F479584

General Info

Members Datasets Scaffolds Average Seq Length
761 471 519 453

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0229169|Ga0395905_0229169_44_1582
Length 512
Sequence LHELQRACQYLARVGNQQAHDYAARYVVLRTARHCNKASKRRRLIGRTISCYDYFDAHGMQLRQKVIFLAIAPLIVALCVIALFVRQQAITLAHEQHATIQQAYLASKEAELRHYVDLASHSIAHLTASGRSDPATLAEAKRVLQSLSFGDDGYFFVYDMQGRNLMHPRQPELVGRDLWNLRDQFGAPTIQNIVAVAKRGGGLVRYNWVKPSTNKPGPKLGYVVAIPQWGWIVGSGLYLDDVDAALDRVDAQQTLNIRTTMWWIAALAIFATLVIGGAGLALNISESRVADMKLKALAQRVVDSQEQERARLSRDLHDGISQWLVSIKLQIEAGIIRMKGTPEQQRQAHACFEHTAEELNKVLGEVRRISHDLRPTLLDDLGLAAALDHLAEEFSQHSGTPVKFAASGDAEHLPQAVGTVLFRIAQEALTNIERHAGAHRIDLSLHTGRGRVLLTIADDGAGFDAEGVATHPQRGIGLRNMMERLDAIGGHLDIASSAAGTTVCASVELETL

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
11 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
12 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
13 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
14 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
15 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
16 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
17 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
18 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
19 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
20 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
21 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
22 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
23 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
24 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
25 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
26 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
27 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
28 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
29 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
30 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
31 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
32 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
33 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
34 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
35 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
36 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
37 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
38 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
39 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
40 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
41 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
42 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
43 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
44 2643221556 Massilia sp. Root1485 Isolate Unclassified
45 2643221580 Devosia sp. Root635 Isolate Unclassified
46 2643221582 Rhizobium sp. Root651 Isolate Unclassified
47 2643221599 Rhizobium sp. Root708 Isolate Unclassified
48 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
49 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
50 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
51 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
52 2643221674 Devosia sp. Root436 Isolate Unclassified
53 2643221684 Massilia sp. Root133 Isolate Unclassified
54 2643221719 Rhizobium sp. Root274 Isolate Unclassified
55 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
56 2718217882 Rhizobium sp. N741 Isolate Nodule
57 2718217927 Rhizobium sp. N324 Isolate Nodule
58 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
59 2718218009 Rhizobium sp. N561 Isolate Nodule
60 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
61 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
62 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
63 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
64 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
65 2718218363 Rhizobium sp. N113 Isolate Nodule
66 2718218365 Rhizobium sp. N731 Isolate Nodule
67 2718218366 Rhizobium sp. N621 Isolate Nodule
68 2718218423 Rhizobium sp. N941 Isolate Nodule
69 2721755514 Rhizobium sp. N6212 Isolate Nodule
70 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
71 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
72 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
73 2721755809 Rhizobium sp. N541 Isolate Nodule
74 2721755810 Rhizobium sp. N871 Isolate Nodule
75 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
76 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
77 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
78 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
79 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
80 2728369365 Rhizobium sp. N1341 Isolate Nodule
81 2728369397 Rhizobium sp. N1314 Isolate Nodule
82 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
83 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
84 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
85 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
86 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
87 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
88 2791355256 Rhizobium sp. M10 Isolate Nodule
89 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
90 2791355260 Rhizobium sp. L9 Isolate Nodule
91 2791355261 Rhizobium sp. J15 Isolate Nodule
92 2791355262 Rhizobium sp. M1 Isolate Nodule
93 2791355263 Rhizobium chutanense C5 Isolate Nodule
94 2791355264 Rhizobium sp. S9 Isolate Nodule
95 2791355265 Rhizobium sp. H4 Isolate Nodule
96 2791355266 Rhizobium sp. L43 Isolate Nodule
97 2791355267 Rhizobium sp. L18 Isolate Nodule
98 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
99 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
100 2802429633 Rhizobium anhuiense J3 Isolate Nodule
101 2802429634 Rhizobium anhuiense S10 Isolate Nodule
102 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
103 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
104 2802429637 Rhizobium anhuiense C15 Isolate Nodule
105 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
106 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
107 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
108 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
109 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
110 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
111 2838061910 Rhizobium phaseoli L15 Isolate Nodule
112 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
113 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
114 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
115 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
116 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
117 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
118 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
119 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
120 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
121 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
122 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
123 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
124 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
125 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
126 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
127 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
128 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
129 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
130 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
131 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
132 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
133 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
134 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
135 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
136 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
137 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
138 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
139 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
140 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
141 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
142 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
143 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
144 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
145 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
146 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
147 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
148 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
149 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
150 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
151 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
152 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
153 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
154 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
155 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
156 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
157 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
158 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
159 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
160 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
161 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
162 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
163 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
164 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
165 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
166 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
167 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
168 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
169 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
170 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
171 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
172 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
173 2854911287 Brucella lupini LUP21 Isolate Unclassified
174 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
175 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
176 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
177 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
178 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
179 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
180 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
181 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
182 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
183 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
184 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
185 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
186 2932401849 Devosia sp. 2618 Isolate Rhizosphere
187 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
188 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
189 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
190 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
191 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
192 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
193 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
194 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
195 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
196 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
197 2936381700 Rhizobium chutanense C16 Isolate Unclassified
198 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
199 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
200 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
201 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
202 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
203 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
204 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
205 2996887358 Rhizobium sp. R711 Isolate Nodule
206 2996893221 Rhizobium sp. R635 Isolate Nodule
207 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
208 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
209 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
210 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
211 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
212 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
213 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
214 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
215 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
216 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
217 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
218 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
219 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
220 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
221 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
222 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
223 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
224 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
225 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
226 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
227 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
228 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
229 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
230 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
231 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
232 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
233 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
234 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
235 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
236 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
237 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
238 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
239 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
240 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
241 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
242 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
243 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
244 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
245 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
246 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
247 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
248 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
249 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
250 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
251 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
252 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
253 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
254 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
255 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
256 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
257 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
258 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
259 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
260 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
261 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
262 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
264 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
265 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
266 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
267 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
270 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
271 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
272 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
273 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
274 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
275 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
276 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
278 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
290 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
292 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
293 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
294 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
295 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
296 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
297 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
298 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
299 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
300 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
301 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
302 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
303 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
304 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
305 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
306 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
307 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
308 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
309 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
310 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
311 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
312 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
313 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
314 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
315 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
316 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
317 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
318 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
319 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
320 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
321 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
322 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
323 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
324 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
325 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
326 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
327 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
328 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
329 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
330 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
331 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
332 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
333 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
334 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
335 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
336 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
337 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
338 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
339 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
340 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
341 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
342 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
343 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
344 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
345 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
346 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
347 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
348 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
349 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
350 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
351 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
352 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
353 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
354 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
355 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
356 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
357 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
358 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
359 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
360 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
361 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
362 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
363 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
364 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
365 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
366 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
367 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
368 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
369 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
370 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
371 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
372 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
373 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
374 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
375 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
376 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
377 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
378 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
379 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
380 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
381 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
382 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
383 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
384 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
385 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
386 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
387 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
388 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
389 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
390 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
391 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
392 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
393 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
394 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
395 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
396 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
397 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
398 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
399 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
400 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
401 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
402 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
403 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
404 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
405 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
406 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
407 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
408 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
409 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
410 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
411 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
412 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
417 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
419 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
420 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
421 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
422 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
423 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
424 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
425 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
426 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
427 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
428 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
429 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
430 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
431 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
432 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
433 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
434 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
435 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
436 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
437 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
438 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
439 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
440 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
441 8005258706 Rhizobium sp. R693 Isolate Nodule
442 8005275841 Rhizobium sp. N4311 Isolate Nodule
443 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
444 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
445 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
446 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
447 8005321885 Rhizobium sp. R72 Isolate Nodule
448 8005382845 Rhizobium sp. R634 Isolate Nodule
449 8005395548 Rhizobium sp. R339 Isolate Nodule
450 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
451 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
452 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
453 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
454 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
455 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
456 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
457 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
458 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
459 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
460 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
461 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
462 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
463 8018176218 Rhizobium sp. N122 Isolate Nodule
464 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
465 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
466 8024501048 Rhizobium sp. H4 Isolate Nodule
467 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
468 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
469 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
470 8056382006 Rhizobium croatiense 13T Isolate Nodule
471 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.33
Metatranscriptomes 0
Isolates 31.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 10.64
Nodule 24.44
Rhizoplane 2.63
Rhizosphere 50.07
Stem 0
Stem Tuber 0
Unclassified 11.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000006 3300002704 Bacteria 244109
2 JGI25156J39149_1000019 3300002705 Bacteria 160845
3 JGI25162J39368_1006349 3300002737 Bacteria 2064
4 JGI25154J39366_1000177 3300002738 Bacteria 49732
5 JGI25157J39369_1000024 3300002741 Bacteria 160844
6 JGI25150J39212_1012418 3300002774 Bacteria 1509
7 JGI25151J46595_10000337 3300003187 Bacteria 50281
8 JGI25153J46596_10014556 3300003215 Bacteria 3262
9 JGI25153J46596_10029523 3300003215 Bacteria 1881
10 rootH1_10116215 3300003316 Bacteria 2328
11 rootH2_10035300 3300003320 Bacteria 4896
12 rootH2_10162198 3300003320 Bacteria 2663
13 rootL2_10000604 3300003322 Bacteria 5374
14 rootH1_10193287 3300003323 Bacteria 3071
15 JGI25160J50197_1003379 3300003354 Bacteria 7156
16 JGI25161J50226_1003563 3300003374 Bacteria 3520
17 Ga0055525_1000029 3300003759 Bacteria 320663
18 Ga0055542_1010032 3300003762 Bacteria 1754
19 Ga0055526_1001763 3300003771 Bacteria 15028
20 Ga0055526_1014249 3300003771 Bacteria 3285
21 Ga0055524_1000875 3300003775 Bacteria 19614
22 Ga0055524_1006929 3300003775 Bacteria 4874
23 Ga0055524_1008408 3300003775 Bacteria 4290
24 Ga0055528_1000526 3300003790 Bacteria 29618
25 Ga0055528_1001697 3300003790 Bacteria 12836
26 Ga0055540_1000066 3300003792 Bacteria 122947
27 Ga0055540_1015774 3300003792 Bacteria 2180
28 Ga0055531_10005865 3300003794 Bacteria 7092
29 Ga0058692_1001939 3300003856 Bacteria 7210
30 Ga0055543_1001451 3300004625 Bacteria 9388
31 Ga0065165_1000924 3300005262 Bacteria 37694
32 Ga0070658_10117472 3300005327 Bacteria 2208
33 Ga0070660_100066290 3300005339 Bacteria 2810
34 Ga0070662_100220366 3300005457 Bacteria 1513
35 Ga0068855_100024179 3300005563 Bacteria 7272
36 Ga0070664_100137889 3300005564 Bacteria 2146
37 Ga0068852_100030112 3300005616 Bacteria 4465
38 Ga0075368_10004226 3300006042 Bacteria 4847
39 Ga0075364_10011254 3300006051 Bacteria 5432
40 Ga0075367_10004319 3300006178 Bacteria 6915
41 Ga0075367_10008268 3300006178 Bacteria 5384
42 Ga0075369_10005393 3300006186 Bacteria 4776
43 Ga0075369_10009086 3300006186 Bacteria 3849
44 Ga0075370_10003533 3300006353 Bacteria 7461
45 Ga0075370_10045895 3300006353 Bacteria 2472
46 Ga0079104_1000454 3300006946 Bacteria 46459
47 Ga0099826_10000043 3300006948 Bacteria 91959
48 Ga0099826_10001556 3300006948 Bacteria 13930
49 Ga0105240_10000297 3300009093 Bacteria 96825
50 Ga0105240_10117666 3300009093 Bacteria 3203
51 Ga0105241_10077453 3300009174 Bacteria 2595
52 Ga0105237_10264008 3300009545 Bacteria 1724
53 Ga0105238_10100271 3300009551 Bacteria 2879
54 Ga0123341_1000005 3300009765 Bacteria 150422
55 Ga0123342_1017954 3300009766 Bacteria 5766
56 Ga0123342_1021468 3300009766 Bacteria 4529
57 Ga0157371_10000013 3300013102 Bacteria 352631
58 Ga0157378_10001966 3300013297 Bacteria 18417
59 Ga0182008_10000095 3300014497 Bacteria 67716
60 Ga0182008_10037096 3300014497 Bacteria 2439
61 Ga0182006_1000078 3300015261 Bacteria 123372
62 Ga0182006_1005427 3300015261 Bacteria 6082
63 Ga0182007_10000055 3300015262 Bacteria 91532
64 Ga0182005_1000128 3300015265 Bacteria 53582
65 Ga0163161_10038412 3300017792 Bacteria 3434
66 Ga0214542_1000307 3300021321 Bacteria 83288
67 Ga0214543_1000195 3300021327 Bacteria 89886
68 Ga0209435_100011 3300025206 Bacteria 413027
69 Ga0209563_100003 3300025230 Bacteria 1932942
70 Ga0209437_100080 3300025233 Bacteria 275402
71 Ga0207425_1002946 3300025245 Bacteria 5695
72 Ga0209646_1000024 3300025246 Bacteria 413027
73 Ga0209026_1000030 3300025250 Bacteria 329811
74 Ga0209677_100653 3300025253 Bacteria 18276
75 Ga0209148_1000652 3300025254 Bacteria 29973
76 Ga0209759_1000011 3300025256 Bacteria 413027
77 Ga0209129_1001120 3300025258 Bacteria 15568
78 Ga0209673_1000020 3300025273 Bacteria 430653
79 Ga0209673_1000433 3300025273 Bacteria 72554
80 Ga0209673_1001482 3300025273 Bacteria 21938
81 Ga0209673_1002063 3300025273 Bacteria 15160
82 Ga0209673_1006755 3300025273 Bacteria 5457
83 Ga0209675_1003735 3300025291 Bacteria 7060
84 Ga0209025_1000081 3300025294 Bacteria 265899
85 Ga0209025_1007609 3300025294 Bacteria 8022
86 Ga0209564_1000114 3300025295 Bacteria 209934
87 Ga0209564_1000416 3300025295 Bacteria 74830
88 Ga0209564_1002170 3300025295 Bacteria 16517
89 Ga0209758_1000076 3300025297 Bacteria 270615
90 Ga0209758_1002616 3300025297 Bacteria 17916
91 Ga0209758_1016407 3300025297 Bacteria 3765
92 Ga0209758_1021786 3300025297 Bacteria 2970
93 Ga0209758_1032526 3300025297 Bacteria 2115
94 Ga0209256_1000550 3300025299 Bacteria 53839
95 Ga0209256_1001187 3300025299 Bacteria 29225
96 Ga0209256_1002269 3300025299 Bacteria 16298
97 Ga0207426_1000169 3300025302 Bacteria 164859
98 Ga0209051_1000038 3300025303 Bacteria 320926
99 Ga0209051_1002057 3300025303 Bacteria 15251
100 Ga0209257_1001132 3300025304 Bacteria 34242
101 Ga0209257_1026506 3300025304 Bacteria 1951
102 Ga0207705_10008981 3300025909 Bacteria 7282
103 Ga0207654_10033768 3300025911 Bacteria 2838
104 Ga0207695_10002247 3300025913 Bacteria 28947
105 Ga0207671_10165926 3300025914 Bacteria 1712
106 Ga0207694_10113372 3300025924 Bacteria 2158
107 Ga0207686_10021115 3300025934 Bacteria 3731
108 Ga0207667_10027084 3300025949 Bacteria 6249
109 Ga0207703_10215930 3300026035 Bacteria 1713
110 Ga0207698_10008324 3300026142 Bacteria 6552
111 Ga0209281_1000035 3300027111 Bacteria 382327
112 Ga0209371_1000771 3300027312 Bacteria 26593
113 Ga0209371_1002055 3300027312 Bacteria 12022
114 Ga0209371_1004722 3300027312 Bacteria 5778
115 Ga0209371_1008770 3300027312 Bacteria 3304
116 Ga0209282_1000001 3300027666 Bacteria 2450367
117 Ga0209282_1000330 3300027666 Bacteria 23454
118 Ga0209282_1004458 3300027666 Bacteria 8439
119 Ga0307515_10042662 3300028794 Bacteria 7086
120 Ga0268256_1001812 3300030500 Bacteria 12022
121 Ga0268256_1002374 3300030500 Bacteria 9687
122 Ga0268256_1004480 3300030500 Bacteria 5778
123 Ga0316182_1072899 3300030745 Bacteria 3965
124 Ga0307513_10045525 3300031456 Bacteria 4795
125 Ga0307516_10137472 3300031730 Bacteria 2216
126 Ga0307518_10010626 3300031838 Bacteria 6573
127 Ga0307412_10057716 3300031911 Bacteria 2593
128 Ga0395899_0000082 3300037312 Bacteria 168513
129 Ga0395899_0001114 3300037312 Bacteria 24057
130 Ga0395899_0014677 3300037312 Bacteria 5978
131 Ga0395899_0018773 3300037312 Bacteria 5254
132 Ga0395899_0077422 3300037312 Bacteria 2425
133 Ga0395900_0000566 3300037418 Bacteria 51197
134 Ga0395900_0001391 3300037418 Bacteria 28978
135 Ga0395900_0001911 3300037418 Bacteria 23679
136 Ga0395900_0026728 3300037418 Bacteria 5908
137 Ga0395900_0077823 3300037418 Bacteria 3407
138 Ga0395900_0153003 3300037418 Bacteria 2356
139 Ga0395900_0154022 3300037418 Bacteria 2348
140 Ga0395898_0083674 3300037466 Bacteria 3075
141 Ga0395905_0002709 3300037471 Bacteria 19409
142 Ga0395905_0050031 3300037471 Bacteria 3916
143 Ga0395905_0163977 3300037471 Bacteria 2088
144 Ga0395905_0229169 3300037471 Bacteria 1737
145 Ga0395901_0000314 3300038443 Bacteria 59738
146 Ga0395901_0010643 3300038443 Bacteria 9320
147 Ga0395901_0031285 3300038443 Bacteria 5487
148 Ga0395901_0216305 3300038443 Bacteria 2004
149 Ga0439436_0013169 3300041404 Bacteria 2504
150 Ga0439465_0009946 3300041413 Bacteria 2995
151 Ga0451841_0633500 3300041498 Bacteria 3028
152 Ga0451849_0375737 3300041505 Bacteria 1563
153 Ga0439445_0018058 3300042004 Bacteria 1748
154 Ga0439448_0021559 3300042005 Bacteria 1997
155 Ga0439449_0004056 3300042007 Bacteria 5670
156 Ga0439462_0011899 3300042015 Bacteria 2219
157 Ga0451577_0020710 3300042876 Bacteria 6030
158 Ga0466969_0016318 3300044656 Bacteria 3889
159 Ga0466972_0003830 3300044658 Bacteria 7485
160 Ga0466965_0002432 3300044683 Bacteria 7908
161 Ga0466965_0129197 3300044683 Bacteria 1309
162 Ga0466966_0028753 3300044684 Bacteria 3618
163 Ga0466966_0032497 3300044684 Bacteria 3381
164 Ga0466966_0066544 3300044684 Bacteria 2264
165 Ga0466964_0002048 3300044706 Bacteria 7090
166 Ga0466964_0002788 3300044706 Bacteria 6284
167 Ga0466968_0011495 3300044735 Bacteria 3450
168 Ga0466957_0007607 3300044842 Bacteria 6124
169 Ga0466959_0003762 3300045049 Bacteria 10044
170 Ga0466959_0098127 3300045049 Bacteria 2099
171 Ga0451576_0000497 3300045051 Bacteria 86307
172 Ga0495617_000030 3300046452 Bacteria 152392
173 Ga0495617_000948 3300046452 Bacteria 13451
174 Ga0495627_000317 3300046453 Bacteria 47238
175 Ga0495603_0037923 3300046455 Bacteria 2891
176 Ga0495590_0000027 3300046457 Bacteria 158323
177 Ga0495590_0000873 3300046457 Bacteria 13531
178 Ga0495590_0010281 3300046457 Bacteria 3525
179 Ga0495591_000396 3300046458 Bacteria 36718
180 Ga0495629_0014440 3300046459 Bacteria 5681
181 Ga0495638_0000210 3300046460 Bacteria 82776
182 Ga0495653_0018899 3300046463 Bacteria 5591
183 Ga0495650_0000011 3300046471 Bacteria 615329
184 Ga0495650_0000135 3300046471 Bacteria 172251
185 Ga0495650_0005942 3300046471 Bacteria 7746
186 Ga0495650_0034904 3300046471 Bacteria 2219
187 Ga0495580_0013644 3300046472 Bacteria 6195
188 Ga0495582_0023418 3300046473 Bacteria 3377
189 Ga0495582_0041529 3300046473 Bacteria 2534
190 Ga0495605_0000029 3300046474 Bacteria 215329
191 Ga0495605_0000046 3300046474 Bacteria 175985
192 Ga0495605_0012183 3300046474 Bacteria 4776
193 Ga0495605_0023532 3300046474 Bacteria 3237
194 Ga0495605_0042259 3300046474 Bacteria 2267
195 Ga0495584_0000003 3300046491 Bacteria 323768
196 Ga0495584_0000513 3300046491 Bacteria 26484
197 Ga0495584_0001471 3300046491 Bacteria 14116
198 Ga0495584_0002239 3300046491 Bacteria 11037
199 Ga0495584_0011595 3300046491 Bacteria 4515
200 Ga0495584_0015272 3300046491 Bacteria 3912
201 Ga0495585_0000010 3300046492 Bacteria 229958
202 Ga0495585_0000133 3300046492 Bacteria 80839
203 Ga0495585_0000218 3300046492 Bacteria 59582
204 Ga0495585_0002146 3300046492 Bacteria 14388
205 Ga0495585_0004713 3300046492 Bacteria 8784
206 Ga0495585_0014151 3300046492 Bacteria 4654
207 Ga0495585_0014938 3300046492 Bacteria 4515
208 Ga0495585_0032058 3300046492 Bacteria 2979
209 Ga0495585_0036114 3300046492 Bacteria 2789
210 Ga0495585_0060987 3300046492 Bacteria 2075
211 Ga0495594_0008706 3300046499 Bacteria 5233
212 Ga0495594_0052093 3300046499 Bacteria 2253
213 Ga0495596_0003574 3300046500 Bacteria 7824
214 Ga0495596_0003612 3300046500 Bacteria 7771
215 Ga0495596_0004580 3300046500 Bacteria 6705
216 Ga0495596_0005492 3300046500 Bacteria 5978
217 Ga0495596_0006200 3300046500 Bacteria 5535
218 Ga0495596_0013567 3300046500 Bacteria 3450
219 Ga0495596_0013675 3300046500 Bacteria 3434
220 Ga0495596_0033033 3300046500 Bacteria 2060
221 Ga0495607_0001008 3300046501 Bacteria 25920
222 Ga0495607_0001933 3300046501 Bacteria 17494
223 Ga0495607_0008638 3300046501 Bacteria 6946
224 Ga0495607_0009071 3300046501 Bacteria 6760
225 Ga0495607_0010250 3300046501 Bacteria 6304
226 Ga0495607_0019783 3300046501 Bacteria 4270
227 Ga0495607_0035071 3300046501 Bacteria 3038
228 Ga0495607_0051671 3300046501 Bacteria 2385
229 Ga0495607_0053619 3300046501 Bacteria 2328
230 Ga0495607_0060104 3300046501 Bacteria 2164
231 Ga0495583_0000176 3300046506 Bacteria 108802
232 Ga0495583_0000478 3300046506 Bacteria 58638
233 Ga0495583_0000580 3300046506 Bacteria 50178
234 Ga0495583_0001750 3300046506 Bacteria 20716
235 Ga0495583_0008474 3300046506 Bacteria 6276
236 Ga0495583_0012468 3300046506 Bacteria 4806
237 Ga0495583_0019696 3300046506 Bacteria 3514
238 Ga0495583_0020065 3300046506 Bacteria 3472
239 Ga0495583_0022145 3300046506 Bacteria 3251
240 Ga0495583_0024614 3300046506 Bacteria 3021
241 Ga0495606_0001588 3300046507 Bacteria 29701
242 Ga0495606_0003217 3300046507 Bacteria 17584
243 Ga0495606_0005450 3300046507 Bacteria 12182
244 Ga0495606_0010487 3300046507 Bacteria 7680
245 Ga0495606_0052143 3300046507 Bacteria 2662
246 Ga0495610_0000214 3300046512 Bacteria 62772
247 Ga0495610_0087641 3300046512 Bacteria 1416
248 Ga0495616_0000250 3300046513 Bacteria 43443
249 Ga0495616_0000635 3300046513 Bacteria 26259
250 Ga0495616_0013512 3300046513 Bacteria 4602
251 Ga0495616_0033120 3300046513 Bacteria 2695
252 Ga0495616_0050891 3300046513 Bacteria 2069
253 Ga0495620_0003674 3300046515 Bacteria 8761
254 Ga0495631_0000008 3300046518 Bacteria 121368
255 Ga0495631_0007006 3300046518 Bacteria 5769
256 Ga0495631_0013801 3300046518 Bacteria 3914
257 Ga0495631_0034390 3300046518 Bacteria 2272
258 Ga0495631_0046846 3300046518 Bacteria 1899
259 Ga0495631_0052926 3300046518 Bacteria 1772
260 Ga0495631_0062333 3300046518 Bacteria 1616
261 Ga0495632_0000027 3300046519 Bacteria 173785
262 Ga0495632_0000140 3300046519 Bacteria 74068
263 Ga0495632_0007715 3300046519 Bacteria 6719
264 Ga0495632_0014656 3300046519 Bacteria 4426
265 Ga0495632_0016496 3300046519 Bacteria 4106
266 Ga0495632_0024777 3300046519 Bacteria 3182
267 Ga0495632_0036118 3300046519 Bacteria 2515
268 Ga0495632_0059003 3300046519 Bacteria 1868
269 Ga0495632_0060644 3300046519 Bacteria 1837
270 Ga0495637_0000012 3300046520 Bacteria 273124
271 Ga0495643_0005201 3300046522 Bacteria 8869
272 Ga0495643_0008267 3300046522 Bacteria 6606
273 Ga0495643_0036671 3300046522 Bacteria 2692
274 Ga0495643_0073040 3300046522 Bacteria 1798
275 Ga0495644_0001401 3300046523 Bacteria 9841
276 Ga0495644_0015508 3300046523 Bacteria 2918
277 Ga0495644_0024545 3300046523 Bacteria 2293
278 Ga0495648_0000003 3300046524 Bacteria 386817
279 Ga0495648_0000309 3300046524 Bacteria 54245
280 Ga0495648_0022057 3300046524 Bacteria 4394
281 Ga0495648_0027982 3300046524 Bacteria 3764
282 Ga0495648_0031217 3300046524 Bacteria 3511
283 Ga0495663_0009844 3300046525 Bacteria 2654
284 Ga0495666_0002930 3300046526 Bacteria 8549
285 Ga0495642_0000161 3300046528 Bacteria 38994
286 Ga0495642_0000424 3300046528 Bacteria 22437
287 Ga0495642_0001897 3300046528 Bacteria 8908
288 Ga0495642_0008955 3300046528 Bacteria 3831
289 Ga0495642_0010016 3300046528 Bacteria 3630
290 Ga0495642_0010601 3300046528 Bacteria 3528
291 Ga0495642_0021256 3300046528 Bacteria 2552
292 Ga0495654_0000133 3300046530 Bacteria 78489
293 Ga0495654_0015338 3300046530 Bacteria 4070
294 Ga0495654_0028970 3300046530 Bacteria 2827
295 Ga0495586_0006672 3300046535 Bacteria 6163
296 Ga0495609_0000022 3300046538 Bacteria 279488
297 Ga0495609_0024916 3300046538 Bacteria 2743
298 Ga0495609_0027407 3300046538 Bacteria 2604
299 Ga0495609_0033375 3300046538 Bacteria 2337
300 Ga0495597_0000113 3300046542 Bacteria 72390
301 Ga0495597_0004075 3300046542 Bacteria 8166
302 Ga0495597_0005731 3300046542 Bacteria 6525
303 Ga0495597_0030364 3300046542 Bacteria 2463
304 Ga0495597_0041377 3300046542 Bacteria 2058
305 Ga0495622_0000055 3300046557 Bacteria 102577
306 Ga0495622_0024939 3300046557 Bacteria 2792
307 Ga0495622_0058782 3300046557 Bacteria 1780
308 Ga0495633_0002785 3300046558 Bacteria 12088
309 Ga0495633_0003700 3300046558 Bacteria 10087
310 Ga0495633_0004245 3300046558 Bacteria 9173
311 Ga0495633_0007705 3300046558 Bacteria 6161
312 Ga0495633_0036325 3300046558 Bacteria 2361
313 Ga0495633_0041953 3300046558 Bacteria 2174
314 Ga0495656_0025182 3300046615 Bacteria 2357
315 Ga0495668_0000755 3300046616 Bacteria 38152
316 Ga0495668_0001165 3300046616 Bacteria 26785
317 Ga0495668_0001635 3300046616 Bacteria 20910
318 Ga0495668_0002595 3300046616 Bacteria 14648
319 Ga0495668_0023778 3300046616 Bacteria 3490
320 Ga0495668_0037173 3300046616 Bacteria 2725
321 Ga0495668_0054849 3300046616 Bacteria 2201
322 Ga0495611_0000644 3300046648 Bacteria 20005
323 Ga0495611_0004918 3300046648 Bacteria 5732
324 Ga0495611_0009717 3300046648 Bacteria 4067
325 Ga0495611_0015314 3300046648 Bacteria 3277
326 Ga0495611_0015967 3300046648 Bacteria 3209
327 Ga0495611_0020694 3300046648 Bacteria 2834
328 Ga0495611_0072837 3300046648 Bacteria 1572
329 Ga0495625_0003107 3300046660 Bacteria 16970
330 Ga0495625_0032592 3300046660 Bacteria 3861
331 Ga0495635_0011179 3300046663 Bacteria 6293
332 Ga0495661_0000248 3300046665 Bacteria 62330
333 Ga0495661_0009319 3300046665 Bacteria 6739
334 Ga0495661_0016333 3300046665 Bacteria 4923
335 Ga0495661_0020885 3300046665 Bacteria 4270
336 Ga0495661_0021274 3300046665 Bacteria 4230
337 Ga0495661_0032775 3300046665 Bacteria 3281
338 Ga0495661_0051266 3300046665 Bacteria 2492
339 Ga0495661_0095798 3300046665 Bacteria 1679
340 Ga0495588_0000086 3300046674 Bacteria 193241
341 Ga0495588_0009166 3300046674 Bacteria 4565
342 Ga0495588_0056045 3300046674 Bacteria 2034
343 Ga0495588_0061098 3300046674 Bacteria 1951
344 Ga0495669_0000025 3300046684 Bacteria 112395
345 Ga0495669_0002260 3300046684 Bacteria 7900
346 Ga0495613_0037863 3300046689 Bacteria 3575
347 Ga0495670_0000150 3300046691 Bacteria 30859
348 Ga0495670_0008728 3300046691 Bacteria 4987
349 Ga0495670_0042823 3300046691 Bacteria 2259
350 Ga0495670_0071611 3300046691 Bacteria 1755
351 Ga0495670_0080548 3300046691 Bacteria 1658
352 Ga0495671_0003396 3300046692 Bacteria 9795
353 Ga0495671_0008298 3300046692 Bacteria 5850
354 Ga0495671_0045997 3300046692 Bacteria 2183
355 Ga0495649_0000066 3300046694 Bacteria 93487
356 Ga0495649_0013708 3300046694 Bacteria 4670
357 Ga0495649_0038787 3300046694 Bacteria 2612
358 Ga0495649_0045629 3300046694 Bacteria 2388
359 Ga0495589_0000017 3300046794 Bacteria 206113
360 Ga0495589_0000157 3300046794 Bacteria 62544
361 Ga0495589_0000170 3300046794 Bacteria 59283
362 Ga0495589_0011897 3300046794 Bacteria 4513
363 Ga0495589_0020404 3300046794 Bacteria 3388
364 Ga0495589_0026277 3300046794 Bacteria 2950
365 Ga0495660_0000127 3300046810 Bacteria 84034
366 Ga0495660_0013636 3300046810 Bacteria 4711
367 Ga0495660_0023922 3300046810 Bacteria 3481
368 Ga0495660_0033803 3300046810 Bacteria 2864
369 Ga0495660_0036028 3300046810 Bacteria 2761
370 Ga0495660_0051373 3300046810 Bacteria 2243
371 Ga0495581_0010318 3300047315 Bacteria 5403
372 Ga0495604_0010745 3300047317 Bacteria 7269
373 Ga0495636_0008507 3300047318 Bacteria 4049
374 Ga0495636_0009302 3300047318 Bacteria 3869
375 Ga0495636_0012725 3300047318 Bacteria 3333
376 Ga0495636_0028341 3300047318 Bacteria 2284
377 Ga0495672_0000138 3300047320 Bacteria 108026
378 Ga0495672_0000171 3300047320 Bacteria 94653
379 Ga0495672_0009291 3300047320 Bacteria 7143
380 Ga0495672_0010355 3300047320 Bacteria 6654
381 Ga0495672_0019931 3300047320 Bacteria 4410
382 Ga0495672_0069963 3300047320 Bacteria 1990
383 Ga0495676_0000859 3300047321 Bacteria 25385
384 Ga0495676_0034164 3300047321 Bacteria 4270
385 Ga0495680_0021346 3300047322 Bacteria 5422
386 Ga0495680_0089659 3300047322 Bacteria 2308
387 Ga0495683_0000046 3300047323 Bacteria 129843
388 Ga0495683_0004241 3300047323 Bacteria 8188
389 Ga0495683_0011598 3300047323 Bacteria 4636
390 Ga0495683_0030677 3300047323 Bacteria 2742
391 Ga0495683_0033783 3300047323 Bacteria 2601
392 Ga0495683_0034996 3300047323 Bacteria 2553
393 Ga0495683_0078998 3300047323 Bacteria 1607
394 Ga0495687_000033 3300047443 Bacteria 263788
395 Ga0495687_000102 3300047443 Bacteria 129228
396 Ga0495687_000184 3300047443 Bacteria 91103
397 Ga0495687_000797 3300047443 Bacteria 33934
398 Ga0495687_003033 3300047443 Bacteria 12628
399 Ga0495687_005456 3300047443 Bacteria 8100
400 Ga0495687_062087 3300047443 Bacteria 1535
401 Ga0495675_0064575 3300047444 Bacteria 2315
402 Ga0495677_0000002 3300047445 Bacteria 346767
403 Ga0495677_0000208 3300047445 Bacteria 27005
404 Ga0495677_0000304 3300047445 Bacteria 21356
405 Ga0495677_0006900 3300047445 Bacteria 4269
406 Ga0495677_0013064 3300047445 Bacteria 3021
407 Ga0495679_008882 3300047446 Bacteria 4056
408 Ga0495679_016325 3300047446 Bacteria 2689
409 Ga0495681_0000100 3300047470 Bacteria 75759
410 Ga0495681_0000391 3300047470 Bacteria 34074
411 Ga0495681_0001604 3300047470 Bacteria 16823
412 Ga0495681_0007479 3300047470 Bacteria 6967
413 Ga0495681_0009233 3300047470 Bacteria 6097
414 Ga0495681_0025600 3300047470 Bacteria 3084
415 Ga0495681_0040306 3300047470 Bacteria 2275
416 Ga0495681_0061997 3300047470 Bacteria 1720
417 Ga0495686_0000272 3300047472 Bacteria 92063
418 Ga0495686_0000853 3300047472 Bacteria 39111
419 Ga0495686_0024487 3300047472 Bacteria 3965
420 Ga0495686_0044502 3300047472 Bacteria 2810
421 Ga0495593_0011603 3300047673 Bacteria 5055
422 Ga0495602_0015897 3300048088 Bacteria 7581
423 Ga0495614_0006847 3300048089 Bacteria 5098
424 Ga0495615_0003998 3300048090 Bacteria 2529
425 Ga0495626_0000014 3300048091 Bacteria 246660
426 Ga0495626_0000097 3300048091 Bacteria 113925
427 Ga0495626_0006289 3300048091 Bacteria 6778
428 Ga0495626_0009034 3300048091 Bacteria 5405
429 Ga0495626_0029070 3300048091 Bacteria 2677
430 Ga0495626_0033291 3300048091 Bacteria 2471
431 Ga0495626_0037630 3300048091 Bacteria 2297
432 Ga0495626_0042595 3300048091 Bacteria 2132
433 Ga0496101_0025995 3300048904 Bacteria 4066
434 Ga0496102_0000140 3300048905 Bacteria 98196
435 Ga0496102_0002114 3300048905 Bacteria 17085
436 Ga0496102_0015944 3300048905 Bacteria 6557
437 Ga0496104_0126439 3300048907 Bacteria 2455
438 Ga0496105_0184606 3300048908 Bacteria 1707
439 Ga0496106_0014678 3300048909 Bacteria 5790
440 Ga0496107_0041708 3300048910 Bacteria 3296
441 Ga0496110_0000027 3300048913 Bacteria 71164
442 Ga0496111_0073530 3300048914 Bacteria 2489
443 Ga0496113_0016377 3300048916 Bacteria 5120
444 Ga0496113_0016577 3300048916 Bacteria 5093
445 Ga0496113_0098703 3300048916 Bacteria 2261
446 Ga0496115_0004384 3300048918 Bacteria 10221
447 Ga0496115_0102252 3300048918 Bacteria 2350
448 Ga0496116_0004220 3300048919 Bacteria 13810
449 Ga0496116_0082512 3300048919 Bacteria 1988
450 Ga0496117_0000032 3300048920 Bacteria 375533
451 Ga0496118_0000027 3300048921 Bacteria 375533
452 Ga0496118_0008593 3300048921 Bacteria 10513
453 Ga0496118_0019786 3300048921 Bacteria 6004
454 Ga0496119_0010239 3300048922 Bacteria 7910
455 Ga0496121_0002434 3300048924 Bacteria 28458
456 Ga0496121_0002563 3300048924 Bacteria 27515
457 Ga0496121_0018546 3300048924 Bacteria 7009
458 Ga0496121_0039396 3300048924 Bacteria 4165
459 Ga0496121_0065553 3300048924 Bacteria 2954
460 Ga0496121_0131186 3300048924 Unclassified 1875
461 Ga0496122_0000455 3300048925 Bacteria 85041
462 Ga0496122_0000815 3300048925 Bacteria 59706
463 Ga0496122_0001704 3300048925 Bacteria 34075
464 Ga0496122_0012167 3300048925 Bacteria 8605
465 Ga0496122_0015865 3300048925 Bacteria 7173
466 Ga0496122_0036250 3300048925 Bacteria 3992
467 Ga0496123_0000197 3300048926 Bacteria 122784
468 Ga0496123_0000578 3300048926 Bacteria 62352
469 Ga0496123_0006645 3300048926 Bacteria 11152
470 Ga0496123_0013837 3300048926 Bacteria 6732
471 Ga0496123_0016025 3300048926 Bacteria 6112
472 Ga0496123_0024836 3300048926 Bacteria 4538
473 Ga0496124_0003586 3300048927 Bacteria 18870
474 Ga0496124_0028677 3300048927 Bacteria 4976
475 Ga0496124_0030032 3300048927 Bacteria 4832
476 Ga0496124_0047960 3300048927 Bacteria 3652
477 Ga0496124_0132733 3300048927 Bacteria 1976
478 Ga0496125_0001622 3300048928 Bacteria 31693
479 Ga0496125_0020264 3300048928 Bacteria 6244
480 Ga0496125_0053253 3300048928 Bacteria 3319
481 Ga0495678_000075 3300049459 Bacteria 125154
482 Ga0495678_000107 3300049459 Bacteria 100130
483 Ga0495678_000184 3300049459 Bacteria 72485
484 Ga0495678_000915 3300049459 Bacteria 25960
485 Ga0495678_004880 3300049459 Bacteria 7587
486 Ga0495682_0000363 3300049460 Bacteria 33063
487 Ga0495682_0003446 3300049460 Bacteria 7028
488 Ga0495682_0014678 3300049460 Bacteria 2970
489 Ga0501032_0039974 3300049569 Bacteria 3189
490 Ga0501034_0001536 3300049571 Bacteria 30295
491 Ga0501037_0075494 3300049573 Bacteria 2448
492 Ga0501043_0154898 3300049579 Bacteria 1792
493 Ga0501238_000616 3300049671 Bacteria 4073
494 Ga0501035_0009150 3300049822 Bacteria 9211
495 Ga0501044_0155424 3300049823 Bacteria 2267
496 nmdc:mga00v17_8_c1 3300050491 Bacteria 141008
497 nmdc:mga0yw44_255_c1 3300050492 Bacteria 18180
498 nmdc:mga0yw44_32194_c1 3300050492 Bacteria 3054
499 nmdc:mga0k408_659_c1 3300050493 Bacteria 18900
500 nmdc:mga06z11_5425_c1 3300050494 Bacteria 5112
501 nmdc:mga07m45_15075_c1 3300050496 Bacteria 4128
502 nmdc:mga07m45_43414_c1 3300050496 Bacteria 2520
503 nmdc:mga0sz30_380_c1 3300050516 Bacteria 16990
504 Ga0500578_0034486 3300053086 Bacteria 3251
505 Ga0500557_000474 3300053105 Bacteria 5343
506 Ga0500658_0000253 3300053134 Bacteria 24884
507 Ga0500658_0004589 3300053134 Bacteria 5150
508 Ga0500559_0008220 3300053136 Bacteria 4587
509 Ga0500561_0000051 3300053137 Bacteria 23765
510 Ga0500568_0000173 3300053139 Bacteria 56326
511 Ga0500604_0004697 3300053151 Bacteria 3617
512 Ga0500616_0004741 3300053153 Bacteria 9563
513 Ga0500616_0006634 3300053153 Bacteria 7534
514 Ga0500633_0000315 3300053160 Bacteria 7158
515 Ga0500634_0000008 3300053161 Bacteria 152203
516 Ga0500639_028487 3300053163 Bacteria 2952
517 Ga0500596_003374 3300053735 Bacteria 3045
518 Ga0501082_0078173 3300060353 Bacteria 2854
519 Ga0466962_0054375 3300061719 Bacteria 1913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0129197 Ga0466965_0129197_16_1161 378
2 iso_pu_bacteria 2984518228 2984523403 384
3 3300025291 Ga0209675_1003735 Ga0209675_10037351 398
4 3300046648 Ga0495611_0072837 Ga0495611_0072837_12_1334 405
5 3300049459 Ga0495678_000107 Ga0495678_000107_2006_3379 405
6 3300049460 Ga0495682_0000363 Ga0495682_0000363_1001_2374 405
7 3300046522 Ga0495643_0008267 Ga0495643_0008267_890_2248 409
8 3300046524 Ga0495648_0027982 Ga0495648_0027982_829_2187 409
9 3300048091 Ga0495626_0037630 Ga0495626_0037630_290_1648 409
10 iso_pu_bacteria 2857531043 2857535685 409
11 3300046538 Ga0495609_0027407 Ga0495609_0027407_746_2116 411
12 3300046542 Ga0495597_0000113 Ga0495597_0000113_70191_71561 411
13 3300046500 Ga0495596_0006200 Ga0495596_0006200_2416_3789 412
14 3300048919 Ga0496116_0004220 Ga0496116_0004220_2300_3556 413
15 3300046492 Ga0495585_0014151 Ga0495585_0014151_2454_3875 414
16 3300046648 Ga0495611_0004918 Ga0495611_0004918_1803_3224 414
17 3300047321 Ga0495676_0000859 Ga0495676_0000859_15216_16589 414
18 3300048091 Ga0495626_0009034 Ga0495626_0009034_480_1901 414
19 3300046500 Ga0495596_0013567 Ga0495596_0013567_1775_3148 416
20 3300046506 Ga0495583_0000580 Ga0495583_0000580_702_2075 416
21 3300046506 Ga0495583_0019696 Ga0495583_0019696_642_2015 416
22 3300046506 Ga0495583_0020065 Ga0495583_0020065_403_1776 416
23 3300046513 Ga0495616_0013512 Ga0495616_0013512_735_2108 416
24 3300046519 Ga0495632_0000140 Ga0495632_0000140_71123_72496 416
25 3300046810 Ga0495660_0051373 Ga0495660_0051373_424_1797 416
26 3300047323 Ga0495683_0033783 Ga0495683_0033783_950_2323 416
27 3300047443 Ga0495687_003033 Ga0495687_003033_10734_12107 416
28 3300049459 Ga0495678_000915 Ga0495678_000915_22895_24268 416
29 3300048908 Ga0496105_0184606 Ga0496105_0184606_371_1690 417
30 3300002737 JGI25162J39368_1006349 JGI25162J39368_10063492 419
31 3300014497 Ga0182008_10037096 Ga0182008_100370962 419
32 3300025233 Ga0209437_100080 Ga0209437_100080191 419
33 3300046452 Ga0495617_000030 Ga0495617_000030_21708_23078 419
34 3300046453 Ga0495627_000317 Ga0495627_000317_43867_45237 419
35 3300046474 Ga0495605_0000046 Ga0495605_0000046_45301_46671 419
36 3300046492 Ga0495585_0002146 Ga0495585_0002146_11946_13454 419
37 3300046500 Ga0495596_0003574 Ga0495596_0003574_4257_5627 419
38 3300046501 Ga0495607_0001933 Ga0495607_0001933_913_2283 419
39 3300046524 Ga0495648_0000309 Ga0495648_0000309_15145_16515 419
40 3300046528 Ga0495642_0000424 Ga0495642_0000424_16764_18134 419
41 3300046616 Ga0495668_0001165 Ga0495668_0001165_24714_26084 419
42 3300046692 Ga0495671_0003396 Ga0495671_0003396_5251_6621 419
43 3300046794 Ga0495589_0011897 Ga0495589_0011897_1920_3290 419
44 3300047472 Ga0495686_0024487 Ga0495686_0024487_446_1816 419
45 3300048927 Ga0496124_0132733 Ga0496124_0132733_680_1960 420
46 3300005563 Ga0068855_100024179 Ga0068855_1000241797 422
47 3300005616 Ga0068852_100030112 Ga0068852_1000301122 422
48 3300009093 Ga0105240_10000297 Ga0105240_1000029766 422
49 3300009551 Ga0105238_10100271 Ga0105238_101002712 422
50 3300025913 Ga0207695_10002247 Ga0207695_1000224732 422
51 3300025924 Ga0207694_10113372 Ga0207694_101133722 422
52 3300026142 Ga0207698_10008324 Ga0207698_100083243 422
53 3300046557 Ga0495622_0024939 Ga0495622_0024939_1451_2776 422
54 3300046660 Ga0495625_0003107 Ga0495625_0003107_14796_16184 422
55 3300048924 Ga0496121_0065553 Ga0496121_0065553_1234_2622 422
56 3300048925 Ga0496122_0000455 Ga0496122_0000455_44331_45719 422
57 3300048926 Ga0496123_0000197 Ga0496123_0000197_77170_78558 422
58 3300048928 Ga0496125_0053253 Ga0496125_0053253_516_1904 422
59 3300046492 Ga0495585_0000218 Ga0495585_0000218_36280_37638 423
60 3300046491 Ga0495584_0000003 Ga0495584_0000003_22268_23659 424
61 3300046500 Ga0495596_0004580 Ga0495596_0004580_1166_2524 424
62 3300046507 Ga0495606_0005450 Ga0495606_0005450_505_1869 424
63 3300046513 Ga0495616_0000635 Ga0495616_0000635_24800_26170 424
64 3300046518 Ga0495631_0062333 Ga0495631_0062333_206_1564 424
65 3300046519 Ga0495632_0014656 Ga0495632_0014656_679_2049 424
66 3300046684 Ga0495669_0002260 Ga0495669_0002260_6173_7543 424
67 3300046691 Ga0495670_0042823 Ga0495670_0042823_337_1695 424
68 3300046810 Ga0495660_0036028 Ga0495660_0036028_486_1856 424
69 3300047320 Ga0495672_0009291 Ga0495672_0009291_4156_5529 424
70 3300046471 Ga0495650_0034904 Ga0495650_0034904_710_2053 428
71 3300046528 Ga0495642_0010601 Ga0495642_0010601_1672_3045 429
72 3300046692 Ga0495671_0008298 Ga0495671_0008298_359_1732 429
73 3300047470 Ga0495681_0009233 Ga0495681_0009233_646_2019 429
74 3300047320 Ga0495672_0069963 Ga0495672_0069963_475_1854 430
75 3300047322 Ga0495680_0089659 Ga0495680_0089659_429_1820 432
76 3300047444 Ga0495675_0064575 Ga0495675_0064575_813_2204 432
77 3300046459 Ga0495629_0014440 Ga0495629_0014440_1451_2824 433
78 3300046473 Ga0495582_0041529 Ga0495582_0041529_734_2107 433
79 3300046492 Ga0495585_0036114 Ga0495585_0036114_428_1801 433
80 3300046501 Ga0495607_0060104 Ga0495607_0060104_185_1558 433
81 3300046513 Ga0495616_0033120 Ga0495616_0033120_760_2133 433
82 3300046518 Ga0495631_0007006 Ga0495631_0007006_1162_2583 433
83 3300046518 Ga0495631_0046846 Ga0495631_0046846_72_1445 433
84 3300046523 Ga0495644_0015508 Ga0495644_0015508_802_2223 433
85 3300046542 Ga0495597_0030364 Ga0495597_0030364_412_1785 433
86 3300046558 Ga0495633_0036325 Ga0495633_0036325_730_2103 433
87 3300046684 Ga0495669_0000025 Ga0495669_0000025_109121_110494 433
88 3300046689 Ga0495613_0037863 Ga0495613_0037863_1227_2600 433
89 3300046810 Ga0495660_0033803 Ga0495660_0033803_868_2238 433
90 3300047315 Ga0495581_0010318 Ga0495581_0010318_1523_2896 433
91 3300047445 Ga0495677_0000208 Ga0495677_0000208_1487_2908 433
92 3300047445 Ga0495677_0013064 Ga0495677_0013064_1627_3000 433
93 3300047472 Ga0495686_0000272 Ga0495686_0000272_61422_62792 433
94 3300048089 Ga0495614_0006847 Ga0495614_0006847_2047_3420 433
95 3300005262 Ga0065165_1000924 Ga0065165_100092434 434
96 3300027312 Ga0209371_1002055 Ga0209371_100205510 434
97 3300030500 Ga0268256_1001812 Ga0268256_10018122 434
98 3300046457 Ga0495590_0000027 Ga0495590_0000027_86745_88118 434
99 3300046458 Ga0495591_000396 Ga0495591_000396_17636_19009 434
100 3300046471 Ga0495650_0005942 Ga0495650_0005942_911_2281 434
101 3300046474 Ga0495605_0042259 Ga0495605_0042259_314_1687 434
102 3300046491 Ga0495584_0001471 Ga0495584_0001471_675_2048 434
103 3300046492 Ga0495585_0014938 Ga0495585_0014938_1185_2558 434
104 3300046501 Ga0495607_0001008 Ga0495607_0001008_19439_20812 434
105 3300046506 Ga0495583_0008474 Ga0495583_0008474_702_2075 434
106 3300046512 Ga0495610_0000214 Ga0495610_0000214_17822_19195 434
107 3300046519 Ga0495632_0016496 Ga0495632_0016496_1555_2928 434
108 3300046520 Ga0495637_0000012 Ga0495637_0000012_47084_48457 434
109 3300046558 Ga0495633_0002785 Ga0495633_0002785_205_1578 434
110 3300046616 Ga0495668_0000755 Ga0495668_0000755_36050_37414 434
111 3300046648 Ga0495611_0000644 Ga0495611_0000644_17107_18480 434
112 3300046694 Ga0495649_0000066 Ga0495649_0000066_22101_23474 434
113 3300047320 Ga0495672_0000138 Ga0495672_0000138_59416_60789 434
114 3300047323 Ga0495683_0004241 Ga0495683_0004241_5074_6447 434
115 3300047470 Ga0495681_0000100 Ga0495681_0000100_21565_22935 434
116 3300047470 Ga0495681_0061997 Ga0495681_0061997_74_1447 434
117 3300048905 Ga0496102_0002114 Ga0496102_0002114_15471_16841 434
118 3300048918 Ga0496115_0102252 Ga0496115_0102252_924_2294 434
119 3300049459 Ga0495678_000075 Ga0495678_000075_29580_30953 434
120 3300046474 Ga0495605_0023532 Ga0495605_0023532_265_1638 435
121 3300046491 Ga0495584_0015272 Ga0495584_0015272_182_1555 435
122 3300046499 Ga0495594_0052093 Ga0495594_0052093_702_2075 435
123 3300046506 Ga0495583_0024614 Ga0495583_0024614_998_2371 435
124 3300046512 Ga0495610_0087641 Ga0495610_0087641_21_1394 435
125 3300046523 Ga0495644_0024545 Ga0495644_0024545_71_1444 435
126 3300046691 Ga0495670_0071611 Ga0495670_0071611_191_1564 435
127 3300046694 Ga0495649_0038787 Ga0495649_0038787_1130_2503 435
128 3300046694 Ga0495649_0045629 Ga0495649_0045629_120_1493 435
129 3300047323 Ga0495683_0011598 Ga0495683_0011598_1413_2786 435
130 3300037471 Ga0395905_0050031 Ga0395905_0050031_2132_3502 436
131 3300046463 Ga0495653_0018899 Ga0495653_0018899_2381_3754 436
132 3300046506 Ga0495583_0012468 Ga0495583_0012468_385_1755 436
133 3300046535 Ga0495586_0006672 Ga0495586_0006672_1644_3017 436
134 3300046663 Ga0495635_0011179 Ga0495635_0011179_3108_4481 436
135 3300046665 Ga0495661_0016333 Ga0495661_0016333_594_2012 436
136 3300047318 Ga0495636_0028341 Ga0495636_0028341_171_1541 436
137 3300047322 Ga0495680_0021346 Ga0495680_0021346_1690_3063 436
138 3300047443 Ga0495687_005456 Ga0495687_005456_2632_4002 436
139 3300047673 Ga0495593_0011603 Ga0495593_0011603_574_1947 436
140 3300046492 Ga0495585_0004713 Ga0495585_0004713_6753_8126 437
141 3300046501 Ga0495607_0053619 Ga0495607_0053619_21_1394 437
142 3300046506 Ga0495583_0000176 Ga0495583_0000176_34844_36202 437
143 3300046518 Ga0495631_0000008 Ga0495631_0000008_54320_55741 437
144 3300046518 Ga0495631_0034390 Ga0495631_0034390_344_1717 437
145 3300046519 Ga0495632_0000027 Ga0495632_0000027_19810_21183 437
146 3300046522 Ga0495643_0073040 Ga0495643_0073040_99_1472 437
147 3300046524 Ga0495648_0022057 Ga0495648_0022057_1279_2652 437
148 3300046530 Ga0495654_0015338 Ga0495654_0015338_1118_2491 437
149 3300046538 Ga0495609_0033375 Ga0495609_0033375_555_1928 437
150 3300046558 Ga0495633_0003700 Ga0495633_0003700_470_1843 437
151 3300046616 Ga0495668_0001635 Ga0495668_0001635_17238_18611 437
152 3300046616 Ga0495668_0037173 Ga0495668_0037173_12_1385 437
153 3300046648 Ga0495611_0015314 Ga0495611_0015314_1879_3252 437
154 3300046660 Ga0495625_0032592 Ga0495625_0032592_706_2079 437
155 3300046665 Ga0495661_0000248 Ga0495661_0000248_1686_3059 437
156 3300046665 Ga0495661_0021274 Ga0495661_0021274_659_2032 437
157 3300046691 Ga0495670_0000150 Ga0495670_0000150_1021_2394 437
158 3300047443 Ga0495687_062087 Ga0495687_062087_64_1422 437
159 3300047446 Ga0495679_016325 Ga0495679_016325_1283_2656 437
160 3300047470 Ga0495681_0000391 Ga0495681_0000391_598_1971 437
161 3300048904 Ga0496101_0025995 Ga0496101_0025995_1646_3019 437
162 3300048916 Ga0496113_0016377 Ga0496113_0016377_1889_3262 437
163 3300048925 Ga0496122_0000815 Ga0496122_0000815_4691_6064 437
164 3300048926 Ga0496123_0000578 Ga0496123_0000578_1652_3025 437
165 3300048928 Ga0496125_0020264 Ga0496125_0020264_4160_5533 437
166 3300049459 Ga0495678_000184 Ga0495678_000184_69567_70988 437
167 3300009545 Ga0105237_10264008 Ga0105237_102640082 438
168 3300046542 Ga0495597_0004075 Ga0495597_0004075_3208_4632 438
169 3300046794 Ga0495589_0000157 Ga0495589_0000157_59892_61316 438
170 3300047443 Ga0495687_000184 Ga0495687_000184_25574_26998 438
171 3300053136 Ga0500559_0008220 Ga0500559_0008220_453_1772 438
172 3300053163 Ga0500639_028487 Ga0500639_028487_1030_2349 438
173 3300053735 Ga0500596_003374 Ga0500596_003374_897_2216 438
174 3300037312 Ga0395899_0000082 Ga0395899_0000082_162507_163844 439
175 3300046691 Ga0495670_0008728 Ga0495670_0008728_1669_3027 439
176 3300048913 Ga0496110_0000027 Ga0496110_0000027_18055_19446 439
177 3300046506 Ga0495583_0000478 Ga0495583_0000478_48425_49783 440
178 3300047321 Ga0495676_0034164 Ga0495676_0034164_898_2238 440
179 3300048905 Ga0496102_0000140 Ga0496102_0000140_96086_97465 440
180 3300003323 rootH1_10193287 rootH1_101932874 441
181 3300046692 Ga0495671_0045997 Ga0495671_0045997_154_1524 441
182 iso_pu_bacteria 2643221603 2644030313 441
183 3300042876 Ga0451577_0020710 Ga0451577_0020710_3898_5244 442
184 3300045051 Ga0451576_0000497 Ga0451576_0000497_19767_21113 442
185 iso_pu_bacteria 8047673197 8047674832 442
186 3300046528 Ga0495642_0021256 Ga0495642_0021256_1123_2493 443
187 3300046616 Ga0495668_0054849 Ga0495668_0054849_131_1501 443
188 3300046674 Ga0495588_0056045 Ga0495588_0056045_534_1919 443
189 3300048909 Ga0496106_0014678 Ga0496106_0014678_1819_3153 443
190 3300048924 Ga0496121_0018546 Ga0496121_0018546_3056_4390 443
191 3300049571 Ga0501034_0001536 Ga0501034_0001536_2523_3905 443
192 iso_pu_bacteria 2884836552 2884836931 443
193 iso_pu_bacteria 2884852848 2884853222 443
194 iso_pu_bacteria 2896154374 2896155660 443
195 3300046457 Ga0495590_0000873 Ga0495590_0000873_5847_7205 444
196 3300046471 Ga0495650_0000011 Ga0495650_0000011_356448_357800 444
197 3300046507 Ga0495606_0010487 Ga0495606_0010487_5533_6903 444
198 3300046518 Ga0495631_0052926 Ga0495631_0052926_51_1421 444
199 3300046665 Ga0495661_0095798 Ga0495661_0095798_109_1479 444
200 3300048091 Ga0495626_0000014 Ga0495626_0000014_15716_17101 444
201 3300049459 Ga0495678_004880 Ga0495678_004880_4441_5793 444
202 iso_pu_bacteria 2885080285 2885082484 444
203 iso_pu_bacteria 2932410948 2932413980 444
204 iso_pu_bacteria 2932416698 2932418040 444
205 3300037312 Ga0395899_0001114 Ga0395899_0001114_15252_16607 445
206 3300037312 Ga0395899_0018773 Ga0395899_0018773_573_1928 445
207 3300037418 Ga0395900_0077823 Ga0395900_0077823_262_1617 445
208 3300037418 Ga0395900_0153003 Ga0395900_0153003_427_1782 445
209 3300037466 Ga0395898_0083674 Ga0395898_0083674_1371_2726 445
210 3300037471 Ga0395905_0002709 Ga0395905_0002709_1493_2848 445
211 3300038443 Ga0395901_0010643 Ga0395901_0010643_7405_8760 445
212 3300038443 Ga0395901_0216305 Ga0395901_0216305_225_1580 445
213 3300044684 Ga0466966_0066544 Ga0466966_0066544_833_2188 445
214 3300045049 Ga0466959_0098127 Ga0466959_0098127_366_1721 445
215 3300046471 Ga0495650_0000135 Ga0495650_0000135_28883_30238 445
216 3300046507 Ga0495606_0001588 Ga0495606_0001588_18013_19368 445
217 3300046557 Ga0495622_0000055 Ga0495622_0000055_4478_5833 445
218 3300061719 Ga0466962_0054375 Ga0466962_0054375_19_1374 445
219 iso_pu_bacteria 2600255292 2601671700 445
220 iso_pu_bacteria 2857547612 2857551954 445
221 3300003322 rootL2_10000604 rootL2_100006043 446
222 3300003759 Ga0055525_1000029 Ga0055525_1000029159 446
223 3300005327 Ga0070658_10117472 Ga0070658_101174721 446
224 3300005339 Ga0070660_100066290 Ga0070660_1000662903 446
225 3300005564 Ga0070664_100137889 Ga0070664_1001378892 446
226 3300009093 Ga0105240_10117666 Ga0105240_101176662 446
227 3300009174 Ga0105241_10077453 Ga0105241_100774533 446
228 3300013102 Ga0157371_10000013 Ga0157371_10000013238 446
229 3300015261 Ga0182006_1005427 Ga0182006_10054274 446
230 3300025230 Ga0209563_100003 Ga0209563_100003321 446
231 3300025253 Ga0209677_100653 Ga0209677_10065316 446
232 3300025909 Ga0207705_10008981 Ga0207705_1000898111 446
233 3300025911 Ga0207654_10033768 Ga0207654_100337682 446
234 3300025934 Ga0207686_10021115 Ga0207686_100211152 446
235 3300025949 Ga0207667_10027084 Ga0207667_100270842 446
236 3300027666 Ga0209282_1000001 Ga0209282_10000012019 446
237 3300030745 Ga0316182_1072899 Ga0316182_10728994 446
238 3300037312 Ga0395899_0014677 Ga0395899_0014677_478_1836 446
239 3300037418 Ga0395900_0000566 Ga0395900_0000566_49088_50446 446
240 3300037418 Ga0395900_0001391 Ga0395900_0001391_14289_15701 446
241 3300037418 Ga0395900_0154022 Ga0395900_0154022_818_2176 446
242 3300037471 Ga0395905_0163977 Ga0395905_0163977_352_1710 446
243 3300038443 Ga0395901_0031285 Ga0395901_0031285_568_1926 446
244 3300042005 Ga0439448_0021559 Ga0439448_0021559_571_1929 446
245 3300044656 Ga0466969_0016318 Ga0466969_0016318_1822_3180 446
246 3300044658 Ga0466972_0003830 Ga0466972_0003830_340_1776 446
247 3300044683 Ga0466965_0002432 Ga0466965_0002432_754_2190 446
248 3300044684 Ga0466966_0028753 Ga0466966_0028753_1859_3217 446
249 3300044684 Ga0466966_0032497 Ga0466966_0032497_931_2289 446
250 3300044706 Ga0466964_0002788 Ga0466964_0002788_760_2196 446
251 3300044735 Ga0466968_0011495 Ga0466968_0011495_195_1553 446
252 3300044842 Ga0466957_0007607 Ga0466957_0007607_615_1973 446
253 3300045049 Ga0466959_0003762 Ga0466959_0003762_7437_8795 446
254 3300046452 Ga0495617_000948 Ga0495617_000948_5967_7325 446
255 3300046455 Ga0495603_0037923 Ga0495603_0037923_1334_2692 446
256 3300046457 Ga0495590_0010281 Ga0495590_0010281_281_1645 446
257 3300046472 Ga0495580_0013644 Ga0495580_0013644_258_1622 446
258 3300046473 Ga0495582_0023418 Ga0495582_0023418_267_1631 446
259 3300046474 Ga0495605_0000029 Ga0495605_0000029_151003_152367 446
260 3300046491 Ga0495584_0000513 Ga0495584_0000513_10962_12320 446
261 3300046491 Ga0495584_0002239 Ga0495584_0002239_8030_9388 446
262 3300046492 Ga0495585_0000010 Ga0495585_0000010_220623_221981 446
263 3300046492 Ga0495585_0000133 Ga0495585_0000133_77592_78950 446
264 3300046492 Ga0495585_0032058 Ga0495585_0032058_739_2097 446
265 3300046499 Ga0495594_0008706 Ga0495594_0008706_2847_4205 446
266 3300046500 Ga0495596_0003612 Ga0495596_0003612_5991_7349 446
267 3300046500 Ga0495596_0005492 Ga0495596_0005492_554_1912 446
268 3300046501 Ga0495607_0008638 Ga0495607_0008638_4761_6119 446
269 3300046501 Ga0495607_0009071 Ga0495607_0009071_1340_2698 446
270 3300046501 Ga0495607_0010250 Ga0495607_0010250_4304_5662 446
271 3300046501 Ga0495607_0035071 Ga0495607_0035071_1293_2657 446
272 3300046507 Ga0495606_0052143 Ga0495606_0052143_731_2116 446
273 3300046513 Ga0495616_0000250 Ga0495616_0000250_37703_39061 446
274 3300046513 Ga0495616_0050891 Ga0495616_0050891_646_2004 446
275 3300046515 Ga0495620_0003674 Ga0495620_0003674_6565_7923 446
276 3300046519 Ga0495632_0007715 Ga0495632_0007715_1082_2440 446
277 3300046519 Ga0495632_0060644 Ga0495632_0060644_391_1749 446
278 3300046522 Ga0495643_0005201 Ga0495643_0005201_5561_6925 446
279 3300046524 Ga0495648_0000003 Ga0495648_0000003_7978_9336 446
280 3300046525 Ga0495663_0009844 Ga0495663_0009844_109_1467 446
281 3300046528 Ga0495642_0000161 Ga0495642_0000161_540_1898 446
282 3300046528 Ga0495642_0001897 Ga0495642_0001897_6898_8256 446
283 3300046538 Ga0495609_0000022 Ga0495609_0000022_236151_237509 446
284 3300046538 Ga0495609_0024916 Ga0495609_0024916_907_2292 446
285 3300046542 Ga0495597_0041377 Ga0495597_0041377_571_1962 446
286 3300046557 Ga0495622_0058782 Ga0495622_0058782_375_1733 446
287 3300046558 Ga0495633_0004245 Ga0495633_0004245_7206_8564 446
288 3300046616 Ga0495668_0002595 Ga0495668_0002595_667_2025 446
289 3300046648 Ga0495611_0015967 Ga0495611_0015967_1306_2664 446
290 3300046665 Ga0495661_0009319 Ga0495661_0009319_3627_4985 446
291 3300046665 Ga0495661_0020885 Ga0495661_0020885_1413_2771 446
292 3300046674 Ga0495588_0000086 Ga0495588_0000086_26286_27644 446
293 3300046674 Ga0495588_0061098 Ga0495588_0061098_106_1470 446
294 3300046794 Ga0495589_0000017 Ga0495589_0000017_200652_202010 446
295 3300046794 Ga0495589_0000170 Ga0495589_0000170_573_1937 446
296 3300046810 Ga0495660_0000127 Ga0495660_0000127_59156_60520 446
297 3300046810 Ga0495660_0013636 Ga0495660_0013636_1904_3262 446
298 3300047317 Ga0495604_0010745 Ga0495604_0010745_4182_5546 446
299 3300047318 Ga0495636_0008507 Ga0495636_0008507_2264_3622 446
300 3300047318 Ga0495636_0012725 Ga0495636_0012725_83_1441 446
301 3300047320 Ga0495672_0000171 Ga0495672_0000171_32015_33385 446
302 3300047320 Ga0495672_0010355 Ga0495672_0010355_701_2065 446
303 3300047323 Ga0495683_0000046 Ga0495683_0000046_42893_44251 446
304 3300047323 Ga0495683_0030677 Ga0495683_0030677_874_2232 446
305 3300047323 Ga0495683_0034996 Ga0495683_0034996_619_1983 446
306 3300047443 Ga0495687_000033 Ga0495687_000033_141341_142699 446
307 3300047443 Ga0495687_000102 Ga0495687_000102_41976_43334 446
308 3300047443 Ga0495687_000797 Ga0495687_000797_1894_3258 446
309 3300047445 Ga0495677_0000002 Ga0495677_0000002_224746_226104 446
310 3300047445 Ga0495677_0006900 Ga0495677_0006900_2839_4197 446
311 3300047470 Ga0495681_0040306 Ga0495681_0040306_310_1668 446
312 3300047472 Ga0495686_0000853 Ga0495686_0000853_20844_22202 446
313 3300048088 Ga0495602_0015897 Ga0495602_0015897_5316_6680 446
314 3300048090 Ga0495615_0003998 Ga0495615_0003998_1072_2430 446
315 3300048091 Ga0495626_0000097 Ga0495626_0000097_85988_87352 446
316 3300048091 Ga0495626_0006289 Ga0495626_0006289_1549_2907 446
317 3300048091 Ga0495626_0029070 Ga0495626_0029070_529_1887 446
318 3300048091 Ga0495626_0033291 Ga0495626_0033291_836_2194 446
319 3300048905 Ga0496102_0015944 Ga0496102_0015944_2468_3826 446
320 3300048907 Ga0496104_0126439 Ga0496104_0126439_267_1625 446
321 3300048916 Ga0496113_0016577 Ga0496113_0016577_2461_3873 446
322 3300048916 Ga0496113_0098703 Ga0496113_0098703_648_2012 446
323 3300048925 Ga0496122_0015865 Ga0496122_0015865_4046_5458 446
324 3300048925 Ga0496122_0036250 Ga0496122_0036250_2111_3592 446
325 3300048926 Ga0496123_0006645 Ga0496123_0006645_9777_11135 446
326 3300048926 Ga0496123_0016025 Ga0496123_0016025_4128_5609 446
327 3300048927 Ga0496124_0047960 Ga0496124_0047960_317_1675 446
328 iso_pu_bacteria 2643221556 2643800146 446
329 iso_pu_bacteria 2643221684 2644472070 446
330 3300003762 Ga0055542_1010032 Ga0055542_10100321 447
331 3300025254 Ga0209148_1000652 Ga0209148_100065219 447
332 3300031838 Ga0307518_10010626 Ga0307518_100106264 447
333 3300037312 Ga0395899_0077422 Ga0395899_0077422_244_1605 447
334 3300037418 Ga0395900_0001911 Ga0395900_0001911_18501_19862 447
335 3300037418 Ga0395900_0026728 Ga0395900_0026728_2390_3751 447
336 3300037471 Ga0395905_0229169 Ga0395905_0229169_44_1582 447
337 3300038443 Ga0395901_0000314 Ga0395901_0000314_42167_43528 447
338 3300046506 Ga0495583_0001750 Ga0495583_0001750_4094_5455 447
339 3300046518 Ga0495631_0013801 Ga0495631_0013801_719_2080 447
340 3300046519 Ga0495632_0036118 Ga0495632_0036118_564_1925 447
341 3300046522 Ga0495643_0036671 Ga0495643_0036671_640_2001 447
342 3300046648 Ga0495611_0009717 Ga0495611_0009717_841_2202 447
343 3300046694 Ga0495649_0013708 Ga0495649_0013708_646_2007 447
344 3300046794 Ga0495589_0020404 Ga0495589_0020404_1836_3197 447
345 3300046810 Ga0495660_0023922 Ga0495660_0023922_1930_3291 447
346 3300047320 Ga0495672_0019931 Ga0495672_0019931_2170_3531 447
347 3300048091 Ga0495626_0042595 Ga0495626_0042595_365_1726 447
348 3300048927 Ga0496124_0028677 Ga0496124_0028677_1202_2563 447
349 3300049822 Ga0501035_0009150 Ga0501035_0009150_558_1919 447
350 3300049823 Ga0501044_0155424 Ga0501044_0155424_323_1684 447
351 3300014497 Ga0182008_10000095 Ga0182008_1000009573 448
352 3300015261 Ga0182006_1000078 Ga0182006_100007894 448
353 3300015262 Ga0182007_10000055 Ga0182007_1000005585 448
354 3300015265 Ga0182005_1000128 Ga0182005_100012818 448
355 3300046491 Ga0495584_0011595 Ga0495584_0011595_884_2248 448
356 3300046500 Ga0495596_0013675 Ga0495596_0013675_1432_2796 448
357 3300046501 Ga0495607_0051671 Ga0495607_0051671_286_1650 448
358 3300046519 Ga0495632_0024777 Ga0495632_0024777_1160_2551 448
359 3300046523 Ga0495644_0001401 Ga0495644_0001401_5039_6403 448
360 3300046528 Ga0495642_0010016 Ga0495642_0010016_1080_2471 448
361 3300046530 Ga0495654_0028970 Ga0495654_0028970_728_2098 448
362 3300046558 Ga0495633_0007705 Ga0495633_0007705_474_1844 448
363 3300046648 Ga0495611_0020694 Ga0495611_0020694_1435_2799 448
364 3300046665 Ga0495661_0032775 Ga0495661_0032775_83_1447 448
365 3300046665 Ga0495661_0051266 Ga0495661_0051266_36_1400 448
366 3300046691 Ga0495670_0080548 Ga0495670_0080548_121_1539 448
367 3300046794 Ga0495589_0026277 Ga0495589_0026277_645_2036 448
368 3300047445 Ga0495677_0000304 Ga0495677_0000304_18390_19754 448
369 3300047446 Ga0495679_008882 Ga0495679_008882_1835_3199 448
370 3300047470 Ga0495681_0001604 Ga0495681_0001604_8104_9468 448
371 3300047470 Ga0495681_0007479 Ga0495681_0007479_1091_2455 448
372 3300048919 Ga0496116_0082512 Ga0496116_0082512_433_1803 448
373 3300048920 Ga0496117_0000032 Ga0496117_0000032_115224_116594 448
374 3300048921 Ga0496118_0000027 Ga0496118_0000027_258940_260310 448
375 3300048924 Ga0496121_0002434 Ga0496121_0002434_374_1744 448
376 3300048924 Ga0496121_0002563 Ga0496121_0002563_22152_23522 448
377 3300048925 Ga0496122_0001704 Ga0496122_0001704_23693_25129 448
378 3300048926 Ga0496123_0013837 Ga0496123_0013837_1791_3227 448
379 3300049460 Ga0495682_0003446 Ga0495682_0003446_4408_5778 448
380 3300049460 Ga0495682_0014678 Ga0495682_0014678_963_2354 448
381 3300017792 Ga0163161_10038412 Ga0163161_100384122 449
382 3300046501 Ga0495607_0019783 Ga0495607_0019783_1247_2605 449
383 3300046528 Ga0495642_0008955 Ga0495642_0008955_1699_3069 449
384 3300048918 Ga0496115_0004384 Ga0496115_0004384_3559_4926 449
385 3300005457 Ga0070662_100220366 Ga0070662_1002203661 450
386 3300044706 Ga0466964_0002048 Ga0466964_0002048_1388_2758 450
387 iso_pu_bacteria 8003570095 8003574169 450
388 3300013297 Ga0157378_10001966 Ga0157378_100019662 451
389 3300042004 Ga0439445_0018058 Ga0439445_0018058_116_1486 451
390 3300046526 Ga0495666_0002930 Ga0495666_0002930_5711_7084 451
391 3300048910 Ga0496107_0041708 Ga0496107_0041708_1278_2651 451
392 3300048914 Ga0496111_0073530 Ga0496111_0073530_445_1818 451
393 3300048927 Ga0496124_0030032 Ga0496124_0030032_295_1668 451
394 iso_pu_bacteria 3005445848 3005450554 451
395 iso_pu_bacteria 2511231027 2511391314 452
396 iso_pu_bacteria 2643221599 2644005157 452
397 iso_pu_bacteria 2643221634 2644192448 452
398 iso_pu_bacteria 2657244999 2657685551 452
399 iso_pu_bacteria 2718217927 2719389934 452
400 iso_pu_bacteria 2718218423 2721403573 452
401 iso_pu_bacteria 2721755809 2724035149 452
402 iso_pu_bacteria 2758568016 2758637722 452
403 iso_pu_bacteria 2791355082 2792579748 452
404 iso_pu_bacteria 2791355265 2793354245 452
405 iso_pu_bacteria 2802429268 2804755206 452
406 iso_pu_bacteria 2842871566 2842875589 452
407 iso_pu_bacteria 2854911287 2854914257 452
408 iso_pu_bacteria 2882632389 2882633327 452
409 iso_pu_bacteria 2913295892 2913296988 452
410 iso_pu_bacteria 2941499720 2941506226 452
411 iso_pu_bacteria 8005275841 8005276057 452
412 iso_pu_bacteria 8018176218 8018180643 452
413 iso_pu_bacteria 8049293176 8049298239 452
414 iso_pu_bacteria 8056382006 8056385399 452
415 iso_pu_bacteria 2510065019 2510133453 453
416 iso_pu_bacteria 2515075009 2515112418 453
417 iso_pu_bacteria 2516653077 2517036150 453
418 iso_pu_bacteria 2582581294 2585204992 453
419 iso_pu_bacteria 2643221580 2643909869 453
420 iso_pu_bacteria 2643221674 2644412966 453
421 iso_pu_bacteria 2915650412 2915651140 453
422 iso_pu_bacteria 2932401849 2932405065 453
423 iso_pu_bacteria 8005460587 8005463089 453
424 iso_pu_bacteria 8057874678 8057874920 453
425 iso_pu_bacteria 2509276021 2509390970 454
426 iso_pu_bacteria 2509276033 2509441877 454
427 iso_pu_bacteria 2510461076 2510893368 454
428 iso_pu_bacteria 2510917022 2511136194 454
429 iso_pu_bacteria 2510917028 2511185995 454
430 iso_pu_bacteria 2513237084 2513572118 454
431 iso_pu_bacteria 2513237085 2513575972 454
432 iso_pu_bacteria 2513237088 2513600169 454
433 iso_pu_bacteria 2513237093 2513633594 454
434 iso_pu_bacteria 2513237103 2513712184 454
435 iso_pu_bacteria 2513237144 2513910913 454
436 iso_pu_bacteria 2513237146 2513927185 454
437 iso_pu_bacteria 2513237159 2513998985 454
438 iso_pu_bacteria 2513237162 2514019181 454
439 iso_pu_bacteria 2515154107 2515611920 454
440 iso_pu_bacteria 2515154113 2515634310 454
441 iso_pu_bacteria 2515154114 2515641813 454
442 iso_pu_bacteria 2515154116 2515658918 454
443 iso_pu_bacteria 2515154134 2515742616 454
444 iso_pu_bacteria 2516653085 2517081429 454
445 iso_pu_bacteria 2517093000 2517100188 454
446 iso_pu_bacteria 2517287029 2517411201 454
447 iso_pu_bacteria 2524023209 2524459332 454
448 iso_pu_bacteria 2529292951 2530648609 454
449 iso_pu_bacteria 2582581307 2585275360 454
450 iso_pu_bacteria 2585427526 2585526516 454
451 iso_pu_bacteria 2585427528 2585538810 454
452 iso_pu_bacteria 2585427531 2585560197 454
453 iso_pu_bacteria 2585427593 2585836761 454
454 iso_pu_bacteria 2585427609 2585905621 454
455 iso_pu_bacteria 2585428125 2587979263 454
456 iso_pu_bacteria 2599185170 2599415375 454
457 iso_pu_bacteria 2599185210 2599604734 454
458 iso_pu_bacteria 2600255279 2601612013 454
459 iso_pu_bacteria 2600255308 2601748717 454
460 iso_pu_bacteria 2615840624 2616294325 454
461 iso_pu_bacteria 2615840698 2616553498 454
462 iso_pu_bacteria 2643221582 2643921933 454
463 iso_pu_bacteria 2643221643 2644239844 454
464 iso_pu_bacteria 2643221653 2644300694 454
465 iso_pu_bacteria 2643221719 2644658916 454
466 iso_pu_bacteria 2718217882 2719184186 454
467 iso_pu_bacteria 2718217997 2719669529 454
468 iso_pu_bacteria 2718218009 2719729759 454
469 iso_pu_bacteria 2718218199 2720494545 454
470 iso_pu_bacteria 2718218232 2720610882 454
471 iso_pu_bacteria 2718218233 2720616759 454
472 iso_pu_bacteria 2718218235 2720628116 454
473 iso_pu_bacteria 2718218269 2720771696 454
474 iso_pu_bacteria 2718218363 2721144009 454
475 iso_pu_bacteria 2718218365 2721156697 454
476 iso_pu_bacteria 2718218366 2721161384 454
477 iso_pu_bacteria 2721755514 2722837337 454
478 iso_pu_bacteria 2721755556 2723030961 454
479 iso_pu_bacteria 2721755684 2723563459 454
480 iso_pu_bacteria 2721755685 2723571450 454
481 iso_pu_bacteria 2721755810 2724040913 454
482 iso_pu_bacteria 2721755819 2724087245 454
483 iso_pu_bacteria 2721755822 2724100956 454
484 iso_pu_bacteria 2721755823 2724108199 454
485 iso_pu_bacteria 2724679232 2725946368 454
486 iso_pu_bacteria 2728369352 2730105427 454
487 iso_pu_bacteria 2728369365 2730162326 454
488 iso_pu_bacteria 2728369397 2730295458 454
489 iso_pu_bacteria 2738541333 2739034232 454
490 iso_pu_bacteria 2765235942 2766068266 454
491 iso_pu_bacteria 2767802442 2770196126 454
492 iso_pu_bacteria 2775507266 2778174253 454
493 iso_pu_bacteria 2791355256 2793295842 454
494 iso_pu_bacteria 2791355259 2793312784 454
495 iso_pu_bacteria 2791355260 2793321899 454
496 iso_pu_bacteria 2791355261 2793326853 454
497 iso_pu_bacteria 2791355262 2793334663 454
498 iso_pu_bacteria 2791355263 2793340698 454
499 iso_pu_bacteria 2791355264 2793348620 454
500 iso_pu_bacteria 2791355266 2793361792 454
501 iso_pu_bacteria 2791355267 2793367304 454
502 iso_pu_bacteria 2802429606 2805933096 454
503 iso_pu_bacteria 2802429633 2806043032 454
504 iso_pu_bacteria 2802429634 2806050985 454
505 iso_pu_bacteria 2802429635 2806057847 454
506 iso_pu_bacteria 2802429636 2806065437 454
507 iso_pu_bacteria 2802429637 2806075322 454
508 iso_pu_bacteria 2808606387 2808989318 454
509 iso_pu_bacteria 2818991439 2819561548 454
510 iso_pu_bacteria 2838016132 2838019594 454
511 iso_pu_bacteria 2838022645 2838027196 454
512 iso_pu_bacteria 2838029111 2838029212 454
513 iso_pu_bacteria 2838035591 2838038902 454
514 iso_pu_bacteria 2838061910 2838066382 454
515 iso_pu_bacteria 2838068647 2838072463 454
516 iso_pu_bacteria 2838661181 2838664508 454
517 iso_pu_bacteria 2838668709 2838669038 454
518 iso_pu_bacteria 2838680041 2838686098 454
519 iso_pu_bacteria 2838686498 2838688447 454
520 iso_pu_bacteria 2838694306 2838700531 454
521 iso_pu_bacteria 2838701080 2838701302 454
522 iso_pu_bacteria 2838707686 2838713810 454
523 iso_pu_bacteria 2838729681 2838734418 454
524 iso_pu_bacteria 2838742623 2838746877 454
525 iso_pu_bacteria 2841851746 2841852188 454
526 iso_pu_bacteria 2841859092 2841863491 454
527 iso_pu_bacteria 2841864319 2841865693 454
528 iso_pu_bacteria 2842077413 2842083037 454
529 iso_pu_bacteria 2842110456 2842111659 454
530 iso_pu_bacteria 2842118031 2842124155 454
531 iso_pu_bacteria 2842146304 2842146633 454
532 iso_pu_bacteria 2842156927 2842158737 454
533 iso_pu_bacteria 2842163707 2842166166 454
534 iso_pu_bacteria 2842180545 2842182351 454
535 iso_pu_bacteria 2842192696 2842193973 454
536 iso_pu_bacteria 2842198810 2842200670 454
537 iso_pu_bacteria 2842205361 2842208557 454
538 iso_pu_bacteria 2842217011 2842222510 454
539 iso_pu_bacteria 2842229732 2842234636 454
540 iso_pu_bacteria 2842237096 2842243223 454
541 iso_pu_bacteria 2842243621 2842248369 454
542 iso_pu_bacteria 2842250916 2842251137 454
543 iso_pu_bacteria 2842257432 2842262458 454
544 iso_pu_bacteria 2842271015 2842272603 454
545 iso_pu_bacteria 2842278818 2842282097 454
546 iso_pu_bacteria 2842285085 2842289140 454
547 iso_pu_bacteria 2842291075 2842297296 454
548 iso_pu_bacteria 2842298080 2842301123 454
549 iso_pu_bacteria 2842304105 2842307956 454
550 iso_pu_bacteria 2842311132 2842313187 454
551 iso_pu_bacteria 2842317721 2842319386 454
552 iso_pu_bacteria 2842341865 2842345645 454
553 iso_pu_bacteria 2842357229 2842359862 454
554 iso_pu_bacteria 2842363717 2842363938 454
555 iso_pu_bacteria 2842370503 2842376283 454
556 iso_pu_bacteria 2842377471 2842383690 454
557 iso_pu_bacteria 2842384541 2842390829 454
558 iso_pu_bacteria 2842402390 2842407346 454
559 iso_pu_bacteria 2842409023 2842413405 454
560 iso_pu_bacteria 2842415677 2842420048 454
561 iso_pu_bacteria 2842422224 2842426089 454
562 iso_pu_bacteria 2842428310 2842430233 454
563 iso_pu_bacteria 2842441272 2842442815 454
564 iso_pu_bacteria 2842447887 2842452508 454
565 iso_pu_bacteria 2842462802 2842464691 454
566 iso_pu_bacteria 2842469257 2842471230 454
567 iso_pu_bacteria 2842475841 2842476358 454
568 iso_pu_bacteria 2842489311 2842490735 454
569 iso_pu_bacteria 2842495871 2842498852 454
570 iso_pu_bacteria 2842502639 2842502740 454
571 iso_pu_bacteria 2842509118 2842512652 454
572 iso_pu_bacteria 2842515876 2842520274 454
573 iso_pu_bacteria 2842521101 2842524727 454
574 iso_pu_bacteria 2844454524 2844461501 454
575 iso_pu_bacteria 2857516855 2857520677 454
576 iso_pu_bacteria 2899792073 2899793847 454
577 iso_pu_bacteria 2928521798 2928526362 454
578 iso_pu_bacteria 2933011516 2933015966 454
579 iso_pu_bacteria 2933016740 2933017018 454
580 iso_pu_bacteria 2933570622 2933574406 454
581 iso_pu_bacteria 2933586486 2933590865 454
582 iso_pu_bacteria 2933594066 2933598467 454
583 iso_pu_bacteria 2935894831 2935900847 454
584 iso_pu_bacteria 2935901341 2935907652 454
585 iso_pu_bacteria 2936367885 2936370817 454
586 iso_pu_bacteria 2936381700 2936382509 454
587 iso_pu_bacteria 2979100975 2979103111 454
588 iso_pu_bacteria 2984509177 2984513856 454
589 iso_pu_bacteria 2984537506 2984542576 454
590 iso_pu_bacteria 2984601300 2984606487 454
591 iso_pu_bacteria 2989349275 2989353532 454
592 iso_pu_bacteria 2996887358 2996893100 454
593 iso_pu_bacteria 2996893221 2996894840 454
594 iso_pu_bacteria 3005409236 3005412012 454
595 iso_pu_bacteria 639633055 639650998 454
596 iso_pu_bacteria 8005258706 8005260649 454
597 iso_pu_bacteria 8005282627 8005287289 454
598 iso_pu_bacteria 8005289223 8005289968 454
599 iso_pu_bacteria 8005301065 8005307363 454
600 iso_pu_bacteria 8005307578 8005312030 454
601 iso_pu_bacteria 8005321885 8005327627 454
602 iso_pu_bacteria 8005382845 8005389318 454
603 iso_pu_bacteria 8005395548 8005396819 454
604 iso_pu_bacteria 8005430974 8005435685 454
605 iso_pu_bacteria 8005497431 8005503429 454
606 iso_pu_bacteria 8005563573 8005564862 454
607 iso_pu_bacteria 8005570704 8005575884 454
608 iso_pu_bacteria 8005619151 8005625731 454
609 iso_pu_bacteria 8005626139 8005631988 454
610 iso_pu_bacteria 8005668836 8005675307 454
611 iso_pu_bacteria 8005682033 8005685031 454
612 iso_pu_bacteria 8005688590 8005688652 454
613 iso_pu_bacteria 8005695170 8005695363 454
614 iso_pu_bacteria 8018127388 8018134640 454
615 iso_pu_bacteria 8018163183 8018169746 454
616 iso_pu_bacteria 8023680758 8023686020 454
617 iso_pu_bacteria 8024479707 8024485383 454
618 iso_pu_bacteria 8024501048 8024507038 454
619 iso_pu_bacteria 8056375014 8056381886 454
620 3300003316 rootH1_10116215 rootH1_101162152 456
621 3300003775 Ga0055524_1006929 Ga0055524_10069295 456
622 3300021321 Ga0214542_1000307 Ga0214542_100030751 456
623 3300021327 Ga0214543_1000195 Ga0214543_100019536 456
624 3300025273 Ga0209673_1002063 Ga0209673_10020636 456
625 3300025295 Ga0209564_1000416 Ga0209564_100041673 456
626 3300025299 Ga0209256_1000550 Ga0209256_100055049 456
627 3300049569 Ga0501032_0039974 Ga0501032_0039974_1528_2913 456
628 3300049579 Ga0501043_0154898 Ga0501043_0154898_364_1749 456
629 3300049671 Ga0501238_000616 Ga0501238_000616_2205_3587 456
630 3300053160 Ga0500633_0000315 Ga0500633_0000315_5118_6503 456
631 3300053161 Ga0500634_0000008 Ga0500634_0000008_108275_109657 456
632 3300060353 Ga0501082_0078173 Ga0501082_0078173_762_2147 456
633 3300003215 JGI25153J46596_10029523 JGI25153J46596_100295232 457
634 3300003320 rootH2_10162198 rootH2_101621983 457
635 3300003794 Ga0055531_10005865 Ga0055531_100058654 457
636 3300006946 Ga0079104_1000454 Ga0079104_100045430 457
637 3300025297 Ga0209758_1002616 Ga0209758_10026163 457
638 3300025297 Ga0209758_1016407 Ga0209758_10164073 457
639 3300025304 Ga0209257_1001132 Ga0209257_100113230 457
640 3300025914 Ga0207671_10165926 Ga0207671_101659262 457
641 3300026035 Ga0207703_10215930 Ga0207703_102159301 457
642 3300027111 Ga0209281_1000035 Ga0209281_1000035311 457
643 3300027111 Ga0209281_1000035 Ga0209281_100003579 457
644 3300031730 Ga0307516_10137472 Ga0307516_101374722 457
645 3300046530 Ga0495654_0000133 Ga0495654_0000133_47414_48817 457
646 3300048921 Ga0496118_0019786 Ga0496118_0019786_76_1452 457
647 3300048924 Ga0496121_0131186 Ga0496121_0131186_279_1682 457
648 3300049573 Ga0501037_0075494 Ga0501037_0075494_14_1396 457
649 3300002704 JGI25155J39150_1000006 JGI25155J39150_1000006242 458
650 3300002705 JGI25156J39149_1000019 JGI25156J39149_10000195 458
651 3300002738 JGI25154J39366_1000177 JGI25154J39366_10001775 458
652 3300002741 JGI25157J39369_1000024 JGI25157J39369_1000024159 458
653 3300002774 JGI25150J39212_1012418 JGI25150J39212_10124181 458
654 3300003187 JGI25151J46595_10000337 JGI25151J46595_100003379 458
655 3300003215 JGI25153J46596_10014556 JGI25153J46596_100145561 458
656 3300003320 rootH2_10035300 rootH2_100353002 458
657 3300003354 JGI25160J50197_1003379 JGI25160J50197_10033796 458
658 3300003374 JGI25161J50226_1003563 JGI25161J50226_10035632 458
659 3300003771 Ga0055526_1001763 Ga0055526_100176314 458
660 3300003771 Ga0055526_1014249 Ga0055526_10142493 458
661 3300003775 Ga0055524_1000875 Ga0055524_100087511 458
662 3300003775 Ga0055524_1008408 Ga0055524_10084082 458
663 3300003790 Ga0055528_1000526 Ga0055528_10005263 458
664 3300003790 Ga0055528_1001697 Ga0055528_100169713 458
665 3300003792 Ga0055540_1000066 Ga0055540_100006698 458
666 3300003792 Ga0055540_1015774 Ga0055540_10157742 458
667 3300003856 Ga0058692_1001939 Ga0058692_10019393 458
668 3300004625 Ga0055543_1001451 Ga0055543_100145110 458
669 3300006042 Ga0075368_10004226 Ga0075368_100042261 458
670 3300006051 Ga0075364_10011254 Ga0075364_100112544 458
671 3300006178 Ga0075367_10004319 Ga0075367_100043196 458
672 3300006178 Ga0075367_10008268 Ga0075367_100082684 458
673 3300006186 Ga0075369_10005393 Ga0075369_100053934 458
674 3300006186 Ga0075369_10009086 Ga0075369_100090862 458
675 3300006353 Ga0075370_10003533 Ga0075370_100035335 458
676 3300006353 Ga0075370_10045895 Ga0075370_100458952 458
677 3300006948 Ga0099826_10000043 Ga0099826_1000004322 458
678 3300006948 Ga0099826_10001556 Ga0099826_100015563 458
679 3300009765 Ga0123341_1000005 Ga0123341_100000543 458
680 3300009766 Ga0123342_1017954 Ga0123342_10179544 458
681 3300009766 Ga0123342_1021468 Ga0123342_10214684 458
682 3300025206 Ga0209435_100011 Ga0209435_100011239 458
683 3300025245 Ga0207425_1002946 Ga0207425_10029462 458
684 3300025246 Ga0209646_1000024 Ga0209646_1000024172 458
685 3300025250 Ga0209026_1000030 Ga0209026_1000030172 458
686 3300025256 Ga0209759_1000011 Ga0209759_1000011239 458
687 3300025258 Ga0209129_1001120 Ga0209129_10011206 458
688 3300025273 Ga0209673_1000020 Ga0209673_1000020247 458
689 3300025273 Ga0209673_1000433 Ga0209673_100043313 458
690 3300025273 Ga0209673_1001482 Ga0209673_10014827 458
691 3300025273 Ga0209673_1006755 Ga0209673_10067555 458
692 3300025294 Ga0209025_1000081 Ga0209025_100008150 458
693 3300025294 Ga0209025_1007609 Ga0209025_10076099 458
694 3300025295 Ga0209564_1000114 Ga0209564_100011429 458
695 3300025295 Ga0209564_1002170 Ga0209564_10021704 458
696 3300025297 Ga0209758_1000076 Ga0209758_100007632 458
697 3300025297 Ga0209758_1021786 Ga0209758_10217861 458
698 3300025297 Ga0209758_1032526 Ga0209758_10325262 458
699 3300025299 Ga0209256_1001187 Ga0209256_100118729 458
700 3300025299 Ga0209256_1002269 Ga0209256_10022692 458
701 3300025302 Ga0207426_1000169 Ga0207426_1000169105 458
702 3300025303 Ga0209051_1000038 Ga0209051_100003857 458
703 3300025303 Ga0209051_1002057 Ga0209051_100205715 458
704 3300025304 Ga0209257_1026506 Ga0209257_10265061 458
705 3300027312 Ga0209371_1000771 Ga0209371_100077114 458
706 3300027312 Ga0209371_1004722 Ga0209371_10047226 458
707 3300027312 Ga0209371_1008770 Ga0209371_10087703 458
708 3300027666 Ga0209282_1000330 Ga0209282_100033015 458
709 3300027666 Ga0209282_1004458 Ga0209282_10044583 458
710 3300028794 Ga0307515_10042662 Ga0307515_100426624 458
711 3300030500 Ga0268256_1002374 Ga0268256_10023749 458
712 3300030500 Ga0268256_1004480 Ga0268256_10044806 458
713 3300031456 Ga0307513_10045525 Ga0307513_100455255 458
714 3300031911 Ga0307412_10057716 Ga0307412_100577162 458
715 3300041404 Ga0439436_0013169 Ga0439436_0013169_519_1904 458
716 3300041413 Ga0439465_0009946 Ga0439465_0009946_1419_2810 458
717 3300041498 Ga0451841_0633500 Ga0451841_0633500_771_2156 458
718 3300041505 Ga0451849_0375737 Ga0451849_0375737_69_1454 458
719 3300042007 Ga0439449_0004056 Ga0439449_0004056_3297_4700 458
720 3300042015 Ga0439462_0011899 Ga0439462_0011899_622_2007 458
721 3300046460 Ga0495638_0000210 Ga0495638_0000210_5286_6671 458
722 3300046474 Ga0495605_0012183 Ga0495605_0012183_2554_3939 458
723 3300046492 Ga0495585_0060987 Ga0495585_0060987_90_1475 458
724 3300046500 Ga0495596_0033033 Ga0495596_0033033_381_1766 458
725 3300046506 Ga0495583_0022145 Ga0495583_0022145_406_1791 458
726 3300046507 Ga0495606_0003217 Ga0495606_0003217_8672_10057 458
727 3300046519 Ga0495632_0059003 Ga0495632_0059003_60_1523 458
728 3300046524 Ga0495648_0031217 Ga0495648_0031217_747_2132 458
729 3300046542 Ga0495597_0005731 Ga0495597_0005731_155_1540 458
730 3300046558 Ga0495633_0041953 Ga0495633_0041953_182_1579 458
731 3300046615 Ga0495656_0025182 Ga0495656_0025182_22_1407 458
732 3300046616 Ga0495668_0023778 Ga0495668_0023778_1614_2999 458
733 3300046674 Ga0495588_0009166 Ga0495588_0009166_2373_3770 458
734 3300047318 Ga0495636_0009302 Ga0495636_0009302_2258_3643 458
735 3300047323 Ga0495683_0078998 Ga0495683_0078998_111_1496 458
736 3300047470 Ga0495681_0025600 Ga0495681_0025600_1156_2553 458
737 3300047472 Ga0495686_0044502 Ga0495686_0044502_247_1632 458
738 3300048921 Ga0496118_0008593 Ga0496118_0008593_1745_3130 458
739 3300048922 Ga0496119_0010239 Ga0496119_0010239_3188_4585 458
740 3300048924 Ga0496121_0039396 Ga0496121_0039396_51_1442 458
741 3300048925 Ga0496122_0012167 Ga0496122_0012167_1371_2762 458
742 3300048926 Ga0496123_0024836 Ga0496123_0024836_1353_2744 458
743 3300048927 Ga0496124_0003586 Ga0496124_0003586_2866_4257 458
744 3300048928 Ga0496125_0001622 Ga0496125_0001622_21293_22690 458
745 3300050491 nmdc:mga00v17_8_c1 nmdc:mga00v17_8_c1_88863_90260 458
746 3300050492 nmdc:mga0yw44_255_c1 nmdc:mga0yw44_255_c1_146_1543 458
747 3300050492 nmdc:mga0yw44_32194_c1 nmdc:mga0yw44_32194_c1_432_1817 458
748 3300050493 nmdc:mga0k408_659_c1 nmdc:mga0k408_659_c1_10903_12300 458
749 3300050494 nmdc:mga06z11_5425_c1 nmdc:mga06z11_5425_c1_1356_2741 458
750 3300050496 nmdc:mga07m45_15075_c1 nmdc:mga07m45_15075_c1_1899_3284 458
751 3300050496 nmdc:mga07m45_43414_c1 nmdc:mga07m45_43414_c1_742_2127 458
752 3300050516 nmdc:mga0sz30_380_c1 nmdc:mga0sz30_380_c1_7152_8549 458
753 3300053086 Ga0500578_0034486 Ga0500578_0034486_1301_2686 458
754 3300053105 Ga0500557_000474 Ga0500557_000474_1832_3217 458
755 3300053134 Ga0500658_0000253 Ga0500658_0000253_933_2318 458
756 3300053134 Ga0500658_0004589 Ga0500658_0004589_541_2004 458
757 3300053137 Ga0500561_0000051 Ga0500561_0000051_2405_3802 458
758 3300053139 Ga0500568_0000173 Ga0500568_0000173_49495_50916 458
759 3300053151 Ga0500604_0004697 Ga0500604_0004697_1742_3205 458
760 3300053153 Ga0500616_0004741 Ga0500616_0004741_7950_9335 458
761 3300053153 Ga0500616_0006634 Ga0500616_0006634_3281_4666 458

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17200

sCache_2

Single Cache domain 2

105

252

0.94

PF17201

Cache_3-Cache_2

Cache 3/Cache 2 fusion domain

130

252

0.94

PF07730

HisKA_3

Histidine kinase

308

378

0.92

PF08269

dCache_2

Cache domain

85

261

0.91

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

416

511

0.88

Feature Viewer

pLDDT pTM Quality
79.01 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map