F479520

General Info

Members Datasets Scaffolds Average Seq Length
760 320 1520 270

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100087444|Ga0075435_1000874443
Length 304
Sequence MIVPRGSAQPVRLLHVSDLHFGGHGAPRIERGLGALIERTRPELVVASGDLTHXXXXDQHEAAADFLRSLGPPVLAIPGNHDIPYTFPARFTRTFAEFERHWETTEPLFRSPSLYVVGLNSVRAWRHQSGGLRDEQLSRARDLLAQAPEGALRVVALHHHLIGAPWRSRKKPVARRSDVLATLVDSGAELILAGHIHQGAVSERHEFEVFTGDVRGVVVSIAPGLGQPRPNRRGEARGLHVYEWDADTIRVLTYVWRDDDWGLTALRMFARGRKPLAVEGGPAGAPSRVAEVPPQTDGGQSPPS

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
159 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
160 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
175 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
176 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
177 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
178 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
179 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
180 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
181 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
203 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
291 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
320 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 1.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 11.97
Rhizosphere 86.71
Stem 0
Stem Tuber 0
Unclassified 12.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100087444 3300007076 Bacteria 2568
2 rootL2_10214072 3300003322 Bacteria 1327
3 JGI25407J50210_10000387 3300003373 Bacteria 8458
4 JGI25407J50210_10000559 3300003373 Bacteria 7475
5 Ga0070658_10015301 3300005327 Bacteria 6140
6 Ga0070658_10254856 3300005327 Bacteria 1489
7 Ga0070658_10566055 3300005327 Bacteria 984
8 Ga0070683_100024600 3300005329 Bacteria 5396
9 Ga0070683_100024806 3300005329 Bacteria 5376
10 Ga0070683_100058978 3300005329 Bacteria 3566
11 Ga0070683_100080978 3300005329 Bacteria 3039
12 Ga0070683_100418375 3300005329 Bacteria 1278
13 Ga0070690_100042636 3300005330 Bacteria 2874
14 Ga0068869_100160808 3300005334 Unclassified 1748
15 Ga0070666_10088923 3300005335 Bacteria 2119
16 Ga0070680_100042145 3300005336 Bacteria 3703
17 Ga0070680_100058634 3300005336 Bacteria 3148
18 Ga0070680_100274218 3300005336 Unclassified 1428
19 Ga0070680_100309927 3300005336 Unclassified 1339
20 Ga0070682_100051240 3300005337 Bacteria 2579
21 Ga0070682_100105346 3300005337 Bacteria 1869
22 Ga0070682_100448759 3300005337 Bacteria 987
23 Ga0068868_100110722 3300005338 Bacteria 2231
24 Ga0068868_100184411 3300005338 Unclassified 1733
25 Ga0070660_100088255 3300005339 Unclassified 2442
26 Ga0070660_100248705 3300005339 Bacteria 1449
27 Ga0070661_100034256 3300005344 Unclassified 3683
28 Ga0070692_10065398 3300005345 Bacteria 1925
29 Ga0070675_100437205 3300005354 Bacteria 1172
30 Ga0070671_100091848 3300005355 Unclassified 2543
31 Ga0070674_100006239 3300005356 Bacteria 6939
32 Ga0070673_100133190 3300005364 Bacteria 2089
33 Ga0070688_100010593 3300005365 Bacteria 5091
34 Ga0070659_100308028 3300005366 Bacteria 1322
35 Ga0070659_100670613 3300005366 Unclassified 895
36 Ga0070667_100050683 3300005367 Bacteria 3499
37 Ga0070714_100058042 3300005435 Bacteria 3314
38 Ga0070714_100194932 3300005435 Bacteria 1851
39 Ga0070714_100249266 3300005435 Bacteria 1641
40 Ga0070713_100030294 3300005436 Bacteria 4296
41 Ga0070713_100156752 3300005436 Bacteria 2030
42 Ga0070713_100254796 3300005436 Bacteria 1602
43 Ga0070710_10033964 3300005437 Bacteria 2772
44 Ga0070710_10073048 3300005437 Bacteria 1982
45 Ga0070701_10003855 3300005438 Bacteria 5989
46 Ga0070711_100127111 3300005439 Bacteria 1893
47 Ga0070700_100001090 3300005441 Bacteria 13418
48 Ga0070700_100139876 3300005441 Bacteria 1644
49 Ga0070700_100338124 3300005441 Bacteria 1112
50 Ga0070694_100014123 3300005444 Bacteria 4997
51 Ga0070694_100100084 3300005444 Bacteria 2049
52 Ga0070708_100021491 3300005445 Bacteria 5456
53 Ga0070708_100043894 3300005445 Bacteria 3929
54 Ga0070708_100162508 3300005445 Unclassified 2081
55 Ga0070708_100184740 3300005445 Bacteria 1949
56 Ga0070708_100769054 3300005445 Unclassified 906
57 Ga0070663_100052734 3300005455 Bacteria 2902
58 Ga0070678_100007139 3300005456 Bacteria 6604
59 Ga0070678_100263772 3300005456 Unclassified 1450
60 Ga0070678_100369051 3300005456 Bacteria 1239
61 Ga0070662_100189128 3300005457 Bacteria 1627
62 Ga0070662_100411664 3300005457 Bacteria 1117
63 Ga0070681_10033589 3300005458 Bacteria 5149
64 Ga0068867_100021482 3300005459 Bacteria 4605
65 Ga0070685_10143880 3300005466 Unclassified 1504
66 Ga0070706_100030939 3300005467 Bacteria 4934
67 Ga0070706_100090103 3300005467 Bacteria 2844
68 Ga0070706_100099260 3300005467 Bacteria 2705
69 Ga0070706_100122819 3300005467 Bacteria 2421
70 Ga0070706_100317892 3300005467 Unclassified 1452
71 Ga0070707_100019302 3300005468 Bacteria 6420
72 Ga0070707_100135613 3300005468 Bacteria 2394
73 Ga0070707_100228111 3300005468 Bacteria 1814
74 Ga0070707_100293405 3300005468 Bacteria 1580
75 Ga0070698_100017072 3300005471 Bacteria 7653
76 Ga0070698_100021815 3300005471 Bacteria 6707
77 Ga0070698_100295974 3300005471 Bacteria 1549
78 Ga0070699_100002193 3300005518 Bacteria 17667
79 Ga0070699_100016866 3300005518 Bacteria 6270
80 Ga0070699_100452852 3300005518 Bacteria 1164
81 Ga0070679_100040701 3300005530 Bacteria 4623
82 Ga0070679_100139081 3300005530 Unclassified 2408
83 Ga0070679_100139427 3300005530 Unclassified 2405
84 Ga0070679_100177203 3300005530 Bacteria 2104
85 Ga0070679_100194682 3300005530 Bacteria 1995
86 Ga0070684_100029344 3300005535 Bacteria 4660
87 Ga0070684_100085362 3300005535 Bacteria 2800
88 Ga0070684_100131758 3300005535 Bacteria 2255
89 Ga0070684_100159227 3300005535 Unclassified 2047
90 Ga0070684_100238068 3300005535 Bacteria 1663
91 Ga0070697_100251571 3300005536 Bacteria 1511
92 Ga0070672_100291698 3300005543 Unclassified 1381
93 Ga0070686_100002328 3300005544 Bacteria 10482
94 Ga0070695_100000347 3300005545 Bacteria 23666
95 Ga0070696_100020791 3300005546 Bacteria 4447
96 Ga0070696_100036441 3300005546 Bacteria 3391
97 Ga0070693_100047655 3300005547 Bacteria 2439
98 Ga0070693_100090653 3300005547 Bacteria 1842
99 Ga0070704_100364394 3300005549 Bacteria 1224
100 Ga0068855_100093932 3300005563 Bacteria 3458
101 Ga0068855_100117959 3300005563 Bacteria 3040
102 Ga0068855_100169479 3300005563 Bacteria 2473
103 Ga0068855_100344850 3300005563 Unclassified 1641
104 Ga0068857_100041764 3300005577 Bacteria 4066
105 Ga0068856_100030033 3300005614 Bacteria 5312
106 Ga0068856_100159533 3300005614 Bacteria 2265
107 Ga0070702_100056474 3300005615 Bacteria 2267
108 Ga0070702_100144576 3300005615 Bacteria 1519
109 Ga0068852_100102291 3300005616 Bacteria 2588
110 Ga0068859_100374277 3300005617 Bacteria 1520
111 Ga0068866_10010110 3300005718 Bacteria 4034
112 Ga0068861_100102678 3300005719 Bacteria 2277
113 Ga0068861_100251037 3300005719 Bacteria 1509
114 Ga0068851_10164319 3300005834 Bacteria 1221
115 Ga0068863_100186800 3300005841 Bacteria 1991
116 Ga0068860_100400960 3300005843 Bacteria 1357
117 Ga0068860_100580168 3300005843 Bacteria 1125
118 Ga0081455_10004967 3300005937 Bacteria 14710
119 Ga0081455_10005435 3300005937 Bacteria 13979
120 Ga0081455_10024080 3300005937 Bacteria 5648
121 Ga0081455_10046662 3300005937 Bacteria 3757
122 Ga0081455_10091958 3300005937 Unclassified 2456
123 Ga0081455_10350926 3300005937 Unclassified 1041
124 Ga0081455_10350927 3300005937 Bacteria 1041
125 Ga0081538_10000155 3300005981 Bacteria 71481
126 Ga0081538_10000375 3300005981 Bacteria 51029
127 Ga0081538_10002367 3300005981 Bacteria 18532
128 Ga0081538_10017416 3300005981 Bacteria 5453
129 Ga0081540_1001919 3300005983 Bacteria 17424
130 Ga0081540_1005495 3300005983 Bacteria 9454
131 Ga0081540_1008818 3300005983 Bacteria 7004
132 Ga0081540_1020377 3300005983 Bacteria 3991
133 Ga0081539_10004025 3300005985 Bacteria 16886
134 Ga0081539_10009548 3300005985 Bacteria 8079
135 Ga0070717_10060068 3300006028 Bacteria 3147
136 Ga0070717_10106269 3300006028 Bacteria 2390
137 Ga0070717_10393313 3300006028 Bacteria 1244
138 Ga0070717_10412020 3300006028 Unclassified 1215
139 Ga0070717_10635349 3300006028 Unclassified 969
140 Ga0075365_10002614 3300006038 Bacteria 8915
141 Ga0075363_100224045 3300006048 Unclassified 1078
142 Ga0075432_10052476 3300006058 Unclassified 1440
143 Ga0070715_10034880 3300006163 Bacteria 2065
144 Ga0070712_100022353 3300006175 Bacteria 4166
145 Ga0070712_100026223 3300006175 Bacteria 3880
146 Ga0070712_100088766 3300006175 Bacteria 2260
147 Ga0070712_100096547 3300006175 Bacteria 2176
148 Ga0070712_100329256 3300006175 Bacteria 1244
149 Ga0075367_10134345 3300006178 Bacteria 1530
150 Ga0097621_100039454 3300006237 Bacteria 3793
151 Ga0068871_100005174 3300006358 Bacteria 9119
152 Ga0075428_100125359 3300006844 Unclassified 2795
153 Ga0075428_100203249 3300006844 Bacteria 2141
154 Ga0075428_100240338 3300006844 Bacteria 1954
155 Ga0075428_100436456 3300006844 Bacteria 1403
156 Ga0075430_100007871 3300006846 Bacteria 9009
157 Ga0075431_100044149 3300006847 Bacteria 4598
158 Ga0075431_100192770 3300006847 Unclassified 2088
159 Ga0075431_100542245 3300006847 Unclassified 1151
160 Ga0075433_10004025 3300006852 Bacteria 11368
161 Ga0075433_10194867 3300006852 Unclassified 1802
162 Ga0075433_10233147 3300006852 Bacteria 1634
163 Ga0075433_10243788 3300006852 Bacteria 1595
164 Ga0075434_100010911 3300006871 Bacteria 8542
165 Ga0075434_100093427 3300006871 Bacteria 3012
166 Ga0075434_100129947 3300006871 Bacteria 2537
167 Ga0075434_100176337 3300006871 Bacteria 2157
168 Ga0075434_100645273 3300006871 Bacteria 1077
169 Ga0075429_100089705 3300006880 Bacteria 2680
170 Ga0075429_100187223 3300006880 Unclassified 1814
171 Ga0068865_100013004 3300006881 Bacteria 5248
172 Ga0075436_100011596 3300006914 Bacteria 6047
173 Ga0075436_100025247 3300006914 Bacteria 4088
174 Ga0075436_100047434 3300006914 Bacteria 2963
175 Ga0075436_100145490 3300006914 Bacteria 1666
176 Ga0075436_100179414 3300006914 Bacteria 1496
177 Ga0097620_100374264 3300006931 Bacteria 1520
178 Ga0075435_100001974 3300007076 Bacteria 13382
179 Ga0075435_100092862 3300007076 Bacteria 2493
180 Ga0105240_10022924 3300009093 Bacteria 8271
181 Ga0105240_10174112 3300009093 Unclassified 2546
182 Ga0105240_10763066 3300009093 Unclassified 1050
183 Ga0111539_10042472 3300009094 Bacteria 5459
184 Ga0111539_10122606 3300009094 Bacteria 3046
185 Ga0111539_10201276 3300009094 Bacteria 2322
186 Ga0111539_10205155 3300009094 Bacteria 2298
187 Ga0111539_10285701 3300009094 Bacteria 1920
188 Ga0105245_10029749 3300009098 Bacteria 4828
189 Ga0105245_10038688 3300009098 Bacteria 4244
190 Ga0105245_10075164 3300009098 Bacteria 3076
191 Ga0105245_10095654 3300009098 Bacteria 2740
192 Ga0105245_10110359 3300009098 Bacteria 2557
193 Ga0105245_10116021 3300009098 Bacteria 2496
194 Ga0105247_10026467 3300009101 Bacteria 3502
195 Ga0114129_10020206 3300009147 Bacteria 9479
196 Ga0114129_10054080 3300009147 Bacteria 5630
197 Ga0114129_10080522 3300009147 Bacteria 4527
198 Ga0114129_10203530 3300009147 Bacteria 2680
199 Ga0114129_10204150 3300009147 Bacteria 2675
200 Ga0105243_10006875 3300009148 Bacteria 8770
201 Ga0105243_10043049 3300009148 Bacteria 3538
202 Ga0105243_10059071 3300009148 Bacteria 3059
203 Ga0105243_10107452 3300009148 Bacteria 2327
204 Ga0105243_10291195 3300009148 Bacteria 1475
205 Ga0105241_10025314 3300009174 Bacteria 4410
206 Ga0105241_10047792 3300009174 Bacteria 3255
207 Ga0105241_10143812 3300009174 Bacteria 1945
208 Ga0105242_10222761 3300009176 Bacteria 1687
209 Ga0105242_10246358 3300009176 Bacteria 1608
210 Ga0105242_10257616 3300009176 Bacteria 1574
211 Ga0105242_10269768 3300009176 Bacteria 1541
212 Ga0105242_10341254 3300009176 Bacteria 1380
213 Ga0105248_10183206 3300009177 Bacteria 2360
214 Ga0105248_10201259 3300009177 Bacteria 2244
215 Ga0105237_10044800 3300009545 Bacteria 4454
216 Ga0105238_10047405 3300009551 Bacteria 4332
217 Ga0105238_10756005 3300009551 Bacteria 986
218 Ga0105249_10021565 3300009553 Bacteria 5768
219 Ga0105249_10234035 3300009553 Unclassified 1813
220 Ga0105249_10375209 3300009553 Unclassified 1447
221 Ga0105239_10009163 3300010375 Bacteria 11195
222 Ga0105239_10111675 3300010375 Bacteria 3030
223 Ga0105239_10201829 3300010375 Bacteria 2228
224 Ga0105239_10254563 3300010375 Unclassified 1972
225 Ga0105239_10526516 3300010375 Bacteria 1345
226 Ga0105239_10677822 3300010375 Unclassified 1178
227 Ga0105246_10058718 3300011119 Bacteria 2666
228 Ga0157369_10070710 3300013105 Unclassified 3748
229 Ga0157374_10005200 3300013296 Bacteria 10912
230 Ga0157374_10054074 3300013296 Bacteria 3744
231 Ga0157378_10010428 3300013297 Bacteria 8115
232 Ga0157378_10083567 3300013297 Bacteria 2890
233 Ga0163162_10059315 3300013306 Bacteria 3858
234 Ga0157372_10037263 3300013307 Bacteria 5362
235 Ga0157372_10094431 3300013307 Bacteria 3406
236 Ga0157372_10291455 3300013307 Bacteria 1898
237 Ga0157375_10032292 3300013308 Bacteria 4964
238 Ga0157375_10036342 3300013308 Bacteria 4712
239 Ga0157375_10293359 3300013308 Bacteria 1789
240 Ga0157375_10379274 3300013308 Bacteria 1581
241 Ga0163163_10201571 3300014325 Bacteria 2038
242 Ga0182008_10111834 3300014497 Bacteria 1353
243 Ga0157377_10023173 3300014745 Bacteria 3288
244 Ga0157376_10232865 3300014969 Bacteria 1712
245 Ga0163161_10057536 3300017792 Bacteria 2825
246 Ga0197907_10120316 3300020069 Unclassified 1985
247 Ga0206356_10056051 3300020070 Unclassified 2787
248 Ga0206356_10307083 3300020070 Bacteria 1888
249 Ga0206356_11421914 3300020070 Unclassified 1771
250 Ga0206354_10292101 3300020081 Bacteria 1533
251 Ga0206354_10996903 3300020081 Bacteria 4204
252 Ga0206353_10161134 3300020082 Unclassified 2706
253 Ga0206353_10208751 3300020082 Bacteria 3051
254 Ga0213876_10100801 3300021384 Bacteria 1531
255 Ga0213876_10149134 3300021384 Unclassified 1244
256 Ga0207653_10022925 3300025885 Bacteria 1986
257 Ga0207692_10012017 3300025898 Bacteria 3708
258 Ga0207692_10042099 3300025898 Bacteria 2265
259 Ga0207692_10086535 3300025898 Unclassified 1689
260 Ga0207642_10019002 3300025899 Bacteria 2651
261 Ga0207688_10007979 3300025901 Bacteria 5759
262 Ga0207688_10178874 3300025901 Bacteria 1264
263 Ga0207680_10082563 3300025903 Bacteria 2023
264 Ga0207699_10020291 3300025906 Bacteria 3559
265 Ga0207699_10033861 3300025906 Bacteria 2892
266 Ga0207699_10107884 3300025906 Bacteria 1780
267 Ga0207699_10315901 3300025906 Unclassified 1094
268 Ga0207684_10031795 3300025910 Bacteria 4490
269 Ga0207684_10039045 3300025910 Bacteria 4028
270 Ga0207654_10015514 3300025911 Bacteria 3955
271 Ga0207654_10270006 3300025911 Bacteria 1147
272 Ga0207707_10102821 3300025912 Bacteria 2498
273 Ga0207707_10133139 3300025912 Bacteria 2174
274 Ga0207707_10467974 3300025912 Unclassified 1077
275 Ga0207695_10077421 3300025913 Bacteria 3378
276 Ga0207693_10002624 3300025915 Bacteria 15613
277 Ga0207693_10016443 3300025915 Bacteria 5911
278 Ga0207693_10039885 3300025915 Bacteria 3698
279 Ga0207693_10048141 3300025915 Bacteria 3348
280 Ga0207663_10022422 3300025916 Bacteria 3609
281 Ga0207663_10070283 3300025916 Unclassified 2255
282 Ga0207663_10109785 3300025916 Bacteria 1870
283 Ga0207660_10043194 3300025917 Bacteria 3167
284 Ga0207657_10001460 3300025919 Bacteria 25308
285 Ga0207657_10028913 3300025919 Bacteria 5050
286 Ga0207652_10055223 3300025921 Bacteria 3415
287 Ga0207652_10237261 3300025921 Bacteria 1644
288 Ga0207652_10363455 3300025921 Bacteria 1306
289 Ga0207646_10005879 3300025922 Bacteria 12814
290 Ga0207646_10028964 3300025922 Bacteria 5037
291 Ga0207646_10268386 3300025922 Bacteria 1542
292 Ga0207646_10300337 3300025922 Bacteria 1451
293 Ga0207687_10044693 3300025927 Bacteria 3058
294 Ga0207687_10082294 3300025927 Archaea 2329
295 Ga0207687_10376583 3300025927 Bacteria 1162
296 Ga0207700_10000004 3300025928 Bacteria 443409
297 Ga0207700_10051994 3300025928 Bacteria 3061
298 Ga0207664_10156855 3300025929 Unclassified 1938
299 Ga0207664_10180346 3300025929 Bacteria 1813
300 Ga0207664_10203451 3300025929 Unclassified 1710
301 Ga0207664_10361373 3300025929 Bacteria 1286
302 Ga0207690_10545843 3300025932 Unclassified 942
303 Ga0207686_10012235 3300025934 Bacteria 4714
304 Ga0207686_10184361 3300025934 Bacteria 1482
305 Ga0207686_10335284 3300025934 Unclassified 1134
306 Ga0207709_10001662 3300025935 Bacteria 14994
307 Ga0207709_10067241 3300025935 Bacteria 2261
308 Ga0207709_10146619 3300025935 Bacteria 1629
309 Ga0207669_10009647 3300025937 Bacteria 4612
310 Ga0207704_10046322 3300025938 Bacteria 2591
311 Ga0207665_10048448 3300025939 Bacteria 2852
312 Ga0207665_10059992 3300025939 Bacteria 2575
313 Ga0207711_10336104 3300025941 Bacteria 1397
314 Ga0207689_10194687 3300025942 Unclassified 1673
315 Ga0207661_10284173 3300025944 Bacteria 1479
316 Ga0207661_10423535 3300025944 Unclassified 1209
317 Ga0207661_10477619 3300025944 Bacteria 1138
318 Ga0207667_10095674 3300025949 Bacteria 3065
319 Ga0207667_10137248 3300025949 Bacteria 2518
320 Ga0207667_10579763 3300025949 Bacteria 1132
321 Ga0207651_10098198 3300025960 Bacteria 2165
322 Ga0207712_10054046 3300025961 Bacteria 2820
323 Ga0207712_10302482 3300025961 Bacteria 1313
324 Ga0207640_10053716 3300025981 Bacteria 2631
325 Ga0207658_10015151 3300025986 Bacteria 5288
326 Ga0207658_10079212 3300025986 Unclassified 2513
327 Ga0207677_10271482 3300026023 Bacteria 1387
328 Ga0207677_10573949 3300026023 Bacteria 986
329 Ga0207639_10110291 3300026041 Bacteria 2241
330 Ga0207678_10778679 3300026067 Bacteria 844
331 Ga0207708_10000305 3300026075 Bacteria 38789
332 Ga0207702_10089526 3300026078 Bacteria 2691
333 Ga0207702_10405066 3300026078 Bacteria 1316
334 Ga0207641_10331007 3300026088 Bacteria 1447
335 Ga0207648_10003702 3300026089 Bacteria 16002
336 Ga0207674_10001754 3300026116 Bacteria 27746
337 Ga0207675_100019798 3300026118 Bacteria 6281
338 Ga0207683_10000572 3300026121 Bacteria 34101
339 Ga0207683_10024773 3300026121 Bacteria 5170
340 Ga0207683_10323238 3300026121 Unclassified 1413
341 Ga0207428_10001268 3300027907 Bacteria 26994
342 Ga0207428_10067270 3300027907 Bacteria 2821
343 Ga0207428_10137373 3300027907 Bacteria 1868
344 Ga0207428_10176873 3300027907 Bacteria 1614
345 Ga0268266_10075262 3300028379 Bacteria 2933
346 Ga0265334_10055783 3300028573 Bacteria 1502
347 Ga0265318_10068485 3300028577 Bacteria 1317
348 Ga0265322_10003946 3300028654 Bacteria 4446
349 Ga0265336_10000676 3300028666 Bacteria 18479
350 Ga0265338_10004508 3300028800 Bacteria 18779
351 Ga0265338_10009753 3300028800 Bacteria 11389
352 Ga0265338_10045158 3300028800 Bacteria 4055
353 Ga0265330_10020776 3300031235 Bacteria 3000
354 Ga0265332_10141848 3300031238 Bacteria 1006
355 Ga0265325_10015319 3300031241 Bacteria 4313
356 Ga0265340_10027909 3300031247 Unclassified 2842
357 Ga0265339_10036804 3300031249 Unclassified 2736
358 Ga0265327_10071856 3300031251 Bacteria 1729
359 Ga0265316_10012382 3300031344 Bacteria 7653
360 Ga0265316_10018129 3300031344 Bacteria 6059
361 Ga0265313_10003489 3300031595 Bacteria 12688
362 Ga0265313_10036243 3300031595 Bacteria 2477
363 Ga0265314_10002807 3300031711 Bacteria 17390
364 Ga0265342_10071609 3300031712 Bacteria 2019
365 Ga0307416_100142097 3300032002 Bacteria 2184
366 Ga0307415_100030294 3300032126 Bacteria 3471
367 Ga0373930_0033559 3300034816 Unclassified 1066
368 Ga0373948_0003027 3300034817 Bacteria 2545
369 Ga0373958_0012654 3300034819 Unclassified 1447
370 Ga0373928_0011690 3300035084 Bacteria 1742
371 Ga0373940_0003415 3300035088 Bacteria 3241
372 Ga0373949_0022523 3300035090 Unclassified 1453
373 Ga0373951_0016401 3300035091 Bacteria 1670
374 Ga0373952_0002424 3300035092 Bacteria 3365
375 Ga0373932_0012778 3300035112 Bacteria 2074
376 Ga0373941_0006284 3300035115 Bacteria 2854
377 Ga0373960_0014767 3300035121 Bacteria 1983
378 Ga0373943_0003088 3300035170 Bacteria 7562
379 Ga0373946_0007250 3300035171 Bacteria 4048
380 Ga0373942_0018766 3300035207 Unclassified 1720
381 Ga0373961_0004581 3300035241 Bacteria 3338
382 Ga0373962_0005720 3300035242 Bacteria 3002
383 Ga0373935_0021095 3300035692 Bacteria 3987
384 Ga0373947_0017682 3300035725 Bacteria 4102
385 Ga0373925_0019349 3300037068 Bacteria 4952
386 Ga0395899_0002364 3300037312 Bacteria 15357
387 Ga0395899_0017563 3300037312 Bacteria 5450
388 Ga0395899_0078307 3300037312 Bacteria 2409
389 Ga0395899_0084304 3300037312 Bacteria 2310
390 Ga0395899_0086019 3300037312 Bacteria 2284
391 Ga0395899_0178878 3300037312 Bacteria 1490
392 Ga0395899_0346694 3300037312 Bacteria 994
393 Ga0395900_0001116 3300037418 Bacteria 34004
394 Ga0395900_0001835 3300037418 Bacteria 24200
395 Ga0395900_0002995 3300037418 Bacteria 18380
396 Ga0395900_0005325 3300037418 Bacteria 13486
397 Ga0395900_0006889 3300037418 Bacteria 11794
398 Ga0395900_0010530 3300037418 Bacteria 9459
399 Ga0395900_0018070 3300037418 Bacteria 7198
400 Ga0395900_0018083 3300037418 Bacteria 7194
401 Ga0395900_0035344 3300037418 Bacteria 5146
402 Ga0395900_0051050 3300037418 Bacteria 4260
403 Ga0395900_0068513 3300037418 Bacteria 3646
404 Ga0395900_0117434 3300037418 Bacteria 2729
405 Ga0395900_0181299 3300037418 Bacteria 2140
406 Ga0395900_0269350 3300037418 Bacteria 1698
407 Ga0395900_0294406 3300037418 Bacteria 1611
408 Ga0395900_0526032 3300037418 Bacteria 1130
409 Ga0395900_0631189 3300037418 Bacteria 1009
410 Ga0395898_0007870 3300037466 Bacteria 11307
411 Ga0395898_0010215 3300037466 Bacteria 9829
412 Ga0395898_0010725 3300037466 Bacteria 9572
413 Ga0395898_0013558 3300037466 Bacteria 8391
414 Ga0395898_0015454 3300037466 Bacteria 7829
415 Ga0395898_0017955 3300037466 Bacteria 7218
416 Ga0395898_0023779 3300037466 Bacteria 6187
417 Ga0395898_0023911 3300037466 Bacteria 6167
418 Ga0395898_0036685 3300037466 Bacteria 4867
419 Ga0395898_0039074 3300037466 Bacteria 4700
420 Ga0395898_0040523 3300037466 Bacteria 4605
421 Ga0395898_0066665 3300037466 Bacteria 3486
422 Ga0395898_0097583 3300037466 Bacteria 2822
423 Ga0395898_0109822 3300037466 Bacteria 2644
424 Ga0395898_0113082 3300037466 Bacteria 2602
425 Ga0395898_0121401 3300037466 Unclassified 2503
426 Ga0395898_0132704 3300037466 Bacteria 2384
427 Ga0395898_0281770 3300037466 Unclassified 1586
428 Ga0395898_0365284 3300037466 Bacteria 1376
429 Ga0395898_0627865 3300037466 Unclassified 1017
430 Ga0395905_0003307 3300037471 Bacteria 17310
431 Ga0395905_0003977 3300037471 Bacteria 15548
432 Ga0395905_0006497 3300037471 Bacteria 11762
433 Ga0395905_0010878 3300037471 Bacteria 8814
434 Ga0395905_0011714 3300037471 Bacteria 8465
435 Ga0395905_0013615 3300037471 Bacteria 7792
436 Ga0395905_0025321 3300037471 Bacteria 5595
437 Ga0395905_0027804 3300037471 Bacteria 5332
438 Ga0395905_0035742 3300037471 Bacteria 4666
439 Ga0395905_0071117 3300037471 Bacteria 3262
440 Ga0395905_0146637 3300037471 Bacteria 2220
441 Ga0395905_0172058 3300037471 Bacteria 2034
442 Ga0395905_0358680 3300037471 Bacteria 1350
443 Ga0395905_0484052 3300037471 Unclassified 1137
444 Ga0395905_0548960 3300037471 Bacteria 1057
445 Ga0395901_0000847 3300038443 Bacteria 33661
446 Ga0395901_0003698 3300038443 Bacteria 15426
447 Ga0395901_0004430 3300038443 Bacteria 14164
448 Ga0395901_0008183 3300038443 Bacteria 10569
449 Ga0395901_0008362 3300038443 Bacteria 10461
450 Ga0395901_0008941 3300038443 Bacteria 10143
451 Ga0395901_0009143 3300038443 Bacteria 10035
452 Ga0395901_0011791 3300038443 Bacteria 8863
453 Ga0395901_0013739 3300038443 Bacteria 8229
454 Ga0395901_0026442 3300038443 Bacteria 5958
455 Ga0395901_0049494 3300038443 Bacteria 4366
456 Ga0395901_0050870 3300038443 Bacteria 4305
457 Ga0395901_0066545 3300038443 Bacteria 3753
458 Ga0395901_0068828 3300038443 Bacteria 3687
459 Ga0395901_0083155 3300038443 Bacteria 3346
460 Ga0395901_0102320 3300038443 Bacteria 3006
461 Ga0395901_0110112 3300038443 Bacteria 2891
462 Ga0395901_0113605 3300038443 Bacteria 2844
463 Ga0395901_0168039 3300038443 Unclassified 2302
464 Ga0395901_0289335 3300038443 Bacteria 1701
465 Ga0395901_0378480 3300038443 Bacteria 1457
466 Ga0395901_0524148 3300038443 Unclassified 1203
467 Ga0395901_0778726 3300038443 Bacteria 947
468 Ga0436365_1366736 3300039437 Bacteria 5865
469 Ga0436363_0352713 3300039450 Bacteria 1108
470 Ga0451789_0817946 3300041443 Unclassified 1101
471 Ga0451853_0214319 3300041512 Bacteria 2020
472 Ga0450915_000372 3300042119 Unclassified 1551
473 Ga0439460_0107586 3300042461 Bacteria 902
474 Ga0466969_0154507 3300044656 Bacteria 1056
475 Ga0466965_0028275 3300044683 Unclassified 2724
476 Ga0466966_0022898 3300044684 Bacteria 4093
477 Ga0466961_0011643 3300044693 Bacteria 5623
478 Ga0466963_0006766 3300044694 Bacteria 6813
479 Ga0466963_0019362 3300044694 Bacteria 4267
480 Ga0466963_0030035 3300044694 Bacteria 3503
481 Ga0466963_0063633 3300044694 Bacteria 2469
482 Ga0466963_0362814 3300044694 Bacteria 1020
483 Ga0466964_0003712 3300044706 Bacteria 5594
484 Ga0466964_0014037 3300044706 Bacteria 3043
485 Ga0466964_0014543 3300044706 Bacteria 2992
486 Ga0466971_0021017 3300044719 Unclassified 2902
487 Ga0466971_0068868 3300044719 Unclassified 1605
488 Ga0466968_0051937 3300044735 Unclassified 1752
489 Ga0466970_0039114 3300044765 Bacteria 2517
490 Ga0466957_0070911 3300044842 Bacteria 2154
491 Ga0466957_0247940 3300044842 Bacteria 1183
492 Ga0466957_0397278 3300044842 Bacteria 942
493 Ga0466960_0011535 3300044901 Bacteria 3701
494 Ga0466960_0315311 3300044901 Unclassified 884
495 Ga0466958_0005848 3300045836 Bacteria 6658
496 Ga0466958_0067010 3300045836 Bacteria 2192
497 Ga0466958_0087697 3300045836 Unclassified 1921
498 Ga0466958_0114103 3300045836 Bacteria 1688
499 Ga0466967_0032470 3300045976 Bacteria 4409
500 Ga0466967_0042357 3300045976 Bacteria 3933
501 Ga0466967_0097424 3300045976 Bacteria 2684
502 Ga0466967_0130759 3300045976 Bacteria 2330
503 Ga0466967_0134323 3300045976 Bacteria 2300
504 Ga0466967_0179777 3300045976 Bacteria 1995
505 Ga0466967_0207925 3300045976 Bacteria 1855
506 Ga0466967_0468241 3300045976 Bacteria 1233
507 Ga0466967_0531487 3300045976 Bacteria 1156
508 Ga0495592_0001615 3300046454 Bacteria 15792
509 Ga0495592_0183000 3300046454 Bacteria 1426
510 Ga0495603_0101652 3300046455 Bacteria 1678
511 Ga0495629_0057817 3300046459 Bacteria 2711
512 Ga0495629_0106578 3300046459 Bacteria 1955
513 Ga0495641_0021226 3300046461 Bacteria 3271
514 Ga0495641_0047995 3300046461 Bacteria 1959
515 Ga0495651_0003563 3300046462 Bacteria 11940
516 Ga0495582_0100282 3300046473 Unclassified 1621
517 Ga0495664_0144231 3300046477 Bacteria 1444
518 Ga0495608_0013925 3300046511 Bacteria 5581
519 Ga0495628_0045963 3300046516 Bacteria 3469
520 Ga0495628_0380375 3300046516 Bacteria 1034
521 Ga0495630_0000446 3300046517 Bacteria 31187
522 Ga0495630_0005371 3300046517 Bacteria 9039
523 Ga0495630_0024825 3300046517 Bacteria 4431
524 Ga0495663_0017870 3300046525 Bacteria 2016
525 Ga0495642_0060880 3300046528 Bacteria 1566
526 Ga0495652_0030665 3300046529 Bacteria 4713
527 Ga0495640_0031403 3300046533 Bacteria 3790
528 Ga0495640_0040923 3300046533 Bacteria 3241
529 Ga0495586_0047458 3300046535 Bacteria 2319
530 Ga0495587_0024922 3300046536 Bacteria 3661
531 Ga0495667_0036684 3300046559 Bacteria 3270
532 Ga0495667_0186105 3300046559 Bacteria 1332
533 Ga0495656_0069184 3300046615 Unclassified 1563
534 Ga0495668_0165107 3300046616 Unclassified 1213
535 Ga0495634_0058069 3300046642 Bacteria 2580
536 Ga0495635_0064846 3300046663 Bacteria 2507
537 Ga0495659_0032977 3300046664 Unclassified 1816
538 Ga0495659_0100233 3300046664 Unclassified 1121
539 Ga0495657_0035356 3300046675 Bacteria 3463
540 Ga0495657_0219841 3300046675 Bacteria 1152
541 Ga0495599_0000409 3300046678 Bacteria 24585
542 Ga0495599_0036310 3300046678 Bacteria 3094
543 Ga0495599_0071284 3300046678 Bacteria 2169
544 Ga0495646_0001458 3300046680 Bacteria 14066
545 Ga0495647_0029920 3300046681 Unclassified 2017
546 Ga0495658_0009957 3300046683 Bacteria 4742
547 Ga0495613_0009537 3300046689 Bacteria 7207
548 Ga0495613_0014770 3300046689 Bacteria 5796
549 Ga0495613_0037654 3300046689 Bacteria 3586
550 Ga0495624_0004755 3300046690 Bacteria 9879
551 Ga0495624_0017487 3300046690 Bacteria 4815
552 Ga0495624_0041244 3300046690 Bacteria 2953
553 Ga0495581_0009890 3300047315 Bacteria 5517
554 Ga0495581_0021889 3300047315 Bacteria 3706
555 Ga0495581_0085210 3300047315 Bacteria 1831
556 Ga0495604_0054484 3300047317 Bacteria 3085
557 Ga0495604_0187802 3300047317 Bacteria 1442
558 Ga0495636_0125470 3300047318 Unclassified 1139
559 Ga0495674_0001283 3300047319 Bacteria 24435
560 Ga0495674_0041788 3300047319 Unclassified 4093
561 Ga0495674_0043792 3300047319 Bacteria 3982
562 Ga0495674_0060796 3300047319 Bacteria 3295
563 Ga0495674_0288208 3300047319 Bacteria 1343
564 Ga0495676_0125044 3300047321 Bacteria 1865
565 Ga0495680_0003455 3300047322 Bacteria 15561
566 Ga0495680_0015166 3300047322 Bacteria 6654
567 Ga0495675_0097688 3300047444 Bacteria 1840
568 Ga0495685_060767 3300047447 Unclassified 1274
569 Ga0495684_0412560 3300047471 Bacteria 946
570 Ga0495602_0071315 3300048088 Bacteria 2967
571 Ga0496100_0004702 3300048903 Bacteria 7277
572 Ga0496100_0007119 3300048903 Bacteria 6143
573 Ga0496100_0104701 3300048903 Bacteria 1955
574 Ga0496101_0004835 3300048904 Bacteria 8544
575 Ga0496101_0026961 3300048904 Bacteria 3996
576 Ga0496101_0028419 3300048904 Bacteria 3903
577 Ga0496101_0039546 3300048904 Bacteria 3355
578 Ga0496101_0066511 3300048904 Bacteria 2629
579 Ga0496101_0083493 3300048904 Bacteria 2365
580 Ga0496101_0104533 3300048904 Bacteria 2124
581 Ga0496101_0144058 3300048904 Bacteria 1818
582 Ga0496101_0194878 3300048904 Bacteria 1565
583 Ga0496101_0258656 3300048904 Bacteria 1357
584 Ga0496102_0008227 3300048905 Bacteria 8928
585 Ga0496102_0012168 3300048905 Bacteria 7439
586 Ga0496102_0030905 3300048905 Bacteria 4797
587 Ga0496102_0099091 3300048905 Bacteria 2705
588 Ga0496102_0239014 3300048905 Bacteria 1713
589 Ga0496102_0274915 3300048905 Bacteria 1588
590 Ga0496102_0540313 3300048905 Bacteria 1088
591 Ga0496103_0014324 3300048906 Bacteria 4709
592 Ga0496103_0197690 3300048906 Bacteria 1293
593 Ga0496103_0234708 3300048906 Bacteria 1180
594 Ga0496104_0021815 3300048907 Bacteria 5882
595 Ga0496104_0029106 3300048907 Bacteria 5122
596 Ga0496104_0068638 3300048907 Bacteria 3368
597 Ga0496104_0093735 3300048907 Bacteria 2872
598 Ga0496104_0103615 3300048907 Bacteria 2726
599 Ga0496105_0002803 3300048908 Bacteria 12747
600 Ga0496105_0004217 3300048908 Bacteria 10801
601 Ga0496105_0008689 3300048908 Bacteria 7903
602 Ga0496105_0035965 3300048908 Bacteria 4078
603 Ga0496105_0161084 3300048908 Unclassified 1842
604 Ga0496105_0254703 3300048908 Unclassified 1421
605 Ga0496106_0032792 3300048909 Bacteria 3873
606 Ga0496106_0051548 3300048909 Bacteria 3103
607 Ga0496106_0151013 3300048909 Bacteria 1832
608 Ga0496106_0157569 3300048909 Bacteria 1794
609 Ga0496106_0227785 3300048909 Unclassified 1487
610 Ga0496107_0005064 3300048910 Bacteria 8981
611 Ga0496107_0471636 3300048910 Unclassified 932
612 Ga0496108_0002409 3300048911 Bacteria 14948
613 Ga0496108_0017127 3300048911 Bacteria 5926
614 Ga0496108_0020827 3300048911 Bacteria 5392
615 Ga0496108_0025220 3300048911 Bacteria 4899
616 Ga0496108_0043664 3300048911 Bacteria 3744
617 Ga0496108_0065303 3300048911 Bacteria 3068
618 Ga0496108_0160260 3300048911 Bacteria 1944
619 Ga0496108_0178251 3300048911 Bacteria 1840
620 Ga0496108_0204911 3300048911 Bacteria 1712
621 Ga0496108_0273963 3300048911 Unclassified 1469
622 Ga0496109_0001756 3300048912 Bacteria 18034
623 Ga0496109_0002119 3300048912 Bacteria 16507
624 Ga0496109_0035497 3300048912 Bacteria 4498
625 Ga0496109_0039105 3300048912 Bacteria 4292
626 Ga0496109_0090589 3300048912 Bacteria 2828
627 Ga0496109_0102986 3300048912 Bacteria 2649
628 Ga0496109_0293660 3300048912 Unclassified 1532
629 Ga0496109_0374481 3300048912 Bacteria 1345
630 Ga0496109_0627206 3300048912 Bacteria 1011
631 Ga0496110_0007078 3300048913 Bacteria 8927
632 Ga0496110_0024522 3300048913 Bacteria 5141
633 Ga0496110_0041055 3300048913 Bacteria 4035
634 Ga0496110_0054112 3300048913 Bacteria 3530
635 Ga0496110_0087750 3300048913 Bacteria 2778
636 Ga0496110_0142117 3300048913 Bacteria 2170
637 Ga0496110_0154303 3300048913 Bacteria 2080
638 Ga0496110_0306752 3300048913 Bacteria 1446
639 Ga0496110_0482851 3300048913 Bacteria 1129
640 Ga0496111_0001490 3300048914 Bacteria 13408
641 Ga0496111_0040335 3300048914 Bacteria 3349
642 Ga0496111_0076256 3300048914 Bacteria 2444
643 Ga0496111_0475786 3300048914 Bacteria 921
644 Ga0496112_0002873 3300048915 Bacteria 14004
645 Ga0496112_0006445 3300048915 Bacteria 10304
646 Ga0496112_0028533 3300048915 Bacteria 5387
647 Ga0496112_0135458 3300048915 Bacteria 2433
648 Ga0496112_0161234 3300048915 Bacteria 2209
649 Ga0496112_0224473 3300048915 Bacteria 1834
650 Ga0496113_0001615 3300048916 Bacteria 12684
651 Ga0496113_0098806 3300048916 Bacteria 2260
652 Ga0496113_0154413 3300048916 Bacteria 1812
653 Ga0496113_0361241 3300048916 Bacteria 1165
654 Ga0496114_0013374 3300048917 Bacteria 6579
655 Ga0496114_0078330 3300048917 Bacteria 2788
656 Ga0496114_0080289 3300048917 Bacteria 2754
657 Ga0496114_0147324 3300048917 Bacteria 2041
658 Ga0496115_0001171 3300048918 Bacteria 18799
659 Ga0496115_0002222 3300048918 Bacteria 13918
660 Ga0496115_0006963 3300048918 Bacteria 8304
661 Ga0501031_0006921 3300049568 Bacteria 7401
662 Ga0501031_0034473 3300049568 Bacteria 3303
663 Ga0501032_0020649 3300049569 Bacteria 4585
664 Ga0501033_0002985 3300049570 Bacteria 14121
665 Ga0501033_0109482 3300049570 Bacteria 2011
666 Ga0501034_0056302 3300049571 Bacteria 3957
667 Ga0501036_0003723 3300049572 Bacteria 12224
668 Ga0501036_0494361 3300049572 Bacteria 1018
669 Ga0501037_0031661 3300049573 Bacteria 3905
670 Ga0501037_0201926 3300049573 Bacteria 1404
671 Ga0501038_0004950 3300049574 Bacteria 12372
672 Ga0501038_0013862 3300049574 Bacteria 7345
673 Ga0501039_0001400 3300049575 Bacteria 17721
674 Ga0501039_0358867 3300049575 Unclassified 1145
675 Ga0501040_0002464 3300049576 Bacteria 11922
676 Ga0501041_0001460 3300049577 Bacteria 13063
677 Ga0501042_0001860 3300049578 Bacteria 12657
678 Ga0501042_0002873 3300049578 Bacteria 10682
679 Ga0501043_0012993 3300049579 Bacteria 6508
680 Ga0501043_0166787 3300049579 Bacteria 1719
681 Ga0501046_0002389 3300049580 Bacteria 17641
682 Ga0501046_0142414 3300049580 Bacteria 1813
683 Ga0501047_0035487 3300049581 Bacteria 4818
684 Ga0501048_0001476 3300049582 Bacteria 17837
685 Ga0501068_0001204 3300049584 Bacteria 13757
686 Ga0501068_0053917 3300049584 Bacteria 2435
687 Ga0501069_0000931 3300049585 Bacteria 13956
688 Ga0501069_0005028 3300049585 Bacteria 6856
689 Ga0501069_0028725 3300049585 Bacteria 3050
690 Ga0501069_0122331 3300049585 Bacteria 1487
691 Ga0501070_0011167 3300049586 Bacteria 7581
692 Ga0501070_0080909 3300049586 Bacteria 2687
693 Ga0501070_0334819 3300049586 Unclassified 1230
694 Ga0501071_0018076 3300049587 Bacteria 4874
695 Ga0501071_0126143 3300049587 Unclassified 1900
696 Ga0501072_0005921 3300049588 Bacteria 9314
697 Ga0501073_0001168 3300049589 Bacteria 19173
698 Ga0501073_0010357 3300049589 Bacteria 6840
699 Ga0501074_0000243 3300049590 Bacteria 30620
700 Ga0501074_0056580 3300049590 Bacteria 2827
701 Ga0501075_0008137 3300049591 Bacteria 7296
702 Ga0501075_0247814 3300049591 Unclassified 1358
703 Ga0501076_0015079 3300049592 Bacteria 5835
704 Ga0501077_0002697 3300049593 Bacteria 10643
705 Ga0501079_0025524 3300049741 Bacteria 4530
706 Ga0501079_0097462 3300049741 Bacteria 2280
707 Ga0501079_0138226 3300049741 Unclassified 1897
708 Ga0501080_0007270 3300049742 Bacteria 9991
709 Ga0501081_0002699 3300049743 Bacteria 11222
710 Ga0501081_0067737 3300049743 Bacteria 2484
711 Ga0501081_0147247 3300049743 Bacteria 1690
712 Ga0501083_0001567 3300049744 Bacteria 15623
713 Ga0501083_0121786 3300049744 Bacteria 1711
714 Ga0501035_0008585 3300049822 Bacteria 9510
715 Ga0501035_0092779 3300049822 Bacteria 2656
716 Ga0501044_0021154 3300049823 Bacteria 6946
717 Ga0501044_0143645 3300049823 Bacteria 2374
718 Ga0501044_0418201 3300049823 Bacteria 1251
719 Ga0501045_0012174 3300049824 Bacteria 6056
720 nmdc:mga06z11_159267_c1 3300050494 Unclassified 1289
721 nmdc:mga05p37_305275_c1 3300050507 Bacteria 1889
722 nmdc:mga05p37_54375_c1 3300050507 Bacteria 4925
723 nmdc:mga05p37_6829_c1 3300050507 Bacteria 13450
724 nmdc:mga05p37_74224_c1 3300050507 Bacteria 4186
725 nmdc:mga05p37_80015_c1 3300050507 Bacteria 4024
726 nmdc:mga09592_139485_c1 3300050508 Unclassified 2089
727 nmdc:mga09592_163952_c1 3300050508 Bacteria 1920
728 nmdc:mga09592_353985_c1 3300050508 Bacteria 1271
729 nmdc:mga0qj67_176052_c1 3300050509 Bacteria 1737
730 nmdc:mga06r32_27619_c1 3300050510 Bacteria 5304
731 nmdc:mga06r32_314917_c1 3300050510 Bacteria 1550
732 nmdc:mga06r32_660536_c1 3300050510 Unclassified 1013
733 nmdc:mga08y16_191791_c1 3300050511 Bacteria 2119
734 nmdc:mga08y16_194289_c1 3300050511 Bacteria 2104
735 nmdc:mga08y16_248527_c1 3300050511 Bacteria 1838
736 nmdc:mga08y16_90961_c1 3300050511 Bacteria 3181
737 nmdc:mga0n895_220536_c1 3300050512 Bacteria 1925
738 nmdc:mga0n895_222159_c1 3300050512 Bacteria 1918
739 nmdc:mga0n895_278983_c1 3300050512 Bacteria 1695
740 nmdc:mga0n895_29757_c1 3300050512 Bacteria 5212
741 nmdc:mga0n895_318787_c1 3300050512 Unclassified 1575
742 nmdc:mga0n895_82303_c1 3300050512 Bacteria 3209
743 nmdc:mga0rr50_612_c1 3300050513 Bacteria 19119
744 nmdc:mga0rr50_84726_c1 3300050513 Bacteria 2455
745 nmdc:mga08x19_193068_c1 3300050514 Bacteria 1394
746 nmdc:mga08x19_27107_c1 3300050514 Bacteria 3582
747 nmdc:mga08x19_7970_c1 3300050514 Bacteria 6294
748 nmdc:mga0a205_204950_c1 3300050515 Unclassified 1862
749 nmdc:mga0a205_412408_c1 3300050515 Bacteria 1214
750 nmdc:mga0a205_93361_c1 3300050515 Bacteria 2908
751 Ga0495612_0026820 3300053078 Bacteria 2315
752 Ga0495595_0012219 3300053084 Bacteria 3604
753 Ga0495619_0075360 3300053085 Bacteria 2264
754 Ga0501084_0003039 3300054114 Bacteria 13595
755 Ga0501084_0163054 3300054114 Bacteria 1880
756 Ga0501082_0004555 3300060353 Bacteria 12098
757 Ga0501082_0049202 3300060353 Bacteria 3635
758 Ga0466962_0004003 3300061719 Bacteria 7055
759 Ga0530510_0002862 3300061734 Bacteria 11865
760 Ga0530510_0015456 3300061734 Bacteria 5394
761 Ga0075435_100087444
762 rootL2_10214072
763 JGI25407J50210_10000387
764 JGI25407J50210_10000559
765 Ga0070658_10015301
766 Ga0070658_10254856
767 Ga0070658_10566055
768 Ga0070683_100024600
769 Ga0070683_100024806
770 Ga0070683_100058978
771 Ga0070683_100080978
772 Ga0070683_100418375
773 Ga0070690_100042636
774 Ga0068869_100160808
775 Ga0070666_10088923
776 Ga0070680_100042145
777 Ga0070680_100058634
778 Ga0070680_100274218
779 Ga0070680_100309927
780 Ga0070682_100051240
781 Ga0070682_100105346
782 Ga0070682_100448759
783 Ga0068868_100110722
784 Ga0068868_100184411
785 Ga0070660_100088255
786 Ga0070660_100248705
787 Ga0070661_100034256
788 Ga0070692_10065398
789 Ga0070675_100437205
790 Ga0070671_100091848
791 Ga0070674_100006239
792 Ga0070673_100133190
793 Ga0070688_100010593
794 Ga0070659_100308028
795 Ga0070659_100670613
796 Ga0070667_100050683
797 Ga0070714_100058042
798 Ga0070714_100194932
799 Ga0070714_100249266
800 Ga0070713_100030294
801 Ga0070713_100156752
802 Ga0070713_100254796
803 Ga0070710_10033964
804 Ga0070710_10073048
805 Ga0070701_10003855
806 Ga0070711_100127111
807 Ga0070700_100001090
808 Ga0070700_100139876
809 Ga0070700_100338124
810 Ga0070694_100014123
811 Ga0070694_100100084
812 Ga0070708_100021491
813 Ga0070708_100043894
814 Ga0070708_100162508
815 Ga0070708_100184740
816 Ga0070708_100769054
817 Ga0070663_100052734
818 Ga0070678_100007139
819 Ga0070678_100263772
820 Ga0070678_100369051
821 Ga0070662_100189128
822 Ga0070662_100411664
823 Ga0070681_10033589
824 Ga0068867_100021482
825 Ga0070685_10143880
826 Ga0070706_100030939
827 Ga0070706_100090103
828 Ga0070706_100099260
829 Ga0070706_100122819
830 Ga0070706_100317892
831 Ga0070707_100019302
832 Ga0070707_100135613
833 Ga0070707_100228111
834 Ga0070707_100293405
835 Ga0070698_100017072
836 Ga0070698_100021815
837 Ga0070698_100295974
838 Ga0070699_100002193
839 Ga0070699_100016866
840 Ga0070699_100452852
841 Ga0070679_100040701
842 Ga0070679_100139081
843 Ga0070679_100139427
844 Ga0070679_100177203
845 Ga0070679_100194682
846 Ga0070684_100029344
847 Ga0070684_100085362
848 Ga0070684_100131758
849 Ga0070684_100159227
850 Ga0070684_100238068
851 Ga0070697_100251571
852 Ga0070672_100291698
853 Ga0070686_100002328
854 Ga0070695_100000347
855 Ga0070696_100020791
856 Ga0070696_100036441
857 Ga0070693_100047655
858 Ga0070693_100090653
859 Ga0070704_100364394
860 Ga0068855_100093932
861 Ga0068855_100117959
862 Ga0068855_100169479
863 Ga0068855_100344850
864 Ga0068857_100041764
865 Ga0068856_100030033
866 Ga0068856_100159533
867 Ga0070702_100056474
868 Ga0070702_100144576
869 Ga0068852_100102291
870 Ga0068859_100374277
871 Ga0068866_10010110
872 Ga0068861_100102678
873 Ga0068861_100251037
874 Ga0068851_10164319
875 Ga0068863_100186800
876 Ga0068860_100400960
877 Ga0068860_100580168
878 Ga0081455_10004967
879 Ga0081455_10005435
880 Ga0081455_10024080
881 Ga0081455_10046662
882 Ga0081455_10091958
883 Ga0081455_10350926
884 Ga0081455_10350927
885 Ga0081538_10000155
886 Ga0081538_10000375
887 Ga0081538_10002367
888 Ga0081538_10017416
889 Ga0081540_1001919
890 Ga0081540_1005495
891 Ga0081540_1008818
892 Ga0081540_1020377
893 Ga0081539_10004025
894 Ga0081539_10009548
895 Ga0070717_10060068
896 Ga0070717_10106269
897 Ga0070717_10393313
898 Ga0070717_10412020
899 Ga0070717_10635349
900 Ga0075365_10002614
901 Ga0075363_100224045
902 Ga0075432_10052476
903 Ga0070715_10034880
904 Ga0070712_100022353
905 Ga0070712_100026223
906 Ga0070712_100088766
907 Ga0070712_100096547
908 Ga0070712_100329256
909 Ga0075367_10134345
910 Ga0097621_100039454
911 Ga0068871_100005174
912 Ga0075428_100125359
913 Ga0075428_100203249
914 Ga0075428_100240338
915 Ga0075428_100436456
916 Ga0075430_100007871
917 Ga0075431_100044149
918 Ga0075431_100192770
919 Ga0075431_100542245
920 Ga0075433_10004025
921 Ga0075433_10194867
922 Ga0075433_10233147
923 Ga0075433_10243788
924 Ga0075434_100010911
925 Ga0075434_100093427
926 Ga0075434_100129947
927 Ga0075434_100176337
928 Ga0075434_100645273
929 Ga0075429_100089705
930 Ga0075429_100187223
931 Ga0068865_100013004
932 Ga0075436_100011596
933 Ga0075436_100025247
934 Ga0075436_100047434
935 Ga0075436_100145490
936 Ga0075436_100179414
937 Ga0097620_100374264
938 Ga0075435_100001974
939 Ga0075435_100092862
940 Ga0105240_10022924
941 Ga0105240_10174112
942 Ga0105240_10763066
943 Ga0111539_10042472
944 Ga0111539_10122606
945 Ga0111539_10201276
946 Ga0111539_10205155
947 Ga0111539_10285701
948 Ga0105245_10029749
949 Ga0105245_10038688
950 Ga0105245_10075164
951 Ga0105245_10095654
952 Ga0105245_10110359
953 Ga0105245_10116021
954 Ga0105247_10026467
955 Ga0114129_10020206
956 Ga0114129_10054080
957 Ga0114129_10080522
958 Ga0114129_10203530
959 Ga0114129_10204150
960 Ga0105243_10006875
961 Ga0105243_10043049
962 Ga0105243_10059071
963 Ga0105243_10107452
964 Ga0105243_10291195
965 Ga0105241_10025314
966 Ga0105241_10047792
967 Ga0105241_10143812
968 Ga0105242_10222761
969 Ga0105242_10246358
970 Ga0105242_10257616
971 Ga0105242_10269768
972 Ga0105242_10341254
973 Ga0105248_10183206
974 Ga0105248_10201259
975 Ga0105237_10044800
976 Ga0105238_10047405
977 Ga0105238_10756005
978 Ga0105249_10021565
979 Ga0105249_10234035
980 Ga0105249_10375209
981 Ga0105239_10009163
982 Ga0105239_10111675
983 Ga0105239_10201829
984 Ga0105239_10254563
985 Ga0105239_10526516
986 Ga0105239_10677822
987 Ga0105246_10058718
988 Ga0157369_10070710
989 Ga0157374_10005200
990 Ga0157374_10054074
991 Ga0157378_10010428
992 Ga0157378_10083567
993 Ga0163162_10059315
994 Ga0157372_10037263
995 Ga0157372_10094431
996 Ga0157372_10291455
997 Ga0157375_10032292
998 Ga0157375_10036342
999 Ga0157375_10293359
1000 Ga0157375_10379274
1001 Ga0163163_10201571
1002 Ga0182008_10111834
1003 Ga0157377_10023173
1004 Ga0157376_10232865
1005 Ga0163161_10057536
1006 Ga0197907_10120316
1007 Ga0206356_10056051
1008 Ga0206356_10307083
1009 Ga0206356_11421914
1010 Ga0206354_10292101
1011 Ga0206354_10996903
1012 Ga0206353_10161134
1013 Ga0206353_10208751
1014 Ga0213876_10100801
1015 Ga0213876_10149134
1016 Ga0207653_10022925
1017 Ga0207692_10012017
1018 Ga0207692_10042099
1019 Ga0207692_10086535
1020 Ga0207642_10019002
1021 Ga0207688_10007979
1022 Ga0207688_10178874
1023 Ga0207680_10082563
1024 Ga0207699_10020291
1025 Ga0207699_10033861
1026 Ga0207699_10107884
1027 Ga0207699_10315901
1028 Ga0207684_10031795
1029 Ga0207684_10039045
1030 Ga0207654_10015514
1031 Ga0207654_10270006
1032 Ga0207707_10102821
1033 Ga0207707_10133139
1034 Ga0207707_10467974
1035 Ga0207695_10077421
1036 Ga0207693_10002624
1037 Ga0207693_10016443
1038 Ga0207693_10039885
1039 Ga0207693_10048141
1040 Ga0207663_10022422
1041 Ga0207663_10070283
1042 Ga0207663_10109785
1043 Ga0207660_10043194
1044 Ga0207657_10001460
1045 Ga0207657_10028913
1046 Ga0207652_10055223
1047 Ga0207652_10237261
1048 Ga0207652_10363455
1049 Ga0207646_10005879
1050 Ga0207646_10028964
1051 Ga0207646_10268386
1052 Ga0207646_10300337
1053 Ga0207687_10044693
1054 Ga0207687_10082294
1055 Ga0207687_10376583
1056 Ga0207700_10000004
1057 Ga0207700_10051994
1058 Ga0207664_10156855
1059 Ga0207664_10180346
1060 Ga0207664_10203451
1061 Ga0207664_10361373
1062 Ga0207690_10545843
1063 Ga0207686_10012235
1064 Ga0207686_10184361
1065 Ga0207686_10335284
1066 Ga0207709_10001662
1067 Ga0207709_10067241
1068 Ga0207709_10146619
1069 Ga0207669_10009647
1070 Ga0207704_10046322
1071 Ga0207665_10048448
1072 Ga0207665_10059992
1073 Ga0207711_10336104
1074 Ga0207689_10194687
1075 Ga0207661_10284173
1076 Ga0207661_10423535
1077 Ga0207661_10477619
1078 Ga0207667_10095674
1079 Ga0207667_10137248
1080 Ga0207667_10579763
1081 Ga0207651_10098198
1082 Ga0207712_10054046
1083 Ga0207712_10302482
1084 Ga0207640_10053716
1085 Ga0207658_10015151
1086 Ga0207658_10079212
1087 Ga0207677_10271482
1088 Ga0207677_10573949
1089 Ga0207639_10110291
1090 Ga0207678_10778679
1091 Ga0207708_10000305
1092 Ga0207702_10089526
1093 Ga0207702_10405066
1094 Ga0207641_10331007
1095 Ga0207648_10003702
1096 Ga0207674_10001754
1097 Ga0207675_100019798
1098 Ga0207683_10000572
1099 Ga0207683_10024773
1100 Ga0207683_10323238
1101 Ga0207428_10001268
1102 Ga0207428_10067270
1103 Ga0207428_10137373
1104 Ga0207428_10176873
1105 Ga0268266_10075262
1106 Ga0265334_10055783
1107 Ga0265318_10068485
1108 Ga0265322_10003946
1109 Ga0265336_10000676
1110 Ga0265338_10004508
1111 Ga0265338_10009753
1112 Ga0265338_10045158
1113 Ga0265330_10020776
1114 Ga0265332_10141848
1115 Ga0265325_10015319
1116 Ga0265340_10027909
1117 Ga0265339_10036804
1118 Ga0265327_10071856
1119 Ga0265316_10012382
1120 Ga0265316_10018129
1121 Ga0265313_10003489
1122 Ga0265313_10036243
1123 Ga0265314_10002807
1124 Ga0265342_10071609
1125 Ga0307416_100142097
1126 Ga0307415_100030294
1127 Ga0373930_0033559
1128 Ga0373948_0003027
1129 Ga0373958_0012654
1130 Ga0373928_0011690
1131 Ga0373940_0003415
1132 Ga0373949_0022523
1133 Ga0373951_0016401
1134 Ga0373952_0002424
1135 Ga0373932_0012778
1136 Ga0373941_0006284
1137 Ga0373960_0014767
1138 Ga0373943_0003088
1139 Ga0373946_0007250
1140 Ga0373942_0018766
1141 Ga0373961_0004581
1142 Ga0373962_0005720
1143 Ga0373935_0021095
1144 Ga0373947_0017682
1145 Ga0373925_0019349
1146 Ga0395899_0002364
1147 Ga0395899_0017563
1148 Ga0395899_0078307
1149 Ga0395899_0084304
1150 Ga0395899_0086019
1151 Ga0395899_0178878
1152 Ga0395899_0346694
1153 Ga0395900_0001116
1154 Ga0395900_0001835
1155 Ga0395900_0002995
1156 Ga0395900_0005325
1157 Ga0395900_0006889
1158 Ga0395900_0010530
1159 Ga0395900_0018070
1160 Ga0395900_0018083
1161 Ga0395900_0035344
1162 Ga0395900_0051050
1163 Ga0395900_0068513
1164 Ga0395900_0117434
1165 Ga0395900_0181299
1166 Ga0395900_0269350
1167 Ga0395900_0294406
1168 Ga0395900_0526032
1169 Ga0395900_0631189
1170 Ga0395898_0007870
1171 Ga0395898_0010215
1172 Ga0395898_0010725
1173 Ga0395898_0013558
1174 Ga0395898_0015454
1175 Ga0395898_0017955
1176 Ga0395898_0023779
1177 Ga0395898_0023911
1178 Ga0395898_0036685
1179 Ga0395898_0039074
1180 Ga0395898_0040523
1181 Ga0395898_0066665
1182 Ga0395898_0097583
1183 Ga0395898_0109822
1184 Ga0395898_0113082
1185 Ga0395898_0121401
1186 Ga0395898_0132704
1187 Ga0395898_0281770
1188 Ga0395898_0365284
1189 Ga0395898_0627865
1190 Ga0395905_0003307
1191 Ga0395905_0003977
1192 Ga0395905_0006497
1193 Ga0395905_0010878
1194 Ga0395905_0011714
1195 Ga0395905_0013615
1196 Ga0395905_0025321
1197 Ga0395905_0027804
1198 Ga0395905_0035742
1199 Ga0395905_0071117
1200 Ga0395905_0146637
1201 Ga0395905_0172058
1202 Ga0395905_0358680
1203 Ga0395905_0484052
1204 Ga0395905_0548960
1205 Ga0395901_0000847
1206 Ga0395901_0003698
1207 Ga0395901_0004430
1208 Ga0395901_0008183
1209 Ga0395901_0008362
1210 Ga0395901_0008941
1211 Ga0395901_0009143
1212 Ga0395901_0011791
1213 Ga0395901_0013739
1214 Ga0395901_0026442
1215 Ga0395901_0049494
1216 Ga0395901_0050870
1217 Ga0395901_0066545
1218 Ga0395901_0068828
1219 Ga0395901_0083155
1220 Ga0395901_0102320
1221 Ga0395901_0110112
1222 Ga0395901_0113605
1223 Ga0395901_0168039
1224 Ga0395901_0289335
1225 Ga0395901_0378480
1226 Ga0395901_0524148
1227 Ga0395901_0778726
1228 Ga0436365_1366736
1229 Ga0436363_0352713
1230 Ga0451789_0817946
1231 Ga0451853_0214319
1232 Ga0450915_000372
1233 Ga0439460_0107586
1234 Ga0466969_0154507
1235 Ga0466965_0028275
1236 Ga0466966_0022898
1237 Ga0466961_0011643
1238 Ga0466963_0006766
1239 Ga0466963_0019362
1240 Ga0466963_0030035
1241 Ga0466963_0063633
1242 Ga0466963_0362814
1243 Ga0466964_0003712
1244 Ga0466964_0014037
1245 Ga0466964_0014543
1246 Ga0466971_0021017
1247 Ga0466971_0068868
1248 Ga0466968_0051937
1249 Ga0466970_0039114
1250 Ga0466957_0070911
1251 Ga0466957_0247940
1252 Ga0466957_0397278
1253 Ga0466960_0011535
1254 Ga0466960_0315311
1255 Ga0466958_0005848
1256 Ga0466958_0067010
1257 Ga0466958_0087697
1258 Ga0466958_0114103
1259 Ga0466967_0032470
1260 Ga0466967_0042357
1261 Ga0466967_0097424
1262 Ga0466967_0130759
1263 Ga0466967_0134323
1264 Ga0466967_0179777
1265 Ga0466967_0207925
1266 Ga0466967_0468241
1267 Ga0466967_0531487
1268 Ga0495592_0001615
1269 Ga0495592_0183000
1270 Ga0495603_0101652
1271 Ga0495629_0057817
1272 Ga0495629_0106578
1273 Ga0495641_0021226
1274 Ga0495641_0047995
1275 Ga0495651_0003563
1276 Ga0495582_0100282
1277 Ga0495664_0144231
1278 Ga0495608_0013925
1279 Ga0495628_0045963
1280 Ga0495628_0380375
1281 Ga0495630_0000446
1282 Ga0495630_0005371
1283 Ga0495630_0024825
1284 Ga0495663_0017870
1285 Ga0495642_0060880
1286 Ga0495652_0030665
1287 Ga0495640_0031403
1288 Ga0495640_0040923
1289 Ga0495586_0047458
1290 Ga0495587_0024922
1291 Ga0495667_0036684
1292 Ga0495667_0186105
1293 Ga0495656_0069184
1294 Ga0495668_0165107
1295 Ga0495634_0058069
1296 Ga0495635_0064846
1297 Ga0495659_0032977
1298 Ga0495659_0100233
1299 Ga0495657_0035356
1300 Ga0495657_0219841
1301 Ga0495599_0000409
1302 Ga0495599_0036310
1303 Ga0495599_0071284
1304 Ga0495646_0001458
1305 Ga0495647_0029920
1306 Ga0495658_0009957
1307 Ga0495613_0009537
1308 Ga0495613_0014770
1309 Ga0495613_0037654
1310 Ga0495624_0004755
1311 Ga0495624_0017487
1312 Ga0495624_0041244
1313 Ga0495581_0009890
1314 Ga0495581_0021889
1315 Ga0495581_0085210
1316 Ga0495604_0054484
1317 Ga0495604_0187802
1318 Ga0495636_0125470
1319 Ga0495674_0001283
1320 Ga0495674_0041788
1321 Ga0495674_0043792
1322 Ga0495674_0060796
1323 Ga0495674_0288208
1324 Ga0495676_0125044
1325 Ga0495680_0003455
1326 Ga0495680_0015166
1327 Ga0495675_0097688
1328 Ga0495685_060767
1329 Ga0495684_0412560
1330 Ga0495602_0071315
1331 Ga0496100_0004702
1332 Ga0496100_0007119
1333 Ga0496100_0104701
1334 Ga0496101_0004835
1335 Ga0496101_0026961
1336 Ga0496101_0028419
1337 Ga0496101_0039546
1338 Ga0496101_0066511
1339 Ga0496101_0083493
1340 Ga0496101_0104533
1341 Ga0496101_0144058
1342 Ga0496101_0194878
1343 Ga0496101_0258656
1344 Ga0496102_0008227
1345 Ga0496102_0012168
1346 Ga0496102_0030905
1347 Ga0496102_0099091
1348 Ga0496102_0239014
1349 Ga0496102_0274915
1350 Ga0496102_0540313
1351 Ga0496103_0014324
1352 Ga0496103_0197690
1353 Ga0496103_0234708
1354 Ga0496104_0021815
1355 Ga0496104_0029106
1356 Ga0496104_0068638
1357 Ga0496104_0093735
1358 Ga0496104_0103615
1359 Ga0496105_0002803
1360 Ga0496105_0004217
1361 Ga0496105_0008689
1362 Ga0496105_0035965
1363 Ga0496105_0161084
1364 Ga0496105_0254703
1365 Ga0496106_0032792
1366 Ga0496106_0051548
1367 Ga0496106_0151013
1368 Ga0496106_0157569
1369 Ga0496106_0227785
1370 Ga0496107_0005064
1371 Ga0496107_0471636
1372 Ga0496108_0002409
1373 Ga0496108_0017127
1374 Ga0496108_0020827
1375 Ga0496108_0025220
1376 Ga0496108_0043664
1377 Ga0496108_0065303
1378 Ga0496108_0160260
1379 Ga0496108_0178251
1380 Ga0496108_0204911
1381 Ga0496108_0273963
1382 Ga0496109_0001756
1383 Ga0496109_0002119
1384 Ga0496109_0035497
1385 Ga0496109_0039105
1386 Ga0496109_0090589
1387 Ga0496109_0102986
1388 Ga0496109_0293660
1389 Ga0496109_0374481
1390 Ga0496109_0627206
1391 Ga0496110_0007078
1392 Ga0496110_0024522
1393 Ga0496110_0041055
1394 Ga0496110_0054112
1395 Ga0496110_0087750
1396 Ga0496110_0142117
1397 Ga0496110_0154303
1398 Ga0496110_0306752
1399 Ga0496110_0482851
1400 Ga0496111_0001490
1401 Ga0496111_0040335
1402 Ga0496111_0076256
1403 Ga0496111_0475786
1404 Ga0496112_0002873
1405 Ga0496112_0006445
1406 Ga0496112_0028533
1407 Ga0496112_0135458
1408 Ga0496112_0161234
1409 Ga0496112_0224473
1410 Ga0496113_0001615
1411 Ga0496113_0098806
1412 Ga0496113_0154413
1413 Ga0496113_0361241
1414 Ga0496114_0013374
1415 Ga0496114_0078330
1416 Ga0496114_0080289
1417 Ga0496114_0147324
1418 Ga0496115_0001171
1419 Ga0496115_0002222
1420 Ga0496115_0006963
1421 Ga0501031_0006921
1422 Ga0501031_0034473
1423 Ga0501032_0020649
1424 Ga0501033_0002985
1425 Ga0501033_0109482
1426 Ga0501034_0056302
1427 Ga0501036_0003723
1428 Ga0501036_0494361
1429 Ga0501037_0031661
1430 Ga0501037_0201926
1431 Ga0501038_0004950
1432 Ga0501038_0013862
1433 Ga0501039_0001400
1434 Ga0501039_0358867
1435 Ga0501040_0002464
1436 Ga0501041_0001460
1437 Ga0501042_0001860
1438 Ga0501042_0002873
1439 Ga0501043_0012993
1440 Ga0501043_0166787
1441 Ga0501046_0002389
1442 Ga0501046_0142414
1443 Ga0501047_0035487
1444 Ga0501048_0001476
1445 Ga0501068_0001204
1446 Ga0501068_0053917
1447 Ga0501069_0000931
1448 Ga0501069_0005028
1449 Ga0501069_0028725
1450 Ga0501069_0122331
1451 Ga0501070_0011167
1452 Ga0501070_0080909
1453 Ga0501070_0334819
1454 Ga0501071_0018076
1455 Ga0501071_0126143
1456 Ga0501072_0005921
1457 Ga0501073_0001168
1458 Ga0501073_0010357
1459 Ga0501074_0000243
1460 Ga0501074_0056580
1461 Ga0501075_0008137
1462 Ga0501075_0247814
1463 Ga0501076_0015079
1464 Ga0501077_0002697
1465 Ga0501079_0025524
1466 Ga0501079_0097462
1467 Ga0501079_0138226
1468 Ga0501080_0007270
1469 Ga0501081_0002699
1470 Ga0501081_0067737
1471 Ga0501081_0147247
1472 Ga0501083_0001567
1473 Ga0501083_0121786
1474 Ga0501035_0008585
1475 Ga0501035_0092779
1476 Ga0501044_0021154
1477 Ga0501044_0143645
1478 Ga0501044_0418201
1479 Ga0501045_0012174
1480 nmdc:mga06z11_159267_c1
1481 nmdc:mga05p37_305275_c1
1482 nmdc:mga05p37_54375_c1
1483 nmdc:mga05p37_6829_c1
1484 nmdc:mga05p37_74224_c1
1485 nmdc:mga05p37_80015_c1
1486 nmdc:mga09592_139485_c1
1487 nmdc:mga09592_163952_c1
1488 nmdc:mga09592_353985_c1
1489 nmdc:mga0qj67_176052_c1
1490 nmdc:mga06r32_27619_c1
1491 nmdc:mga06r32_314917_c1
1492 nmdc:mga06r32_660536_c1
1493 nmdc:mga08y16_191791_c1
1494 nmdc:mga08y16_194289_c1
1495 nmdc:mga08y16_248527_c1
1496 nmdc:mga08y16_90961_c1
1497 nmdc:mga0n895_220536_c1
1498 nmdc:mga0n895_222159_c1
1499 nmdc:mga0n895_278983_c1
1500 nmdc:mga0n895_29757_c1
1501 nmdc:mga0n895_318787_c1
1502 nmdc:mga0n895_82303_c1
1503 nmdc:mga0rr50_612_c1
1504 nmdc:mga0rr50_84726_c1
1505 nmdc:mga08x19_193068_c1
1506 nmdc:mga08x19_27107_c1
1507 nmdc:mga08x19_7970_c1
1508 nmdc:mga0a205_204950_c1
1509 nmdc:mga0a205_412408_c1
1510 nmdc:mga0a205_93361_c1
1511 Ga0495612_0026820
1512 Ga0495595_0012219
1513 Ga0495619_0075360
1514 Ga0501084_0003039
1515 Ga0501084_0163054
1516 Ga0501082_0004555
1517 Ga0501082_0049202
1518 Ga0466962_0004003
1519 Ga0530510_0002862
1520 Ga0530510_0015456

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

11

199

0.76

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

11

236

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tps-assembly1.cif.gz_A crystal structure of alpn-202 (engineered cd80 vigd) in complex with pd-l1 0.8778 218 241
4tty-assembly1.cif.gz_B n-terminal domain of c. reinhardtii sas-6 homolog bld12p g94d f145w q147r (nn25) 0.826 207 243
2zuy-assembly1.cif.gz_A crystal structure of exotype rhamnogalacturonan lyase yesx 0.818 209 239
4wsp-assembly1.cif.gz_A racemic crystal structure of rv1738 from mycobacterium tuberculosis (form-i) 0.7869 209 241
1e4f-assembly1.cif.gz_T ftsa (apo form) from thermotoga maritima 0.7816 211 241
ID Description Score Start End Superfamily
af_A0A2R8QV90_961_1207_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9002 209 239 2.130.10.10
1i8lB01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.873 218 241 2.60.40.10
af_Q54AR9_158_227_3.10.20.370 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.8403 207 246 3.10.20.370
af_A0A2R8QV54_792_862_3.10.20.370 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.8359 209 243 3.10.20.370
af_A0A2R8QQ93_25_87_3.10.20.370 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.808 207 246 3.10.20.370
ID Description Score Start End GO Terms
AF-A0A7V9V1Q4-F1-model_v4 Metallophosphoesterase 0.9705 2 243 GO:0016787
AF-A0A538LN50-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9657 9 241 GO:0016787
AF-A0A1F2Y2U7-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9623 2 243 GO:0016787
AF-A0A7M2YVF1-F1-model_v4 Calcineurin-like phosphoesterase superfamily domain 0.9619 2 243 GO:0016787
AF-A0A855HQ91-F1-model_v4 deleted 0.961 2 56

Map