209025_100053749 | 409 |
| 190 | 3300025294 | Ga0209025_1001209 | Ga0209025_100120928 | 409 |
| 191 | 3300025294 | Ga0209025_1003817 | Ga0209025_10038178 | 409 |
| 192 | 3300025294 | Ga0209025_1005577 | Ga0209025_10055779 | 409 |
| 193 | 3300025295 | Ga0209564_1000259 | Ga0209564_100025969 | 409 |
| 194 | 3300025295 | Ga0209564_1000841 | Ga0209564_100084113 | 409 |
| 195 | 3300025295 | Ga0209564_1002070 | Ga0209564_10020707 | 409 |
| 196 | 3300025295 | Ga0209564_1002604 | Ga0209564_10026043 | 409 |
| 197 | 3300025297 | Ga0209758_1000058 | Ga0209758_1000058189 | 409 |
| 198 | 3300025297 | Ga0209758_1000254 | Ga0209758_1000254107 | 409 |
| 199 | 3300025297 | Ga0209758_1000592 | Ga0209758_100059262 | 409 |
| 200 | 3300025297 | Ga0209758_1000678 | Ga0209758_100067810 | 409 |
| 201 | 3300025297 | Ga0209758_1002403 | Ga0209758_100240312 | 409 |
| 202 | 3300025297 | Ga0209758_1003028 | Ga0209758_100302817 | 409 |
| 203 | 3300025297 | Ga0209758_1029977 | Ga0209758_10299773 | 409 |
| 204 | 3300025298 | Ga0209050_1005160 | Ga0209050_10051608 | 409 |
| 205 | 3300025299 | Ga0209256_1000283 | Ga0209256_100028332 | 409 |
| 206 | 3300025299 | Ga0209256_1000669 | Ga0209256_100066918 | 409 |
| 207 | 3300025299 | Ga0209256_1001412 | Ga0209256_100141217 | 409 |
| 208 | 3300025299 | Ga0209256_1016918 | Ga0209256_10169183 | 409 |
| 209 | 3300025302 | Ga0207426_1000011 | Ga0207426_1000011175 | 409 |
| 210 | 3300025302 | Ga0207426_1000087 | Ga0207426_1000087218 | 409 |
| 211 | 3300025302 | Ga0207426_1000208 | Ga0207426_1000208127 | 409 |
| 212 | 3300025303 | Ga0209051_1000434 | Ga0209051_100043446 | 409 |
| 213 | 3300025303 | Ga0209051_1002705 | Ga0209051_100270510 | 409 |
| 214 | 3300025303 | Ga0209051_1004907 | Ga0209051_10049077 | 409 |
| 215 | 3300025303 | Ga0209051_1011248 | Ga0209051_10112483 | 409 |
| 216 | 3300025303 | Ga0209051_1032772 | Ga0209051_10327722 | 409 |
| 217 | 3300025304 | Ga0209257_1004213 | Ga0209257_10042139 | 409 |
| 218 | 3300025321 | Ga0207656_10026758 | Ga0207656_100267582 | 409 |
| 219 | 3300025909 | Ga0207705_10016659 | Ga0207705_100166593 | 409 |
| 220 | 3300025913 | Ga0207695_10000037 | Ga0207695_10000037122 | 409 |
| 221 | 3300025914 | Ga0207671_10000080 | Ga0207671_10000080123 | 409 |
| 222 | 3300025914 | Ga0207671_10001343 | Ga0207671_1000134312 | 409 |
| 223 | 3300025914 | Ga0207671_10019105 | Ga0207671_100191053 | 409 |
| 224 | 3300025919 | Ga0207657_10022185 | Ga0207657_100221852 | 409 |
| 225 | 3300025920 | Ga0207649_10001014 | Ga0207649_100010141 | 409 |
| 226 | 3300025924 | Ga0207694_10201043 | Ga0207694_102010431 | 409 |
| 227 | 3300025925 | Ga0207650_10000624 | Ga0207650_100006241 | 409 |
| 228 | 3300025931 | Ga0207644_10027543 | Ga0207644_100275432 | 409 |
| 229 | 3300025937 | Ga0207669_10039648 | Ga0207669_100396484 | 409 |
| 230 | 3300025941 | Ga0207711_10050887 | Ga0207711_100508874 | 409 |
| 231 | 3300025941 | Ga0207711_10347149 | Ga0207711_103471491 | 409 |
| 232 | 3300025949 | Ga0207667_10027587 | Ga0207667_100275873 | 409 |
| 233 | 3300025949 | Ga0207667_10064549 | Ga0207667_100645492 | 409 |
| 234 | 3300025949 | Ga0207667_10094888 | Ga0207667_100948882 | 409 |
| 235 | 3300025986 | Ga0207658_10227411 | Ga0207658_102274111 | 409 |
| 236 | 3300026041 | Ga0207639_10001237 | Ga0207639_1000123716 | 409 |
| 237 | 3300026041 | Ga0207639_10002277 | Ga0207639_100022773 | 409 |
| 238 | 3300026067 | Ga0207678_10012369 | Ga0207678_100123693 | 409 |
| 239 | 3300026078 | Ga0207702_10054621 | Ga0207702_100546212 | 409 |
| 240 | 3300026078 | Ga0207702_10061226 | Ga0207702_100612262 | 409 |
| 241 | 3300026089 | Ga0207648_10176900 | Ga0207648_101769002 | 409 |
| 242 | 3300027111 | Ga0209281_1000068 | Ga0209281_1000068238 | 409 |
| 243 | 3300027312 | Ga0209371_1000022 | Ga0209371_1000022351 | 409 |
| 244 | 3300027312 | Ga0209371_1016380 | Ga0209371_10163801 | 409 |
| 245 | 3300028379 | Ga0268266_10000753 | Ga0268266_1000075335 | 409 |
| 246 | 3300028577 | Ga0265318_10026903 | Ga0265318_100269032 | 409 |
| 247 | 3300028794 | Ga0307515_10042022 | Ga0307515_100420222 | 409 |
| 248 | 3300028800 | Ga0265338_10055133 | Ga0265338_100551331 | 409 |
| 249 | 3300030500 | Ga0268256_1000019 | Ga0268256_1000019169 | 409 |
| 250 | 3300030500 | Ga0268256_1002919 | Ga0268256_10029195 | 409 |
| 251 | 3300030500 | Ga0268256_1016660 | Ga0268256_10166602 | 409 |
| 252 | 3300031235 | Ga0265330_10052584 | Ga0265330_100525841 | 409 |
| 253 | 3300031241 | Ga0265325_10017179 | Ga0265325_100171793 | 409 |
| 254 | 3300031241 | Ga0265325_10050957 | Ga0265325_100509572 | 409 |
| 255 | 3300031247 | Ga0265340_10021572 | Ga0265340_100215723 | 409 |
| 256 | 3300031249 | Ga0265339_10002355 | Ga0265339_100023555 | 409 |
| 257 | 3300031344 | Ga0265316_10195925 | Ga0265316_101959252 | 409 |
| 258 | 3300031456 | Ga0307513_10056156 | Ga0307513_100561564 | 409 |
| 259 | 3300031595 | Ga0265313_10000048 | Ga0265313_10000048100 | 409 |
| 260 | 3300031595 | Ga0265313_10016705 | Ga0265313_100167052 | 409 |
| 261 | 3300031711 | Ga0265314_10025741 | Ga0265314_100257415 | 409 |
| 262 | 3300032004 | Ga0307414_10214947 | Ga0307414_102149472 | 409 |
| 263 | 3300032004 | Ga0307414_10300625 | Ga0307414_103006251 | 409 |
| 264 | 3300037312 | Ga0395899_0026042 | Ga0395899_0026042_867_2117 | 409 |
| 265 | 3300037418 | Ga0395900_0118984 | Ga0395900_0118984_438_1688 | 409 |
| 266 | 3300037466 | Ga0395898_0321675 | Ga0395898_0321675_172_1422 | 409 |
| 267 | 3300037471 | Ga0395905_0002480 | Ga0395905_0002480_4890_6119 | 409 |
| 268 | 3300037471 | Ga0395905_0002698 | Ga0395905_0002698_17339_18568 | 409 |
| 269 | 3300037471 | Ga0395905_0243271 | Ga0395905_0243271_289_1539 | 409 |
| 270 | 3300038443 | Ga0395901_0128521 | Ga0395901_0128521_112_1362 | 409 |
| 271 | 3300038443 | Ga0395901_0239783 | Ga0395901_0239783_338_1585 | 409 |
| 272 | 3300041441 | Ga0451787_267633 | Ga0451787_267633_519_1772 | 409 |
| 273 | 3300041496 | Ga0451839_1069755 | Ga0451839_1069755_20_1249 | 409 |
| 274 | 3300041507 | Ga0451851_0685669 | Ga0451851_0685669_2582_3835 | 409 |
| 275 | 3300041512 | Ga0451853_3017342 | Ga0451853_3017342_948_2201 | 409 |
| 276 | 3300044765 | Ga0466970_0060481 | Ga0466970_0060481_657_1910 | 409 |
| 277 | 3300046460 | Ga0495638_0000746 | Ga0495638_0000746_32463_33692 | 409 |
| 278 | 3300046460 | Ga0495638_0040547 | Ga0495638_0040547_116_1345 | 409 |
| 279 | 3300046474 | Ga0495605_0033036 | Ga0495605_0033036_417_1670 | 409 |
| 280 | 3300046507 | Ga0495606_0003935 | Ga0495606_0003935_7961_9214 | 409 |
| 281 | 3300046507 | Ga0495606_0020624 | Ga0495606_0020624_716_1969 | 409 |
| 282 | 3300046512 | Ga0495610_0006541 | Ga0495610_0006541_5608_6861 | 409 |
| 283 | 3300046519 | Ga0495632_0026990 | Ga0495632_0026990_90_1343 | 409 |
| 284 | 3300046530 | Ga0495654_0000912 | Ga0495654_0000912_19304_20758 | 409 |
| 285 | 3300046538 | Ga0495609_0010907 | Ga0495609_0010907_744_1997 | 409 |
| 286 | 3300046616 | Ga0495668_0006000 | Ga0495668_0006000_689_1942 | 409 |
| 287 | 3300046660 | Ga0495625_0047808 | Ga0495625_0047808_1158_2411 | 409 |
| 288 | 3300046674 | Ga0495588_0002287 | Ga0495588_0002287_1075_2322 | 409 |
| 289 | 3300046674 | Ga0495588_0053761 | Ga0495588_0053761_439_1821 | 409 |
| 290 | 3300047472 | Ga0495686_0003605 | Ga0495686_0003605_1848_3101 | 409 |
| 291 | 3300048909 | Ga0496106_0000206 | Ga0496106_0000206_38770_40023 | 409 |
| 292 | 3300048919 | Ga0496116_0032986 | Ga0496116_0032986_2368_3615 | 409 |
| 293 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_192667_193914 | 409 |
| 294 | 3300048920 | Ga0496117_0094014 | Ga0496117_0094014_472_1725 | 409 |
| 295 | 3300048921 | Ga0496118_0000736 | Ga0496118_0000736_43479_44726 | 409 |
| 296 | 3300048921 | Ga0496118_0003614 | Ga0496118_0003614_703_1956 | 409 |
| 297 | 3300048922 | Ga0496119_0041157 | Ga0496119_0041157_1289_2542 | 409 |
| 298 | 3300048923 | Ga0496120_0000534 | Ga0496120_0000534_29809_31056 | 409 |
| 299 | 3300048923 | Ga0496120_0005660 | Ga0496120_0005660_7704_8954 | 409 |
| 300 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_772678_773982 | 409 |
| 301 | 3300048924 | Ga0496121_0015046 | Ga0496121_0015046_334_1587 | 409 |
| 302 | 3300048925 | Ga0496122_0000004 | Ga0496122_0000004_451762_453009 | 409 |
| 303 | 3300048925 | Ga0496122_0000042 | Ga0496122_0000042_204387_205640 | 409 |
| 304 | 3300048925 | Ga0496122_0066336 | Ga0496122_0066336_515_1768 | 409 |
| 305 | 3300048925 | Ga0496122_0096538 | Ga0496122_0096538_394_1698 | 409 |
| 306 | 3300048926 | Ga0496123_0000007 | Ga0496123_0000007_451762_453009 | 409 |
| 307 | 3300048926 | Ga0496123_0000030 | Ga0496123_0000030_86120_87373 | 409 |
| 308 | 3300048927 | Ga0496124_0000067 | Ga0496124_0000067_81553_82806 | 409 |
| 309 | 3300048927 | Ga0496124_0048453 | Ga0496124_0048453_1750_2997 | 409 |
| 310 | 3300048927 | Ga0496124_0122407 | Ga0496124_0122407_670_1956 | 409 |
| 311 | 3300048927 | Ga0496124_0169591 | Ga0496124_0169591_260_1558 | 409 |
| 312 | 3300048928 | Ga0496125_0000262 | Ga0496125_0000262_29209_30513 | 409 |
| 313 | 3300048928 | Ga0496125_0000270 | Ga0496125_0000270_92260_93510 | 409 |
| 314 | 3300048928 | Ga0496125_0090489 | Ga0496125_0090489_514_1761 | 409 |
| 315 | 3300048928 | Ga0496125_0127921 | Ga0496125_0127921_152_1402 | 409 |
| 316 | 3300048929 | Ga0496126_0023200 | Ga0496126_0023200_4553_5803 | 409 |
| 317 | 3300049459 | Ga0495678_007866 | Ga0495678_007866_99_1352 | 409 |
| 318 | 3300049568 | Ga0501031_0000010 | Ga0501031_0000010_676_1926 | 409 |
| 319 | 3300049568 | Ga0501031_0036746 | Ga0501031_0036746_700_1950 | 409 |
| 320 | 3300049569 | Ga0501032_0000023 | Ga0501032_0000023_144510_145760 | 409 |
| 321 | 3300049569 | Ga0501032_0000075 | Ga0501032_0000075_35465_36718 | 409 |
| 322 | 3300049569 | Ga0501032_0091327 | Ga0501032_0091327_536_1786 | 409 |
| 323 | 3300049569 | Ga0501032_0100942 | Ga0501032_0100942_446_1696 | 409 |
| 324 | 3300049570 | Ga0501033_0000216 | Ga0501033_0000216_37028_38281 | 409 |
| 325 | 3300049570 | Ga0501033_0000308 | Ga0501033_0000308_43321_44571 | 409 |
| 326 | 3300049570 | Ga0501033_0041133 | Ga0501033_0041133_1122_2372 | 409 |
| 327 | 3300049570 | Ga0501033_0112933 | Ga0501033_0112933_493_1743 | 409 |
| 328 | 3300049571 | Ga0501034_0000116 | Ga0501034_0000116_683_1933 | 409 |
| 329 | 3300049571 | Ga0501034_0000476 | Ga0501034_0000476_29243_30496 | 409 |
| 330 | 3300049571 | Ga0501034_0040163 | Ga0501034_0040163_1628_2878 | 409 |
| 331 | 3300049571 | Ga0501034_0049018 | Ga0501034_0049018_1205_2455 | 409 |
| 332 | 3300049571 | Ga0501034_0075227 | Ga0501034_0075227_321_1571 | 409 |
| 333 | 3300049571 | Ga0501034_0125726 | Ga0501034_0125726_316_1566 | 409 |
| 334 | 3300049571 | Ga0501034_0126173 | Ga0501034_0126173_302_1588 | 409 |
| 335 | 3300049571 | Ga0501034_0134746 | Ga0501034_0134746_1112_2362 | 409 |
| 336 | 3300049571 | Ga0501034_0149848 | Ga0501034_0149848_965_2215 | 409 |
| 337 | 3300049572 | Ga0501036_0000015 | Ga0501036_0000015_683_1933 | 409 |
| 338 | 3300049572 | Ga0501036_0000540 | Ga0501036_0000540_20071_21324 | 409 |
| 339 | 3300049572 | Ga0501036_0129866 | Ga0501036_0129866_599_1849 | 409 |
| 340 | 3300049573 | Ga0501037_0000021 | Ga0501037_0000021_112994_114247 | 409 |
| 341 | 3300049573 | Ga0501037_0000023 | Ga0501037_0000023_783_2033 | 409 |
| 342 | 3300049573 | Ga0501037_0068868 | Ga0501037_0068868_385_1635 | 409 |
| 343 | 3300049574 | Ga0501038_0000025 | Ga0501038_0000025_783_2033 | 409 |
| 344 | 3300049574 | Ga0501038_0000032 | Ga0501038_0000032_94715_95968 | 409 |
| 345 | 3300049574 | Ga0501038_0146276 | Ga0501038_0146276_152_1402 | 409 |
| 346 | 3300049575 | Ga0501039_0000025 | Ga0501039_0000025_108984_110237 | 409 |
| 347 | 3300049575 | Ga0501039_0000037 | Ga0501039_0000037_683_1933 | 409 |
| 348 | 3300049575 | Ga0501039_0018288 | Ga0501039_0018288_220_1470 | 409 |
| 349 | 3300049576 | Ga0501040_0012464 | Ga0501040_0012464_3638_4888 | 409 |
| 350 | 3300049579 | Ga0501043_0000570 | Ga0501043_0000570_29243_30496 | 409 |
| 351 | 3300049579 | Ga0501043_0008991 | Ga0501043_0008991_764_2014 | 409 |
| 352 | 3300049579 | Ga0501043_0011454 | Ga0501043_0011454_4911_6161 | 409 |
| 353 | 3300049580 | Ga0501046_0047765 | Ga0501046_0047765_950_2203 | 409 |
| 354 | 3300049580 | Ga0501046_0067979 | Ga0501046_0067979_1402_2652 | 409 |
| 355 | 3300049581 | Ga0501047_0005004 | Ga0501047_0005004_534_1784 | 409 |
| 356 | 3300049581 | Ga0501047_0025729 | Ga0501047_0025729_1318_2568 | 409 |
| 357 | 3300049581 | Ga0501047_0053396 | Ga0501047_0053396_1205_2455 | 409 |
| 358 | 3300049582 | Ga0501048_0007452 | Ga0501048_0007452_6198_7448 | 409 |
| 359 | 3300049583 | Ga0501067_0002349 | Ga0501067_0002349_7389_8639 | 409 |
| 360 | 3300049585 | Ga0501069_0004804 | Ga0501069_0004804_1072_2322 | 409 |
| 361 | 3300049586 | Ga0501070_0005027 | Ga0501070_0005027_5569_6819 | 409 |
| 362 | 3300049586 | Ga0501070_0010394 | Ga0501070_0010394_5324_6574 | 409 |
| 363 | 3300049586 | Ga0501070_0021657 | Ga0501070_0021657_3571_4821 | 409 |
| 364 | 3300049586 | Ga0501070_0054870 | Ga0501070_0054870_1415_2665 | 409 |
| 365 | 3300049586 | Ga0501070_0099045 | Ga0501070_0099045_1122_2372 | 409 |
| 366 | 3300049589 | Ga0501073_0002930 | Ga0501073_0002930_8552_9802 | 409 |
| 367 | 3300049589 | Ga0501073_0007316 | Ga0501073_0007316_324_1574 | 409 |
| 368 | 3300049589 | Ga0501073_0048136 | Ga0501073_0048136_99_1349 | 409 |
| 369 | 3300049590 | Ga0501074_0020559 | Ga0501074_0020559_442_1692 | 409 |
| 370 | 3300049592 | Ga0501076_0122163 | Ga0501076_0122163_423_1673 | 409 |
| 371 | 3300049593 | Ga0501077_0047815 | Ga0501077_0047815_1405_2655 | 409 |
| 372 | 3300049742 | Ga0501080_0000429 | Ga0501080_0000429_25014_26264 | 409 |
| 373 | 3300049742 | Ga0501080_0028634 | Ga0501080_0028634_3482_4732 | 409 |
| 374 | 3300049744 | Ga0501083_0010993 | Ga0501083_0010993_3092_4342 | 409 |
| 375 | 3300049744 | Ga0501083_0033085 | Ga0501083_0033085_1637_2887 | 409 |
| 376 | 3300049822 | Ga0501035_0000074 | Ga0501035_0000074_664_1914 | 409 |
| 377 | 3300049822 | Ga0501035_0000085 | Ga0501035_0000085_75026_76279 | 409 |
| 378 | 3300049822 | Ga0501035_0003697 | Ga0501035_0003697_975_2225 | 409 |
| 379 | 3300049822 | Ga0501035_0044853 | Ga0501035_0044853_2274_3524 | 409 |
| 380 | 3300049822 | Ga0501035_0047191 | Ga0501035_0047191_1504_2754 | 409 |
| 381 | 3300049822 | Ga0501035_0062977 | Ga0501035_0062977_917_2167 | 409 |
| 382 | 3300049822 | Ga0501035_0135392 | Ga0501035_0135392_342_1592 | 409 |
| 383 | 3300049822 | Ga0501035_0153649 | Ga0501035_0153649_543_1793 | 409 |
| 384 | 3300049823 | Ga0501044_0000069 | Ga0501044_0000069_124042_125292 | 409 |
| 385 | 3300049823 | Ga0501044_0009602 | Ga0501044_0009602_783_2033 | 409 |
| 386 | 3300049823 | Ga0501044_0046671 | Ga0501044_0046671_1748_2998 | 409 |
| 387 | 3300049823 | Ga0501044_0099994 | Ga0501044_0099994_1453_2703 | 409 |
| 388 | 3300049823 | Ga0501044_0143512 | Ga0501044_0143512_764_2014 | 409 |
| 389 | 3300049823 | Ga0501044_0260565 | Ga0501044_0260565_161_1411 | 409 |
| 390 | 3300049824 | Ga0501045_0017706 | Ga0501045_0017706_716_1966 | 409 |
| 391 | 3300050489 | nmdc:mga03683_17941_c1 | nmdc:mga03683_17941_c1_762_2015 | 409 |
| 392 | 3300050491 | nmdc:mga00v17_15220_c1 | nmdc:mga00v17_15220_c1_2797_4101 | 409 |
| 393 | 3300050491 | nmdc:mga00v17_7_c1 | nmdc:mga00v17_7_c1_77039_78286 | 409 |
| 394 | 3300050491 | nmdc:mga00v17_81851_c1 | nmdc:mga00v17_81851_c1_464_1714 | 409 |
| 395 | 3300050492 | nmdc:mga0yw44_52596_c1 | nmdc:mga0yw44_52596_c1_560_1807 | 409 |
| 396 | 3300050493 | nmdc:mga0k408_21953_c1 | nmdc:mga0k408_21953_c1_1029_2279 | 409 |
| 397 | 3300053107 | Ga0500560_005310 | Ga0500560_005310_100_1347 | 409 |
| 398 | 3300053125 | Ga0500618_003259 | Ga0500618_003259_1815_3068 | 409 |
| 399 | 3300053134 | Ga0500658_0005826 | Ga0500658_0005826_2261_3514 | 409 |
| 400 | 3300053137 | Ga0500561_0001746 | Ga0500561_0001746_1822_3069 | 409 |
| 401 | 3300053153 | Ga0500616_0002773 | Ga0500616_0002773_6215_7444 | 409 |
| 402 | 3300053161 | Ga0500634_0000003 | Ga0500634_0000003_182785_184035 | 409 |
| 403 | 3300053161 | Ga0500634_0014987 | Ga0500634_0014987_1781_3034 | 409 |
| 404 | 3300053177 | Ga0500636_0001803 | Ga0500636_0001803_885_2156 | 409 |
| 405 | 3300054114 | Ga0501084_0017036 | Ga0501084_0017036_4354_5604 | 409 |
| 406 | 3300054114 | Ga0501084_0169052 | Ga0501084_0169052_192_1442 | 409 |
| 407 | 3300059643 | Ga0587072_007591 | Ga0587072_007591_172_1419 | 409 |
| 408 | 3300060353 | Ga0501082_0007985 | Ga0501082_0007985_597_1847 | 409 |
| 409 | iso_pu_bacteria | 2509276021 | 2509390160 | 409 |
| 410 | iso_pu_bacteria | 2509276033 | 2509447553 | 409 |
| 411 | iso_pu_bacteria | 2510065019 | 2510134383 | 409 |
| 412 | iso_pu_bacteria | 2510461069 | 2510841701 | 409 |
| 413 | iso_pu_bacteria | 2510461076 | 2510895808 | 409 |
| 414 | iso_pu_bacteria | 2510917026 | 2511175400 | 409 |
| 415 | iso_pu_bacteria | 2510917028 | 2511182667 | 409 |
| 416 | iso_pu_bacteria | 2510917030 | 2511194901 | 409 |
| 417 | iso_pu_bacteria | 2512875026 | 2512970341 | 409 |
| 418 | iso_pu_bacteria | 2513237084 | 2513567505 | 409 |
| 419 | iso_pu_bacteria | 2513237085 | 2513577839 | 409 |
| 420 | iso_pu_bacteria | 2513237088 | 2513598391 | 409 |
| 421 | iso_pu_bacteria | 2513237093 | 2513632012 | 409 |
| 422 | iso_pu_bacteria | 2513237103 | 2513712514 | 409 |
| 423 | iso_pu_bacteria | 2513237138 | 2513867902 | 409 |
| 424 | iso_pu_bacteria | 2513237144 | 2513910631 | 409 |
| 425 | iso_pu_bacteria | 2513237146 | 2513928076 | 409 |
| 426 | iso_pu_bacteria | 2513237159 | 2513997553 | 409 |
| 427 | iso_pu_bacteria | 2513237160 | 2514003148 | 409 |
| 428 | iso_pu_bacteria | 2513237162 | 2514017885 | 409 |
| 429 | iso_pu_bacteria | 2515075009 | 2515113544 | 409 |
| 430 | iso_pu_bacteria | 2515154114 | 2515643834 | 409 |
| 431 | iso_pu_bacteria | 2515154116 | 2515654922 | 409 |
| 432 | iso_pu_bacteria | 2515154134 | 2515739902 | 409 |
| 433 | iso_pu_bacteria | 2516143018 | 2516206053 | 409 |
| 434 | iso_pu_bacteria | 2516653077 | 2517037160 | 409 |
| 435 | iso_pu_bacteria | 2516653085 | 2517077499 | 409 |
| 436 | iso_pu_bacteria | 2517093000 | 2517096267 | 409 |
| 437 | iso_pu_bacteria | 2517287029 | 2517408128 | 409 |
| 438 | iso_pu_bacteria | 2519899620 | 2520378434 | 409 |
| 439 | iso_pu_bacteria | 2523231067 | 2523466151 | 409 |
| 440 | iso_pu_bacteria | 2529292951 | 2530646373 | 409 |
| 441 | iso_pu_bacteria | 2534681796 | 2535517252 | 409 |
| 442 | iso_pu_bacteria | 2554235003 | 2554248525 | 409 |
| 443 | iso_pu_bacteria | 2558860242 | 2559295613 | 409 |
| 444 | iso_pu_bacteria | 2582581294 | 2585205087 | 409 |
| 445 | iso_pu_bacteria | 2582581298 | 2585225243 | 409 |
| 446 | iso_pu_bacteria | 2582581299 | 2585230694 | 409 |
| 447 | iso_pu_bacteria | 2582581306 | 2585265801 | 409 |
| 448 | iso_pu_bacteria | 2582581316 | 2585331066 | 409 |
| 449 | iso_pu_bacteria | 2582581865 | 2585389048 | 409 |
| 450 | iso_pu_bacteria | 2582581866 | 2585395195 | 409 |
| 451 | iso_pu_bacteria | 2582581867 | 2585404589 | 409 |
| 452 | iso_pu_bacteria | 2585427526 | 2585524928 | 409 |
| 453 | iso_pu_bacteria | 2585427527 | 2585531076 | 409 |
| 454 | iso_pu_bacteria | 2585427528 | 2585542767 | 409 |
| 455 | iso_pu_bacteria | 2585427529 | 2585547799 | 409 |
| 456 | iso_pu_bacteria | 2585427590 | 2585824874 | 409 |
| 457 | iso_pu_bacteria | 2585427593 | 2585841409 | 409 |
| 458 | iso_pu_bacteria | 2585427608 | 2585898624 | 409 |
| 459 | iso_pu_bacteria | 2585427609 | 2585903788 | 409 |
| 460 | iso_pu_bacteria | 2585427633 | 2585996807 | 409 |
| 461 | iso_pu_bacteria | 2585427634 | 2586001392 | 409 |
| 462 | iso_pu_bacteria | 2585428125 | 2587981093 | 409 |
| 463 | iso_pu_bacteria | 2599185156 | 2599332116 | 409 |
| 464 | iso_pu_bacteria | 2599185170 | 2599421085 | 409 |
| 465 | iso_pu_bacteria | 2599185210 | 2599601936 | 409 |
| 466 | iso_pu_bacteria | 2599185236 | 2599722244 | 409 |
| 467 | iso_pu_bacteria | 2599185301 | 2599936766 | 409 |
| 468 | iso_pu_bacteria | 2600254933 | 2600374008 | 409 |
| 469 | iso_pu_bacteria | 2615840624 | 2616296638 | 409 |
| 470 | iso_pu_bacteria | 2615840626 | 2616307013 | 409 |
| 471 | iso_pu_bacteria | 2615840698 | 2616554627 | 409 |
| 472 | iso_pu_bacteria | 2643221558 | 2643811101 | 409 |
| 473 | iso_pu_bacteria | 2643221564 | 2643840005 | 409 |
| 474 | iso_pu_bacteria | 2643221580 | 2643910805 | 409 |
| 475 | iso_pu_bacteria | 2643221599 | 2644002929 | 409 |
| 476 | iso_pu_bacteria | 2643221607 | 2644052066 | 409 |
| 477 | iso_pu_bacteria | 2643221618 | 2644105470 | 409 |
| 478 | iso_pu_bacteria | 2643221626 | 2644146473 | 409 |
| 479 | iso_pu_bacteria | 2643221634 | 2644196674 | 409 |
| 480 | iso_pu_bacteria | 2643221636 | 2644204859 | 409 |
| 481 | iso_pu_bacteria | 2643221637 | 2644208676 | 409 |
| 482 | iso_pu_bacteria | 2643221643 | 2644237909 | 409 |
| 483 | iso_pu_bacteria | 2643221655 | 2644308221 | 409 |
| 484 | iso_pu_bacteria | 2643221659 | 2644334045 | 409 |
| 485 | iso_pu_bacteria | 2643221686 | 2644484809 | 409 |
| 486 | iso_pu_bacteria | 2643221688 | 2644494194 | 409 |
| 487 | iso_pu_bacteria | 2643221693 | 2644523419 | 409 |
| 488 | iso_pu_bacteria | 2643221698 | 2644541642 | 409 |
| 489 | iso_pu_bacteria | 2643221712 | 2644615503 | 409 |
| 490 | iso_pu_bacteria | 2643221718 | 2644652206 | 409 |
| 491 | iso_pu_bacteria | 2657244999 | 2657684846 | 409 |
| 492 | iso_pu_bacteria | 2690316117 | 2692315160 | 409 |
| 493 | iso_pu_bacteria | 2693429783 | 2694631058 | 409 |
| 494 | iso_pu_bacteria | 2693429784 | 2694636444 | 409 |
| 495 | iso_pu_bacteria | 2718217882 | 2719182262 | 409 |
| 496 | iso_pu_bacteria | 2718217927 | 2719386852 | 409 |
| 497 | iso_pu_bacteria | 2718217997 | 2719666590 | 409 |
| 498 | iso_pu_bacteria | 2718218009 | 2719732978 | 409 |
| 499 | iso_pu_bacteria | 2718218199 | 2720493010 | 409 |
| 500 | iso_pu_bacteria | 2718218232 | 2720614488 | 409 |
| 501 | iso_pu_bacteria | 2718218233 | 2720621262 | 409 |
| 502 | iso_pu_bacteria | 2718218235 | 2720632588 | 409 |
| 503 | iso_pu_bacteria | 2718218269 | 2720776312 | 409 |
| 504 | iso_pu_bacteria | 2718218363 | 2721148375 | 409 |
| 505 | iso_pu_bacteria | 2718218365 | 2721159761 | 409 |
| 506 | iso_pu_bacteria | 2718218366 | 2721165189 | 409 |
| 507 | iso_pu_bacteria | 2718218423 | 2721400575 | 409 |
| 508 | iso_pu_bacteria | 2721755514 | 2722841359 | 409 |
| 509 | iso_pu_bacteria | 2721755556 | 2723027902 | 409 |
| 510 | iso_pu_bacteria | 2721755684 | 2723561531 | 409 |
| 511 | iso_pu_bacteria | 2721755685 | 2723568160 | 409 |
| 512 | iso_pu_bacteria | 2721755809 | 2724039388 | 409 |
| 513 | iso_pu_bacteria | 2721755810 | 2724045734 | 409 |
| 514 | iso_pu_bacteria | 2721755819 | 2724090919 | 409 |
| 515 | iso_pu_bacteria | 2721755822 | 2724105425 | 409 |
| 516 | iso_pu_bacteria | 2721755823 | 2724111251 | 409 |
| 517 | iso_pu_bacteria | 2724679232 | 2725950223 | 409 |
| 518 | iso_pu_bacteria | 2728369352 | 2730108838 | 409 |
| 519 | iso_pu_bacteria | 2728369365 | 2730165497 | 409 |
| 520 | iso_pu_bacteria | 2728369397 | 2730299393 | 409 |
| 521 | iso_pu_bacteria | 2738541293 | 2738805435 | 409 |
| 522 | iso_pu_bacteria | 2738541317 | 2738944207 | 409 |
| 523 | iso_pu_bacteria | 2738541333 | 2739033251 | 409 |
| 524 | iso_pu_bacteria | 2738543031 | 2739347120 | 409 |
| 525 | iso_pu_bacteria | 2751185821 | 2753463335 | 409 |
| 526 | iso_pu_bacteria | 2765235942 | 2766066298 | 409 |
| 527 | iso_pu_bacteria | 2775507049 | 2776914316 | 409 |
| 528 | iso_pu_bacteria | 2791355091 | 2792620462 | 409 |
| 529 | iso_pu_bacteria | 2791355092 | 2792625820 | 409 |
| 530 | iso_pu_bacteria | 2791355253 | 2793283766 | 409 |
| 531 | iso_pu_bacteria | 2791355256 | 2793294001 | 409 |
| 532 | iso_pu_bacteria | 2791355259 | 2793314323 | 409 |
| 533 | iso_pu_bacteria | 2791355260 | 2793323813 | 409 |
| 534 | iso_pu_bacteria | 2791355261 | 2793329716 | 409 |
| 535 | iso_pu_bacteria | 2791355262 | 2793335096 | 409 |
| 536 | iso_pu_bacteria | 2791355263 | 2793342313 | 409 |
| 537 | iso_pu_bacteria | 2791355264 | 2793349685 | 409 |
| 538 | iso_pu_bacteria | 2791355265 | 2793355334 | 409 |
| 539 | iso_pu_bacteria | 2791355266 | 2793363026 | 409 |
| 540 | iso_pu_bacteria | 2791355267 | 2793369895 | 409 |
| 541 | iso_pu_bacteria | 2802428858 | 2802716698 | 409 |
| 542 | iso_pu_bacteria | 2802428862 | 2802742981 | 409 |
| 543 | iso_pu_bacteria | 2802428863 | 2802750405 | 409 |
| 544 | iso_pu_bacteria | 2802429268 | 2804753024 | 409 |
| 545 | iso_pu_bacteria | 2802429605 | 2805929553 | 409 |
| 546 | iso_pu_bacteria | 2802429606 | 2805936857 | 409 |
| 547 | iso_pu_bacteria | 2802429633 | 2806047507 | 409 |
| 548 | iso_pu_bacteria | 2802429634 | 2806055143 | 409 |
| 549 | iso_pu_bacteria | 2802429635 | 2806063047 | 409 |
| 550 | iso_pu_bacteria | 2802429636 | 2806069782 | 409 |
| 551 | iso_pu_bacteria | 2802429637 | 2806075711 | 409 |
| 552 | iso_pu_bacteria | 2808606387 | 2808987654 | 409 |
| 553 | iso_pu_bacteria | 2818991439 | 2819559329 | 409 |
| 554 | iso_pu_bacteria | 2818991461 | 2819685373 | 409 |
| 555 | iso_pu_bacteria | 2821123053 | 2821125897 | 409 |
| 556 | iso_pu_bacteria | 2838016132 | 2838019920 | 409 |
| 557 | iso_pu_bacteria | 2838022645 | 2838023426 | 409 |
| 558 | iso_pu_bacteria | 2838035591 | 2838041448 | 409 |
| 559 | iso_pu_bacteria | 2838042994 | 2838045626 | 409 |
| 560 | iso_pu_bacteria | 2838048938 | 2838052729 | 409 |
| 561 | iso_pu_bacteria | 2838061910 | 2838064986 | 409 |
| 562 | iso_pu_bacteria | 2838068647 | 2838069713 | 409 |
| 563 | iso_pu_bacteria | 2838074704 | 2838079655 | 409 |
| 564 | iso_pu_bacteria | 2838661181 | 2838665839 | 409 |
| 565 | iso_pu_bacteria | 2838668709 | 2838671784 | 409 |
| 566 | iso_pu_bacteria | 2838680041 | 2838683012 | 409 |
| 567 | iso_pu_bacteria | 2838686498 | 2838686623 | 409 |
| 568 | iso_pu_bacteria | 2838694306 | 2838698045 | 409 |
| 569 | iso_pu_bacteria | 2838701080 | 2838704463 | 409 |
| 570 | iso_pu_bacteria | 2838707686 | 2838711159 | 409 |
| 571 | iso_pu_bacteria | 2838729681 | 2838734865 | 409 |
| 572 | iso_pu_bacteria | 2838736955 | 2838737627 | 409 |
| 573 | iso_pu_bacteria | 2838742623 | 2838747480 | 409 |
| 574 | iso_pu_bacteria | 2841840854 | 2841842004 | 409 |
| 575 | iso_pu_bacteria | 2841851746 | 2841854452 | 409 |
| 576 | iso_pu_bacteria | 2841859092 | 2841862473 | 409 |
| 577 | iso_pu_bacteria | 2841864319 | 2841867402 | 409 |
| 578 | iso_pu_bacteria | 2842077413 | 2842079335 | 409 |
| 579 | iso_pu_bacteria | 2842110456 | 2842115561 | 409 |
| 580 | iso_pu_bacteria | 2842118031 | 2842118155 | 409 |
| 581 | iso_pu_bacteria | 2842140634 | 2842141783 | 409 |
| 582 | iso_pu_bacteria | 2842146304 | 2842149681 | 409 |
| 583 | iso_pu_bacteria | 2842156927 | 2842158529 | 409 |
| 584 | iso_pu_bacteria | 2842163707 | 2842169025 | 409 |
| 585 | iso_pu_bacteria | 2842180545 | 2842182143 | 409 |
| 586 | iso_pu_bacteria | 2842192696 | 2842195616 | 409 |
| 587 | iso_pu_bacteria | 2842198810 | 2842198940 | 409 |
| 588 | iso_pu_bacteria | 2842205361 | 2842210937 | 409 |
| 589 | iso_pu_bacteria | 2842217011 | 2842218376 | 409 |
| 590 | iso_pu_bacteria | 2842229732 | 2842229857 | 409 |
| 591 | iso_pu_bacteria | 2842237096 | 2842240068 | 409 |
| 592 | iso_pu_bacteria | 2842243621 | 2842243746 | 409 |
| 593 | iso_pu_bacteria | 2842250916 | 2842254152 | 409 |
| 594 | iso_pu_bacteria | 2842257432 | 2842258169 | 409 |
| 595 | iso_pu_bacteria | 2842264693 | 2842268922 | 409 |
| 596 | iso_pu_bacteria | 2842271015 | 2842271839 | 409 |
| 597 | iso_pu_bacteria | 2842278818 | 2842284390 | 409 |
| 598 | iso_pu_bacteria | 2842285085 | 2842285175 | 409 |
| 599 | iso_pu_bacteria | 2842291075 | 2842292997 | 409 |
| 600 | iso_pu_bacteria | 2842304105 | 2842305452 | 409 |
| 601 | iso_pu_bacteria | 2842311132 | 2842314176 | 409 |
| 602 | iso_pu_bacteria | 2842317721 | 2842319980 | 409 |
| 603 | iso_pu_bacteria | 2842341865 | 2842347627 | 409 |
| 604 | iso_pu_bacteria | 2842363717 | 2842368723 | 409 |
| 605 | iso_pu_bacteria | 2842370503 | 2842373641 | 409 |
| 606 | iso_pu_bacteria | 2842377471 | 2842379394 | 409 |
| 607 | iso_pu_bacteria | 2842384541 | 2842384665 | 409 |
| 608 | iso_pu_bacteria | 2842395702 | 2842400569 | 409 |
| 609 | iso_pu_bacteria | 2842402390 | 2842402533 | 409 |
| 610 | iso_pu_bacteria | 2842409023 | 2842410096 | 409 |
| 611 | iso_pu_bacteria | 2842415677 | 2842416744 | 409 |
| 612 | iso_pu_bacteria | 2842422224 | 2842423327 | 409 |
| 613 | iso_pu_bacteria | 2842428310 | 2842433156 | 409 |
| 614 | iso_pu_bacteria | 2842434925 | 2842439461 | 409 |
| 615 | iso_pu_bacteria | 2842441272 | 2842446090 | 409 |
| 616 | iso_pu_bacteria | 2842447887 | 2842449118 | 409 |
| 617 | iso_pu_bacteria | 2842462802 | 2842467305 | 409 |
| 618 | iso_pu_bacteria | 2842469257 | 2842474100 | 409 |
| 619 | iso_pu_bacteria | 2842489311 | 2842493480 | 409 |
| 620 | iso_pu_bacteria | 2842495871 | 2842497630 | 409 |
| 621 | iso_pu_bacteria | 2842515876 | 2842519257 | 409 |
| 622 | iso_pu_bacteria | 2842521101 | 2842522204 | 409 |
| 623 | iso_pu_bacteria | 2844163670 | 2844166384 | 409 |
| 624 | iso_pu_bacteria | 2844454524 | 2844457921 | 409 |
| 625 | iso_pu_bacteria | 2847417321 | 2847419784 | 409 |
| 626 | iso_pu_bacteria | 2847670302 | 2847675597 | 409 |
| 627 | iso_pu_bacteria | 2848992105 | 2848994800 | 409 |
| 628 | iso_pu_bacteria | 2852387548 | 2852390805 | 409 |
| 629 | iso_pu_bacteria | 2854916844 | 2854917432 | 409 |
| 630 | iso_pu_bacteria | 2855872281 | 2855877299 | 409 |
| 631 | iso_pu_bacteria | 2856314179 | 2856319483 | 409 |
| 632 | iso_pu_bacteria | 2856364286 | 2856369442 | 409 |
| 633 | iso_pu_bacteria | 2857516855 | 2857516993 | 409 |
| 634 | iso_pu_bacteria | 2857531043 | 2857532459 | 409 |
| 635 | iso_pu_bacteria | 2869285874 | 2869286485 | 409 |
| 636 | iso_pu_bacteria | 2871429161 | 2871434638 | 409 |
| 637 | iso_pu_bacteria | 2874146452 | 2874149843 | 409 |
| 638 | iso_pu_bacteria | 2876413966 | 2876416305 | 409 |
| 639 | iso_pu_bacteria | 2878745973 | 2878751771 | 409 |
| 640 | iso_pu_bacteria | 2899275550 | 2899278705 | 409 |
| 641 | iso_pu_bacteria | 2899803654 | 2899806711 | 409 |
| 642 | iso_pu_bacteria | 2899845264 | 2899847245 | 409 |
| 643 | iso_pu_bacteria | 2903492973 | 2903504717 | 409 |
| 644 | iso_pu_bacteria | 2906308376 | 2906314169 | 409 |
| 645 | iso_pu_bacteria | 2906321335 | 2906327335 | 409 |
| 646 | iso_pu_bacteria | 2906328253 | 2906330020 | 409 |
| 647 | iso_pu_bacteria | 2906414383 | 2906420203 | 409 |
| 648 | iso_pu_bacteria | 2913295892 | 2913299099 | 409 |
| 649 | iso_pu_bacteria | 2913308742 | 2913308826 | 409 |
| 650 | iso_pu_bacteria | 2919100787 | 2919105603 | 409 |
| 651 | iso_pu_bacteria | 2919171160 | 2919173100 | 409 |
| 652 | iso_pu_bacteria | 2920760137 | 2920761167 | 409 |
| 653 | iso_pu_bacteria | 2920822456 | 2920825645 | 409 |
| 654 | iso_pu_bacteria | 2923556063 | 2923562249 | 409 |
| 655 | iso_pu_bacteria | 2926760298 | 2926762540 | 409 |
| 656 | iso_pu_bacteria | 2929138655 | 2929141158 | 409 |
| 657 | iso_pu_bacteria | 2932401849 | 2932405198 | 409 |
| 658 | iso_pu_bacteria | 2933011516 | 2933014571 | 409 |
| 659 | iso_pu_bacteria | 2933016740 | 2933023678 | 409 |
| 660 | iso_pu_bacteria | 2933570622 | 2933571259 | 409 |
| 661 | iso_pu_bacteria | 2933586486 | 2933591976 | 409 |
| 662 | iso_pu_bacteria | 2933599457 | 2933600520 | 409 |
| 663 | iso_pu_bacteria | 2935894831 | 2935896572 | 409 |
| 664 | iso_pu_bacteria | 2935901341 | 2935901467 | 409 |
| 665 | iso_pu_bacteria | 2936367885 | 2936371612 | 409 |
| 666 | iso_pu_bacteria | 2936375103 | 2936376985 | 409 |
| 667 | iso_pu_bacteria | 2936381700 | 2936383426 | 409 |
| 668 | iso_pu_bacteria | 2937036028 | 2937039685 | 409 |
| 669 | iso_pu_bacteria | 2937084907 | 2937090115 | 409 |
| 670 | iso_pu_bacteria | 2937813078 | 2937815721 | 409 |
| 671 | iso_pu_bacteria | 2937891427 | 2937896275 | 409 |
| 672 | iso_pu_bacteria | 2937994558 | 2938000082 | 409 |
| 673 | iso_pu_bacteria | 2958041894 | 2958042107 | 409 |
| 674 | iso_pu_bacteria | 2958115193 | 2958118447 | 409 |
| 675 | iso_pu_bacteria | 2958130278 | 2958130888 | 409 |
| 676 | iso_pu_bacteria | 2958165035 | 2958170546 | 409 |
| 677 | iso_pu_bacteria | 2958179912 | 2958184809 | 409 |
| 678 | iso_pu_bacteria | 2960591022 | 2960591827 | 409 |
| 679 | iso_pu_bacteria | 2961077736 | 2961082976 | 409 |
| 680 | iso_pu_bacteria | 2961163497 | 2961169001 | 409 |
| 681 | iso_pu_bacteria | 2965018300 | 2965024288 | 409 |
| 682 | iso_pu_bacteria | 2965062239 | 2965065990 | 409 |
| 683 | iso_pu_bacteria | 2967728569 | 2967732311 | 409 |
| 684 | iso_pu_bacteria | 2968091066 | 2968096352 | 409 |
| 685 | iso_pu_bacteria | 2968097103 | 2968098853 | 409 |
| 686 | iso_pu_bacteria | 2968117919 | 2968120618 | 409 |
| 687 | iso_pu_bacteria | 2968128360 | 2968129171 | 409 |
| 688 | iso_pu_bacteria | 2968171901 | 2968177395 | 409 |
| 689 | iso_pu_bacteria | 2970122695 | 2970126346 | 409 |
| 690 | iso_pu_bacteria | 2970143518 | 2970147148 | 409 |
| 691 | iso_pu_bacteria | 2970554993 | 2970560241 | 409 |
| 692 | iso_pu_bacteria | 2977530762 | 2977536378 | 409 |
| 693 | iso_pu_bacteria | 2977843712 | 2977845957 | 409 |
| 694 | iso_pu_bacteria | 2977858184 | 2977861611 | 409 |
| 695 | iso_pu_bacteria | 2977942078 | 2977942735 | 409 |
| 696 | iso_pu_bacteria | 2979089926 | 2979092192 | 409 |
| 697 | iso_pu_bacteria | 2979095461 | 2979100420 | 409 |
| 698 | iso_pu_bacteria | 2979100975 | 2979104178 | 409 |
| 699 | iso_pu_bacteria | 2979779861 | 2979785595 | 409 |
| 700 | iso_pu_bacteria | 2984509177 | 2984511244 | 409 |
| 701 | iso_pu_bacteria | 2984518228 | 2984522395 | 409 |
| 702 | iso_pu_bacteria | 2984537506 | 2984541697 | 409 |
| 703 | iso_pu_bacteria | 2984601300 | 2984604056 | 409 |
| 704 | iso_pu_bacteria | 2987636660 | 2987638350 | 409 |
| 705 | iso_pu_bacteria | 2987652177 | 2987658390 | 409 |
| 706 | iso_pu_bacteria | 2987659509 | 2987665032 | 409 |
| 707 | iso_pu_bacteria | 2989349275 | 2989351054 | 409 |
| 708 | iso_pu_bacteria | 2989776772 | 2989779574 | 409 |
| 709 | iso_pu_bacteria | 2996341866 | 2996345057 | 409 |
| 710 | iso_pu_bacteria | 2996887358 | 2996892545 | 409 |
| 711 | iso_pu_bacteria | 2996893221 | 2996898062 | 409 |
| 712 | iso_pu_bacteria | 3000017691 | 3000018739 | 409 |
| 713 | iso_pu_bacteria | 3003930520 | 3003934665 | 409 |
| 714 | iso_pu_bacteria | 3004188549 | 3004194089 | 409 |
| 715 | iso_pu_bacteria | 3004203850 | 3004205406 | 409 |
| 716 | iso_pu_bacteria | 3005445848 | 3005448841 | 409 |
| 717 | iso_pu_bacteria | 3005452660 | 3005455065 | 409 |
| 718 | iso_pu_bacteria | 639633055 | 639649590 | 409 |
| 719 | iso_pu_bacteria | 643692032 | 643826678 | 409 |
| 720 | iso_pu_bacteria | 650716007 | 650740823 | 409 |
| 721 | iso_pu_bacteria | 8003570095 | 8003571895 | 409 |
| 722 | iso_pu_bacteria | 8003999396 | 8004002158 | 409 |
| 723 | iso_pu_bacteria | 8004387939 | 8004393659 | 409 |
| 724 | iso_pu_bacteria | 8004445564 | 8004450214 | 409 |
| 725 | iso_pu_bacteria | 8004703790 | 8004709349 | 409 |
| 726 | iso_pu_bacteria | 8004714634 | 8004720427 | 409 |
| 727 | iso_pu_bacteria | 8005258706 | 8005264828 | 409 |
| 728 | iso_pu_bacteria | 8005275841 | 8005281663 | 409 |
| 729 | iso_pu_bacteria | 8005282627 | 8005284377 | 409 |
| 730 | iso_pu_bacteria | 8005301065 | 8005303575 | 409 |
| 731 | iso_pu_bacteria | 8005307578 | 8005314087 | 409 |
| 732 | iso_pu_bacteria | 8005321885 | 8005327072 | 409 |
| 733 | iso_pu_bacteria | 8005376324 | 8005382671 | 409 |
| 734 | iso_pu_bacteria | 8005382845 | 8005384633 | 409 |
| 735 | iso_pu_bacteria | 8005395548 | 8005395662 | 409 |
| 736 | iso_pu_bacteria | 8005430974 | 8005433899 | 409 |
| 737 | iso_pu_bacteria | 8005460587 | 8005464231 | 409 |
| 738 | iso_pu_bacteria | 8005497431 | 8005501337 | 409 |
| 739 | iso_pu_bacteria | 8005542996 | 8005546072 | 409 |
| 740 | iso_pu_bacteria | 8005556819 | 8005561644 | 409 |
| 741 | iso_pu_bacteria | 8005563573 | 8005568422 | 409 |
| 742 | iso_pu_bacteria | 8005570704 | 8005573039 | 409 |
| 743 | iso_pu_bacteria | 8005619151 | 8005622699 | 409 |
| 744 | iso_pu_bacteria | 8005626139 | 8005630214 | 409 |
| 745 | iso_pu_bacteria | 8005658619 | 8005658773 | 409 |
| 746 | iso_pu_bacteria | 8005668836 | 8005672756 | 409 |
| 747 | iso_pu_bacteria | 8005688590 | 8005691646 | 409 |
| 748 | iso_pu_bacteria | 8005695170 | 8005696781 | 409 |
| 749 | iso_pu_bacteria | 8018127388 | 8018127584 | 409 |
| 750 | iso_pu_bacteria | 8018150411 | 8018154096 | 409 |
| 751 | iso_pu_bacteria | 8018163183 | 8018163336 | 409 |
| 752 | iso_pu_bacteria | 8018176218 | 8018178966 | 409 |
| 753 | iso_pu_bacteria | 8023680758 | 8023682742 | 409 |
| 754 | iso_pu_bacteria | 8024479707 | 8024486100 | 409 |
| 755 | iso_pu_bacteria | 8024486573 | 8024488438 | 409 |
| 756 | iso_pu_bacteria | 8024501048 | 8024501174 | 409 |
| 757 | iso_pu_bacteria | 8054460903 | 8054463237 | 409 |
| 758 | iso_pu_bacteria | 8055431914 | 8055432266 | 409 |
| 759 | iso_pu_bacteria | 8056375014 | 8056377028 | 409 |
| 760 | iso_pu_bacteria | 8056382006 | 8056387350 | 409 |
| 761 | iso_pu_bacteria | 8057874678 | 8057881912 | 409 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8aq0-assembly1.cif.gz_B | crystal structure of l-n-carbamoylase from sinorhizobium meliloti mutant l217g/f329c | 0.9715 | 2 | 408 |
| 8apz-assembly1.cif.gz_B | crystal structure of wild-type l-n-carbamoylase from sinorhizobium meliloti | 0.9686 | 1 | 409 |
| 8apz-assembly1.cif.gz_B | crystal structure of wild-type l-n-carbamoylase from sinorhizobium meliloti | 0.9663 | 1 | 409 |
| 5i4m-assembly1.cif.gz_B | crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia vietnamiensis | 0.9656 | 2 | 405 |
| 8aq0-assembly1.cif.gz_B | crystal structure of l-n-carbamoylase from sinorhizobium meliloti mutant l217g/f329c | 0.9646 | 2 | 408 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5i4mA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9871 | 210 | 322 | 3.30.70.360 |
| 3n5fB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9747 | 210 | 322 | 3.30.70.360 |
| af_C0P5R8_269_385_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9671 | 210 | 322 | 3.40.630.10 |
| 1z2lA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9658 | 210 | 323 | 3.30.70.360 |
| 5i4mA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9619 | 210 | 322 | 3.30.70.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I2IWC1-F1-model_v4 | deleted | 0.975 | 210 | 286 |
|
| AF-A0A1M5DYX5-F1-model_v4 | N-carbamoyl-L-amino-acid hydrolase | 0.9722 | 13 | 409 |
GO:0016813
GO:0046872 |
| AF-A0A1M5DYX5-F1-model_v4 | N-carbamoyl-L-amino-acid hydrolase | 0.9698 | 13 | 409 |
GO:0016813
GO:0046872 |
| AF-A0A353VEN8-F1-model_v4 | Zn-dependent hydrolase | 0.9681 | 58 | 188 |
GO:0016813
|
| AF-A0A228QAI6-F1-model_v4 | Zn-dependent hydrolase | 0.968 | 2 | 406 |
GO:0016813
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar