F479587

General Info

Members Datasets Scaffolds Average Seq Length
761 585 364 413

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0000912|Ga0495654_0000912_19304_20758
Length 484
Sequence VTIFSLSDAAEFVSFYQAVKLSATSKTKAMPIFRPGRLDHRQASGKTTGNNKQAAIAQSINRVRTKNMVAAPGENLRVNGDRLWDMLMDMAKIGPGIAGGNNRQTLTDADGEGRHLFKTWCEAAGLTVGVDRMGTMFATRPGTDPDALPVYIGSHLDTQPTGGKFDGVLGVLAALEVVRSMNDLGITTKHPIVVTNWANEEGARFAPAMLASGVFAGVHSLDYAYGRKDPDGKTYGDELKRIGWLGDEEVGARKMHAYFEYHIEQGPILEADNKQIGVVTHCQGLWWLEFTLTGREAHTGSTPMAMRVNAGLAFGRILEMAQDVAMAEQPGAVAGVGQAFFSPNSRNVLPGTVVFTVDMRTPSQEKLDRMRARIESAAAEICDALGVGCSVEAVGHFDPITFDPTLVGRVRSAAEKLGYSHMDIISGAGHDACWAAKVAPATMIMCPCVGGLSHNEAEEISRDWAAAGCDVLFHAVVETAEIVE

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
8 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
14 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
15 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
16 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
17 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
18 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
19 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
20 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
21 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
22 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
23 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
24 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
25 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
26 2516143018 Ensifer sp. BR816 Isolate Nodule
27 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
28 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
29 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
30 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
31 2519899620 Rhizobium sp. Pop5 Isolate Nodule
32 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
33 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
34 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
35 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
36 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
37 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
38 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
39 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
40 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
41 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
42 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
43 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
44 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
45 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
46 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
47 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
48 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
49 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
50 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
51 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
52 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
53 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
54 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
55 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
56 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
57 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
58 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
59 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
60 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
61 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
62 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
63 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
64 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
65 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
66 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
67 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
68 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
69 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
70 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
71 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
72 2643221558 Rhizobium sp. Root149 Isolate Unclassified
73 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
74 2643221580 Devosia sp. Root635 Isolate Unclassified
75 2643221599 Rhizobium sp. Root708 Isolate Unclassified
76 2643221607 Rhizobium sp. Root73 Isolate Unclassified
77 2643221618 Ensifer sp. Root231 Isolate Unclassified
78 2643221626 Ensifer sp. Root31 Isolate Unclassified
79 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
80 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
81 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
82 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
83 2643221655 Ensifer sp. Root1252 Isolate Unclassified
84 2643221659 Ensifer sp. Root127 Isolate Unclassified
85 2643221674 Devosia sp. Root436 Isolate Unclassified
86 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
87 2643221688 Rhizobium sp. Root482 Isolate Unclassified
88 2643221693 Rhizobium sp. Root491 Isolate Unclassified
89 2643221698 Ensifer sp. Root142 Isolate Unclassified
90 2643221712 Ensifer sp. Root258 Isolate Unclassified
91 2643221718 Rhizobium sp. Root268 Isolate Unclassified
92 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
93 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
94 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
95 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
96 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
97 2718217882 Rhizobium sp. N741 Isolate Nodule
98 2718217927 Rhizobium sp. N324 Isolate Nodule
99 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
100 2718218009 Rhizobium sp. N561 Isolate Nodule
101 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
102 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
103 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
104 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
105 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
106 2718218363 Rhizobium sp. N113 Isolate Nodule
107 2718218365 Rhizobium sp. N731 Isolate Nodule
108 2718218366 Rhizobium sp. N621 Isolate Nodule
109 2718218423 Rhizobium sp. N941 Isolate Nodule
110 2721755514 Rhizobium sp. N6212 Isolate Nodule
111 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
112 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
113 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
114 2721755809 Rhizobium sp. N541 Isolate Nodule
115 2721755810 Rhizobium sp. N871 Isolate Nodule
116 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
117 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
118 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
119 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
120 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
121 2728369365 Rhizobium sp. N1341 Isolate Nodule
122 2728369397 Rhizobium sp. N1314 Isolate Nodule
123 2738541293 Rhizobium sp. GV031 Isolate Unclassified
124 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
125 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
126 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
127 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
128 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
129 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
130 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
131 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
132 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
133 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
134 2791355256 Rhizobium sp. M10 Isolate Nodule
135 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
136 2791355260 Rhizobium sp. L9 Isolate Nodule
137 2791355261 Rhizobium sp. J15 Isolate Nodule
138 2791355262 Rhizobium sp. M1 Isolate Nodule
139 2791355263 Rhizobium chutanense C5 Isolate Nodule
140 2791355264 Rhizobium sp. S9 Isolate Nodule
141 2791355265 Rhizobium sp. H4 Isolate Nodule
142 2791355266 Rhizobium sp. L43 Isolate Nodule
143 2791355267 Rhizobium sp. L18 Isolate Nodule
144 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
145 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
146 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
147 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
148 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
149 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
150 2802429633 Rhizobium anhuiense J3 Isolate Nodule
151 2802429634 Rhizobium anhuiense S10 Isolate Nodule
152 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
153 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
154 2802429637 Rhizobium anhuiense C15 Isolate Nodule
155 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
156 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
157 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
158 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
159 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
160 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
161 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
162 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
163 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
164 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
165 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
166 2838048938 Rhizobium pisi 27/80 Isolate Nodule
167 2838061910 Rhizobium phaseoli L15 Isolate Nodule
168 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
169 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
170 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
171 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
172 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
173 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
174 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
175 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
176 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
177 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
178 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
179 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
180 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
181 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
182 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
183 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
184 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
185 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
186 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
187 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
188 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
189 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
190 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
191 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
192 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
193 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
194 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
195 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
196 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
197 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
198 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
199 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
200 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
201 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
202 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
203 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
204 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
205 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
206 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
207 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
208 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
209 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
210 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
211 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
212 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
213 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
214 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
215 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
216 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
217 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
218 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
219 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
220 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
221 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
222 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
223 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
224 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
225 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
226 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
227 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
228 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
229 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
230 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
231 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
232 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
233 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
234 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
235 2844163670 Ensifer sp. 1H6 Isolate Unclassified
236 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
237 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
238 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
239 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
240 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
241 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
242 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
243 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
244 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
245 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
246 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
247 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
248 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
249 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
250 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
251 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
252 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
253 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
254 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
255 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
256 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
257 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
258 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
259 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
260 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
261 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
262 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
263 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
264 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
265 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
266 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
267 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
268 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
269 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
270 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
271 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
272 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
273 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
274 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
275 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
276 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
277 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
278 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
279 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
280 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
281 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
282 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
283 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
284 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
285 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
286 2932401849 Devosia sp. 2618 Isolate Rhizosphere
287 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
288 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
289 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
290 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
291 2933599457 Rhizobium phaseoli M3 Isolate Nodule
292 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
293 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
294 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
295 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
296 2936381700 Rhizobium chutanense C16 Isolate Unclassified
297 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
298 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
299 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
300 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
301 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
302 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
303 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
304 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
305 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
306 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
307 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
308 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
309 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
310 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
311 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
312 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
313 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
314 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
315 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
316 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
317 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
318 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
319 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
320 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
321 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
322 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
323 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
324 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
325 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
326 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
327 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
328 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
329 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
330 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
331 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
332 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
333 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
334 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
335 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
336 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
337 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
338 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
339 2996887358 Rhizobium sp. R711 Isolate Nodule
340 2996893221 Rhizobium sp. R635 Isolate Nodule
341 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
342 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
343 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
344 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
345 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
346 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
347 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
348 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
349 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
350 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
351 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
352 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
353 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
354 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
355 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
356 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
357 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
358 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
359 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
360 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
361 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
362 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
363 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
364 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
365 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
366 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
367 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
368 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
369 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
370 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
371 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
372 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
373 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
374 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
375 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
376 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
377 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
378 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
379 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
380 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
381 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
382 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
383 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
384 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
385 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
386 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
387 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
388 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
389 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
390 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
391 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
392 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
393 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
394 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
395 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
396 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
397 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
398 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
399 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
400 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
401 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
402 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
403 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
404 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
405 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
406 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
407 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
408 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
409 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
410 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
411 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
412 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
413 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
414 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
415 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
416 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
417 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
418 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
419 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
420 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
421 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
422 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
423 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
424 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
425 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
442 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
444 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
445 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
447 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
448 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
449 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
450 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
451 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
452 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
453 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
454 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
455 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
456 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
457 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
458 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
459 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
460 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
461 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
462 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
463 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
464 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
465 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
466 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
467 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
468 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
469 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
470 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
471 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
472 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
473 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
474 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
475 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
476 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
477 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
478 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
479 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
480 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
481 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
482 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
483 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
484 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
485 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
486 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
487 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
488 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
489 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
490 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
491 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
492 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
493 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
494 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
495 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
496 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
497 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
498 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
499 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
501 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
502 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
503 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
504 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
508 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
509 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
510 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
511 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
512 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
513 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
514 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
515 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
516 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
517 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
518 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
519 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
520 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
521 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
522 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
523 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
524 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
525 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
526 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
527 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
528 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
529 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
530 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
531 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
532 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
533 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
534 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
536 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
537 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
538 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
539 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
540 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
541 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
542 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
543 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
544 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
545 8005258706 Rhizobium sp. R693 Isolate Nodule
546 8005275841 Rhizobium sp. N4311 Isolate Nodule
547 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
548 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
549 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
550 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
551 8005321885 Rhizobium sp. R72 Isolate Nodule
552 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
553 8005382845 Rhizobium sp. R634 Isolate Nodule
554 8005395548 Rhizobium sp. R339 Isolate Nodule
555 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
556 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
557 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
558 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
559 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
560 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
561 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
562 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
563 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
564 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
565 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
566 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
567 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
568 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
569 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
570 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
571 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
572 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
573 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
574 8018176218 Rhizobium sp. N122 Isolate Nodule
575 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
576 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
577 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
578 8024501048 Rhizobium sp. H4 Isolate Nodule
579 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
580 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
581 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
582 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
583 8056382006 Rhizobium croatiense 13T Isolate Nodule
584 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
585 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.7
Metatranscriptomes 0.13
Isolates 52.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 17.08
Nodule 35.48
Rhizoplane 1.05
Rhizosphere 29.83
Stem 0
Stem Tuber 0
Unclassified 16.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000066 3300002704 Bacteria 69429
2 JGI25156J39149_1000075 3300002705 Bacteria 76505
3 JGI25162J39368_1000149 3300002737 Bacteria 76227
4 JGI25162J39368_1000211 3300002737 Bacteria 61063
5 JGI25154J39366_1000075 3300002738 Bacteria 91249
6 JGI25158J39367_1000194 3300002739 Bacteria 14540
7 JGI25157J39369_1000051 3300002741 Bacteria 111770
8 JGI25157J39369_1000077 3300002741 Bacteria 86251
9 JGI25152J39213_1001494 3300002773 Bacteria 9965
10 JGI25152J39213_1005813 3300002773 Bacteria 3500
11 JGI25159J45721_1000108 3300002987 Bacteria 39183
12 JGI25151J46595_10002158 3300003187 Bacteria 12188
13 JGI25151J46595_10002818 3300003187 Bacteria 10046
14 JGI25151J46595_10004382 3300003187 Bacteria 7481
15 JGI25151J46595_10012482 3300003187 Bacteria 3863
16 JGI25165J46597_1000938 3300003214 Bacteria 19980
17 JGI25165J46597_1003676 3300003214 Bacteria 3661
18 JGI25165J46597_1004248 3300003214 Bacteria 3148
19 JGI25153J46596_10012364 3300003215 Bacteria 3689
20 JGI25153J46596_10025006 3300003215 Bacteria 2142
21 JGI25153J46596_10035257 3300003215 Bacteria 1623
22 JGI25160J50197_1000001 3300003354 Bacteria 782301
23 JGI25160J50197_1004300 3300003354 Bacteria 6173
24 JGI25160J50197_1008515 3300003354 Bacteria 3902
25 JGI25160J50197_1008936 3300003354 Bacteria 3763
26 JGI25161J50226_1000001 3300003374 Bacteria 655036
27 JGI25161J50226_1000163 3300003374 Bacteria 46470
28 Ga0055526_1004503 3300003771 Bacteria 8344
29 Ga0055526_1009408 3300003771 Bacteria 4703
30 Ga0055526_1009759 3300003771 Bacteria 4567
31 Ga0055524_1001395 3300003775 Bacteria 13921
32 Ga0055524_1003836 3300003775 Bacteria 7138
33 Ga0055524_1011581 3300003775 Bacteria 3440
34 Ga0055536_1015425 3300003781 Bacteria 2615
35 Ga0055528_1000662 3300003790 Bacteria 25014
36 Ga0055528_1013493 3300003790 Bacteria 3090
37 Ga0055528_1013735 3300003790 Bacteria 3049
38 Ga0055528_1017225 3300003790 Bacteria 2515
39 Ga0055540_1001547 3300003792 Bacteria 13472
40 Ga0055531_10007648 3300003794 Bacteria 5850
41 Ga0058692_1001033 3300003856 Bacteria 10914
42 Ga0055543_1000007 3300004625 Bacteria 204042
43 Ga0055543_1000104 3300004625 Bacteria 73576
44 Ga0055543_1000108 3300004625 Bacteria 71519
45 Ga0065165_1000008 3300005262 Bacteria 334429
46 Ga0065165_1005090 3300005262 Bacteria 7640
47 Ga0065165_1012225 3300005262 Bacteria 3511
48 Ga0065165_1040336 3300005262 Bacteria 1393
49 Ga0070670_100001446 3300005331 Bacteria 19064
50 Ga0070668_100209700 3300005347 Bacteria 1602
51 Ga0070674_100057957 3300005356 Bacteria 2691
52 Ga0070659_100058483 3300005366 Bacteria 3042
53 Ga0068853_100046936 3300005539 Bacteria 3706
54 Ga0070664_100081573 3300005564 Bacteria 2788
55 Ga0068856_100048755 3300005614 Bacteria 4174
56 Ga0068856_100094678 3300005614 Bacteria 2973
57 Ga0068856_100097257 3300005614 Bacteria 2933
58 Ga0081455_10018499 3300005937 Bacteria 6634
59 Ga0075365_10000510 3300006038 Bacteria 14791
60 Ga0075365_10003643 3300006038 Bacteria 7985
61 Ga0075363_100041270 3300006048 Bacteria 2433
62 Ga0075364_10087149 3300006051 Bacteria 2069
63 Ga0075362_10008871 3300006177 Bacteria 3865
64 Ga0075367_10001877 3300006178 Bacteria 9292
65 Ga0075366_10014942 3300006195 Bacteria 4439
66 Ga0075366_10028507 3300006195 Bacteria 3277
67 Ga0075370_10015910 3300006353 Bacteria 4038
68 Ga0075370_10016018 3300006353 Bacteria 4027
69 Ga0075370_10016383 3300006353 Bacteria 3988
70 Ga0075430_100067112 3300006846 Bacteria 3012
71 Ga0068865_100214514 3300006881 Bacteria 1502
72 Ga0079104_1000015 3300006946 Bacteria 321803
73 Ga0105240_10000014 3300009093 Bacteria 482033
74 Ga0114129_10124864 3300009147 Bacteria 3539
75 Ga0114129_10230519 3300009147 Bacteria 2494
76 Ga0105243_10004033 3300009148 Bacteria 11688
77 Ga0105248_10080268 3300009177 Bacteria 3666
78 Ga0105248_10389876 3300009177 Bacteria 1568
79 Ga0105237_10008351 3300009545 Bacteria 11227
80 Ga0105237_10034929 3300009545 Bacteria 5088
81 Ga0123341_1000018 3300009765 Bacteria 81421
82 Ga0123342_1021678 3300009766 Bacteria 4474
83 Ga0105239_10000552 3300010375 Bacteria 53680
84 Ga0105239_10024598 3300010375 Bacteria 6634
85 Ga0105239_10106601 3300010375 Bacteria 3104
86 Ga0105239_10133420 3300010375 Bacteria 2763
87 Ga0157371_10000165 3300013102 Bacteria 96321
88 Ga0157370_10000015 3300013104 Bacteria 185771
89 Ga0157378_10208885 3300013297 Bacteria 1850
90 Ga0182008_10015373 3300014497 Bacteria 3994
91 Ga0182007_10000385 3300015262 Bacteria 27600
92 Ga0214542_1000023 3300021321 Bacteria 191557
93 Ga0214543_1000019 3300021327 Bacteria 267908
94 Ga0209435_100005 3300025206 Bacteria 573745
95 Ga0209760_103244 3300025207 Bacteria 1454
96 Ga0209436_100058 3300025208 Bacteria 60755
97 Ga0209437_100058 3300025233 Bacteria 357279
98 Ga0209437_100060 3300025233 Bacteria 355034
99 Ga0207425_1000436 3300025245 Bacteria 27617
100 Ga0207425_1009106 3300025245 Bacteria 2492
101 Ga0209646_1000011 3300025246 Bacteria 573745
102 Ga0209026_1000008 3300025250 Bacteria 573745
103 Ga0209677_100289 3300025253 Bacteria 33302
104 Ga0209759_1000004 3300025256 Bacteria 573745
105 Ga0209129_1000128 3300025258 Bacteria 130420
106 Ga0209129_1000976 3300025258 Bacteria 17199
107 Ga0209129_1002097 3300025258 Bacteria 10213
108 Ga0209129_1002855 3300025258 Bacteria 7982
109 Ga0209129_1003400 3300025258 Bacteria 6972
110 Ga0209129_1014582 3300025258 Bacteria 1667
111 Ga0209233_1000137 3300025261 Bacteria 200314
112 Ga0209233_1000149 3300025261 Bacteria 181183
113 Ga0209233_1000160 3300025261 Bacteria 159035
114 Ga0209233_1000391 3300025261 Bacteria 37267
115 Ga0209673_1000125 3300025273 Bacteria 168465
116 Ga0209673_1000256 3300025273 Bacteria 100514
117 Ga0209673_1001124 3300025273 Bacteria 29604
118 Ga0209673_1001756 3300025273 Bacteria 18064
119 Ga0209673_1002455 3300025273 Bacteria 12830
120 Ga0209673_1003474 3300025273 Bacteria 9256
121 Ga0209673_1008164 3300025273 Bacteria 4703
122 Ga0209673_1008302 3300025273 Bacteria 4634
123 Ga0209130_1000003 3300025284 Bacteria 677988
124 Ga0209130_1000023 3300025284 Bacteria 359355
125 Ga0209130_1009056 3300025284 Bacteria 2873
126 Ga0209130_1012131 3300025284 Bacteria 2272
127 Ga0209676_1006852 3300025292 Bacteria 5518
128 Ga0209025_1000154 3300025294 Bacteria 170288
129 Ga0209025_1000451 3300025294 Bacteria 80470
130 Ga0209025_1000537 3300025294 Bacteria 71838
131 Ga0209025_1001209 3300025294 Bacteria 36250
132 Ga0209025_1003817 3300025294 Bacteria 13758
133 Ga0209025_1005577 3300025294 Bacteria 10192
134 Ga0209564_1000259 3300025295 Bacteria 112570
135 Ga0209564_1000841 3300025295 Bacteria 41363
136 Ga0209564_1002070 3300025295 Bacteria 17245
137 Ga0209564_1002604 3300025295 Bacteria 13811
138 Ga0209758_1000058 3300025297 Bacteria 331603
139 Ga0209758_1000254 3300025297 Bacteria 107330
140 Ga0209758_1000592 3300025297 Bacteria 56476
141 Ga0209758_1000678 3300025297 Bacteria 50806
142 Ga0209758_1002403 3300025297 Bacteria 19211
143 Ga0209758_1003028 3300025297 Bacteria 16025
144 Ga0209758_1029977 3300025297 Bacteria 2262
145 Ga0209050_1005160 3300025298 Bacteria 8364
146 Ga0209256_1000283 3300025299 Bacteria 89387
147 Ga0209256_1000669 3300025299 Bacteria 46351
148 Ga0209256_1001412 3300025299 Bacteria 24978
149 Ga0209256_1003656 3300025299 Bacteria 10516
150 Ga0209256_1016918 3300025299 Bacteria 2454
151 Ga0207426_1000011 3300025302 Bacteria 791203
152 Ga0207426_1000087 3300025302 Bacteria 288870
153 Ga0207426_1000208 3300025302 Bacteria 140385
154 Ga0207426_1000936 3300025302 Bacteria 29086
155 Ga0209051_1000434 3300025303 Bacteria 56673
156 Ga0209051_1002705 3300025303 Bacteria 12332
157 Ga0209051_1004907 3300025303 Bacteria 8010
158 Ga0209051_1011248 3300025303 Bacteria 4437
159 Ga0209051_1032772 3300025303 Bacteria 1976
160 Ga0209257_1004213 3300025304 Bacteria 11397
161 Ga0207656_10026758 3300025321 Bacteria 2354
162 Ga0207705_10016659 3300025909 Bacteria 5264
163 Ga0207695_10000037 3300025913 Bacteria 476303
164 Ga0207671_10000080 3300025914 Bacteria 148567
165 Ga0207671_10001343 3300025914 Bacteria 28757
166 Ga0207671_10019105 3300025914 Bacteria 5249
167 Ga0207657_10022185 3300025919 Bacteria 5954
168 Ga0207649_10001014 3300025920 Bacteria 17344
169 Ga0207694_10201043 3300025924 Bacteria 1621
170 Ga0207650_10000624 3300025925 Bacteria 28219
171 Ga0207644_10027543 3300025931 Bacteria 3927
172 Ga0207669_10039648 3300025937 Bacteria 2724
173 Ga0207711_10050887 3300025941 Bacteria 3547
174 Ga0207711_10347149 3300025941 Bacteria 1374
175 Ga0207667_10027587 3300025949 Bacteria 6177
176 Ga0207667_10064549 3300025949 Bacteria 3822
177 Ga0207667_10094888 3300025949 Bacteria 3080
178 Ga0207668_10150444 3300025972 Bacteria 1801
179 Ga0207658_10227411 3300025986 Bacteria 1573
180 Ga0207639_10001237 3300026041 Bacteria 17295
181 Ga0207639_10002277 3300026041 Bacteria 12907
182 Ga0207678_10012369 3300026067 Bacteria 7491
183 Ga0207702_10054621 3300026078 Bacteria 3385
184 Ga0207702_10061226 3300026078 Bacteria 3210
185 Ga0207648_10176900 3300026089 Bacteria 1887
186 Ga0209281_1000068 3300027111 Bacteria 280238
187 Ga0209371_1000022 3300027312 Bacteria 536342
188 Ga0209371_1016380 3300027312 Bacteria 1957
189 Ga0268266_10000753 3300028379 Bacteria 43310
190 Ga0265318_10026903 3300028577 Bacteria 2263
191 Ga0307515_10042022 3300028794 Bacteria 7169
192 Ga0265338_10055133 3300028800 Bacteria 3538
193 Ga0268256_1000019 3300030500 Bacteria 587949
194 Ga0268256_1002919 3300030500 Bacteria 8174
195 Ga0268256_1016660 3300030500 Bacteria 2096
196 Ga0265330_10052584 3300031235 Bacteria 1784
197 Ga0265325_10017179 3300031241 Bacteria 4024
198 Ga0265325_10050957 3300031241 Bacteria 2130
199 Ga0265340_10021572 3300031247 Bacteria 3303
200 Ga0265339_10002355 3300031249 Bacteria 13581
201 Ga0265316_10195925 3300031344 Bacteria 1499
202 Ga0307513_10056156 3300031456 Bacteria 4206
203 Ga0307513_10224220 3300031456 Bacteria 1698
204 Ga0265313_10000048 3300031595 Bacteria 112723
205 Ga0265313_10016705 3300031595 Bacteria 4208
206 Ga0265314_10025741 3300031711 Bacteria 4432
207 Ga0307414_10214947 3300032004 Bacteria 1574
208 Ga0307414_10300625 3300032004 Bacteria 1357
209 Ga0395899_0026042 3300037312 Bacteria 4413
210 Ga0395900_0118984 3300037418 Bacteria 2711
211 Ga0395898_0321675 3300037466 Bacteria 1476
212 Ga0395905_0002480 3300037471 Bacteria 20425
213 Ga0395905_0002698 3300037471 Bacteria 19454
214 Ga0395905_0079057 3300037471 Bacteria 3082
215 Ga0395905_0243271 3300037471 Bacteria 1681
216 Ga0395901_0128521 3300038443 Bacteria 2663
217 Ga0395901_0239783 3300038443 Bacteria 1891
218 Ga0395901_0259976 3300038443 Bacteria 1807
219 Ga0451787_267633 3300041441 Bacteria 2959
220 Ga0451835_0620589 3300041492 Bacteria 2148
221 Ga0451839_1069755 3300041496 Bacteria 2170
222 Ga0451851_0685669 3300041507 Bacteria 5290
223 Ga0451853_3017342 3300041512 Bacteria 3753
224 Ga0466970_0060481 3300044765 Bacteria 2029
225 Ga0495638_0000746 3300046460 Bacteria 34841
226 Ga0495638_0040547 3300046460 Bacteria 2950
227 Ga0495605_0033036 3300046474 Bacteria 2630
228 Ga0495606_0003935 3300046507 Bacteria 15284
229 Ga0495606_0020624 3300046507 Bacteria 4851
230 Ga0495610_0006541 3300046512 Bacteria 7984
231 Ga0495632_0026990 3300046519 Bacteria 3014
232 Ga0495654_0000912 3300046530 Bacteria 21951
233 Ga0495609_0010907 3300046538 Bacteria 4341
234 Ga0495668_0006000 3300046616 Bacteria 8064
235 Ga0495625_0047808 3300046660 Bacteria 3084
236 Ga0495588_0002287 3300046674 Bacteria 8201
237 Ga0495588_0053761 3300046674 Bacteria 2077
238 Ga0495686_0003605 3300047472 Bacteria 13275
239 Ga0496106_0000206 3300048909 Bacteria 41054
240 Ga0496116_0032986 3300048919 Bacteria 3682
241 Ga0496117_0000002 3300048920 Bacteria 2483758
242 Ga0496117_0094014 3300048920 Bacteria 1920
243 Ga0496118_0000736 3300048921 Bacteria 52853
244 Ga0496118_0003614 3300048921 Bacteria 19207
245 Ga0496119_0041157 3300048922 Bacteria 2946
246 Ga0496120_0000534 3300048923 Bacteria 58507
247 Ga0496120_0005660 3300048923 Bacteria 9880
248 Ga0496121_0000003 3300048924 Bacteria 1191431
249 Ga0496121_0015046 3300048924 Bacteria 8142
250 Ga0496122_0000004 3300048925 Bacteria 645283
251 Ga0496122_0000042 3300048925 Bacteria 280482
252 Ga0496122_0066336 3300048925 Bacteria 2608
253 Ga0496122_0096538 3300048925 Bacteria 1992
254 Ga0496123_0000007 3300048926 Bacteria 645283
255 Ga0496123_0000030 3300048926 Bacteria 291764
256 Ga0496124_0000067 3300048927 Bacteria 222576
257 Ga0496124_0048453 3300048927 Bacteria 3630
258 Ga0496124_0122407 3300048927 Bacteria 2077
259 Ga0496124_0169591 3300048927 Bacteria 1692
260 Ga0496124_0206341 3300048927 Bacteria 1490
261 Ga0496125_0000262 3300048928 Bacteria 108389
262 Ga0496125_0000270 3300048928 Bacteria 106118
263 Ga0496125_0090489 3300048928 Bacteria 2296
264 Ga0496125_0127921 3300048928 Bacteria 1796
265 Ga0496126_0023200 3300048929 Bacteria 6015
266 Ga0495678_007866 3300049459 Bacteria 5476
267 Ga0501031_0000010 3300049568 Bacteria 146435
268 Ga0501031_0036746 3300049568 Bacteria 3196
269 Ga0501032_0000023 3300049569 Bacteria 146435
270 Ga0501032_0000075 3300049569 Bacteria 84153
271 Ga0501032_0091327 3300049569 Bacteria 2020
272 Ga0501032_0100942 3300049569 Bacteria 1911
273 Ga0501033_0000216 3300049570 Bacteria 55449
274 Ga0501033_0000308 3300049570 Bacteria 46219
275 Ga0501033_0041133 3300049570 Bacteria 3450
276 Ga0501033_0112933 3300049570 Bacteria 1976
277 Ga0501034_0000116 3300049571 Bacteria 146442
278 Ga0501034_0000476 3300049571 Bacteria 65960
279 Ga0501034_0040163 3300049571 Bacteria 4737
280 Ga0501034_0049018 3300049571 Bacteria 4262
281 Ga0501034_0075227 3300049571 Bacteria 3385
282 Ga0501034_0125726 3300049571 Bacteria 2549
283 Ga0501034_0126173 3300049571 Bacteria 2544
284 Ga0501034_0134746 3300049571 Bacteria 2451
285 Ga0501034_0149848 3300049571 Bacteria 2309
286 Ga0501036_0000015 3300049572 Bacteria 146442
287 Ga0501036_0000540 3300049572 Bacteria 27084
288 Ga0501036_0129866 3300049572 Bacteria 2127
289 Ga0501037_0000021 3300049573 Bacteria 150037
290 Ga0501037_0000023 3300049573 Bacteria 146542
291 Ga0501037_0068868 3300049573 Bacteria 2576
292 Ga0501038_0000025 3300049574 Bacteria 146542
293 Ga0501038_0000032 3300049574 Bacteria 131432
294 Ga0501038_0121196 3300049574 Bacteria 2156
295 Ga0501038_0146276 3300049574 Bacteria 1929
296 Ga0501039_0000025 3300049575 Bacteria 152236
297 Ga0501039_0000037 3300049575 Bacteria 122286
298 Ga0501039_0018288 3300049575 Bacteria 5378
299 Ga0501040_0012464 3300049576 Bacteria 5571
300 Ga0501043_0000570 3300049579 Bacteria 32944
301 Ga0501043_0008991 3300049579 Bacteria 7860
302 Ga0501043_0011454 3300049579 Bacteria 6943
303 Ga0501043_0058885 3300049579 Bacteria 3014
304 Ga0501046_0047765 3300049580 Bacteria 3393
305 Ga0501046_0067979 3300049580 Bacteria 2774
306 Ga0501046_0072957 3300049580 Bacteria 2664
307 Ga0501047_0005004 3300049581 Bacteria 12438
308 Ga0501047_0025729 3300049581 Bacteria 5659
309 Ga0501047_0053396 3300049581 Bacteria 3907
310 Ga0501048_0007452 3300049582 Bacteria 8293
311 Ga0501067_0002349 3300049583 Bacteria 10468
312 Ga0501069_0004804 3300049585 Bacteria 6995
313 Ga0501070_0005027 3300049586 Bacteria 11280
314 Ga0501070_0010394 3300049586 Bacteria 7867
315 Ga0501070_0021657 3300049586 Bacteria 5390
316 Ga0501070_0054870 3300049586 Bacteria 3304
317 Ga0501070_0099045 3300049586 Bacteria 2411
318 Ga0501073_0002930 3300049589 Bacteria 12804
319 Ga0501073_0007316 3300049589 Bacteria 8218
320 Ga0501073_0048136 3300049589 Bacteria 2994
321 Ga0501074_0020559 3300049590 Bacteria 4797
322 Ga0501076_0122163 3300049592 Bacteria 2109
323 Ga0501077_0047815 3300049593 Bacteria 2718
324 Ga0501080_0000429 3300049742 Bacteria 32423
325 Ga0501080_0028634 3300049742 Bacteria 5185
326 Ga0501083_0010993 3300049744 Bacteria 6362
327 Ga0501083_0033085 3300049744 Bacteria 3541
328 Ga0501083_0088339 3300049744 Bacteria 2049
329 Ga0501035_0000074 3300049822 Bacteria 122269
330 Ga0501035_0000085 3300049822 Bacteria 116189
331 Ga0501035_0003697 3300049822 Bacteria 14584
332 Ga0501035_0044853 3300049822 Bacteria 3979
333 Ga0501035_0047191 3300049822 Bacteria 3868
334 Ga0501035_0062977 3300049822 Bacteria 3299
335 Ga0501035_0135392 3300049822 Bacteria 2145
336 Ga0501035_0153649 3300049822 Bacteria 1996
337 Ga0501044_0000069 3300049823 Bacteria 125974
338 Ga0501044_0009602 3300049823 Bacteria 10529
339 Ga0501044_0046671 3300049823 Bacteria 4484
340 Ga0501044_0099994 3300049823 Bacteria 2918
341 Ga0501044_0143512 3300049823 Bacteria 2375
342 Ga0501044_0260565 3300049823 Bacteria 1672
343 Ga0501045_0017706 3300049824 Bacteria 5059
344 nmdc:mga03683_17941_c1 3300050489 Bacteria 2684
345 nmdc:mga00v17_15220_c1 3300050491 Bacteria 4313
346 nmdc:mga00v17_7_c1 3300050491 Bacteria 167228
347 nmdc:mga00v17_81851_c1 3300050491 Bacteria 2017
348 nmdc:mga0yw44_52596_c1 3300050492 Bacteria 2470
349 nmdc:mga0k408_21953_c1 3300050493 Bacteria 3590
350 nmdc:mga05p37_462250_c1 3300050507 Bacteria 1466
351 nmdc:mga0qj67_2433_c1 3300050509 Bacteria 13256
352 nmdc:mga0n895_15824_c1 3300050512 Bacteria 6896
353 Ga0500560_005310 3300053107 Bacteria 2840
354 Ga0500618_003259 3300053125 Bacteria 5642
355 Ga0500658_0005826 3300053134 Bacteria 4589
356 Ga0500561_0001746 3300053137 Bacteria 3579
357 Ga0500616_0002773 3300053153 Bacteria 14146
358 Ga0500634_0000003 3300053161 Bacteria 245536
359 Ga0500634_0014987 3300053161 Bacteria 4105
360 Ga0500636_0001803 3300053177 Bacteria 11727
361 Ga0501084_0017036 3300054114 Bacteria 6037
362 Ga0501084_0169052 3300054114 Bacteria 1845
363 Ga0587072_007591 3300059643 Bacteria 1692
364 Ga0501082_0007985 3300060353 Bacteria 9137

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025207 Ga0209760_103244 Ga0209760_1032442 369
2 3300050507 nmdc:mga05p37_462250_c1 nmdc:mga05p37_462250_c1_119_1360 385
3 3300050512 nmdc:mga0n895_15824_c1 nmdc:mga0n895_15824_c1_4730_5971 385
4 iso_pu_bacteria 2882632389 2882636258 391
5 iso_pu_bacteria 2885305155 2885309416 391
6 iso_pu_bacteria 2885334103 2885342090 391
7 iso_pu_bacteria 2643221674 2644412074 393
8 iso_pu_bacteria 2847686936 2847692243 393
9 iso_pu_bacteria 2857349434 2857351166 393
10 iso_pu_bacteria 2871444079 2871447558 393
11 iso_pu_bacteria 2871495908 2871501413 393
12 iso_pu_bacteria 2874102143 2874109025 393
13 iso_pu_bacteria 2874155637 2874158101 393
14 iso_pu_bacteria 2878035449 2878040717 393
15 iso_pu_bacteria 2878760144 2878765393 393
16 iso_pu_bacteria 2878767105 2878773101 393
17 iso_pu_bacteria 2885326080 2885327189 393
18 iso_pu_bacteria 2903540706 2903546224 393
19 iso_pu_bacteria 2922158528 2922161112 393
20 iso_pu_bacteria 2924726620 2924727566 393
21 3300049744 Ga0501083_0088339 Ga0501083_0088339_832_2019 395
22 3300037471 Ga0395905_0079057 Ga0395905_0079057_1098_2291 397
23 3300038443 Ga0395901_0259976 Ga0395901_0259976_97_1290 397
24 3300041492 Ga0451835_0620589 Ga0451835_0620589_14_1207 397
25 3300049579 Ga0501043_0058885 Ga0501043_0058885_22_1215 397
26 3300049580 Ga0501046_0072957 Ga0501046_0072957_1450_2643 397
27 3300003354 JGI25160J50197_1008515 JGI25160J50197_10085153 399
28 3300005347 Ga0070668_100209700 Ga0070668_1002097001 399
29 3300025273 Ga0209673_1001756 Ga0209673_10017562 399
30 3300025284 Ga0209130_1009056 Ga0209130_10090562 399
31 3300025299 Ga0209256_1003656 Ga0209256_10036562 399
32 3300025302 Ga0207426_1000936 Ga0207426_10009368 399
33 3300025972 Ga0207668_10150444 Ga0207668_101504442 399
34 3300048927 Ga0496124_0206341 Ga0496124_0206341_277_1476 399
35 3300049574 Ga0501038_0121196 Ga0501038_0121196_625_1860 404
36 3300005937 Ga0081455_10018499 Ga0081455_100184996 405
37 3300006846 Ga0075430_100067112 Ga0075430_1000671121 405
38 3300009147 Ga0114129_10124864 Ga0114129_101248642 405
39 3300009147 Ga0114129_10230519 Ga0114129_102305192 405
40 3300050509 nmdc:mga0qj67_2433_c1 nmdc:mga0qj67_2433_c1_6146_7387 405
41 iso_pu_bacteria 2510917022 2511131939 405
42 iso_pu_bacteria 2524023209 2524459022 405
43 iso_pu_bacteria 2582581307 2585273979 405
44 iso_pu_bacteria 2582581308 2585279440 405
45 iso_pu_bacteria 2582581315 2585322900 405
46 iso_pu_bacteria 2585427530 2585553003 405
47 iso_pu_bacteria 2585427531 2585560430 405
48 iso_pu_bacteria 2617270742 2617384873 405
49 iso_pu_bacteria 2667528174 2671111871 405
50 iso_pu_bacteria 2775507266 2778173393 405
51 iso_pu_bacteria 2818991448 2819609916 405
52 iso_pu_bacteria 2818991453 2819640027 405
53 iso_pu_bacteria 2838029111 2838033228 405
54 iso_pu_bacteria 2842298080 2842298374 405
55 iso_pu_bacteria 2842357229 2842360386 405
56 iso_pu_bacteria 2842475841 2842480107 405
57 iso_pu_bacteria 2842482326 2842483698 405
58 iso_pu_bacteria 2842502639 2842505108 405
59 iso_pu_bacteria 2842509118 2842510390 405
60 iso_pu_bacteria 2919408235 2919410371 405
61 iso_pu_bacteria 3005416602 3005418805 405
62 iso_pu_bacteria 8005314921 8005318303 405
63 iso_pu_bacteria 8005484373 8005488816 405
64 iso_pu_bacteria 8005645114 8005645808 405
65 iso_pu_bacteria 8005682033 8005682510 405
66 iso_pu_bacteria 8046767195 8046772631 405
67 iso_pu_bacteria 8057575449 8057576910 405
68 3300003215 JGI25153J46596_10012364 JGI25153J46596_100123643 406
69 3300031456 Ga0307513_10224220 Ga0307513_102242202 408
70 3300002704 JGI25155J39150_1000066 JGI25155J39150_100006626 409
71 3300002705 JGI25156J39149_1000075 JGI25156J39149_100007541 409
72 3300002737 JGI25162J39368_1000149 JGI25162J39368_100014928 409
73 3300002737 JGI25162J39368_1000211 JGI25162J39368_100021130 409
74 3300002738 JGI25154J39366_1000075 JGI25154J39366_100007542 409
75 3300002739 JGI25158J39367_1000194 JGI25158J39367_10001942 409
76 3300002741 JGI25157J39369_1000051 JGI25157J39369_100005179 409
77 3300002741 JGI25157J39369_1000077 JGI25157J39369_100007753 409
78 3300002773 JGI25152J39213_1001494 JGI25152J39213_10014943 409
79 3300002773 JGI25152J39213_1005813 JGI25152J39213_10058133 409
80 3300002987 JGI25159J45721_1000108 JGI25159J45721_100010817 409
81 3300003187 JGI25151J46595_10002158 JGI25151J46595_100021588 409
82 3300003187 JGI25151J46595_10002818 JGI25151J46595_100028182 409
83 3300003187 JGI25151J46595_10004382 JGI25151J46595_100043822 409
84 3300003187 JGI25151J46595_10012482 JGI25151J46595_100124821 409
85 3300003214 JGI25165J46597_1000938 JGI25165J46597_100093824 409
86 3300003214 JGI25165J46597_1003676 JGI25165J46597_10036763 409
87 3300003214 JGI25165J46597_1004248 JGI25165J46597_10042483 409
88 3300003215 JGI25153J46596_10025006 JGI25153J46596_100250061 409
89 3300003215 JGI25153J46596_10035257 JGI25153J46596_100352571 409
90 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001174 409
91 3300003354 JGI25160J50197_1004300 JGI25160J50197_10043003 409
92 3300003354 JGI25160J50197_1008936 JGI25160J50197_10089362 409
93 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001594 409
94 3300003374 JGI25161J50226_1000163 JGI25161J50226_100016332 409
95 3300003771 Ga0055526_1004503 Ga0055526_10045036 409
96 3300003771 Ga0055526_1009408 Ga0055526_10094082 409
97 3300003771 Ga0055526_1009759 Ga0055526_10097591 409
98 3300003775 Ga0055524_1001395 Ga0055524_10013954 409
99 3300003775 Ga0055524_1003836 Ga0055524_10038366 409
100 3300003775 Ga0055524_1011581 Ga0055524_10115813 409
101 3300003781 Ga0055536_1015425 Ga0055536_10154252 409
102 3300003790 Ga0055528_1000662 Ga0055528_100066210 409
103 3300003790 Ga0055528_1013493 Ga0055528_10134931 409
104 3300003790 Ga0055528_1013735 Ga0055528_10137353 409
105 3300003790 Ga0055528_1017225 Ga0055528_10172251 409
106 3300003792 Ga0055540_1001547 Ga0055540_10015471 409
107 3300003794 Ga0055531_10007648 Ga0055531_100076488 409
108 3300003856 Ga0058692_1001033 Ga0058692_100103311 409
109 3300004625 Ga0055543_1000007 Ga0055543_100000721 409
110 3300004625 Ga0055543_1000104 Ga0055543_100010472 409
111 3300004625 Ga0055543_1000108 Ga0055543_100010845 409
112 3300005262 Ga0065165_1000008 Ga0065165_1000008289 409
113 3300005262 Ga0065165_1005090 Ga0065165_10050903 409
114 3300005262 Ga0065165_1012225 Ga0065165_10122253 409
115 3300005262 Ga0065165_1040336 Ga0065165_10403361 409
116 3300005331 Ga0070670_100001446 Ga0070670_10000144619 409
117 3300005356 Ga0070674_100057957 Ga0070674_1000579572 409
118 3300005366 Ga0070659_100058483 Ga0070659_1000584835 409
119 3300005539 Ga0068853_100046936 Ga0068853_1000469363 409
120 3300005564 Ga0070664_100081573 Ga0070664_1000815732 409
121 3300005614 Ga0068856_100048755 Ga0068856_1000487553 409
122 3300005614 Ga0068856_100094678 Ga0068856_1000946782 409
123 3300005614 Ga0068856_100097257 Ga0068856_1000972572 409
124 3300006038 Ga0075365_10000510 Ga0075365_1000051013 409
125 3300006038 Ga0075365_10003643 Ga0075365_100036438 409
126 3300006048 Ga0075363_100041270 Ga0075363_1000412703 409
127 3300006051 Ga0075364_10087149 Ga0075364_100871492 409
128 3300006177 Ga0075362_10008871 Ga0075362_100088712 409
129 3300006178 Ga0075367_10001877 Ga0075367_100018779 409
130 3300006195 Ga0075366_10014942 Ga0075366_100149423 409
131 3300006195 Ga0075366_10028507 Ga0075366_100285073 409
132 3300006353 Ga0075370_10015910 Ga0075370_100159102 409
133 3300006353 Ga0075370_10016018 Ga0075370_100160183 409
134 3300006353 Ga0075370_10016383 Ga0075370_100163834 409
135 3300006881 Ga0068865_100214514 Ga0068865_1002145142 409
136 3300006946 Ga0079104_1000015 Ga0079104_1000015150 409
137 3300009093 Ga0105240_10000014 Ga0105240_10000014122 409
138 3300009148 Ga0105243_10004033 Ga0105243_100040334 409
139 3300009177 Ga0105248_10080268 Ga0105248_100802682 409
140 3300009177 Ga0105248_10389876 Ga0105248_103898761 409
141 3300009545 Ga0105237_10008351 Ga0105237_100083517 409
142 3300009545 Ga0105237_10034929 Ga0105237_100349294 409
143 3300009765 Ga0123341_1000018 Ga0123341_100001855 409
144 3300009766 Ga0123342_1021678 Ga0123342_10216783 409
145 3300010375 Ga0105239_10000552 Ga0105239_1000055220 409
146 3300010375 Ga0105239_10024598 Ga0105239_100245984 409
147 3300010375 Ga0105239_10106601 Ga0105239_101066012 409
148 3300010375 Ga0105239_10133420 Ga0105239_101334201 409
149 3300013102 Ga0157371_10000165 Ga0157371_1000016580 409
150 3300013104 Ga0157370_10000015 Ga0157370_10000015122 409
151 3300013297 Ga0157378_10208885 Ga0157378_102088851 409
152 3300014497 Ga0182008_10015373 Ga0182008_100153732 409
153 3300015262 Ga0182007_10000385 Ga0182007_1000038523 409
154 3300021321 Ga0214542_1000023 Ga0214542_1000023106 409
155 3300021327 Ga0214543_1000019 Ga0214543_1000019181 409
156 3300025206 Ga0209435_100005 Ga0209435_100005471 409
157 3300025208 Ga0209436_100058 Ga0209436_10005868 409
158 3300025233 Ga0209437_100058 Ga0209437_100058114 409
159 3300025233 Ga0209437_100060 Ga0209437_100060146 409
160 3300025245 Ga0207425_1000436 Ga0207425_100043627 409
161 3300025245 Ga0207425_1009106 Ga0207425_10091062 409
162 3300025246 Ga0209646_1000011 Ga0209646_1000011471 409
163 3300025250 Ga0209026_1000008 Ga0209026_1000008471 409
164 3300025253 Ga0209677_100289 Ga0209677_1002892 409
165 3300025256 Ga0209759_1000004 Ga0209759_1000004471 409
166 3300025258 Ga0209129_1000128 Ga0209129_100012884 409
167 3300025258 Ga0209129_1000976 Ga0209129_100097610 409
168 3300025258 Ga0209129_1002097 Ga0209129_10020978 409
169 3300025258 Ga0209129_1002855 Ga0209129_10028558 409
170 3300025258 Ga0209129_1003400 Ga0209129_10034002 409
171 3300025258 Ga0209129_1014582 Ga0209129_10145822 409
172 3300025261 Ga0209233_1000137 Ga0209233_1000137123 409
173 3300025261 Ga0209233_1000149 Ga0209233_100014970 409
174 3300025261 Ga0209233_1000160 Ga0209233_100016085 409
175 3300025261 Ga0209233_1000391 Ga0209233_100039111 409
176 3300025273 Ga0209673_1000125 Ga0209673_100012598 409
177 3300025273 Ga0209673_1000256 Ga0209673_100025659 409
178 3300025273 Ga0209673_1001124 Ga0209673_10011241 409
179 3300025273 Ga0209673_1002455 Ga0209673_100245510 409
180 3300025273 Ga0209673_1003474 Ga0209673_10034747 409
181 3300025273 Ga0209673_1008164 Ga0209673_10081643 409
182 3300025273 Ga0209673_1008302 Ga0209673_10083023 409
183 3300025284 Ga0209130_1000003 Ga0209130_1000003600 409
184 3300025284 Ga0209130_1000023 Ga0209130_1000023144 409
185 3300025284 Ga0209130_1012131 Ga0209130_10121311 409
186 3300025292 Ga0209676_1006852 Ga0209676_10068524 409
187 3300025294 Ga0209025_1000154 Ga0209025_100015432 409
188 3300025294 Ga0209025_1000451 Ga0209025_100045125 409
189 3300025294 Ga0209025_1000537 Ga0209025_100053749 409
190 3300025294 Ga0209025_1001209 Ga0209025_100120928 409
191 3300025294 Ga0209025_1003817 Ga0209025_10038178 409
192 3300025294 Ga0209025_1005577 Ga0209025_10055779 409
193 3300025295 Ga0209564_1000259 Ga0209564_100025969 409
194 3300025295 Ga0209564_1000841 Ga0209564_100084113 409
195 3300025295 Ga0209564_1002070 Ga0209564_10020707 409
196 3300025295 Ga0209564_1002604 Ga0209564_10026043 409
197 3300025297 Ga0209758_1000058 Ga0209758_1000058189 409
198 3300025297 Ga0209758_1000254 Ga0209758_1000254107 409
199 3300025297 Ga0209758_1000592 Ga0209758_100059262 409
200 3300025297 Ga0209758_1000678 Ga0209758_100067810 409
201 3300025297 Ga0209758_1002403 Ga0209758_100240312 409
202 3300025297 Ga0209758_1003028 Ga0209758_100302817 409
203 3300025297 Ga0209758_1029977 Ga0209758_10299773 409
204 3300025298 Ga0209050_1005160 Ga0209050_10051608 409
205 3300025299 Ga0209256_1000283 Ga0209256_100028332 409
206 3300025299 Ga0209256_1000669 Ga0209256_100066918 409
207 3300025299 Ga0209256_1001412 Ga0209256_100141217 409
208 3300025299 Ga0209256_1016918 Ga0209256_10169183 409
209 3300025302 Ga0207426_1000011 Ga0207426_1000011175 409
210 3300025302 Ga0207426_1000087 Ga0207426_1000087218 409
211 3300025302 Ga0207426_1000208 Ga0207426_1000208127 409
212 3300025303 Ga0209051_1000434 Ga0209051_100043446 409
213 3300025303 Ga0209051_1002705 Ga0209051_100270510 409
214 3300025303 Ga0209051_1004907 Ga0209051_10049077 409
215 3300025303 Ga0209051_1011248 Ga0209051_10112483 409
216 3300025303 Ga0209051_1032772 Ga0209051_10327722 409
217 3300025304 Ga0209257_1004213 Ga0209257_10042139 409
218 3300025321 Ga0207656_10026758 Ga0207656_100267582 409
219 3300025909 Ga0207705_10016659 Ga0207705_100166593 409
220 3300025913 Ga0207695_10000037 Ga0207695_10000037122 409
221 3300025914 Ga0207671_10000080 Ga0207671_10000080123 409
222 3300025914 Ga0207671_10001343 Ga0207671_1000134312 409
223 3300025914 Ga0207671_10019105 Ga0207671_100191053 409
224 3300025919 Ga0207657_10022185 Ga0207657_100221852 409
225 3300025920 Ga0207649_10001014 Ga0207649_100010141 409
226 3300025924 Ga0207694_10201043 Ga0207694_102010431 409
227 3300025925 Ga0207650_10000624 Ga0207650_100006241 409
228 3300025931 Ga0207644_10027543 Ga0207644_100275432 409
229 3300025937 Ga0207669_10039648 Ga0207669_100396484 409
230 3300025941 Ga0207711_10050887 Ga0207711_100508874 409
231 3300025941 Ga0207711_10347149 Ga0207711_103471491 409
232 3300025949 Ga0207667_10027587 Ga0207667_100275873 409
233 3300025949 Ga0207667_10064549 Ga0207667_100645492 409
234 3300025949 Ga0207667_10094888 Ga0207667_100948882 409
235 3300025986 Ga0207658_10227411 Ga0207658_102274111 409
236 3300026041 Ga0207639_10001237 Ga0207639_1000123716 409
237 3300026041 Ga0207639_10002277 Ga0207639_100022773 409
238 3300026067 Ga0207678_10012369 Ga0207678_100123693 409
239 3300026078 Ga0207702_10054621 Ga0207702_100546212 409
240 3300026078 Ga0207702_10061226 Ga0207702_100612262 409
241 3300026089 Ga0207648_10176900 Ga0207648_101769002 409
242 3300027111 Ga0209281_1000068 Ga0209281_1000068238 409
243 3300027312 Ga0209371_1000022 Ga0209371_1000022351 409
244 3300027312 Ga0209371_1016380 Ga0209371_10163801 409
245 3300028379 Ga0268266_10000753 Ga0268266_1000075335 409
246 3300028577 Ga0265318_10026903 Ga0265318_100269032 409
247 3300028794 Ga0307515_10042022 Ga0307515_100420222 409
248 3300028800 Ga0265338_10055133 Ga0265338_100551331 409
249 3300030500 Ga0268256_1000019 Ga0268256_1000019169 409
250 3300030500 Ga0268256_1002919 Ga0268256_10029195 409
251 3300030500 Ga0268256_1016660 Ga0268256_10166602 409
252 3300031235 Ga0265330_10052584 Ga0265330_100525841 409
253 3300031241 Ga0265325_10017179 Ga0265325_100171793 409
254 3300031241 Ga0265325_10050957 Ga0265325_100509572 409
255 3300031247 Ga0265340_10021572 Ga0265340_100215723 409
256 3300031249 Ga0265339_10002355 Ga0265339_100023555 409
257 3300031344 Ga0265316_10195925 Ga0265316_101959252 409
258 3300031456 Ga0307513_10056156 Ga0307513_100561564 409
259 3300031595 Ga0265313_10000048 Ga0265313_10000048100 409
260 3300031595 Ga0265313_10016705 Ga0265313_100167052 409
261 3300031711 Ga0265314_10025741 Ga0265314_100257415 409
262 3300032004 Ga0307414_10214947 Ga0307414_102149472 409
263 3300032004 Ga0307414_10300625 Ga0307414_103006251 409
264 3300037312 Ga0395899_0026042 Ga0395899_0026042_867_2117 409
265 3300037418 Ga0395900_0118984 Ga0395900_0118984_438_1688 409
266 3300037466 Ga0395898_0321675 Ga0395898_0321675_172_1422 409
267 3300037471 Ga0395905_0002480 Ga0395905_0002480_4890_6119 409
268 3300037471 Ga0395905_0002698 Ga0395905_0002698_17339_18568 409
269 3300037471 Ga0395905_0243271 Ga0395905_0243271_289_1539 409
270 3300038443 Ga0395901_0128521 Ga0395901_0128521_112_1362 409
271 3300038443 Ga0395901_0239783 Ga0395901_0239783_338_1585 409
272 3300041441 Ga0451787_267633 Ga0451787_267633_519_1772 409
273 3300041496 Ga0451839_1069755 Ga0451839_1069755_20_1249 409
274 3300041507 Ga0451851_0685669 Ga0451851_0685669_2582_3835 409
275 3300041512 Ga0451853_3017342 Ga0451853_3017342_948_2201 409
276 3300044765 Ga0466970_0060481 Ga0466970_0060481_657_1910 409
277 3300046460 Ga0495638_0000746 Ga0495638_0000746_32463_33692 409
278 3300046460 Ga0495638_0040547 Ga0495638_0040547_116_1345 409
279 3300046474 Ga0495605_0033036 Ga0495605_0033036_417_1670 409
280 3300046507 Ga0495606_0003935 Ga0495606_0003935_7961_9214 409
281 3300046507 Ga0495606_0020624 Ga0495606_0020624_716_1969 409
282 3300046512 Ga0495610_0006541 Ga0495610_0006541_5608_6861 409
283 3300046519 Ga0495632_0026990 Ga0495632_0026990_90_1343 409
284 3300046530 Ga0495654_0000912 Ga0495654_0000912_19304_20758 409
285 3300046538 Ga0495609_0010907 Ga0495609_0010907_744_1997 409
286 3300046616 Ga0495668_0006000 Ga0495668_0006000_689_1942 409
287 3300046660 Ga0495625_0047808 Ga0495625_0047808_1158_2411 409
288 3300046674 Ga0495588_0002287 Ga0495588_0002287_1075_2322 409
289 3300046674 Ga0495588_0053761 Ga0495588_0053761_439_1821 409
290 3300047472 Ga0495686_0003605 Ga0495686_0003605_1848_3101 409
291 3300048909 Ga0496106_0000206 Ga0496106_0000206_38770_40023 409
292 3300048919 Ga0496116_0032986 Ga0496116_0032986_2368_3615 409
293 3300048920 Ga0496117_0000002 Ga0496117_0000002_192667_193914 409
294 3300048920 Ga0496117_0094014 Ga0496117_0094014_472_1725 409
295 3300048921 Ga0496118_0000736 Ga0496118_0000736_43479_44726 409
296 3300048921 Ga0496118_0003614 Ga0496118_0003614_703_1956 409
297 3300048922 Ga0496119_0041157 Ga0496119_0041157_1289_2542 409
298 3300048923 Ga0496120_0000534 Ga0496120_0000534_29809_31056 409
299 3300048923 Ga0496120_0005660 Ga0496120_0005660_7704_8954 409
300 3300048924 Ga0496121_0000003 Ga0496121_0000003_772678_773982 409
301 3300048924 Ga0496121_0015046 Ga0496121_0015046_334_1587 409
302 3300048925 Ga0496122_0000004 Ga0496122_0000004_451762_453009 409
303 3300048925 Ga0496122_0000042 Ga0496122_0000042_204387_205640 409
304 3300048925 Ga0496122_0066336 Ga0496122_0066336_515_1768 409
305 3300048925 Ga0496122_0096538 Ga0496122_0096538_394_1698 409
306 3300048926 Ga0496123_0000007 Ga0496123_0000007_451762_453009 409
307 3300048926 Ga0496123_0000030 Ga0496123_0000030_86120_87373 409
308 3300048927 Ga0496124_0000067 Ga0496124_0000067_81553_82806 409
309 3300048927 Ga0496124_0048453 Ga0496124_0048453_1750_2997 409
310 3300048927 Ga0496124_0122407 Ga0496124_0122407_670_1956 409
311 3300048927 Ga0496124_0169591 Ga0496124_0169591_260_1558 409
312 3300048928 Ga0496125_0000262 Ga0496125_0000262_29209_30513 409
313 3300048928 Ga0496125_0000270 Ga0496125_0000270_92260_93510 409
314 3300048928 Ga0496125_0090489 Ga0496125_0090489_514_1761 409
315 3300048928 Ga0496125_0127921 Ga0496125_0127921_152_1402 409
316 3300048929 Ga0496126_0023200 Ga0496126_0023200_4553_5803 409
317 3300049459 Ga0495678_007866 Ga0495678_007866_99_1352 409
318 3300049568 Ga0501031_0000010 Ga0501031_0000010_676_1926 409
319 3300049568 Ga0501031_0036746 Ga0501031_0036746_700_1950 409
320 3300049569 Ga0501032_0000023 Ga0501032_0000023_144510_145760 409
321 3300049569 Ga0501032_0000075 Ga0501032_0000075_35465_36718 409
322 3300049569 Ga0501032_0091327 Ga0501032_0091327_536_1786 409
323 3300049569 Ga0501032_0100942 Ga0501032_0100942_446_1696 409
324 3300049570 Ga0501033_0000216 Ga0501033_0000216_37028_38281 409
325 3300049570 Ga0501033_0000308 Ga0501033_0000308_43321_44571 409
326 3300049570 Ga0501033_0041133 Ga0501033_0041133_1122_2372 409
327 3300049570 Ga0501033_0112933 Ga0501033_0112933_493_1743 409
328 3300049571 Ga0501034_0000116 Ga0501034_0000116_683_1933 409
329 3300049571 Ga0501034_0000476 Ga0501034_0000476_29243_30496 409
330 3300049571 Ga0501034_0040163 Ga0501034_0040163_1628_2878 409
331 3300049571 Ga0501034_0049018 Ga0501034_0049018_1205_2455 409
332 3300049571 Ga0501034_0075227 Ga0501034_0075227_321_1571 409
333 3300049571 Ga0501034_0125726 Ga0501034_0125726_316_1566 409
334 3300049571 Ga0501034_0126173 Ga0501034_0126173_302_1588 409
335 3300049571 Ga0501034_0134746 Ga0501034_0134746_1112_2362 409
336 3300049571 Ga0501034_0149848 Ga0501034_0149848_965_2215 409
337 3300049572 Ga0501036_0000015 Ga0501036_0000015_683_1933 409
338 3300049572 Ga0501036_0000540 Ga0501036_0000540_20071_21324 409
339 3300049572 Ga0501036_0129866 Ga0501036_0129866_599_1849 409
340 3300049573 Ga0501037_0000021 Ga0501037_0000021_112994_114247 409
341 3300049573 Ga0501037_0000023 Ga0501037_0000023_783_2033 409
342 3300049573 Ga0501037_0068868 Ga0501037_0068868_385_1635 409
343 3300049574 Ga0501038_0000025 Ga0501038_0000025_783_2033 409
344 3300049574 Ga0501038_0000032 Ga0501038_0000032_94715_95968 409
345 3300049574 Ga0501038_0146276 Ga0501038_0146276_152_1402 409
346 3300049575 Ga0501039_0000025 Ga0501039_0000025_108984_110237 409
347 3300049575 Ga0501039_0000037 Ga0501039_0000037_683_1933 409
348 3300049575 Ga0501039_0018288 Ga0501039_0018288_220_1470 409
349 3300049576 Ga0501040_0012464 Ga0501040_0012464_3638_4888 409
350 3300049579 Ga0501043_0000570 Ga0501043_0000570_29243_30496 409
351 3300049579 Ga0501043_0008991 Ga0501043_0008991_764_2014 409
352 3300049579 Ga0501043_0011454 Ga0501043_0011454_4911_6161 409
353 3300049580 Ga0501046_0047765 Ga0501046_0047765_950_2203 409
354 3300049580 Ga0501046_0067979 Ga0501046_0067979_1402_2652 409
355 3300049581 Ga0501047_0005004 Ga0501047_0005004_534_1784 409
356 3300049581 Ga0501047_0025729 Ga0501047_0025729_1318_2568 409
357 3300049581 Ga0501047_0053396 Ga0501047_0053396_1205_2455 409
358 3300049582 Ga0501048_0007452 Ga0501048_0007452_6198_7448 409
359 3300049583 Ga0501067_0002349 Ga0501067_0002349_7389_8639 409
360 3300049585 Ga0501069_0004804 Ga0501069_0004804_1072_2322 409
361 3300049586 Ga0501070_0005027 Ga0501070_0005027_5569_6819 409
362 3300049586 Ga0501070_0010394 Ga0501070_0010394_5324_6574 409
363 3300049586 Ga0501070_0021657 Ga0501070_0021657_3571_4821 409
364 3300049586 Ga0501070_0054870 Ga0501070_0054870_1415_2665 409
365 3300049586 Ga0501070_0099045 Ga0501070_0099045_1122_2372 409
366 3300049589 Ga0501073_0002930 Ga0501073_0002930_8552_9802 409
367 3300049589 Ga0501073_0007316 Ga0501073_0007316_324_1574 409
368 3300049589 Ga0501073_0048136 Ga0501073_0048136_99_1349 409
369 3300049590 Ga0501074_0020559 Ga0501074_0020559_442_1692 409
370 3300049592 Ga0501076_0122163 Ga0501076_0122163_423_1673 409
371 3300049593 Ga0501077_0047815 Ga0501077_0047815_1405_2655 409
372 3300049742 Ga0501080_0000429 Ga0501080_0000429_25014_26264 409
373 3300049742 Ga0501080_0028634 Ga0501080_0028634_3482_4732 409
374 3300049744 Ga0501083_0010993 Ga0501083_0010993_3092_4342 409
375 3300049744 Ga0501083_0033085 Ga0501083_0033085_1637_2887 409
376 3300049822 Ga0501035_0000074 Ga0501035_0000074_664_1914 409
377 3300049822 Ga0501035_0000085 Ga0501035_0000085_75026_76279 409
378 3300049822 Ga0501035_0003697 Ga0501035_0003697_975_2225 409
379 3300049822 Ga0501035_0044853 Ga0501035_0044853_2274_3524 409
380 3300049822 Ga0501035_0047191 Ga0501035_0047191_1504_2754 409
381 3300049822 Ga0501035_0062977 Ga0501035_0062977_917_2167 409
382 3300049822 Ga0501035_0135392 Ga0501035_0135392_342_1592 409
383 3300049822 Ga0501035_0153649 Ga0501035_0153649_543_1793 409
384 3300049823 Ga0501044_0000069 Ga0501044_0000069_124042_125292 409
385 3300049823 Ga0501044_0009602 Ga0501044_0009602_783_2033 409
386 3300049823 Ga0501044_0046671 Ga0501044_0046671_1748_2998 409
387 3300049823 Ga0501044_0099994 Ga0501044_0099994_1453_2703 409
388 3300049823 Ga0501044_0143512 Ga0501044_0143512_764_2014 409
389 3300049823 Ga0501044_0260565 Ga0501044_0260565_161_1411 409
390 3300049824 Ga0501045_0017706 Ga0501045_0017706_716_1966 409
391 3300050489 nmdc:mga03683_17941_c1 nmdc:mga03683_17941_c1_762_2015 409
392 3300050491 nmdc:mga00v17_15220_c1 nmdc:mga00v17_15220_c1_2797_4101 409
393 3300050491 nmdc:mga00v17_7_c1 nmdc:mga00v17_7_c1_77039_78286 409
394 3300050491 nmdc:mga00v17_81851_c1 nmdc:mga00v17_81851_c1_464_1714 409
395 3300050492 nmdc:mga0yw44_52596_c1 nmdc:mga0yw44_52596_c1_560_1807 409
396 3300050493 nmdc:mga0k408_21953_c1 nmdc:mga0k408_21953_c1_1029_2279 409
397 3300053107 Ga0500560_005310 Ga0500560_005310_100_1347 409
398 3300053125 Ga0500618_003259 Ga0500618_003259_1815_3068 409
399 3300053134 Ga0500658_0005826 Ga0500658_0005826_2261_3514 409
400 3300053137 Ga0500561_0001746 Ga0500561_0001746_1822_3069 409
401 3300053153 Ga0500616_0002773 Ga0500616_0002773_6215_7444 409
402 3300053161 Ga0500634_0000003 Ga0500634_0000003_182785_184035 409
403 3300053161 Ga0500634_0014987 Ga0500634_0014987_1781_3034 409
404 3300053177 Ga0500636_0001803 Ga0500636_0001803_885_2156 409
405 3300054114 Ga0501084_0017036 Ga0501084_0017036_4354_5604 409
406 3300054114 Ga0501084_0169052 Ga0501084_0169052_192_1442 409
407 3300059643 Ga0587072_007591 Ga0587072_007591_172_1419 409
408 3300060353 Ga0501082_0007985 Ga0501082_0007985_597_1847 409
409 iso_pu_bacteria 2509276021 2509390160 409
410 iso_pu_bacteria 2509276033 2509447553 409
411 iso_pu_bacteria 2510065019 2510134383 409
412 iso_pu_bacteria 2510461069 2510841701 409
413 iso_pu_bacteria 2510461076 2510895808 409
414 iso_pu_bacteria 2510917026 2511175400 409
415 iso_pu_bacteria 2510917028 2511182667 409
416 iso_pu_bacteria 2510917030 2511194901 409
417 iso_pu_bacteria 2512875026 2512970341 409
418 iso_pu_bacteria 2513237084 2513567505 409
419 iso_pu_bacteria 2513237085 2513577839 409
420 iso_pu_bacteria 2513237088 2513598391 409
421 iso_pu_bacteria 2513237093 2513632012 409
422 iso_pu_bacteria 2513237103 2513712514 409
423 iso_pu_bacteria 2513237138 2513867902 409
424 iso_pu_bacteria 2513237144 2513910631 409
425 iso_pu_bacteria 2513237146 2513928076 409
426 iso_pu_bacteria 2513237159 2513997553 409
427 iso_pu_bacteria 2513237160 2514003148 409
428 iso_pu_bacteria 2513237162 2514017885 409
429 iso_pu_bacteria 2515075009 2515113544 409
430 iso_pu_bacteria 2515154114 2515643834 409
431 iso_pu_bacteria 2515154116 2515654922 409
432 iso_pu_bacteria 2515154134 2515739902 409
433 iso_pu_bacteria 2516143018 2516206053 409
434 iso_pu_bacteria 2516653077 2517037160 409
435 iso_pu_bacteria 2516653085 2517077499 409
436 iso_pu_bacteria 2517093000 2517096267 409
437 iso_pu_bacteria 2517287029 2517408128 409
438 iso_pu_bacteria 2519899620 2520378434 409
439 iso_pu_bacteria 2523231067 2523466151 409
440 iso_pu_bacteria 2529292951 2530646373 409
441 iso_pu_bacteria 2534681796 2535517252 409
442 iso_pu_bacteria 2554235003 2554248525 409
443 iso_pu_bacteria 2558860242 2559295613 409
444 iso_pu_bacteria 2582581294 2585205087 409
445 iso_pu_bacteria 2582581298 2585225243 409
446 iso_pu_bacteria 2582581299 2585230694 409
447 iso_pu_bacteria 2582581306 2585265801 409
448 iso_pu_bacteria 2582581316 2585331066 409
449 iso_pu_bacteria 2582581865 2585389048 409
450 iso_pu_bacteria 2582581866 2585395195 409
451 iso_pu_bacteria 2582581867 2585404589 409
452 iso_pu_bacteria 2585427526 2585524928 409
453 iso_pu_bacteria 2585427527 2585531076 409
454 iso_pu_bacteria 2585427528 2585542767 409
455 iso_pu_bacteria 2585427529 2585547799 409
456 iso_pu_bacteria 2585427590 2585824874 409
457 iso_pu_bacteria 2585427593 2585841409 409
458 iso_pu_bacteria 2585427608 2585898624 409
459 iso_pu_bacteria 2585427609 2585903788 409
460 iso_pu_bacteria 2585427633 2585996807 409
461 iso_pu_bacteria 2585427634 2586001392 409
462 iso_pu_bacteria 2585428125 2587981093 409
463 iso_pu_bacteria 2599185156 2599332116 409
464 iso_pu_bacteria 2599185170 2599421085 409
465 iso_pu_bacteria 2599185210 2599601936 409
466 iso_pu_bacteria 2599185236 2599722244 409
467 iso_pu_bacteria 2599185301 2599936766 409
468 iso_pu_bacteria 2600254933 2600374008 409
469 iso_pu_bacteria 2615840624 2616296638 409
470 iso_pu_bacteria 2615840626 2616307013 409
471 iso_pu_bacteria 2615840698 2616554627 409
472 iso_pu_bacteria 2643221558 2643811101 409
473 iso_pu_bacteria 2643221564 2643840005 409
474 iso_pu_bacteria 2643221580 2643910805 409
475 iso_pu_bacteria 2643221599 2644002929 409
476 iso_pu_bacteria 2643221607 2644052066 409
477 iso_pu_bacteria 2643221618 2644105470 409
478 iso_pu_bacteria 2643221626 2644146473 409
479 iso_pu_bacteria 2643221634 2644196674 409
480 iso_pu_bacteria 2643221636 2644204859 409
481 iso_pu_bacteria 2643221637 2644208676 409
482 iso_pu_bacteria 2643221643 2644237909 409
483 iso_pu_bacteria 2643221655 2644308221 409
484 iso_pu_bacteria 2643221659 2644334045 409
485 iso_pu_bacteria 2643221686 2644484809 409
486 iso_pu_bacteria 2643221688 2644494194 409
487 iso_pu_bacteria 2643221693 2644523419 409
488 iso_pu_bacteria 2643221698 2644541642 409
489 iso_pu_bacteria 2643221712 2644615503 409
490 iso_pu_bacteria 2643221718 2644652206 409
491 iso_pu_bacteria 2657244999 2657684846 409
492 iso_pu_bacteria 2690316117 2692315160 409
493 iso_pu_bacteria 2693429783 2694631058 409
494 iso_pu_bacteria 2693429784 2694636444 409
495 iso_pu_bacteria 2718217882 2719182262 409
496 iso_pu_bacteria 2718217927 2719386852 409
497 iso_pu_bacteria 2718217997 2719666590 409
498 iso_pu_bacteria 2718218009 2719732978 409
499 iso_pu_bacteria 2718218199 2720493010 409
500 iso_pu_bacteria 2718218232 2720614488 409
501 iso_pu_bacteria 2718218233 2720621262 409
502 iso_pu_bacteria 2718218235 2720632588 409
503 iso_pu_bacteria 2718218269 2720776312 409
504 iso_pu_bacteria 2718218363 2721148375 409
505 iso_pu_bacteria 2718218365 2721159761 409
506 iso_pu_bacteria 2718218366 2721165189 409
507 iso_pu_bacteria 2718218423 2721400575 409
508 iso_pu_bacteria 2721755514 2722841359 409
509 iso_pu_bacteria 2721755556 2723027902 409
510 iso_pu_bacteria 2721755684 2723561531 409
511 iso_pu_bacteria 2721755685 2723568160 409
512 iso_pu_bacteria 2721755809 2724039388 409
513 iso_pu_bacteria 2721755810 2724045734 409
514 iso_pu_bacteria 2721755819 2724090919 409
515 iso_pu_bacteria 2721755822 2724105425 409
516 iso_pu_bacteria 2721755823 2724111251 409
517 iso_pu_bacteria 2724679232 2725950223 409
518 iso_pu_bacteria 2728369352 2730108838 409
519 iso_pu_bacteria 2728369365 2730165497 409
520 iso_pu_bacteria 2728369397 2730299393 409
521 iso_pu_bacteria 2738541293 2738805435 409
522 iso_pu_bacteria 2738541317 2738944207 409
523 iso_pu_bacteria 2738541333 2739033251 409
524 iso_pu_bacteria 2738543031 2739347120 409
525 iso_pu_bacteria 2751185821 2753463335 409
526 iso_pu_bacteria 2765235942 2766066298 409
527 iso_pu_bacteria 2775507049 2776914316 409
528 iso_pu_bacteria 2791355091 2792620462 409
529 iso_pu_bacteria 2791355092 2792625820 409
530 iso_pu_bacteria 2791355253 2793283766 409
531 iso_pu_bacteria 2791355256 2793294001 409
532 iso_pu_bacteria 2791355259 2793314323 409
533 iso_pu_bacteria 2791355260 2793323813 409
534 iso_pu_bacteria 2791355261 2793329716 409
535 iso_pu_bacteria 2791355262 2793335096 409
536 iso_pu_bacteria 2791355263 2793342313 409
537 iso_pu_bacteria 2791355264 2793349685 409
538 iso_pu_bacteria 2791355265 2793355334 409
539 iso_pu_bacteria 2791355266 2793363026 409
540 iso_pu_bacteria 2791355267 2793369895 409
541 iso_pu_bacteria 2802428858 2802716698 409
542 iso_pu_bacteria 2802428862 2802742981 409
543 iso_pu_bacteria 2802428863 2802750405 409
544 iso_pu_bacteria 2802429268 2804753024 409
545 iso_pu_bacteria 2802429605 2805929553 409
546 iso_pu_bacteria 2802429606 2805936857 409
547 iso_pu_bacteria 2802429633 2806047507 409
548 iso_pu_bacteria 2802429634 2806055143 409
549 iso_pu_bacteria 2802429635 2806063047 409
550 iso_pu_bacteria 2802429636 2806069782 409
551 iso_pu_bacteria 2802429637 2806075711 409
552 iso_pu_bacteria 2808606387 2808987654 409
553 iso_pu_bacteria 2818991439 2819559329 409
554 iso_pu_bacteria 2818991461 2819685373 409
555 iso_pu_bacteria 2821123053 2821125897 409
556 iso_pu_bacteria 2838016132 2838019920 409
557 iso_pu_bacteria 2838022645 2838023426 409
558 iso_pu_bacteria 2838035591 2838041448 409
559 iso_pu_bacteria 2838042994 2838045626 409
560 iso_pu_bacteria 2838048938 2838052729 409
561 iso_pu_bacteria 2838061910 2838064986 409
562 iso_pu_bacteria 2838068647 2838069713 409
563 iso_pu_bacteria 2838074704 2838079655 409
564 iso_pu_bacteria 2838661181 2838665839 409
565 iso_pu_bacteria 2838668709 2838671784 409
566 iso_pu_bacteria 2838680041 2838683012 409
567 iso_pu_bacteria 2838686498 2838686623 409
568 iso_pu_bacteria 2838694306 2838698045 409
569 iso_pu_bacteria 2838701080 2838704463 409
570 iso_pu_bacteria 2838707686 2838711159 409
571 iso_pu_bacteria 2838729681 2838734865 409
572 iso_pu_bacteria 2838736955 2838737627 409
573 iso_pu_bacteria 2838742623 2838747480 409
574 iso_pu_bacteria 2841840854 2841842004 409
575 iso_pu_bacteria 2841851746 2841854452 409
576 iso_pu_bacteria 2841859092 2841862473 409
577 iso_pu_bacteria 2841864319 2841867402 409
578 iso_pu_bacteria 2842077413 2842079335 409
579 iso_pu_bacteria 2842110456 2842115561 409
580 iso_pu_bacteria 2842118031 2842118155 409
581 iso_pu_bacteria 2842140634 2842141783 409
582 iso_pu_bacteria 2842146304 2842149681 409
583 iso_pu_bacteria 2842156927 2842158529 409
584 iso_pu_bacteria 2842163707 2842169025 409
585 iso_pu_bacteria 2842180545 2842182143 409
586 iso_pu_bacteria 2842192696 2842195616 409
587 iso_pu_bacteria 2842198810 2842198940 409
588 iso_pu_bacteria 2842205361 2842210937 409
589 iso_pu_bacteria 2842217011 2842218376 409
590 iso_pu_bacteria 2842229732 2842229857 409
591 iso_pu_bacteria 2842237096 2842240068 409
592 iso_pu_bacteria 2842243621 2842243746 409
593 iso_pu_bacteria 2842250916 2842254152 409
594 iso_pu_bacteria 2842257432 2842258169 409
595 iso_pu_bacteria 2842264693 2842268922 409
596 iso_pu_bacteria 2842271015 2842271839 409
597 iso_pu_bacteria 2842278818 2842284390 409
598 iso_pu_bacteria 2842285085 2842285175 409
599 iso_pu_bacteria 2842291075 2842292997 409
600 iso_pu_bacteria 2842304105 2842305452 409
601 iso_pu_bacteria 2842311132 2842314176 409
602 iso_pu_bacteria 2842317721 2842319980 409
603 iso_pu_bacteria 2842341865 2842347627 409
604 iso_pu_bacteria 2842363717 2842368723 409
605 iso_pu_bacteria 2842370503 2842373641 409
606 iso_pu_bacteria 2842377471 2842379394 409
607 iso_pu_bacteria 2842384541 2842384665 409
608 iso_pu_bacteria 2842395702 2842400569 409
609 iso_pu_bacteria 2842402390 2842402533 409
610 iso_pu_bacteria 2842409023 2842410096 409
611 iso_pu_bacteria 2842415677 2842416744 409
612 iso_pu_bacteria 2842422224 2842423327 409
613 iso_pu_bacteria 2842428310 2842433156 409
614 iso_pu_bacteria 2842434925 2842439461 409
615 iso_pu_bacteria 2842441272 2842446090 409
616 iso_pu_bacteria 2842447887 2842449118 409
617 iso_pu_bacteria 2842462802 2842467305 409
618 iso_pu_bacteria 2842469257 2842474100 409
619 iso_pu_bacteria 2842489311 2842493480 409
620 iso_pu_bacteria 2842495871 2842497630 409
621 iso_pu_bacteria 2842515876 2842519257 409
622 iso_pu_bacteria 2842521101 2842522204 409
623 iso_pu_bacteria 2844163670 2844166384 409
624 iso_pu_bacteria 2844454524 2844457921 409
625 iso_pu_bacteria 2847417321 2847419784 409
626 iso_pu_bacteria 2847670302 2847675597 409
627 iso_pu_bacteria 2848992105 2848994800 409
628 iso_pu_bacteria 2852387548 2852390805 409
629 iso_pu_bacteria 2854916844 2854917432 409
630 iso_pu_bacteria 2855872281 2855877299 409
631 iso_pu_bacteria 2856314179 2856319483 409
632 iso_pu_bacteria 2856364286 2856369442 409
633 iso_pu_bacteria 2857516855 2857516993 409
634 iso_pu_bacteria 2857531043 2857532459 409
635 iso_pu_bacteria 2869285874 2869286485 409
636 iso_pu_bacteria 2871429161 2871434638 409
637 iso_pu_bacteria 2874146452 2874149843 409
638 iso_pu_bacteria 2876413966 2876416305 409
639 iso_pu_bacteria 2878745973 2878751771 409
640 iso_pu_bacteria 2899275550 2899278705 409
641 iso_pu_bacteria 2899803654 2899806711 409
642 iso_pu_bacteria 2899845264 2899847245 409
643 iso_pu_bacteria 2903492973 2903504717 409
644 iso_pu_bacteria 2906308376 2906314169 409
645 iso_pu_bacteria 2906321335 2906327335 409
646 iso_pu_bacteria 2906328253 2906330020 409
647 iso_pu_bacteria 2906414383 2906420203 409
648 iso_pu_bacteria 2913295892 2913299099 409
649 iso_pu_bacteria 2913308742 2913308826 409
650 iso_pu_bacteria 2919100787 2919105603 409
651 iso_pu_bacteria 2919171160 2919173100 409
652 iso_pu_bacteria 2920760137 2920761167 409
653 iso_pu_bacteria 2920822456 2920825645 409
654 iso_pu_bacteria 2923556063 2923562249 409
655 iso_pu_bacteria 2926760298 2926762540 409
656 iso_pu_bacteria 2929138655 2929141158 409
657 iso_pu_bacteria 2932401849 2932405198 409
658 iso_pu_bacteria 2933011516 2933014571 409
659 iso_pu_bacteria 2933016740 2933023678 409
660 iso_pu_bacteria 2933570622 2933571259 409
661 iso_pu_bacteria 2933586486 2933591976 409
662 iso_pu_bacteria 2933599457 2933600520 409
663 iso_pu_bacteria 2935894831 2935896572 409
664 iso_pu_bacteria 2935901341 2935901467 409
665 iso_pu_bacteria 2936367885 2936371612 409
666 iso_pu_bacteria 2936375103 2936376985 409
667 iso_pu_bacteria 2936381700 2936383426 409
668 iso_pu_bacteria 2937036028 2937039685 409
669 iso_pu_bacteria 2937084907 2937090115 409
670 iso_pu_bacteria 2937813078 2937815721 409
671 iso_pu_bacteria 2937891427 2937896275 409
672 iso_pu_bacteria 2937994558 2938000082 409
673 iso_pu_bacteria 2958041894 2958042107 409
674 iso_pu_bacteria 2958115193 2958118447 409
675 iso_pu_bacteria 2958130278 2958130888 409
676 iso_pu_bacteria 2958165035 2958170546 409
677 iso_pu_bacteria 2958179912 2958184809 409
678 iso_pu_bacteria 2960591022 2960591827 409
679 iso_pu_bacteria 2961077736 2961082976 409
680 iso_pu_bacteria 2961163497 2961169001 409
681 iso_pu_bacteria 2965018300 2965024288 409
682 iso_pu_bacteria 2965062239 2965065990 409
683 iso_pu_bacteria 2967728569 2967732311 409
684 iso_pu_bacteria 2968091066 2968096352 409
685 iso_pu_bacteria 2968097103 2968098853 409
686 iso_pu_bacteria 2968117919 2968120618 409
687 iso_pu_bacteria 2968128360 2968129171 409
688 iso_pu_bacteria 2968171901 2968177395 409
689 iso_pu_bacteria 2970122695 2970126346 409
690 iso_pu_bacteria 2970143518 2970147148 409
691 iso_pu_bacteria 2970554993 2970560241 409
692 iso_pu_bacteria 2977530762 2977536378 409
693 iso_pu_bacteria 2977843712 2977845957 409
694 iso_pu_bacteria 2977858184 2977861611 409
695 iso_pu_bacteria 2977942078 2977942735 409
696 iso_pu_bacteria 2979089926 2979092192 409
697 iso_pu_bacteria 2979095461 2979100420 409
698 iso_pu_bacteria 2979100975 2979104178 409
699 iso_pu_bacteria 2979779861 2979785595 409
700 iso_pu_bacteria 2984509177 2984511244 409
701 iso_pu_bacteria 2984518228 2984522395 409
702 iso_pu_bacteria 2984537506 2984541697 409
703 iso_pu_bacteria 2984601300 2984604056 409
704 iso_pu_bacteria 2987636660 2987638350 409
705 iso_pu_bacteria 2987652177 2987658390 409
706 iso_pu_bacteria 2987659509 2987665032 409
707 iso_pu_bacteria 2989349275 2989351054 409
708 iso_pu_bacteria 2989776772 2989779574 409
709 iso_pu_bacteria 2996341866 2996345057 409
710 iso_pu_bacteria 2996887358 2996892545 409
711 iso_pu_bacteria 2996893221 2996898062 409
712 iso_pu_bacteria 3000017691 3000018739 409
713 iso_pu_bacteria 3003930520 3003934665 409
714 iso_pu_bacteria 3004188549 3004194089 409
715 iso_pu_bacteria 3004203850 3004205406 409
716 iso_pu_bacteria 3005445848 3005448841 409
717 iso_pu_bacteria 3005452660 3005455065 409
718 iso_pu_bacteria 639633055 639649590 409
719 iso_pu_bacteria 643692032 643826678 409
720 iso_pu_bacteria 650716007 650740823 409
721 iso_pu_bacteria 8003570095 8003571895 409
722 iso_pu_bacteria 8003999396 8004002158 409
723 iso_pu_bacteria 8004387939 8004393659 409
724 iso_pu_bacteria 8004445564 8004450214 409
725 iso_pu_bacteria 8004703790 8004709349 409
726 iso_pu_bacteria 8004714634 8004720427 409
727 iso_pu_bacteria 8005258706 8005264828 409
728 iso_pu_bacteria 8005275841 8005281663 409
729 iso_pu_bacteria 8005282627 8005284377 409
730 iso_pu_bacteria 8005301065 8005303575 409
731 iso_pu_bacteria 8005307578 8005314087 409
732 iso_pu_bacteria 8005321885 8005327072 409
733 iso_pu_bacteria 8005376324 8005382671 409
734 iso_pu_bacteria 8005382845 8005384633 409
735 iso_pu_bacteria 8005395548 8005395662 409
736 iso_pu_bacteria 8005430974 8005433899 409
737 iso_pu_bacteria 8005460587 8005464231 409
738 iso_pu_bacteria 8005497431 8005501337 409
739 iso_pu_bacteria 8005542996 8005546072 409
740 iso_pu_bacteria 8005556819 8005561644 409
741 iso_pu_bacteria 8005563573 8005568422 409
742 iso_pu_bacteria 8005570704 8005573039 409
743 iso_pu_bacteria 8005619151 8005622699 409
744 iso_pu_bacteria 8005626139 8005630214 409
745 iso_pu_bacteria 8005658619 8005658773 409
746 iso_pu_bacteria 8005668836 8005672756 409
747 iso_pu_bacteria 8005688590 8005691646 409
748 iso_pu_bacteria 8005695170 8005696781 409
749 iso_pu_bacteria 8018127388 8018127584 409
750 iso_pu_bacteria 8018150411 8018154096 409
751 iso_pu_bacteria 8018163183 8018163336 409
752 iso_pu_bacteria 8018176218 8018178966 409
753 iso_pu_bacteria 8023680758 8023682742 409
754 iso_pu_bacteria 8024479707 8024486100 409
755 iso_pu_bacteria 8024486573 8024488438 409
756 iso_pu_bacteria 8024501048 8024501174 409
757 iso_pu_bacteria 8054460903 8054463237 409
758 iso_pu_bacteria 8055431914 8055432266 409
759 iso_pu_bacteria 8056375014 8056377028 409
760 iso_pu_bacteria 8056382006 8056387350 409
761 iso_pu_bacteria 8057874678 8057881912 409

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

151

478

0.96

PF07687

M20_dimer

Peptidase dimerisation domain

280

384

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8aq0-assembly1.cif.gz_B crystal structure of l-n-carbamoylase from sinorhizobium meliloti mutant l217g/f329c 0.9715 2 408
8apz-assembly1.cif.gz_B crystal structure of wild-type l-n-carbamoylase from sinorhizobium meliloti 0.9686 1 409
8apz-assembly1.cif.gz_B crystal structure of wild-type l-n-carbamoylase from sinorhizobium meliloti 0.9663 1 409
5i4m-assembly1.cif.gz_B crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia vietnamiensis 0.9656 2 405
8aq0-assembly1.cif.gz_B crystal structure of l-n-carbamoylase from sinorhizobium meliloti mutant l217g/f329c 0.9646 2 408
ID Description Score Start End Superfamily
5i4mA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9871 210 322 3.30.70.360
3n5fB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9747 210 322 3.30.70.360
af_C0P5R8_269_385_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9671 210 322 3.40.630.10
1z2lA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9658 210 323 3.30.70.360
5i4mA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9619 210 322 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A6I2IWC1-F1-model_v4 deleted 0.975 210 286
AF-A0A1M5DYX5-F1-model_v4 N-carbamoyl-L-amino-acid hydrolase 0.9722 13 409 GO:0016813
GO:0046872
AF-A0A1M5DYX5-F1-model_v4 N-carbamoyl-L-amino-acid hydrolase 0.9698 13 409 GO:0016813
GO:0046872
AF-A0A353VEN8-F1-model_v4 Zn-dependent hydrolase 0.9681 58 188 GO:0016813
AF-A0A228QAI6-F1-model_v4 Zn-dependent hydrolase 0.968 2 406 GO:0016813
GO:0046872

Feature Viewer

pLDDT pTM Quality
90.77 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map