F479520
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 760 | 320 | 1520 | 270 |
Family's Representative Sequence
| Representative Sequence | 3300007076|Ga0075435_100087444|Ga0075435_1000874443 |
| Length | 304 |
| Sequence | MIVPRGSAQPVRLLHVSDLHFGGHGAPRIERGLGALIERTRPELVVASGDLTHXXXXDQHEAAADFLRSLGPPVLAIPGNHDIPYTFPARFTRTFAEFERHWETTEPLFRSPSLYVVGLNSVRAWRHQSGGLRDEQLSRARDLLAQAPEGALRVVALHHHLIGAPWRSRKKPVARRSDVLATLVDSGAELILAGHIHQGAVSERHEFEVFTGDVRGVVVSIAPGLGQPRPNRRGEARGLHVYEWDADTIRVLTYVWRDDDWGLTALRMFARGRKPLAVEGGPAGAPSRVAEVPPQTDGGQSPPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 159 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 165 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 166 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 175 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 176 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 182 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 202 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 203 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 204 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 205 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 210 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 211 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 212 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 213 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 214 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 260 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 261 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 262 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 267 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 268 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 269 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 270 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 271 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 272 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 320 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.95 |
| Metatranscriptomes | 1.05 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.53 |
| Nodule | 0 |
| Rhizoplane | 11.97 |
| Rhizosphere | 86.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075435_100087444 | 3300007076 | Bacteria | 2568 |
| 2 | rootL2_10214072 | 3300003322 | Bacteria | 1327 |
| 3 | JGI25407J50210_10000387 | 3300003373 | Bacteria | 8458 |
| 4 | JGI25407J50210_10000559 | 3300003373 | Bacteria | 7475 |
| 5 | Ga0070658_10015301 | 3300005327 | Bacteria | 6140 |
| 6 | Ga0070658_10254856 | 3300005327 | Bacteria | 1489 |
| 7 | Ga0070658_10566055 | 3300005327 | Bacteria | 984 |
| 8 | Ga0070683_100024600 | 3300005329 | Bacteria | 5396 |
| 9 | Ga0070683_100024806 | 3300005329 | Bacteria | 5376 |
| 10 | Ga0070683_100058978 | 3300005329 | Bacteria | 3566 |
| 11 | Ga0070683_100080978 | 3300005329 | Bacteria | 3039 |
| 12 | Ga0070683_100418375 | 3300005329 | Bacteria | 1278 |
| 13 | Ga0070690_100042636 | 3300005330 | Bacteria | 2874 |
| 14 | Ga0068869_100160808 | 3300005334 | Unclassified | 1748 |
| 15 | Ga0070666_10088923 | 3300005335 | Bacteria | 2119 |
| 16 | Ga0070680_100042145 | 3300005336 | Bacteria | 3703 |
| 17 | Ga0070680_100058634 | 3300005336 | Bacteria | 3148 |
| 18 | Ga0070680_100274218 | 3300005336 | Unclassified | 1428 |
| 19 | Ga0070680_100309927 | 3300005336 | Unclassified | 1339 |
| 20 | Ga0070682_100051240 | 3300005337 | Bacteria | 2579 |
| 21 | Ga0070682_100105346 | 3300005337 | Bacteria | 1869 |
| 22 | Ga0070682_100448759 | 3300005337 | Bacteria | 987 |
| 23 | Ga0068868_100110722 | 3300005338 | Bacteria | 2231 |
| 24 | Ga0068868_100184411 | 3300005338 | Unclassified | 1733 |
| 25 | Ga0070660_100088255 | 3300005339 | Unclassified | 2442 |
| 26 | Ga0070660_100248705 | 3300005339 | Bacteria | 1449 |
| 27 | Ga0070661_100034256 | 3300005344 | Unclassified | 3683 |
| 28 | Ga0070692_10065398 | 3300005345 | Bacteria | 1925 |
| 29 | Ga0070675_100437205 | 3300005354 | Bacteria | 1172 |
| 30 | Ga0070671_100091848 | 3300005355 | Unclassified | 2543 |
| 31 | Ga0070674_100006239 | 3300005356 | Bacteria | 6939 |
| 32 | Ga0070673_100133190 | 3300005364 | Bacteria | 2089 |
| 33 | Ga0070688_100010593 | 3300005365 | Bacteria | 5091 |
| 34 | Ga0070659_100308028 | 3300005366 | Bacteria | 1322 |
| 35 | Ga0070659_100670613 | 3300005366 | Unclassified | 895 |
| 36 | Ga0070667_100050683 | 3300005367 | Bacteria | 3499 |
| 37 | Ga0070714_100058042 | 3300005435 | Bacteria | 3314 |
| 38 | Ga0070714_100194932 | 3300005435 | Bacteria | 1851 |
| 39 | Ga0070714_100249266 | 3300005435 | Bacteria | 1641 |
| 40 | Ga0070713_100030294 | 3300005436 | Bacteria | 4296 |
| 41 | Ga0070713_100156752 | 3300005436 | Bacteria | 2030 |
| 42 | Ga0070713_100254796 | 3300005436 | Bacteria | 1602 |
| 43 | Ga0070710_10033964 | 3300005437 | Bacteria | 2772 |
| 44 | Ga0070710_10073048 | 3300005437 | Bacteria | 1982 |
| 45 | Ga0070701_10003855 | 3300005438 | Bacteria | 5989 |
| 46 | Ga0070711_100127111 | 3300005439 | Bacteria | 1893 |
| 47 | Ga0070700_100001090 | 3300005441 | Bacteria | 13418 |
| 48 | Ga0070700_100139876 | 3300005441 | Bacteria | 1644 |
| 49 | Ga0070700_100338124 | 3300005441 | Bacteria | 1112 |
| 50 | Ga0070694_100014123 | 3300005444 | Bacteria | 4997 |
| 51 | Ga0070694_100100084 | 3300005444 | Bacteria | 2049 |
| 52 | Ga0070708_100021491 | 3300005445 | Bacteria | 5456 |
| 53 | Ga0070708_100043894 | 3300005445 | Bacteria | 3929 |
| 54 | Ga0070708_100162508 | 3300005445 | Unclassified | 2081 |
| 55 | Ga0070708_100184740 | 3300005445 | Bacteria | 1949 |
| 56 | Ga0070708_100769054 | 3300005445 | Unclassified | 906 |
| 57 | Ga0070663_100052734 | 3300005455 | Bacteria | 2902 |
| 58 | Ga0070678_100007139 | 3300005456 | Bacteria | 6604 |
| 59 | Ga0070678_100263772 | 3300005456 | Unclassified | 1450 |
| 60 | Ga0070678_100369051 | 3300005456 | Bacteria | 1239 |
| 61 | Ga0070662_100189128 | 3300005457 | Bacteria | 1627 |
| 62 | Ga0070662_100411664 | 3300005457 | Bacteria | 1117 |
| 63 | Ga0070681_10033589 | 3300005458 | Bacteria | 5149 |
| 64 | Ga0068867_100021482 | 3300005459 | Bacteria | 4605 |
| 65 | Ga0070685_10143880 | 3300005466 | Unclassified | 1504 |
| 66 | Ga0070706_100030939 | 3300005467 | Bacteria | 4934 |
| 67 | Ga0070706_100090103 | 3300005467 | Bacteria | 2844 |
| 68 | Ga0070706_100099260 | 3300005467 | Bacteria | 2705 |
| 69 | Ga0070706_100122819 | 3300005467 | Bacteria | 2421 |
| 70 | Ga0070706_100317892 | 3300005467 | Unclassified | 1452 |
| 71 | Ga0070707_100019302 | 3300005468 | Bacteria | 6420 |
| 72 | Ga0070707_100135613 | 3300005468 | Bacteria | 2394 |
| 73 | Ga0070707_100228111 | 3300005468 | Bacteria | 1814 |
| 74 | Ga0070707_100293405 | 3300005468 | Bacteria | 1580 |
| 75 | Ga0070698_100017072 | 3300005471 | Bacteria | 7653 |
| 76 | Ga0070698_100021815 | 3300005471 | Bacteria | 6707 |
| 77 | Ga0070698_100295974 | 3300005471 | Bacteria | 1549 |
| 78 | Ga0070699_100002193 | 3300005518 | Bacteria | 17667 |
| 79 | Ga0070699_100016866 | 3300005518 | Bacteria | 6270 |
| 80 | Ga0070699_100452852 | 3300005518 | Bacteria | 1164 |
| 81 | Ga0070679_100040701 | 3300005530 | Bacteria | 4623 |
| 82 | Ga0070679_100139081 | 3300005530 | Unclassified | 2408 |
| 83 | Ga0070679_100139427 | 3300005530 | Unclassified | 2405 |
| 84 | Ga0070679_100177203 | 3300005530 | Bacteria | 2104 |
| 85 | Ga0070679_100194682 | 3300005530 | Bacteria | 1995 |
| 86 | Ga0070684_100029344 | 3300005535 | Bacteria | 4660 |
| 87 | Ga0070684_100085362 | 3300005535 | Bacteria | 2800 |
| 88 | Ga0070684_100131758 | 3300005535 | Bacteria | 2255 |
| 89 | Ga0070684_100159227 | 3300005535 | Unclassified | 2047 |
| 90 | Ga0070684_100238068 | 3300005535 | Bacteria | 1663 |
| 91 | Ga0070697_100251571 | 3300005536 | Bacteria | 1511 |
| 92 | Ga0070672_100291698 | 3300005543 | Unclassified | 1381 |
| 93 | Ga0070686_100002328 | 3300005544 | Bacteria | 10482 |
| 94 | Ga0070695_100000347 | 3300005545 | Bacteria | 23666 |
| 95 | Ga0070696_100020791 | 3300005546 | Bacteria | 4447 |
| 96 | Ga0070696_100036441 | 3300005546 | Bacteria | 3391 |
| 97 | Ga0070693_100047655 | 3300005547 | Bacteria | 2439 |
| 98 | Ga0070693_100090653 | 3300005547 | Bacteria | 1842 |
| 99 | Ga0070704_100364394 | 3300005549 | Bacteria | 1224 |
| 100 | Ga0068855_100093932 | 3300005563 | Bacteria | 3458 |
| 101 | Ga0068855_100117959 | 3300005563 | Bacteria | 3040 |
| 102 | Ga0068855_100169479 | 3300005563 | Bacteria | 2473 |
| 103 | Ga0068855_100344850 | 3300005563 | Unclassified | 1641 |
| 104 | Ga0068857_100041764 | 3300005577 | Bacteria | 4066 |
| 105 | Ga0068856_100030033 | 3300005614 | Bacteria | 5312 |
| 106 | Ga0068856_100159533 | 3300005614 | Bacteria | 2265 |
| 107 | Ga0070702_100056474 | 3300005615 | Bacteria | 2267 |
| 108 | Ga0070702_100144576 | 3300005615 | Bacteria | 1519 |
| 109 | Ga0068852_100102291 | 3300005616 | Bacteria | 2588 |
| 110 | Ga0068859_100374277 | 3300005617 | Bacteria | 1520 |
| 111 | Ga0068866_10010110 | 3300005718 | Bacteria | 4034 |
| 112 | Ga0068861_100102678 | 3300005719 | Bacteria | 2277 |
| 113 | Ga0068861_100251037 | 3300005719 | Bacteria | 1509 |
| 114 | Ga0068851_10164319 | 3300005834 | Bacteria | 1221 |
| 115 | Ga0068863_100186800 | 3300005841 | Bacteria | 1991 |
| 116 | Ga0068860_100400960 | 3300005843 | Bacteria | 1357 |
| 117 | Ga0068860_100580168 | 3300005843 | Bacteria | 1125 |
| 118 | Ga0081455_10004967 | 3300005937 | Bacteria | 14710 |
| 119 | Ga0081455_10005435 | 3300005937 | Bacteria | 13979 |
| 120 | Ga0081455_10024080 | 3300005937 | Bacteria | 5648 |
| 121 | Ga0081455_10046662 | 3300005937 | Bacteria | 3757 |
| 122 | Ga0081455_10091958 | 3300005937 | Unclassified | 2456 |
| 123 | Ga0081455_10350926 | 3300005937 | Unclassified | 1041 |
| 124 | Ga0081455_10350927 | 3300005937 | Bacteria | 1041 |
| 125 | Ga0081538_10000155 | 3300005981 | Bacteria | 71481 |
| 126 | Ga0081538_10000375 | 3300005981 | Bacteria | 51029 |
| 127 | Ga0081538_10002367 | 3300005981 | Bacteria | 18532 |
| 128 | Ga0081538_10017416 | 3300005981 | Bacteria | 5453 |
| 129 | Ga0081540_1001919 | 3300005983 | Bacteria | 17424 |
| 130 | Ga0081540_1005495 | 3300005983 | Bacteria | 9454 |
| 131 | Ga0081540_1008818 | 3300005983 | Bacteria | 7004 |
| 132 | Ga0081540_1020377 | 3300005983 | Bacteria | 3991 |
| 133 | Ga0081539_10004025 | 3300005985 | Bacteria | 16886 |
| 134 | Ga0081539_10009548 | 3300005985 | Bacteria | 8079 |
| 135 | Ga0070717_10060068 | 3300006028 | Bacteria | 3147 |
| 136 | Ga0070717_10106269 | 3300006028 | Bacteria | 2390 |
| 137 | Ga0070717_10393313 | 3300006028 | Bacteria | 1244 |
| 138 | Ga0070717_10412020 | 3300006028 | Unclassified | 1215 |
| 139 | Ga0070717_10635349 | 3300006028 | Unclassified | 969 |
| 140 | Ga0075365_10002614 | 3300006038 | Bacteria | 8915 |
| 141 | Ga0075363_100224045 | 3300006048 | Unclassified | 1078 |
| 142 | Ga0075432_10052476 | 3300006058 | Unclassified | 1440 |
| 143 | Ga0070715_10034880 | 3300006163 | Bacteria | 2065 |
| 144 | Ga0070712_100022353 | 3300006175 | Bacteria | 4166 |
| 145 | Ga0070712_100026223 | 3300006175 | Bacteria | 3880 |
| 146 | Ga0070712_100088766 | 3300006175 | Bacteria | 2260 |
| 147 | Ga0070712_100096547 | 3300006175 | Bacteria | 2176 |
| 148 | Ga0070712_100329256 | 3300006175 | Bacteria | 1244 |
| 149 | Ga0075367_10134345 | 3300006178 | Bacteria | 1530 |
| 150 | Ga0097621_100039454 | 3300006237 | Bacteria | 3793 |
| 151 | Ga0068871_100005174 | 3300006358 | Bacteria | 9119 |
| 152 | Ga0075428_100125359 | 3300006844 | Unclassified | 2795 |
| 153 | Ga0075428_100203249 | 3300006844 | Bacteria | 2141 |
| 154 | Ga0075428_100240338 | 3300006844 | Bacteria | 1954 |
| 155 | Ga0075428_100436456 | 3300006844 | Bacteria | 1403 |
| 156 | Ga0075430_100007871 | 3300006846 | Bacteria | 9009 |
| 157 | Ga0075431_100044149 | 3300006847 | Bacteria | 4598 |
| 158 | Ga0075431_100192770 | 3300006847 | Unclassified | 2088 |
| 159 | Ga0075431_100542245 | 3300006847 | Unclassified | 1151 |
| 160 | Ga0075433_10004025 | 3300006852 | Bacteria | 11368 |
| 161 | Ga0075433_10194867 | 3300006852 | Unclassified | 1802 |
| 162 | Ga0075433_10233147 | 3300006852 | Bacteria | 1634 |
| 163 | Ga0075433_10243788 | 3300006852 | Bacteria | 1595 |
| 164 | Ga0075434_100010911 | 3300006871 | Bacteria | 8542 |
| 165 | Ga0075434_100093427 | 3300006871 | Bacteria | 3012 |
| 166 | Ga0075434_100129947 | 3300006871 | Bacteria | 2537 |
| 167 | Ga0075434_100176337 | 3300006871 | Bacteria | 2157 |
| 168 | Ga0075434_100645273 | 3300006871 | Bacteria | 1077 |
| 169 | Ga0075429_100089705 | 3300006880 | Bacteria | 2680 |
| 170 | Ga0075429_100187223 | 3300006880 | Unclassified | 1814 |
| 171 | Ga0068865_100013004 | 3300006881 | Bacteria | 5248 |
| 172 | Ga0075436_100011596 | 3300006914 | Bacteria | 6047 |
| 173 | Ga0075436_100025247 | 3300006914 | Bacteria | 4088 |
| 174 | Ga0075436_100047434 | 3300006914 | Bacteria | 2963 |
| 175 | Ga0075436_100145490 | 3300006914 | Bacteria | 1666 |
| 176 | Ga0075436_100179414 | 3300006914 | Bacteria | 1496 |
| 177 | Ga0097620_100374264 | 3300006931 | Bacteria | 1520 |
| 178 | Ga0075435_100001974 | 3300007076 | Bacteria | 13382 |
| 179 | Ga0075435_100092862 | 3300007076 | Bacteria | 2493 |
| 180 | Ga0105240_10022924 | 3300009093 | Bacteria | 8271 |
| 181 | Ga0105240_10174112 | 3300009093 | Unclassified | 2546 |
| 182 | Ga0105240_10763066 | 3300009093 | Unclassified | 1050 |
| 183 | Ga0111539_10042472 | 3300009094 | Bacteria | 5459 |
| 184 | Ga0111539_10122606 | 3300009094 | Bacteria | 3046 |
| 185 | Ga0111539_10201276 | 3300009094 | Bacteria | 2322 |
| 186 | Ga0111539_10205155 | 3300009094 | Bacteria | 2298 |
| 187 | Ga0111539_10285701 | 3300009094 | Bacteria | 1920 |
| 188 | Ga0105245_10029749 | 3300009098 | Bacteria | 4828 |
| 189 | Ga0105245_10038688 | 3300009098 | Bacteria | 4244 |
| 190 | Ga0105245_10075164 | 3300009098 | Bacteria | 3076 |
| 191 | Ga0105245_10095654 | 3300009098 | Bacteria | 2740 |
| 192 | Ga0105245_10110359 | 3300009098 | Bacteria | 2557 |
| 193 | Ga0105245_10116021 | 3300009098 | Bacteria | 2496 |
| 194 | Ga0105247_10026467 | 3300009101 | Bacteria | 3502 |
| 195 | Ga0114129_10020206 | 3300009147 | Bacteria | 9479 |
| 196 | Ga0114129_10054080 | 3300009147 | Bacteria | 5630 |
| 197 | Ga0114129_10080522 | 3300009147 | Bacteria | 4527 |
| 198 | Ga0114129_10203530 | 3300009147 | Bacteria | 2680 |
| 199 | Ga0114129_10204150 | 3300009147 | Bacteria | 2675 |
| 200 | Ga0105243_10006875 | 3300009148 | Bacteria | 8770 |
| 201 | Ga0105243_10043049 | 3300009148 | Bacteria | 3538 |
| 202 | Ga0105243_10059071 | 3300009148 | Bacteria | 3059 |
| 203 | Ga0105243_10107452 | 3300009148 | Bacteria | 2327 |
| 204 | Ga0105243_10291195 | 3300009148 | Bacteria | 1475 |
| 205 | Ga0105241_10025314 | 3300009174 | Bacteria | 4410 |
| 206 | Ga0105241_10047792 | 3300009174 | Bacteria | 3255 |
| 207 | Ga0105241_10143812 | 3300009174 | Bacteria | 1945 |
| 208 | Ga0105242_10222761 | 3300009176 | Bacteria | 1687 |
| 209 | Ga0105242_10246358 | 3300009176 | Bacteria | 1608 |
| 210 | Ga0105242_10257616 | 3300009176 | Bacteria | 1574 |
| 211 | Ga0105242_10269768 | 3300009176 | Bacteria | 1541 |
| 212 | Ga0105242_10341254 | 3300009176 | Bacteria | 1380 |
| 213 | Ga0105248_10183206 | 3300009177 | Bacteria | 2360 |
| 214 | Ga0105248_10201259 | 3300009177 | Bacteria | 2244 |
| 215 | Ga0105237_10044800 | 3300009545 | Bacteria | 4454 |
| 216 | Ga0105238_10047405 | 3300009551 | Bacteria | 4332 |
| 217 | Ga0105238_10756005 | 3300009551 | Bacteria | 986 |
| 218 | Ga0105249_10021565 | 3300009553 | Bacteria | 5768 |
| 219 | Ga0105249_10234035 | 3300009553 | Unclassified | 1813 |
| 220 | Ga0105249_10375209 | 3300009553 | Unclassified | 1447 |
| 221 | Ga0105239_10009163 | 3300010375 | Bacteria | 11195 |
| 222 | Ga0105239_10111675 | 3300010375 | Bacteria | 3030 |
| 223 | Ga0105239_10201829 | 3300010375 | Bacteria | 2228 |
| 224 | Ga0105239_10254563 | 3300010375 | Unclassified | 1972 |
| 225 | Ga0105239_10526516 | 3300010375 | Bacteria | 1345 |
| 226 | Ga0105239_10677822 | 3300010375 | Unclassified | 1178 |
| 227 | Ga0105246_10058718 | 3300011119 | Bacteria | 2666 |
| 228 | Ga0157369_10070710 | 3300013105 | Unclassified | 3748 |
| 229 | Ga0157374_10005200 | 3300013296 | Bacteria | 10912 |
| 230 | Ga0157374_10054074 | 3300013296 | Bacteria | 3744 |
| 231 | Ga0157378_10010428 | 3300013297 | Bacteria | 8115 |
| 232 | Ga0157378_10083567 | 3300013297 | Bacteria | 2890 |
| 233 | Ga0163162_10059315 | 3300013306 | Bacteria | 3858 |
| 234 | Ga0157372_10037263 | 3300013307 | Bacteria | 5362 |
| 235 | Ga0157372_10094431 | 3300013307 | Bacteria | 3406 |
| 236 | Ga0157372_10291455 | 3300013307 | Bacteria | 1898 |
| 237 | Ga0157375_10032292 | 3300013308 | Bacteria | 4964 |
| 238 | Ga0157375_10036342 | 3300013308 | Bacteria | 4712 |
| 239 | Ga0157375_10293359 | 3300013308 | Bacteria | 1789 |
| 240 | Ga0157375_10379274 | 3300013308 | Bacteria | 1581 |
| 241 | Ga0163163_10201571 | 3300014325 | Bacteria | 2038 |
| 242 | Ga0182008_10111834 | 3300014497 | Bacteria | 1353 |
| 243 | Ga0157377_10023173 | 3300014745 | Bacteria | 3288 |
| 244 | Ga0157376_10232865 | 3300014969 | Bacteria | 1712 |
| 245 | Ga0163161_10057536 | 3300017792 | Bacteria | 2825 |
| 246 | Ga0197907_10120316 | 3300020069 | Unclassified | 1985 |
| 247 | Ga0206356_10056051 | 3300020070 | Unclassified | 2787 |
| 248 | Ga0206356_10307083 | 3300020070 | Bacteria | 1888 |
| 249 | Ga0206356_11421914 | 3300020070 | Unclassified | 1771 |
| 250 | Ga0206354_10292101 | 3300020081 | Bacteria | 1533 |
| 251 | Ga0206354_10996903 | 3300020081 | Bacteria | 4204 |
| 252 | Ga0206353_10161134 | 3300020082 | Unclassified | 2706 |
| 253 | Ga0206353_10208751 | 3300020082 | Bacteria | 3051 |
| 254 | Ga0213876_10100801 | 3300021384 | Bacteria | 1531 |
| 255 | Ga0213876_10149134 | 3300021384 | Unclassified | 1244 |
| 256 | Ga0207653_10022925 | 3300025885 | Bacteria | 1986 |
| 257 | Ga0207692_10012017 | 3300025898 | Bacteria | 3708 |
| 258 | Ga0207692_10042099 | 3300025898 | Bacteria | 2265 |
| 259 | Ga0207692_10086535 | 3300025898 | Unclassified | 1689 |
| 260 | Ga0207642_10019002 | 3300025899 | Bacteria | 2651 |
| 261 | Ga0207688_10007979 | 3300025901 | Bacteria | 5759 |
| 262 | Ga0207688_10178874 | 3300025901 | Bacteria | 1264 |
| 263 | Ga0207680_10082563 | 3300025903 | Bacteria | 2023 |
| 264 | Ga0207699_10020291 | 3300025906 | Bacteria | 3559 |
| 265 | Ga0207699_10033861 | 3300025906 | Bacteria | 2892 |
| 266 | Ga0207699_10107884 | 3300025906 | Bacteria | 1780 |
| 267 | Ga0207699_10315901 | 3300025906 | Unclassified | 1094 |
| 268 | Ga0207684_10031795 | 3300025910 | Bacteria | 4490 |
| 269 | Ga0207684_10039045 | 3300025910 | Bacteria | 4028 |
| 270 | Ga0207654_10015514 | 3300025911 | Bacteria | 3955 |
| 271 | Ga0207654_10270006 | 3300025911 | Bacteria | 1147 |
| 272 | Ga0207707_10102821 | 3300025912 | Bacteria | 2498 |
| 273 | Ga0207707_10133139 | 3300025912 | Bacteria | 2174 |
| 274 | Ga0207707_10467974 | 3300025912 | Unclassified | 1077 |
| 275 | Ga0207695_10077421 | 3300025913 | Bacteria | 3378 |
| 276 | Ga0207693_10002624 | 3300025915 | Bacteria | 15613 |
| 277 | Ga0207693_10016443 | 3300025915 | Bacteria | 5911 |
| 278 | Ga0207693_10039885 | 3300025915 | Bacteria | 3698 |
| 279 | Ga0207693_10048141 | 3300025915 | Bacteria | 3348 |
| 280 | Ga0207663_10022422 | 3300025916 | Bacteria | 3609 |
| 281 | Ga0207663_10070283 | 3300025916 | Unclassified | 2255 |
| 282 | Ga0207663_10109785 | 3300025916 | Bacteria | 1870 |
| 283 | Ga0207660_10043194 | 3300025917 | Bacteria | 3167 |
| 284 | Ga0207657_10001460 | 3300025919 | Bacteria | 25308 |
| 285 | Ga0207657_10028913 | 3300025919 | Bacteria | 5050 |
| 286 | Ga0207652_10055223 | 3300025921 | Bacteria | 3415 |
| 287 | Ga0207652_10237261 | 3300025921 | Bacteria | 1644 |
| 288 | Ga0207652_10363455 | 3300025921 | Bacteria | 1306 |
| 289 | Ga0207646_10005879 | 3300025922 | Bacteria | 12814 |
| 290 | Ga0207646_10028964 | 3300025922 | Bacteria | 5037 |
| 291 | Ga0207646_10268386 | 3300025922 | Bacteria | 1542 |
| 292 | Ga0207646_10300337 | 3300025922 | Bacteria | 1451 |
| 293 | Ga0207687_10044693 | 3300025927 | Bacteria | 3058 |
| 294 | Ga0207687_10082294 | 3300025927 | Archaea | 2329 |
| 295 | Ga0207687_10376583 | 3300025927 | Bacteria | 1162 |
| 296 | Ga0207700_10000004 | 3300025928 | Bacteria | 443409 |
| 297 | Ga0207700_10051994 | 3300025928 | Bacteria | 3061 |
| 298 | Ga0207664_10156855 | 3300025929 | Unclassified | 1938 |
| 299 | Ga0207664_10180346 | 3300025929 | Bacteria | 1813 |
| 300 | Ga0207664_10203451 | 3300025929 | Unclassified | 1710 |
| 301 | Ga0207664_10361373 | 3300025929 | Bacteria | 1286 |
| 302 | Ga0207690_10545843 | 3300025932 | Unclassified | 942 |
| 303 | Ga0207686_10012235 | 3300025934 | Bacteria | 4714 |
| 304 | Ga0207686_10184361 | 3300025934 | Bacteria | 1482 |
| 305 | Ga0207686_10335284 | 3300025934 | Unclassified | 1134 |
| 306 | Ga0207709_10001662 | 3300025935 | Bacteria | 14994 |
| 307 | Ga0207709_10067241 | 3300025935 | Bacteria | 2261 |
| 308 | Ga0207709_10146619 | 3300025935 | Bacteria | 1629 |
| 309 | Ga0207669_10009647 | 3300025937 | Bacteria | 4612 |
| 310 | Ga0207704_10046322 | 3300025938 | Bacteria | 2591 |
| 311 | Ga0207665_10048448 | 3300025939 | Bacteria | 2852 |
| 312 | Ga0207665_10059992 | 3300025939 | Bacteria | 2575 |
| 313 | Ga0207711_10336104 | 3300025941 | Bacteria | 1397 |
| 314 | Ga0207689_10194687 | 3300025942 | Unclassified | 1673 |
| 315 | Ga0207661_10284173 | 3300025944 | Bacteria | 1479 |
| 316 | Ga0207661_10423535 | 3300025944 | Unclassified | 1209 |
| 317 | Ga0207661_10477619 | 3300025944 | Bacteria | 1138 |
| 318 | Ga0207667_10095674 | 3300025949 | Bacteria | 3065 |
| 319 | Ga0207667_10137248 | 3300025949 | Bacteria | 2518 |
| 320 | Ga0207667_10579763 | 3300025949 | Bacteria | 1132 |
| 321 | Ga0207651_10098198 | 3300025960 | Bacteria | 2165 |
| 322 | Ga0207712_10054046 | 3300025961 | Bacteria | 2820 |
| 323 | Ga0207712_10302482 | 3300025961 | Bacteria | 1313 |
| 324 | Ga0207640_10053716 | 3300025981 | Bacteria | 2631 |
| 325 | Ga0207658_10015151 | 3300025986 | Bacteria | 5288 |
| 326 | Ga0207658_10079212 | 3300025986 | Unclassified | 2513 |
| 327 | Ga0207677_10271482 | 3300026023 | Bacteria | 1387 |
| 328 | Ga0207677_10573949 | 3300026023 | Bacteria | 986 |
| 329 | Ga0207639_10110291 | 3300026041 | Bacteria | 2241 |
| 330 | Ga0207678_10778679 | 3300026067 | Bacteria | 844 |
| 331 | Ga0207708_10000305 | 3300026075 | Bacteria | 38789 |
| 332 | Ga0207702_10089526 | 3300026078 | Bacteria | 2691 |
| 333 | Ga0207702_10405066 | 3300026078 | Bacteria | 1316 |
| 334 | Ga0207641_10331007 | 3300026088 | Bacteria | 1447 |
| 335 | Ga0207648_10003702 | 3300026089 | Bacteria | 16002 |
| 336 | Ga0207674_10001754 | 3300026116 | Bacteria | 27746 |
| 337 | Ga0207675_100019798 | 3300026118 | Bacteria | 6281 |
| 338 | Ga0207683_10000572 | 3300026121 | Bacteria | 34101 |
| 339 | Ga0207683_10024773 | 3300026121 | Bacteria | 5170 |
| 340 | Ga0207683_10323238 | 3300026121 | Unclassified | 1413 |
| 341 | Ga0207428_10001268 | 3300027907 | Bacteria | 26994 |
| 342 | Ga0207428_10067270 | 3300027907 | Bacteria | 2821 |
| 343 | Ga0207428_10137373 | 3300027907 | Bacteria | 1868 |
| 344 | Ga0207428_10176873 | 3300027907 | Bacteria | 1614 |
| 345 | Ga0268266_10075262 | 3300028379 | Bacteria | 2933 |
| 346 | Ga0265334_10055783 | 3300028573 | Bacteria | 1502 |
| 347 | Ga0265318_10068485 | 3300028577 | Bacteria | 1317 |
| 348 | Ga0265322_10003946 | 3300028654 | Bacteria | 4446 |
| 349 | Ga0265336_10000676 | 3300028666 | Bacteria | 18479 |
| 350 | Ga0265338_10004508 | 3300028800 | Bacteria | 18779 |
| 351 | Ga0265338_10009753 | 3300028800 | Bacteria | 11389 |
| 352 | Ga0265338_10045158 | 3300028800 | Bacteria | 4055 |
| 353 | Ga0265330_10020776 | 3300031235 | Bacteria | 3000 |
| 354 | Ga0265332_10141848 | 3300031238 | Bacteria | 1006 |
| 355 | Ga0265325_10015319 | 3300031241 | Bacteria | 4313 |
| 356 | Ga0265340_10027909 | 3300031247 | Unclassified | 2842 |
| 357 | Ga0265339_10036804 | 3300031249 | Unclassified | 2736 |
| 358 | Ga0265327_10071856 | 3300031251 | Bacteria | 1729 |
| 359 | Ga0265316_10012382 | 3300031344 | Bacteria | 7653 |
| 360 | Ga0265316_10018129 | 3300031344 | Bacteria | 6059 |
| 361 | Ga0265313_10003489 | 3300031595 | Bacteria | 12688 |
| 362 | Ga0265313_10036243 | 3300031595 | Bacteria | 2477 |
| 363 | Ga0265314_10002807 | 3300031711 | Bacteria | 17390 |
| 364 | Ga0265342_10071609 | 3300031712 | Bacteria | 2019 |
| 365 | Ga0307416_100142097 | 3300032002 | Bacteria | 2184 |
| 366 | Ga0307415_100030294 | 3300032126 | Bacteria | 3471 |
| 367 | Ga0373930_0033559 | 3300034816 | Unclassified | 1066 |
| 368 | Ga0373948_0003027 | 3300034817 | Bacteria | 2545 |
| 369 | Ga0373958_0012654 | 3300034819 | Unclassified | 1447 |
| 370 | Ga0373928_0011690 | 3300035084 | Bacteria | 1742 |
| 371 | Ga0373940_0003415 | 3300035088 | Bacteria | 3241 |
| 372 | Ga0373949_0022523 | 3300035090 | Unclassified | 1453 |
| 373 | Ga0373951_0016401 | 3300035091 | Bacteria | 1670 |
| 374 | Ga0373952_0002424 | 3300035092 | Bacteria | 3365 |
| 375 | Ga0373932_0012778 | 3300035112 | Bacteria | 2074 |
| 376 | Ga0373941_0006284 | 3300035115 | Bacteria | 2854 |
| 377 | Ga0373960_0014767 | 3300035121 | Bacteria | 1983 |
| 378 | Ga0373943_0003088 | 3300035170 | Bacteria | 7562 |
| 379 | Ga0373946_0007250 | 3300035171 | Bacteria | 4048 |
| 380 | Ga0373942_0018766 | 3300035207 | Unclassified | 1720 |
| 381 | Ga0373961_0004581 | 3300035241 | Bacteria | 3338 |
| 382 | Ga0373962_0005720 | 3300035242 | Bacteria | 3002 |
| 383 | Ga0373935_0021095 | 3300035692 | Bacteria | 3987 |
| 384 | Ga0373947_0017682 | 3300035725 | Bacteria | 4102 |
| 385 | Ga0373925_0019349 | 3300037068 | Bacteria | 4952 |
| 386 | Ga0395899_0002364 | 3300037312 | Bacteria | 15357 |
| 387 | Ga0395899_0017563 | 3300037312 | Bacteria | 5450 |
| 388 | Ga0395899_0078307 | 3300037312 | Bacteria | 2409 |
| 389 | Ga0395899_0084304 | 3300037312 | Bacteria | 2310 |
| 390 | Ga0395899_0086019 | 3300037312 | Bacteria | 2284 |
| 391 | Ga0395899_0178878 | 3300037312 | Bacteria | 1490 |
| 392 | Ga0395899_0346694 | 3300037312 | Bacteria | 994 |
| 393 | Ga0395900_0001116 | 3300037418 | Bacteria | 34004 |
| 394 | Ga0395900_0001835 | 3300037418 | Bacteria | 24200 |
| 395 | Ga0395900_0002995 | 3300037418 | Bacteria | 18380 |
| 396 | Ga0395900_0005325 | 3300037418 | Bacteria | 13486 |
| 397 | Ga0395900_0006889 | 3300037418 | Bacteria | 11794 |
| 398 | Ga0395900_0010530 | 3300037418 | Bacteria | 9459 |
| 399 | Ga0395900_0018070 | 3300037418 | Bacteria | 7198 |
| 400 | Ga0395900_0018083 | 3300037418 | Bacteria | 7194 |
| 401 | Ga0395900_0035344 | 3300037418 | Bacteria | 5146 |
| 402 | Ga0395900_0051050 | 3300037418 | Bacteria | 4260 |
| 403 | Ga0395900_0068513 | 3300037418 | Bacteria | 3646 |
| 404 | Ga0395900_0117434 | 3300037418 | Bacteria | 2729 |
| 405 | Ga0395900_0181299 | 3300037418 | Bacteria | 2140 |
| 406 | Ga0395900_0269350 | 3300037418 | Bacteria | 1698 |
| 407 | Ga0395900_0294406 | 3300037418 | Bacteria | 1611 |
| 408 | Ga0395900_0526032 | 3300037418 | Bacteria | 1130 |
| 409 | Ga0395900_0631189 | 3300037418 | Bacteria | 1009 |
| 410 | Ga0395898_0007870 | 3300037466 | Bacteria | 11307 |
| 411 | Ga0395898_0010215 | 3300037466 | Bacteria | 9829 |
| 412 | Ga0395898_0010725 | 3300037466 | Bacteria | 9572 |
| 413 | Ga0395898_0013558 | 3300037466 | Bacteria | 8391 |
| 414 | Ga0395898_0015454 | 3300037466 | Bacteria | 7829 |
| 415 | Ga0395898_0017955 | 3300037466 | Bacteria | 7218 |
| 416 | Ga0395898_0023779 | 3300037466 | Bacteria | 6187 |
| 417 | Ga0395898_0023911 | 3300037466 | Bacteria | 6167 |
| 418 | Ga0395898_0036685 | 3300037466 | Bacteria | 4867 |
| 419 | Ga0395898_0039074 | 3300037466 | Bacteria | 4700 |
| 420 | Ga0395898_0040523 | 3300037466 | Bacteria | 4605 |
| 421 | Ga0395898_0066665 | 3300037466 | Bacteria | 3486 |
| 422 | Ga0395898_0097583 | 3300037466 | Bacteria | 2822 |
| 423 | Ga0395898_0109822 | 3300037466 | Bacteria | 2644 |
| 424 | Ga0395898_0113082 | 3300037466 | Bacteria | 2602 |
| 425 | Ga0395898_0121401 | 3300037466 | Unclassified | 2503 |
| 426 | Ga0395898_0132704 | 3300037466 | Bacteria | 2384 |
| 427 | Ga0395898_0281770 | 3300037466 | Unclassified | 1586 |
| 428 | Ga0395898_0365284 | 3300037466 | Bacteria | 1376 |
| 429 | Ga0395898_0627865 | 3300037466 | Unclassified | 1017 |
| 430 | Ga0395905_0003307 | 3300037471 | Bacteria | 17310 |
| 431 | Ga0395905_0003977 | 3300037471 | Bacteria | 15548 |
| 432 | Ga0395905_0006497 | 3300037471 | Bacteria | 11762 |
| 433 | Ga0395905_0010878 | 3300037471 | Bacteria | 8814 |
| 434 | Ga0395905_0011714 | 3300037471 | Bacteria | 8465 |
| 435 | Ga0395905_0013615 | 3300037471 | Bacteria | 7792 |
| 436 | Ga0395905_0025321 | 3300037471 | Bacteria | 5595 |
| 437 | Ga0395905_0027804 | 3300037471 | Bacteria | 5332 |
| 438 | Ga0395905_0035742 | 3300037471 | Bacteria | 4666 |
| 439 | Ga0395905_0071117 | 3300037471 | Bacteria | 3262 |
| 440 | Ga0395905_0146637 | 3300037471 | Bacteria | 2220 |
| 441 | Ga0395905_0172058 | 3300037471 | Bacteria | 2034 |
| 442 | Ga0395905_0358680 | 3300037471 | Bacteria | 1350 |
| 443 | Ga0395905_0484052 | 3300037471 | Unclassified | 1137 |
| 444 | Ga0395905_0548960 | 3300037471 | Bacteria | 1057 |
| 445 | Ga0395901_0000847 | 3300038443 | Bacteria | 33661 |
| 446 | Ga0395901_0003698 | 3300038443 | Bacteria | 15426 |
| 447 | Ga0395901_0004430 | 3300038443 | Bacteria | 14164 |
| 448 | Ga0395901_0008183 | 3300038443 | Bacteria | 10569 |
| 449 | Ga0395901_0008362 | 3300038443 | Bacteria | 10461 |
| 450 | Ga0395901_0008941 | 3300038443 | Bacteria | 10143 |
| 451 | Ga0395901_0009143 | 3300038443 | Bacteria | 10035 |
| 452 | Ga0395901_0011791 | 3300038443 | Bacteria | 8863 |
| 453 | Ga0395901_0013739 | 3300038443 | Bacteria | 8229 |
| 454 | Ga0395901_0026442 | 3300038443 | Bacteria | 5958 |
| 455 | Ga0395901_0049494 | 3300038443 | Bacteria | 4366 |
| 456 | Ga0395901_0050870 | 3300038443 | Bacteria | 4305 |
| 457 | Ga0395901_0066545 | 3300038443 | Bacteria | 3753 |
| 458 | Ga0395901_0068828 | 3300038443 | Bacteria | 3687 |
| 459 | Ga0395901_0083155 | 3300038443 | Bacteria | 3346 |
| 460 | Ga0395901_0102320 | 3300038443 | Bacteria | 3006 |
| 461 | Ga0395901_0110112 | 3300038443 | Bacteria | 2891 |
| 462 | Ga0395901_0113605 | 3300038443 | Bacteria | 2844 |
| 463 | Ga0395901_0168039 | 3300038443 | Unclassified | 2302 |
| 464 | Ga0395901_0289335 | 3300038443 | Bacteria | 1701 |
| 465 | Ga0395901_0378480 | 3300038443 | Bacteria | 1457 |
| 466 | Ga0395901_0524148 | 3300038443 | Unclassified | 1203 |
| 467 | Ga0395901_0778726 | 3300038443 | Bacteria | 947 |
| 468 | Ga0436365_1366736 | 3300039437 | Bacteria | 5865 |
| 469 | Ga0436363_0352713 | 3300039450 | Bacteria | 1108 |
| 470 | Ga0451789_0817946 | 3300041443 | Unclassified | 1101 |
| 471 | Ga0451853_0214319 | 3300041512 | Bacteria | 2020 |
| 472 | Ga0450915_000372 | 3300042119 | Unclassified | 1551 |
| 473 | Ga0439460_0107586 | 3300042461 | Bacteria | 902 |
| 474 | Ga0466969_0154507 | 3300044656 | Bacteria | 1056 |
| 475 | Ga0466965_0028275 | 3300044683 | Unclassified | 2724 |
| 476 | Ga0466966_0022898 | 3300044684 | Bacteria | 4093 |
| 477 | Ga0466961_0011643 | 3300044693 | Bacteria | 5623 |
| 478 | Ga0466963_0006766 | 3300044694 | Bacteria | 6813 |
| 479 | Ga0466963_0019362 | 3300044694 | Bacteria | 4267 |
| 480 | Ga0466963_0030035 | 3300044694 | Bacteria | 3503 |
| 481 | Ga0466963_0063633 | 3300044694 | Bacteria | 2469 |
| 482 | Ga0466963_0362814 | 3300044694 | Bacteria | 1020 |
| 483 | Ga0466964_0003712 | 3300044706 | Bacteria | 5594 |
| 484 | Ga0466964_0014037 | 3300044706 | Bacteria | 3043 |
| 485 | Ga0466964_0014543 | 3300044706 | Bacteria | 2992 |
| 486 | Ga0466971_0021017 | 3300044719 | Unclassified | 2902 |
| 487 | Ga0466971_0068868 | 3300044719 | Unclassified | 1605 |
| 488 | Ga0466968_0051937 | 3300044735 | Unclassified | 1752 |
| 489 | Ga0466970_0039114 | 3300044765 | Bacteria | 2517 |
| 490 | Ga0466957_0070911 | 3300044842 | Bacteria | 2154 |
| 491 | Ga0466957_0247940 | 3300044842 | Bacteria | 1183 |
| 492 | Ga0466957_0397278 | 3300044842 | Bacteria | 942 |
| 493 | Ga0466960_0011535 | 3300044901 | Bacteria | 3701 |
| 494 | Ga0466960_0315311 | 3300044901 | Unclassified | 884 |
| 495 | Ga0466958_0005848 | 3300045836 | Bacteria | 6658 |
| 496 | Ga0466958_0067010 | 3300045836 | Bacteria | 2192 |
| 497 | Ga0466958_0087697 | 3300045836 | Unclassified | 1921 |
| 498 | Ga0466958_0114103 | 3300045836 | Bacteria | 1688 |
| 499 | Ga0466967_0032470 | 3300045976 | Bacteria | 4409 |
| 500 | Ga0466967_0042357 | 3300045976 | Bacteria | 3933 |
| 501 | Ga0466967_0097424 | 3300045976 | Bacteria | 2684 |
| 502 | Ga0466967_0130759 | 3300045976 | Bacteria | 2330 |
| 503 | Ga0466967_0134323 | 3300045976 | Bacteria | 2300 |
| 504 | Ga0466967_0179777 | 3300045976 | Bacteria | 1995 |
| 505 | Ga0466967_0207925 | 3300045976 | Bacteria | 1855 |
| 506 | Ga0466967_0468241 | 3300045976 | Bacteria | 1233 |
| 507 | Ga0466967_0531487 | 3300045976 | Bacteria | 1156 |
| 508 | Ga0495592_0001615 | 3300046454 | Bacteria | 15792 |
| 509 | Ga0495592_0183000 | 3300046454 | Bacteria | 1426 |
| 510 | Ga0495603_0101652 | 3300046455 | Bacteria | 1678 |
| 511 | Ga0495629_0057817 | 3300046459 | Bacteria | 2711 |
| 512 | Ga0495629_0106578 | 3300046459 | Bacteria | 1955 |
| 513 | Ga0495641_0021226 | 3300046461 | Bacteria | 3271 |
| 514 | Ga0495641_0047995 | 3300046461 | Bacteria | 1959 |
| 515 | Ga0495651_0003563 | 3300046462 | Bacteria | 11940 |
| 516 | Ga0495582_0100282 | 3300046473 | Unclassified | 1621 |
| 517 | Ga0495664_0144231 | 3300046477 | Bacteria | 1444 |
| 518 | Ga0495608_0013925 | 3300046511 | Bacteria | 5581 |
| 519 | Ga0495628_0045963 | 3300046516 | Bacteria | 3469 |
| 520 | Ga0495628_0380375 | 3300046516 | Bacteria | 1034 |
| 521 | Ga0495630_0000446 | 3300046517 | Bacteria | 31187 |
| 522 | Ga0495630_0005371 | 3300046517 | Bacteria | 9039 |
| 523 | Ga0495630_0024825 | 3300046517 | Bacteria | 4431 |
| 524 | Ga0495663_0017870 | 3300046525 | Bacteria | 2016 |
| 525 | Ga0495642_0060880 | 3300046528 | Bacteria | 1566 |
| 526 | Ga0495652_0030665 | 3300046529 | Bacteria | 4713 |
| 527 | Ga0495640_0031403 | 3300046533 | Bacteria | 3790 |
| 528 | Ga0495640_0040923 | 3300046533 | Bacteria | 3241 |
| 529 | Ga0495586_0047458 | 3300046535 | Bacteria | 2319 |
| 530 | Ga0495587_0024922 | 3300046536 | Bacteria | 3661 |
| 531 | Ga0495667_0036684 | 3300046559 | Bacteria | 3270 |
| 532 | Ga0495667_0186105 | 3300046559 | Bacteria | 1332 |
| 533 | Ga0495656_0069184 | 3300046615 | Unclassified | 1563 |
| 534 | Ga0495668_0165107 | 3300046616 | Unclassified | 1213 |
| 535 | Ga0495634_0058069 | 3300046642 | Bacteria | 2580 |
| 536 | Ga0495635_0064846 | 3300046663 | Bacteria | 2507 |
| 537 | Ga0495659_0032977 | 3300046664 | Unclassified | 1816 |
| 538 | Ga0495659_0100233 | 3300046664 | Unclassified | 1121 |
| 539 | Ga0495657_0035356 | 3300046675 | Bacteria | 3463 |
| 540 | Ga0495657_0219841 | 3300046675 | Bacteria | 1152 |
| 541 | Ga0495599_0000409 | 3300046678 | Bacteria | 24585 |
| 542 | Ga0495599_0036310 | 3300046678 | Bacteria | 3094 |
| 543 | Ga0495599_0071284 | 3300046678 | Bacteria | 2169 |
| 544 | Ga0495646_0001458 | 3300046680 | Bacteria | 14066 |
| 545 | Ga0495647_0029920 | 3300046681 | Unclassified | 2017 |
| 546 | Ga0495658_0009957 | 3300046683 | Bacteria | 4742 |
| 547 | Ga0495613_0009537 | 3300046689 | Bacteria | 7207 |
| 548 | Ga0495613_0014770 | 3300046689 | Bacteria | 5796 |
| 549 | Ga0495613_0037654 | 3300046689 | Bacteria | 3586 |
| 550 | Ga0495624_0004755 | 3300046690 | Bacteria | 9879 |
| 551 | Ga0495624_0017487 | 3300046690 | Bacteria | 4815 |
| 552 | Ga0495624_0041244 | 3300046690 | Bacteria | 2953 |
| 553 | Ga0495581_0009890 | 3300047315 | Bacteria | 5517 |
| 554 | Ga0495581_0021889 | 3300047315 | Bacteria | 3706 |
| 555 | Ga0495581_0085210 | 3300047315 | Bacteria | 1831 |
| 556 | Ga0495604_0054484 | 3300047317 | Bacteria | 3085 |
| 557 | Ga0495604_0187802 | 3300047317 | Bacteria | 1442 |
| 558 | Ga0495636_0125470 | 3300047318 | Unclassified | 1139 |
| 559 | Ga0495674_0001283 | 3300047319 | Bacteria | 24435 |
| 560 | Ga0495674_0041788 | 3300047319 | Unclassified | 4093 |
| 561 | Ga0495674_0043792 | 3300047319 | Bacteria | 3982 |
| 562 | Ga0495674_0060796 | 3300047319 | Bacteria | 3295 |
| 563 | Ga0495674_0288208 | 3300047319 | Bacteria | 1343 |
| 564 | Ga0495676_0125044 | 3300047321 | Bacteria | 1865 |
| 565 | Ga0495680_0003455 | 3300047322 | Bacteria | 15561 |
| 566 | Ga0495680_0015166 | 3300047322 | Bacteria | 6654 |
| 567 | Ga0495675_0097688 | 3300047444 | Bacteria | 1840 |
| 568 | Ga0495685_060767 | 3300047447 | Unclassified | 1274 |
| 569 | Ga0495684_0412560 | 3300047471 | Bacteria | 946 |
| 570 | Ga0495602_0071315 | 3300048088 | Bacteria | 2967 |
| 571 | Ga0496100_0004702 | 3300048903 | Bacteria | 7277 |
| 572 | Ga0496100_0007119 | 3300048903 | Bacteria | 6143 |
| 573 | Ga0496100_0104701 | 3300048903 | Bacteria | 1955 |
| 574 | Ga0496101_0004835 | 3300048904 | Bacteria | 8544 |
| 575 | Ga0496101_0026961 | 3300048904 | Bacteria | 3996 |
| 576 | Ga0496101_0028419 | 3300048904 | Bacteria | 3903 |
| 577 | Ga0496101_0039546 | 3300048904 | Bacteria | 3355 |
| 578 | Ga0496101_0066511 | 3300048904 | Bacteria | 2629 |
| 579 | Ga0496101_0083493 | 3300048904 | Bacteria | 2365 |
| 580 | Ga0496101_0104533 | 3300048904 | Bacteria | 2124 |
| 581 | Ga0496101_0144058 | 3300048904 | Bacteria | 1818 |
| 582 | Ga0496101_0194878 | 3300048904 | Bacteria | 1565 |
| 583 | Ga0496101_0258656 | 3300048904 | Bacteria | 1357 |
| 584 | Ga0496102_0008227 | 3300048905 | Bacteria | 8928 |
| 585 | Ga0496102_0012168 | 3300048905 | Bacteria | 7439 |
| 586 | Ga0496102_0030905 | 3300048905 | Bacteria | 4797 |
| 587 | Ga0496102_0099091 | 3300048905 | Bacteria | 2705 |
| 588 | Ga0496102_0239014 | 3300048905 | Bacteria | 1713 |
| 589 | Ga0496102_0274915 | 3300048905 | Bacteria | 1588 |
| 590 | Ga0496102_0540313 | 3300048905 | Bacteria | 1088 |
| 591 | Ga0496103_0014324 | 3300048906 | Bacteria | 4709 |
| 592 | Ga0496103_0197690 | 3300048906 | Bacteria | 1293 |
| 593 | Ga0496103_0234708 | 3300048906 | Bacteria | 1180 |
| 594 | Ga0496104_0021815 | 3300048907 | Bacteria | 5882 |
| 595 | Ga0496104_0029106 | 3300048907 | Bacteria | 5122 |
| 596 | Ga0496104_0068638 | 3300048907 | Bacteria | 3368 |
| 597 | Ga0496104_0093735 | 3300048907 | Bacteria | 2872 |
| 598 | Ga0496104_0103615 | 3300048907 | Bacteria | 2726 |
| 599 | Ga0496105_0002803 | 3300048908 | Bacteria | 12747 |
| 600 | Ga0496105_0004217 | 3300048908 | Bacteria | 10801 |
| 601 | Ga0496105_0008689 | 3300048908 | Bacteria | 7903 |
| 602 | Ga0496105_0035965 | 3300048908 | Bacteria | 4078 |
| 603 | Ga0496105_0161084 | 3300048908 | Unclassified | 1842 |
| 604 | Ga0496105_0254703 | 3300048908 | Unclassified | 1421 |
| 605 | Ga0496106_0032792 | 3300048909 | Bacteria | 3873 |
| 606 | Ga0496106_0051548 | 3300048909 | Bacteria | 3103 |
| 607 | Ga0496106_0151013 | 3300048909 | Bacteria | 1832 |
| 608 | Ga0496106_0157569 | 3300048909 | Bacteria | 1794 |
| 609 | Ga0496106_0227785 | 3300048909 | Unclassified | 1487 |
| 610 | Ga0496107_0005064 | 3300048910 | Bacteria | 8981 |
| 611 | Ga0496107_0471636 | 3300048910 | Unclassified | 932 |
| 612 | Ga0496108_0002409 | 3300048911 | Bacteria | 14948 |
| 613 | Ga0496108_0017127 | 3300048911 | Bacteria | 5926 |
| 614 | Ga0496108_0020827 | 3300048911 | Bacteria | 5392 |
| 615 | Ga0496108_0025220 | 3300048911 | Bacteria | 4899 |
| 616 | Ga0496108_0043664 | 3300048911 | Bacteria | 3744 |
| 617 | Ga0496108_0065303 | 3300048911 | Bacteria | 3068 |
| 618 | Ga0496108_0160260 | 3300048911 | Bacteria | 1944 |
| 619 | Ga0496108_0178251 | 3300048911 | Bacteria | 1840 |
| 620 | Ga0496108_0204911 | 3300048911 | Bacteria | 1712 |
| 621 | Ga0496108_0273963 | 3300048911 | Unclassified | 1469 |
| 622 | Ga0496109_0001756 | 3300048912 | Bacteria | 18034 |
| 623 | Ga0496109_0002119 | 3300048912 | Bacteria | 16507 |
| 624 | Ga0496109_0035497 | 3300048912 | Bacteria | 4498 |
| 625 | Ga0496109_0039105 | 3300048912 | Bacteria | 4292 |
| 626 | Ga0496109_0090589 | 3300048912 | Bacteria | 2828 |
| 627 | Ga0496109_0102986 | 3300048912 | Bacteria | 2649 |
| 628 | Ga0496109_0293660 | 3300048912 | Unclassified | 1532 |
| 629 | Ga0496109_0374481 | 3300048912 | Bacteria | 1345 |
| 630 | Ga0496109_0627206 | 3300048912 | Bacteria | 1011 |
| 631 | Ga0496110_0007078 | 3300048913 | Bacteria | 8927 |
| 632 | Ga0496110_0024522 | 3300048913 | Bacteria | 5141 |
| 633 | Ga0496110_0041055 | 3300048913 | Bacteria | 4035 |
| 634 | Ga0496110_0054112 | 3300048913 | Bacteria | 3530 |
| 635 | Ga0496110_0087750 | 3300048913 | Bacteria | 2778 |
| 636 | Ga0496110_0142117 | 3300048913 | Bacteria | 2170 |
| 637 | Ga0496110_0154303 | 3300048913 | Bacteria | 2080 |
| 638 | Ga0496110_0306752 | 3300048913 | Bacteria | 1446 |
| 639 | Ga0496110_0482851 | 3300048913 | Bacteria | 1129 |
| 640 | Ga0496111_0001490 | 3300048914 | Bacteria | 13408 |
| 641 | Ga0496111_0040335 | 3300048914 | Bacteria | 3349 |
| 642 | Ga0496111_0076256 | 3300048914 | Bacteria | 2444 |
| 643 | Ga0496111_0475786 | 3300048914 | Bacteria | 921 |
| 644 | Ga0496112_0002873 | 3300048915 | Bacteria | 14004 |
| 645 | Ga0496112_0006445 | 3300048915 | Bacteria | 10304 |
| 646 | Ga0496112_0028533 | 3300048915 | Bacteria | 5387 |
| 647 | Ga0496112_0135458 | 3300048915 | Bacteria | 2433 |
| 648 | Ga0496112_0161234 | 3300048915 | Bacteria | 2209 |
| 649 | Ga0496112_0224473 | 3300048915 | Bacteria | 1834 |
| 650 | Ga0496113_0001615 | 3300048916 | Bacteria | 12684 |
| 651 | Ga0496113_0098806 | 3300048916 | Bacteria | 2260 |
| 652 | Ga0496113_0154413 | 3300048916 | Bacteria | 1812 |
| 653 | Ga0496113_0361241 | 3300048916 | Bacteria | 1165 |
| 654 | Ga0496114_0013374 | 3300048917 | Bacteria | 6579 |
| 655 | Ga0496114_0078330 | 3300048917 | Bacteria | 2788 |
| 656 | Ga0496114_0080289 | 3300048917 | Bacteria | 2754 |
| 657 | Ga0496114_0147324 | 3300048917 | Bacteria | 2041 |
| 658 | Ga0496115_0001171 | 3300048918 | Bacteria | 18799 |
| 659 | Ga0496115_0002222 | 3300048918 | Bacteria | 13918 |
| 660 | Ga0496115_0006963 | 3300048918 | Bacteria | 8304 |
| 661 | Ga0501031_0006921 | 3300049568 | Bacteria | 7401 |
| 662 | Ga0501031_0034473 | 3300049568 | Bacteria | 3303 |
| 663 | Ga0501032_0020649 | 3300049569 | Bacteria | 4585 |
| 664 | Ga0501033_0002985 | 3300049570 | Bacteria | 14121 |
| 665 | Ga0501033_0109482 | 3300049570 | Bacteria | 2011 |
| 666 | Ga0501034_0056302 | 3300049571 | Bacteria | 3957 |
| 667 | Ga0501036_0003723 | 3300049572 | Bacteria | 12224 |
| 668 | Ga0501036_0494361 | 3300049572 | Bacteria | 1018 |
| 669 | Ga0501037_0031661 | 3300049573 | Bacteria | 3905 |
| 670 | Ga0501037_0201926 | 3300049573 | Bacteria | 1404 |
| 671 | Ga0501038_0004950 | 3300049574 | Bacteria | 12372 |
| 672 | Ga0501038_0013862 | 3300049574 | Bacteria | 7345 |
| 673 | Ga0501039_0001400 | 3300049575 | Bacteria | 17721 |
| 674 | Ga0501039_0358867 | 3300049575 | Unclassified | 1145 |
| 675 | Ga0501040_0002464 | 3300049576 | Bacteria | 11922 |
| 676 | Ga0501041_0001460 | 3300049577 | Bacteria | 13063 |
| 677 | Ga0501042_0001860 | 3300049578 | Bacteria | 12657 |
| 678 | Ga0501042_0002873 | 3300049578 | Bacteria | 10682 |
| 679 | Ga0501043_0012993 | 3300049579 | Bacteria | 6508 |
| 680 | Ga0501043_0166787 | 3300049579 | Bacteria | 1719 |
| 681 | Ga0501046_0002389 | 3300049580 | Bacteria | 17641 |
| 682 | Ga0501046_0142414 | 3300049580 | Bacteria | 1813 |
| 683 | Ga0501047_0035487 | 3300049581 | Bacteria | 4818 |
| 684 | Ga0501048_0001476 | 3300049582 | Bacteria | 17837 |
| 685 | Ga0501068_0001204 | 3300049584 | Bacteria | 13757 |
| 686 | Ga0501068_0053917 | 3300049584 | Bacteria | 2435 |
| 687 | Ga0501069_0000931 | 3300049585 | Bacteria | 13956 |
| 688 | Ga0501069_0005028 | 3300049585 | Bacteria | 6856 |
| 689 | Ga0501069_0028725 | 3300049585 | Bacteria | 3050 |
| 690 | Ga0501069_0122331 | 3300049585 | Bacteria | 1487 |
| 691 | Ga0501070_0011167 | 3300049586 | Bacteria | 7581 |
| 692 | Ga0501070_0080909 | 3300049586 | Bacteria | 2687 |
| 693 | Ga0501070_0334819 | 3300049586 | Unclassified | 1230 |
| 694 | Ga0501071_0018076 | 3300049587 | Bacteria | 4874 |
| 695 | Ga0501071_0126143 | 3300049587 | Unclassified | 1900 |
| 696 | Ga0501072_0005921 | 3300049588 | Bacteria | 9314 |
| 697 | Ga0501073_0001168 | 3300049589 | Bacteria | 19173 |
| 698 | Ga0501073_0010357 | 3300049589 | Bacteria | 6840 |
| 699 | Ga0501074_0000243 | 3300049590 | Bacteria | 30620 |
| 700 | Ga0501074_0056580 | 3300049590 | Bacteria | 2827 |
| 701 | Ga0501075_0008137 | 3300049591 | Bacteria | 7296 |
| 702 | Ga0501075_0247814 | 3300049591 | Unclassified | 1358 |
| 703 | Ga0501076_0015079 | 3300049592 | Bacteria | 5835 |
| 704 | Ga0501077_0002697 | 3300049593 | Bacteria | 10643 |
| 705 | Ga0501079_0025524 | 3300049741 | Bacteria | 4530 |
| 706 | Ga0501079_0097462 | 3300049741 | Bacteria | 2280 |
| 707 | Ga0501079_0138226 | 3300049741 | Unclassified | 1897 |
| 708 | Ga0501080_0007270 | 3300049742 | Bacteria | 9991 |
| 709 | Ga0501081_0002699 | 3300049743 | Bacteria | 11222 |
| 710 | Ga0501081_0067737 | 3300049743 | Bacteria | 2484 |
| 711 | Ga0501081_0147247 | 3300049743 | Bacteria | 1690 |
| 712 | Ga0501083_0001567 | 3300049744 | Bacteria | 15623 |
| 713 | Ga0501083_0121786 | 3300049744 | Bacteria | 1711 |
| 714 | Ga0501035_0008585 | 3300049822 | Bacteria | 9510 |
| 715 | Ga0501035_0092779 | 3300049822 | Bacteria | 2656 |
| 716 | Ga0501044_0021154 | 3300049823 | Bacteria | 6946 |
| 717 | Ga0501044_0143645 | 3300049823 | Bacteria | 2374 |
| 718 | Ga0501044_0418201 | 3300049823 | Bacteria | 1251 |
| 719 | Ga0501045_0012174 | 3300049824 | Bacteria | 6056 |
| 720 | nmdc:mga06z11_159267_c1 | 3300050494 | Unclassified | 1289 |
| 721 | nmdc:mga05p37_305275_c1 | 3300050507 | Bacteria | 1889 |
| 722 | nmdc:mga05p37_54375_c1 | 3300050507 | Bacteria | 4925 |
| 723 | nmdc:mga05p37_6829_c1 | 3300050507 | Bacteria | 13450 |
| 724 | nmdc:mga05p37_74224_c1 | 3300050507 | Bacteria | 4186 |
| 725 | nmdc:mga05p37_80015_c1 | 3300050507 | Bacteria | 4024 |
| 726 | nmdc:mga09592_139485_c1 | 3300050508 | Unclassified | 2089 |
| 727 | nmdc:mga09592_163952_c1 | 3300050508 | Bacteria | 1920 |
| 728 | nmdc:mga09592_353985_c1 | 3300050508 | Bacteria | 1271 |
| 729 | nmdc:mga0qj67_176052_c1 | 3300050509 | Bacteria | 1737 |
| 730 | nmdc:mga06r32_27619_c1 | 3300050510 | Bacteria | 5304 |
| 731 | nmdc:mga06r32_314917_c1 | 3300050510 | Bacteria | 1550 |
| 732 | nmdc:mga06r32_660536_c1 | 3300050510 | Unclassified | 1013 |
| 733 | nmdc:mga08y16_191791_c1 | 3300050511 | Bacteria | 2119 |
| 734 | nmdc:mga08y16_194289_c1 | 3300050511 | Bacteria | 2104 |
| 735 | nmdc:mga08y16_248527_c1 | 3300050511 | Bacteria | 1838 |
| 736 | nmdc:mga08y16_90961_c1 | 3300050511 | Bacteria | 3181 |
| 737 | nmdc:mga0n895_220536_c1 | 3300050512 | Bacteria | 1925 |
| 738 | nmdc:mga0n895_222159_c1 | 3300050512 | Bacteria | 1918 |
| 739 | nmdc:mga0n895_278983_c1 | 3300050512 | Bacteria | 1695 |
| 740 | nmdc:mga0n895_29757_c1 | 3300050512 | Bacteria | 5212 |
| 741 | nmdc:mga0n895_318787_c1 | 3300050512 | Unclassified | 1575 |
| 742 | nmdc:mga0n895_82303_c1 | 3300050512 | Bacteria | 3209 |
| 743 | nmdc:mga0rr50_612_c1 | 3300050513 | Bacteria | 19119 |
| 744 | nmdc:mga0rr50_84726_c1 | 3300050513 | Bacteria | 2455 |
| 745 | nmdc:mga08x19_193068_c1 | 3300050514 | Bacteria | 1394 |
| 746 | nmdc:mga08x19_27107_c1 | 3300050514 | Bacteria | 3582 |
| 747 | nmdc:mga08x19_7970_c1 | 3300050514 | Bacteria | 6294 |
| 748 | nmdc:mga0a205_204950_c1 | 3300050515 | Unclassified | 1862 |
| 749 | nmdc:mga0a205_412408_c1 | 3300050515 | Bacteria | 1214 |
| 750 | nmdc:mga0a205_93361_c1 | 3300050515 | Bacteria | 2908 |
| 751 | Ga0495612_0026820 | 3300053078 | Bacteria | 2315 |
| 752 | Ga0495595_0012219 | 3300053084 | Bacteria | 3604 |
| 753 | Ga0495619_0075360 | 3300053085 | Bacteria | 2264 |
| 754 | Ga0501084_0003039 | 3300054114 | Bacteria | 13595 |
| 755 | Ga0501084_0163054 | 3300054114 | Bacteria | 1880 |
| 756 | Ga0501082_0004555 | 3300060353 | Bacteria | 12098 |
| 757 | Ga0501082_0049202 | 3300060353 | Bacteria | 3635 |
| 758 | Ga0466962_0004003 | 3300061719 | Bacteria | 7055 |
| 759 | Ga0530510_0002862 | 3300061734 | Bacteria | 11865 |
| 760 | Ga0530510_0015456 | 3300061734 | Bacteria | 5394 |
| 761 | Ga0075435_100087444 | |||
| 762 | rootL2_10214072 | |||
| 763 | JGI25407J50210_10000387 | |||
| 764 | JGI25407J50210_10000559 | |||
| 765 | Ga0070658_10015301 | |||
| 766 | Ga0070658_10254856 | |||
| 767 | Ga0070658_10566055 | |||
| 768 | Ga0070683_100024600 | |||
| 769 | Ga0070683_100024806 | |||
| 770 | Ga0070683_100058978 | |||
| 771 | Ga0070683_100080978 | |||
| 772 | Ga0070683_100418375 | |||
| 773 | Ga0070690_100042636 | |||
| 774 | Ga0068869_100160808 | |||
| 775 | Ga0070666_10088923 | |||
| 776 | Ga0070680_100042145 | |||
| 777 | Ga0070680_100058634 | |||
| 778 | Ga0070680_100274218 | |||
| 779 | Ga0070680_100309927 | |||
| 780 | Ga0070682_100051240 | |||
| 781 | Ga0070682_100105346 | |||
| 782 | Ga0070682_100448759 | |||
| 783 | Ga0068868_100110722 | |||
| 784 | Ga0068868_100184411 | |||
| 785 | Ga0070660_100088255 | |||
| 786 | Ga0070660_100248705 | |||
| 787 | Ga0070661_100034256 | |||
| 788 | Ga0070692_10065398 | |||
| 789 | Ga0070675_100437205 | |||
| 790 | Ga0070671_100091848 | |||
| 791 | Ga0070674_100006239 | |||
| 792 | Ga0070673_100133190 | |||
| 793 | Ga0070688_100010593 | |||
| 794 | Ga0070659_100308028 | |||
| 795 | Ga0070659_100670613 | |||
| 796 | Ga0070667_100050683 | |||
| 797 | Ga0070714_100058042 | |||
| 798 | Ga0070714_100194932 | |||
| 799 | Ga0070714_100249266 | |||
| 800 | Ga0070713_100030294 | |||
| 801 | Ga0070713_100156752 | |||
| 802 | Ga0070713_100254796 | |||
| 803 | Ga0070710_10033964 | |||
| 804 | Ga0070710_10073048 | |||
| 805 | Ga0070701_10003855 | |||
| 806 | Ga0070711_100127111 | |||
| 807 | Ga0070700_100001090 | |||
| 808 | Ga0070700_100139876 | |||
| 809 | Ga0070700_100338124 | |||
| 810 | Ga0070694_100014123 | |||
| 811 | Ga0070694_100100084 | |||
| 812 | Ga0070708_100021491 | |||
| 813 | Ga0070708_100043894 | |||
| 814 | Ga0070708_100162508 | |||
| 815 | Ga0070708_100184740 | |||
| 816 | Ga0070708_100769054 | |||
| 817 | Ga0070663_100052734 | |||
| 818 | Ga0070678_100007139 | |||
| 819 | Ga0070678_100263772 | |||
| 820 | Ga0070678_100369051 | |||
| 821 | Ga0070662_100189128 | |||
| 822 | Ga0070662_100411664 | |||
| 823 | Ga0070681_10033589 | |||
| 824 | Ga0068867_100021482 | |||
| 825 | Ga0070685_10143880 | |||
| 826 | Ga0070706_100030939 | |||
| 827 | Ga0070706_100090103 | |||
| 828 | Ga0070706_100099260 | |||
| 829 | Ga0070706_100122819 | |||
| 830 | Ga0070706_100317892 | |||
| 831 | Ga0070707_100019302 | |||
| 832 | Ga0070707_100135613 | |||
| 833 | Ga0070707_100228111 | |||
| 834 | Ga0070707_100293405 | |||
| 835 | Ga0070698_100017072 | |||
| 836 | Ga0070698_100021815 | |||
| 837 | Ga0070698_100295974 | |||
| 838 | Ga0070699_100002193 | |||
| 839 | Ga0070699_100016866 | |||
| 840 | Ga0070699_100452852 | |||
| 841 | Ga0070679_100040701 | |||
| 842 | Ga0070679_100139081 | |||
| 843 | Ga0070679_100139427 | |||
| 844 | Ga0070679_100177203 | |||
| 845 | Ga0070679_100194682 | |||
| 846 | Ga0070684_100029344 | |||
| 847 | Ga0070684_100085362 | |||
| 848 | Ga0070684_100131758 | |||
| 849 | Ga0070684_100159227 | |||
| 850 | Ga0070684_100238068 | |||
| 851 | Ga0070697_100251571 | |||
| 852 | Ga0070672_100291698 | |||
| 853 | Ga0070686_100002328 | |||
| 854 | Ga0070695_100000347 | |||
| 855 | Ga0070696_100020791 | |||
| 856 | Ga0070696_100036441 | |||
| 857 | Ga0070693_100047655 | |||
| 858 | Ga0070693_100090653 | |||
| 859 | Ga0070704_100364394 | |||
| 860 | Ga0068855_100093932 | |||
| 861 | Ga0068855_100117959 | |||
| 862 | Ga0068855_100169479 | |||
| 863 | Ga0068855_100344850 | |||
| 864 | Ga0068857_100041764 | |||
| 865 | Ga0068856_100030033 | |||
| 866 | Ga0068856_100159533 | |||
| 867 | Ga0070702_100056474 | |||
| 868 | Ga0070702_100144576 | |||
| 869 | Ga0068852_100102291 | |||
| 870 | Ga0068859_100374277 | |||
| 871 | Ga0068866_10010110 | |||
| 872 | Ga0068861_100102678 | |||
| 873 | Ga0068861_100251037 | |||
| 874 | Ga0068851_10164319 | |||
| 875 | Ga0068863_100186800 | |||
| 876 | Ga0068860_100400960 | |||
| 877 | Ga0068860_100580168 | |||
| 878 | Ga0081455_10004967 | |||
| 879 | Ga0081455_10005435 | |||
| 880 | Ga0081455_10024080 | |||
| 881 | Ga0081455_10046662 | |||
| 882 | Ga0081455_10091958 | |||
| 883 | Ga0081455_10350926 | |||
| 884 | Ga0081455_10350927 | |||
| 885 | Ga0081538_10000155 | |||
| 886 | Ga0081538_10000375 | |||
| 887 | Ga0081538_10002367 | |||
| 888 | Ga0081538_10017416 | |||
| 889 | Ga0081540_1001919 | |||
| 890 | Ga0081540_1005495 | |||
| 891 | Ga0081540_1008818 | |||
| 892 | Ga0081540_1020377 | |||
| 893 | Ga0081539_10004025 | |||
| 894 | Ga0081539_10009548 | |||
| 895 | Ga0070717_10060068 | |||
| 896 | Ga0070717_10106269 | |||
| 897 | Ga0070717_10393313 | |||
| 898 | Ga0070717_10412020 | |||
| 899 | Ga0070717_10635349 | |||
| 900 | Ga0075365_10002614 | |||
| 901 | Ga0075363_100224045 | |||
| 902 | Ga0075432_10052476 | |||
| 903 | Ga0070715_10034880 | |||
| 904 | Ga0070712_100022353 | |||
| 905 | Ga0070712_100026223 | |||
| 906 | Ga0070712_100088766 | |||
| 907 | Ga0070712_100096547 | |||
| 908 | Ga0070712_100329256 | |||
| 909 | Ga0075367_10134345 | |||
| 910 | Ga0097621_100039454 | |||
| 911 | Ga0068871_100005174 | |||
| 912 | Ga0075428_100125359 | |||
| 913 | Ga0075428_100203249 | |||
| 914 | Ga0075428_100240338 | |||
| 915 | Ga0075428_100436456 | |||
| 916 | Ga0075430_100007871 | |||
| 917 | Ga0075431_100044149 | |||
| 918 | Ga0075431_100192770 | |||
| 919 | Ga0075431_100542245 | |||
| 920 | Ga0075433_10004025 | |||
| 921 | Ga0075433_10194867 | |||
| 922 | Ga0075433_10233147 | |||
| 923 | Ga0075433_10243788 | |||
| 924 | Ga0075434_100010911 | |||
| 925 | Ga0075434_100093427 | |||
| 926 | Ga0075434_100129947 | |||
| 927 | Ga0075434_100176337 | |||
| 928 | Ga0075434_100645273 | |||
| 929 | Ga0075429_100089705 | |||
| 930 | Ga0075429_100187223 | |||
| 931 | Ga0068865_100013004 | |||
| 932 | Ga0075436_100011596 | |||
| 933 | Ga0075436_100025247 | |||
| 934 | Ga0075436_100047434 | |||
| 935 | Ga0075436_100145490 | |||
| 936 | Ga0075436_100179414 | |||
| 937 | Ga0097620_100374264 | |||
| 938 | Ga0075435_100001974 | |||
| 939 | Ga0075435_100092862 | |||
| 940 | Ga0105240_10022924 | |||
| 941 | Ga0105240_10174112 | |||
| 942 | Ga0105240_10763066 | |||
| 943 | Ga0111539_10042472 | |||
| 944 | Ga0111539_10122606 | |||
| 945 | Ga0111539_10201276 | |||
| 946 | Ga0111539_10205155 | |||
| 947 | Ga0111539_10285701 | |||
| 948 | Ga0105245_10029749 | |||
| 949 | Ga0105245_10038688 | |||
| 950 | Ga0105245_10075164 | |||
| 951 | Ga0105245_10095654 | |||
| 952 | Ga0105245_10110359 | |||
| 953 | Ga0105245_10116021 | |||
| 954 | Ga0105247_10026467 | |||
| 955 | Ga0114129_10020206 | |||
| 956 | Ga0114129_10054080 | |||
| 957 | Ga0114129_10080522 | |||
| 958 | Ga0114129_10203530 | |||
| 959 | Ga0114129_10204150 | |||
| 960 | Ga0105243_10006875 | |||
| 961 | Ga0105243_10043049 | |||
| 962 | Ga0105243_10059071 | |||
| 963 | Ga0105243_10107452 | |||
| 964 | Ga0105243_10291195 | |||
| 965 | Ga0105241_10025314 | |||
| 966 | Ga0105241_10047792 | |||
| 967 | Ga0105241_10143812 | |||
| 968 | Ga0105242_10222761 | |||
| 969 | Ga0105242_10246358 | |||
| 970 | Ga0105242_10257616 | |||
| 971 | Ga0105242_10269768 | |||
| 972 | Ga0105242_10341254 | |||
| 973 | Ga0105248_10183206 | |||
| 974 | Ga0105248_10201259 | |||
| 975 | Ga0105237_10044800 | |||
| 976 | Ga0105238_10047405 | |||
| 977 | Ga0105238_10756005 | |||
| 978 | Ga0105249_10021565 | |||
| 979 | Ga0105249_10234035 | |||
| 980 | Ga0105249_10375209 | |||
| 981 | Ga0105239_10009163 | |||
| 982 | Ga0105239_10111675 | |||
| 983 | Ga0105239_10201829 | |||
| 984 | Ga0105239_10254563 | |||
| 985 | Ga0105239_10526516 | |||
| 986 | Ga0105239_10677822 | |||
| 987 | Ga0105246_10058718 | |||
| 988 | Ga0157369_10070710 | |||
| 989 | Ga0157374_10005200 | |||
| 990 | Ga0157374_10054074 | |||
| 991 | Ga0157378_10010428 | |||
| 992 | Ga0157378_10083567 | |||
| 993 | Ga0163162_10059315 | |||
| 994 | Ga0157372_10037263 | |||
| 995 | Ga0157372_10094431 | |||
| 996 | Ga0157372_10291455 | |||
| 997 | Ga0157375_10032292 | |||
| 998 | Ga0157375_10036342 | |||
| 999 | Ga0157375_10293359 | |||
| 1000 | Ga0157375_10379274 | |||
| 1001 | Ga0163163_10201571 | |||
| 1002 | Ga0182008_10111834 | |||
| 1003 | Ga0157377_10023173 | |||
| 1004 | Ga0157376_10232865 | |||
| 1005 | Ga0163161_10057536 | |||
| 1006 | Ga0197907_10120316 | |||
| 1007 | Ga0206356_10056051 | |||
| 1008 | Ga0206356_10307083 | |||
| 1009 | Ga0206356_11421914 | |||
| 1010 | Ga0206354_10292101 | |||
| 1011 | Ga0206354_10996903 | |||
| 1012 | Ga0206353_10161134 | |||
| 1013 | Ga0206353_10208751 | |||
| 1014 | Ga0213876_10100801 | |||
| 1015 | Ga0213876_10149134 | |||
| 1016 | Ga0207653_10022925 | |||
| 1017 | Ga0207692_10012017 | |||
| 1018 | Ga0207692_10042099 | |||
| 1019 | Ga0207692_10086535 | |||
| 1020 | Ga0207642_10019002 | |||
| 1021 | Ga0207688_10007979 | |||
| 1022 | Ga0207688_10178874 | |||
| 1023 | Ga0207680_10082563 | |||
| 1024 | Ga0207699_10020291 | |||
| 1025 | Ga0207699_10033861 | |||
| 1026 | Ga0207699_10107884 | |||
| 1027 | Ga0207699_10315901 | |||
| 1028 | Ga0207684_10031795 | |||
| 1029 | Ga0207684_10039045 | |||
| 1030 | Ga0207654_10015514 | |||
| 1031 | Ga0207654_10270006 | |||
| 1032 | Ga0207707_10102821 | |||
| 1033 | Ga0207707_10133139 | |||
| 1034 | Ga0207707_10467974 | |||
| 1035 | Ga0207695_10077421 | |||
| 1036 | Ga0207693_10002624 | |||
| 1037 | Ga0207693_10016443 | |||
| 1038 | Ga0207693_10039885 | |||
| 1039 | Ga0207693_10048141 | |||
| 1040 | Ga0207663_10022422 | |||
| 1041 | Ga0207663_10070283 | |||
| 1042 | Ga0207663_10109785 | |||
| 1043 | Ga0207660_10043194 | |||
| 1044 | Ga0207657_10001460 | |||
| 1045 | Ga0207657_10028913 | |||
| 1046 | Ga0207652_10055223 | |||
| 1047 | Ga0207652_10237261 | |||
| 1048 | Ga0207652_10363455 | |||
| 1049 | Ga0207646_10005879 | |||
| 1050 | Ga0207646_10028964 | |||
| 1051 | Ga0207646_10268386 | |||
| 1052 | Ga0207646_10300337 | |||
| 1053 | Ga0207687_10044693 | |||
| 1054 | Ga0207687_10082294 | |||
| 1055 | Ga0207687_10376583 | |||
| 1056 | Ga0207700_10000004 | |||
| 1057 | Ga0207700_10051994 | |||
| 1058 | Ga0207664_10156855 | |||
| 1059 | Ga0207664_10180346 | |||
| 1060 | Ga0207664_10203451 | |||
| 1061 | Ga0207664_10361373 | |||
| 1062 | Ga0207690_10545843 | |||
| 1063 | Ga0207686_10012235 | |||
| 1064 | Ga0207686_10184361 | |||
| 1065 | Ga0207686_10335284 | |||
| 1066 | Ga0207709_10001662 | |||
| 1067 | Ga0207709_10067241 | |||
| 1068 | Ga0207709_10146619 | |||
| 1069 | Ga0207669_10009647 | |||
| 1070 | Ga0207704_10046322 | |||
| 1071 | Ga0207665_10048448 | |||
| 1072 | Ga0207665_10059992 | |||
| 1073 | Ga0207711_10336104 | |||
| 1074 | Ga0207689_10194687 | |||
| 1075 | Ga0207661_10284173 | |||
| 1076 | Ga0207661_10423535 | |||
| 1077 | Ga0207661_10477619 | |||
| 1078 | Ga0207667_10095674 | |||
| 1079 | Ga0207667_10137248 | |||
| 1080 | Ga0207667_10579763 | |||
| 1081 | Ga0207651_10098198 | |||
| 1082 | Ga0207712_10054046 | |||
| 1083 | Ga0207712_10302482 | |||
| 1084 | Ga0207640_10053716 | |||
| 1085 | Ga0207658_10015151 | |||
| 1086 | Ga0207658_10079212 | |||
| 1087 | Ga0207677_10271482 | |||
| 1088 | Ga0207677_10573949 | |||
| 1089 | Ga0207639_10110291 | |||
| 1090 | Ga0207678_10778679 | |||
| 1091 | Ga0207708_10000305 | |||
| 1092 | Ga0207702_10089526 | |||
| 1093 | Ga0207702_10405066 | |||
| 1094 | Ga0207641_10331007 | |||
| 1095 | Ga0207648_10003702 | |||
| 1096 | Ga0207674_10001754 | |||
| 1097 | Ga0207675_100019798 | |||
| 1098 | Ga0207683_10000572 | |||
| 1099 | Ga0207683_10024773 | |||
| 1100 | Ga0207683_10323238 | |||
| 1101 | Ga0207428_10001268 | |||
| 1102 | Ga0207428_10067270 | |||
| 1103 | Ga0207428_10137373 | |||
| 1104 | Ga0207428_10176873 | |||
| 1105 | Ga0268266_10075262 | |||
| 1106 | Ga0265334_10055783 | |||
| 1107 | Ga0265318_10068485 | |||
| 1108 | Ga0265322_10003946 | |||
| 1109 | Ga0265336_10000676 | |||
| 1110 | Ga0265338_10004508 | |||
| 1111 | Ga0265338_10009753 | |||
| 1112 | Ga0265338_10045158 | |||
| 1113 | Ga0265330_10020776 | |||
| 1114 | Ga0265332_10141848 | |||
| 1115 | Ga0265325_10015319 | |||
| 1116 | Ga0265340_10027909 | |||
| 1117 | Ga0265339_10036804 | |||
| 1118 | Ga0265327_10071856 | |||
| 1119 | Ga0265316_10012382 | |||
| 1120 | Ga0265316_10018129 | |||
| 1121 | Ga0265313_10003489 | |||
| 1122 | Ga0265313_10036243 | |||
| 1123 | Ga0265314_10002807 | |||
| 1124 | Ga0265342_10071609 | |||
| 1125 | Ga0307416_100142097 | |||
| 1126 | Ga0307415_100030294 | |||
| 1127 | Ga0373930_0033559 | |||
| 1128 | Ga0373948_0003027 | |||
| 1129 | Ga0373958_0012654 | |||
| 1130 | Ga0373928_0011690 | |||
| 1131 | Ga0373940_0003415 | |||
| 1132 | Ga0373949_0022523 | |||
| 1133 | Ga0373951_0016401 | |||
| 1134 | Ga0373952_0002424 | |||
| 1135 | Ga0373932_0012778 | |||
| 1136 | Ga0373941_0006284 | |||
| 1137 | Ga0373960_0014767 | |||
| 1138 | Ga0373943_0003088 | |||
| 1139 | Ga0373946_0007250 | |||
| 1140 | Ga0373942_0018766 | |||
| 1141 | Ga0373961_0004581 | |||
| 1142 | Ga0373962_0005720 | |||
| 1143 | Ga0373935_0021095 | |||
| 1144 | Ga0373947_0017682 | |||
| 1145 | Ga0373925_0019349 | |||
| 1146 | Ga0395899_0002364 | |||
| 1147 | Ga0395899_0017563 | |||
| 1148 | Ga0395899_0078307 | |||
| 1149 | Ga0395899_0084304 | |||
| 1150 | Ga0395899_0086019 | |||
| 1151 | Ga0395899_0178878 | |||
| 1152 | Ga0395899_0346694 | |||
| 1153 | Ga0395900_0001116 | |||
| 1154 | Ga0395900_0001835 | |||
| 1155 | Ga0395900_0002995 | |||
| 1156 | Ga0395900_0005325 | |||
| 1157 | Ga0395900_0006889 | |||
| 1158 | Ga0395900_0010530 | |||
| 1159 | Ga0395900_0018070 | |||
| 1160 | Ga0395900_0018083 | |||
| 1161 | Ga0395900_0035344 | |||
| 1162 | Ga0395900_0051050 | |||
| 1163 | Ga0395900_0068513 | |||
| 1164 | Ga0395900_0117434 | |||
| 1165 | Ga0395900_0181299 | |||
| 1166 | Ga0395900_0269350 | |||
| 1167 | Ga0395900_0294406 | |||
| 1168 | Ga0395900_0526032 | |||
| 1169 | Ga0395900_0631189 | |||
| 1170 | Ga0395898_0007870 | |||
| 1171 | Ga0395898_0010215 | |||
| 1172 | Ga0395898_0010725 | |||
| 1173 | Ga0395898_0013558 | |||
| 1174 | Ga0395898_0015454 | |||
| 1175 | Ga0395898_0017955 | |||
| 1176 | Ga0395898_0023779 | |||
| 1177 | Ga0395898_0023911 | |||
| 1178 | Ga0395898_0036685 | |||
| 1179 | Ga0395898_0039074 | |||
| 1180 | Ga0395898_0040523 | |||
| 1181 | Ga0395898_0066665 | |||
| 1182 | Ga0395898_0097583 | |||
| 1183 | Ga0395898_0109822 | |||
| 1184 | Ga0395898_0113082 | |||
| 1185 | Ga0395898_0121401 | |||
| 1186 | Ga0395898_0132704 | |||
| 1187 | Ga0395898_0281770 | |||
| 1188 | Ga0395898_0365284 | |||
| 1189 | Ga0395898_0627865 | |||
| 1190 | Ga0395905_0003307 | |||
| 1191 | Ga0395905_0003977 | |||
| 1192 | Ga0395905_0006497 | |||
| 1193 | Ga0395905_0010878 | |||
| 1194 | Ga0395905_0011714 | |||
| 1195 | Ga0395905_0013615 | |||
| 1196 | Ga0395905_0025321 | |||
| 1197 | Ga0395905_0027804 | |||
| 1198 | Ga0395905_0035742 | |||
| 1199 | Ga0395905_0071117 | |||
| 1200 | Ga0395905_0146637 | |||
| 1201 | Ga0395905_0172058 | |||
| 1202 | Ga0395905_0358680 | |||
| 1203 | Ga0395905_0484052 | |||
| 1204 | Ga0395905_0548960 | |||
| 1205 | Ga0395901_0000847 | |||
| 1206 | Ga0395901_0003698 | |||
| 1207 | Ga0395901_0004430 | |||
| 1208 | Ga0395901_0008183 | |||
| 1209 | Ga0395901_0008362 | |||
| 1210 | Ga0395901_0008941 | |||
| 1211 | Ga0395901_0009143 | |||
| 1212 | Ga0395901_0011791 | |||
| 1213 | Ga0395901_0013739 | |||
| 1214 | Ga0395901_0026442 | |||
| 1215 | Ga0395901_0049494 | |||
| 1216 | Ga0395901_0050870 | |||
| 1217 | Ga0395901_0066545 | |||
| 1218 | Ga0395901_0068828 | |||
| 1219 | Ga0395901_0083155 | |||
| 1220 | Ga0395901_0102320 | |||
| 1221 | Ga0395901_0110112 | |||
| 1222 | Ga0395901_0113605 | |||
| 1223 | Ga0395901_0168039 | |||
| 1224 | Ga0395901_0289335 | |||
| 1225 | Ga0395901_0378480 | |||
| 1226 | Ga0395901_0524148 | |||
| 1227 | Ga0395901_0778726 | |||
| 1228 | Ga0436365_1366736 | |||
| 1229 | Ga0436363_0352713 | |||
| 1230 | Ga0451789_0817946 | |||
| 1231 | Ga0451853_0214319 | |||
| 1232 | Ga0450915_000372 | |||
| 1233 | Ga0439460_0107586 | |||
| 1234 | Ga0466969_0154507 | |||
| 1235 | Ga0466965_0028275 | |||
| 1236 | Ga0466966_0022898 | |||
| 1237 | Ga0466961_0011643 | |||
| 1238 | Ga0466963_0006766 | |||
| 1239 | Ga0466963_0019362 | |||
| 1240 | Ga0466963_0030035 | |||
| 1241 | Ga0466963_0063633 | |||
| 1242 | Ga0466963_0362814 | |||
| 1243 | Ga0466964_0003712 | |||
| 1244 | Ga0466964_0014037 | |||
| 1245 | Ga0466964_0014543 | |||
| 1246 | Ga0466971_0021017 | |||
| 1247 | Ga0466971_0068868 | |||
| 1248 | Ga0466968_0051937 | |||
| 1249 | Ga0466970_0039114 | |||
| 1250 | Ga0466957_0070911 | |||
| 1251 | Ga0466957_0247940 | |||
| 1252 | Ga0466957_0397278 | |||
| 1253 | Ga0466960_0011535 | |||
| 1254 | Ga0466960_0315311 | |||
| 1255 | Ga0466958_0005848 | |||
| 1256 | Ga0466958_0067010 | |||
| 1257 | Ga0466958_0087697 | |||
| 1258 | Ga0466958_0114103 | |||
| 1259 | Ga0466967_0032470 | |||
| 1260 | Ga0466967_0042357 | |||
| 1261 | Ga0466967_0097424 | |||
| 1262 | Ga0466967_0130759 | |||
| 1263 | Ga0466967_0134323 | |||
| 1264 | Ga0466967_0179777 | |||
| 1265 | Ga0466967_0207925 | |||
| 1266 | Ga0466967_0468241 | |||
| 1267 | Ga0466967_0531487 | |||
| 1268 | Ga0495592_0001615 | |||
| 1269 | Ga0495592_0183000 | |||
| 1270 | Ga0495603_0101652 | |||
| 1271 | Ga0495629_0057817 | |||
| 1272 | Ga0495629_0106578 | |||
| 1273 | Ga0495641_0021226 | |||
| 1274 | Ga0495641_0047995 | |||
| 1275 | Ga0495651_0003563 | |||
| 1276 | Ga0495582_0100282 | |||
| 1277 | Ga0495664_0144231 | |||
| 1278 | Ga0495608_0013925 | |||
| 1279 | Ga0495628_0045963 | |||
| 1280 | Ga0495628_0380375 | |||
| 1281 | Ga0495630_0000446 | |||
| 1282 | Ga0495630_0005371 | |||
| 1283 | Ga0495630_0024825 | |||
| 1284 | Ga0495663_0017870 | |||
| 1285 | Ga0495642_0060880 | |||
| 1286 | Ga0495652_0030665 | |||
| 1287 | Ga0495640_0031403 | |||
| 1288 | Ga0495640_0040923 | |||
| 1289 | Ga0495586_0047458 | |||
| 1290 | Ga0495587_0024922 | |||
| 1291 | Ga0495667_0036684 | |||
| 1292 | Ga0495667_0186105 | |||
| 1293 | Ga0495656_0069184 | |||
| 1294 | Ga0495668_0165107 | |||
| 1295 | Ga0495634_0058069 | |||
| 1296 | Ga0495635_0064846 | |||
| 1297 | Ga0495659_0032977 | |||
| 1298 | Ga0495659_0100233 | |||
| 1299 | Ga0495657_0035356 | |||
| 1300 | Ga0495657_0219841 | |||
| 1301 | Ga0495599_0000409 | |||
| 1302 | Ga0495599_0036310 | |||
| 1303 | Ga0495599_0071284 | |||
| 1304 | Ga0495646_0001458 | |||
| 1305 | Ga0495647_0029920 | |||
| 1306 | Ga0495658_0009957 | |||
| 1307 | Ga0495613_0009537 | |||
| 1308 | Ga0495613_0014770 | |||
| 1309 | Ga0495613_0037654 | |||
| 1310 | Ga0495624_0004755 | |||
| 1311 | Ga0495624_0017487 | |||
| 1312 | Ga0495624_0041244 | |||
| 1313 | Ga0495581_0009890 | |||
| 1314 | Ga0495581_0021889 | |||
| 1315 | Ga0495581_0085210 | |||
| 1316 | Ga0495604_0054484 | |||
| 1317 | Ga0495604_0187802 | |||
| 1318 | Ga0495636_0125470 | |||
| 1319 | Ga0495674_0001283 | |||
| 1320 | Ga0495674_0041788 | |||
| 1321 | Ga0495674_0043792 | |||
| 1322 | Ga0495674_0060796 | |||
| 1323 | Ga0495674_0288208 | |||
| 1324 | Ga0495676_0125044 | |||
| 1325 | Ga0495680_0003455 | |||
| 1326 | Ga0495680_0015166 | |||
| 1327 | Ga0495675_0097688 | |||
| 1328 | Ga0495685_060767 | |||
| 1329 | Ga0495684_0412560 | |||
| 1330 | Ga0495602_0071315 | |||
| 1331 | Ga0496100_0004702 | |||
| 1332 | Ga0496100_0007119 | |||
| 1333 | Ga0496100_0104701 | |||
| 1334 | Ga0496101_0004835 | |||
| 1335 | Ga0496101_0026961 | |||
| 1336 | Ga0496101_0028419 | |||
| 1337 | Ga0496101_0039546 | |||
| 1338 | Ga0496101_0066511 | |||
| 1339 | Ga0496101_0083493 | |||
| 1340 | Ga0496101_0104533 | |||
| 1341 | Ga0496101_0144058 | |||
| 1342 | Ga0496101_0194878 | |||
| 1343 | Ga0496101_0258656 | |||
| 1344 | Ga0496102_0008227 | |||
| 1345 | Ga0496102_0012168 | |||
| 1346 | Ga0496102_0030905 | |||
| 1347 | Ga0496102_0099091 | |||
| 1348 | Ga0496102_0239014 | |||
| 1349 | Ga0496102_0274915 | |||
| 1350 | Ga0496102_0540313 | |||
| 1351 | Ga0496103_0014324 | |||
| 1352 | Ga0496103_0197690 | |||
| 1353 | Ga0496103_0234708 | |||
| 1354 | Ga0496104_0021815 | |||
| 1355 | Ga0496104_0029106 | |||
| 1356 | Ga0496104_0068638 | |||
| 1357 | Ga0496104_0093735 | |||
| 1358 | Ga0496104_0103615 | |||
| 1359 | Ga0496105_0002803 | |||
| 1360 | Ga0496105_0004217 | |||
| 1361 | Ga0496105_0008689 | |||
| 1362 | Ga0496105_0035965 | |||
| 1363 | Ga0496105_0161084 | |||
| 1364 | Ga0496105_0254703 | |||
| 1365 | Ga0496106_0032792 | |||
| 1366 | Ga0496106_0051548 | |||
| 1367 | Ga0496106_0151013 | |||
| 1368 | Ga0496106_0157569 | |||
| 1369 | Ga0496106_0227785 | |||
| 1370 | Ga0496107_0005064 | |||
| 1371 | Ga0496107_0471636 | |||
| 1372 | Ga0496108_0002409 | |||
| 1373 | Ga0496108_0017127 | |||
| 1374 | Ga0496108_0020827 | |||
| 1375 | Ga0496108_0025220 | |||
| 1376 | Ga0496108_0043664 | |||
| 1377 | Ga0496108_0065303 | |||
| 1378 | Ga0496108_0160260 | |||
| 1379 | Ga0496108_0178251 | |||
| 1380 | Ga0496108_0204911 | |||
| 1381 | Ga0496108_0273963 | |||
| 1382 | Ga0496109_0001756 | |||
| 1383 | Ga0496109_0002119 | |||
| 1384 | Ga0496109_0035497 | |||
| 1385 | Ga0496109_0039105 | |||
| 1386 | Ga0496109_0090589 | |||
| 1387 | Ga0496109_0102986 | |||
| 1388 | Ga0496109_0293660 | |||
| 1389 | Ga0496109_0374481 | |||
| 1390 | Ga0496109_0627206 | |||
| 1391 | Ga0496110_0007078 | |||
| 1392 | Ga0496110_0024522 | |||
| 1393 | Ga0496110_0041055 | |||
| 1394 | Ga0496110_0054112 | |||
| 1395 | Ga0496110_0087750 | |||
| 1396 | Ga0496110_0142117 | |||
| 1397 | Ga0496110_0154303 | |||
| 1398 | Ga0496110_0306752 | |||
| 1399 | Ga0496110_0482851 | |||
| 1400 | Ga0496111_0001490 | |||
| 1401 | Ga0496111_0040335 | |||
| 1402 | Ga0496111_0076256 | |||
| 1403 | Ga0496111_0475786 | |||
| 1404 | Ga0496112_0002873 | |||
| 1405 | Ga0496112_0006445 | |||
| 1406 | Ga0496112_0028533 | |||
| 1407 | Ga0496112_0135458 | |||
| 1408 | Ga0496112_0161234 | |||
| 1409 | Ga0496112_0224473 | |||
| 1410 | Ga0496113_0001615 | |||
| 1411 | Ga0496113_0098806 | |||
| 1412 | Ga0496113_0154413 | |||
| 1413 | Ga0496113_0361241 | |||
| 1414 | Ga0496114_0013374 | |||
| 1415 | Ga0496114_0078330 | |||
| 1416 | Ga0496114_0080289 | |||
| 1417 | Ga0496114_0147324 | |||
| 1418 | Ga0496115_0001171 | |||
| 1419 | Ga0496115_0002222 | |||
| 1420 | Ga0496115_0006963 | |||
| 1421 | Ga0501031_0006921 | |||
| 1422 | Ga0501031_0034473 | |||
| 1423 | Ga0501032_0020649 | |||
| 1424 | Ga0501033_0002985 | |||
| 1425 | Ga0501033_0109482 | |||
| 1426 | Ga0501034_0056302 | |||
| 1427 | Ga0501036_0003723 | |||
| 1428 | Ga0501036_0494361 | |||
| 1429 | Ga0501037_0031661 | |||
| 1430 | Ga0501037_0201926 | |||
| 1431 | Ga0501038_0004950 | |||
| 1432 | Ga0501038_0013862 | |||
| 1433 | Ga0501039_0001400 | |||
| 1434 | Ga0501039_0358867 | |||
| 1435 | Ga0501040_0002464 | |||
| 1436 | Ga0501041_0001460 | |||
| 1437 | Ga0501042_0001860 | |||
| 1438 | Ga0501042_0002873 | |||
| 1439 | Ga0501043_0012993 | |||
| 1440 | Ga0501043_0166787 | |||
| 1441 | Ga0501046_0002389 | |||
| 1442 | Ga0501046_0142414 | |||
| 1443 | Ga0501047_0035487 | |||
| 1444 | Ga0501048_0001476 | |||
| 1445 | Ga0501068_0001204 | |||
| 1446 | Ga0501068_0053917 | |||
| 1447 | Ga0501069_0000931 | |||
| 1448 | Ga0501069_0005028 | |||
| 1449 | Ga0501069_0028725 | |||
| 1450 | Ga0501069_0122331 | |||
| 1451 | Ga0501070_0011167 | |||
| 1452 | Ga0501070_0080909 | |||
| 1453 | Ga0501070_0334819 | |||
| 1454 | Ga0501071_0018076 | |||
| 1455 | Ga0501071_0126143 | |||
| 1456 | Ga0501072_0005921 | |||
| 1457 | Ga0501073_0001168 | |||
| 1458 | Ga0501073_0010357 | |||
| 1459 | Ga0501074_0000243 | |||
| 1460 | Ga0501074_0056580 | |||
| 1461 | Ga0501075_0008137 | |||
| 1462 | Ga0501075_0247814 | |||
| 1463 | Ga0501076_0015079 | |||
| 1464 | Ga0501077_0002697 | |||
| 1465 | Ga0501079_0025524 | |||
| 1466 | Ga0501079_0097462 | |||
| 1467 | Ga0501079_0138226 | |||
| 1468 | Ga0501080_0007270 | |||
| 1469 | Ga0501081_0002699 | |||
| 1470 | Ga0501081_0067737 | |||
| 1471 | Ga0501081_0147247 | |||
| 1472 | Ga0501083_0001567 | |||
| 1473 | Ga0501083_0121786 | |||
| 1474 | Ga0501035_0008585 | |||
| 1475 | Ga0501035_0092779 | |||
| 1476 | Ga0501044_0021154 | |||
| 1477 | Ga0501044_0143645 | |||
| 1478 | Ga0501044_0418201 | |||
| 1479 | Ga0501045_0012174 | |||
| 1480 | nmdc:mga06z11_159267_c1 | |||
| 1481 | nmdc:mga05p37_305275_c1 | |||
| 1482 | nmdc:mga05p37_54375_c1 | |||
| 1483 | nmdc:mga05p37_6829_c1 | |||
| 1484 | nmdc:mga05p37_74224_c1 | |||
| 1485 | nmdc:mga05p37_80015_c1 | |||
| 1486 | nmdc:mga09592_139485_c1 | |||
| 1487 | nmdc:mga09592_163952_c1 | |||
| 1488 | nmdc:mga09592_353985_c1 | |||
| 1489 | nmdc:mga0qj67_176052_c1 | |||
| 1490 | nmdc:mga06r32_27619_c1 | |||
| 1491 | nmdc:mga06r32_314917_c1 | |||
| 1492 | nmdc:mga06r32_660536_c1 | |||
| 1493 | nmdc:mga08y16_191791_c1 | |||
| 1494 | nmdc:mga08y16_194289_c1 | |||
| 1495 | nmdc:mga08y16_248527_c1 | |||
| 1496 | nmdc:mga08y16_90961_c1 | |||
| 1497 | nmdc:mga0n895_220536_c1 | |||
| 1498 | nmdc:mga0n895_222159_c1 | |||
| 1499 | nmdc:mga0n895_278983_c1 | |||
| 1500 | nmdc:mga0n895_29757_c1 | |||
| 1501 | nmdc:mga0n895_318787_c1 | |||
| 1502 | nmdc:mga0n895_82303_c1 | |||
| 1503 | nmdc:mga0rr50_612_c1 | |||
| 1504 | nmdc:mga0rr50_84726_c1 | |||
| 1505 | nmdc:mga08x19_193068_c1 | |||
| 1506 | nmdc:mga08x19_27107_c1 | |||
| 1507 | nmdc:mga08x19_7970_c1 | |||
| 1508 | nmdc:mga0a205_204950_c1 | |||
| 1509 | nmdc:mga0a205_412408_c1 | |||
| 1510 | nmdc:mga0a205_93361_c1 | |||
| 1511 | Ga0495612_0026820 | |||
| 1512 | Ga0495595_0012219 | |||
| 1513 | Ga0495619_0075360 | |||
| 1514 | Ga0501084_0003039 | |||
| 1515 | Ga0501084_0163054 | |||
| 1516 | Ga0501082_0004555 | |||
| 1517 | Ga0501082_0049202 | |||
| 1518 | Ga0466962_0004003 | |||
| 1519 | Ga0530510_0002862 | |||
| 1520 | Ga0530510_0015456 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7tps-assembly1.cif.gz_A | crystal structure of alpn-202 (engineered cd80 vigd) in complex with pd-l1 | 0.8778 | 218 | 241 |
| 4tty-assembly1.cif.gz_B | n-terminal domain of c. reinhardtii sas-6 homolog bld12p g94d f145w q147r (nn25) | 0.826 | 207 | 243 |
| 2zuy-assembly1.cif.gz_A | crystal structure of exotype rhamnogalacturonan lyase yesx | 0.818 | 209 | 239 |
| 4wsp-assembly1.cif.gz_A | racemic crystal structure of rv1738 from mycobacterium tuberculosis (form-i) | 0.7869 | 209 | 241 |
| 1e4f-assembly1.cif.gz_T | ftsa (apo form) from thermotoga maritima | 0.7816 | 211 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8QV90_961_1207_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.9002 | 209 | 239 | 2.130.10.10 |
| 1i8lB01 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.873 | 218 | 241 | 2.60.40.10 |
| af_Q54AR9_158_227_3.10.20.370 | Alpha Beta;Roll;Ubiquitin-like (UB roll); | 0.8403 | 207 | 246 | 3.10.20.370 |
| af_A0A2R8QV54_792_862_3.10.20.370 | Alpha Beta;Roll;Ubiquitin-like (UB roll); | 0.8359 | 209 | 243 | 3.10.20.370 |
| af_A0A2R8QQ93_25_87_3.10.20.370 | Alpha Beta;Roll;Ubiquitin-like (UB roll); | 0.808 | 207 | 246 | 3.10.20.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9V1Q4-F1-model_v4 | Metallophosphoesterase | 0.9705 | 2 | 243 |
GO:0016787
|
| AF-A0A538LN50-F1-model_v4 | Calcineurin-like phosphoesterase domain-containing protein | 0.9657 | 9 | 241 |
GO:0016787
|
| AF-A0A1F2Y2U7-F1-model_v4 | Calcineurin-like phosphoesterase domain-containing protein | 0.9623 | 2 | 243 |
GO:0016787
|
| AF-A0A7M2YVF1-F1-model_v4 | Calcineurin-like phosphoesterase superfamily domain | 0.9619 | 2 | 243 |
GO:0016787
|
| AF-A0A855HQ91-F1-model_v4 | deleted | 0.961 | 2 | 56 |
|