F479495

General Info

Members Datasets Scaffolds Average Seq Length
759 362 1518 261

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0192770|Ga0495606_0192770_31_891
Length 286
Sequence MQLRRPIVYDPLREIRMTLASRHQETPMNPMTLEIPSRKNQVSPEEWQARVDLAAAYRLVALFKWDDLVFTHISARVPGSHDEFLINPYGLMFEEITASSLIKIDAQGNKLDKSPYEVNPAGFTIHSAIHSSRHDAQCVLHVHSLNGIAVSAQKGGVLPISQQSIFVLSSLGYHDYEGVALRDDEKPRLVADLGPDNNFLMLRNHGLLTVGRTVADAFLSMYLFETVCTIQVRAMGGGAELVRVDPRIIAGAQEQARGATRGMGAGALTWPGLLRRLDRADSSYRT

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
5 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
6 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
214 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
215 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
216 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
217 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
228 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
229 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
230 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
231 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
232 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
233 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
234 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
235 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
236 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
245 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
246 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
247 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
248 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
249 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
250 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
251 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
252 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
253 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
254 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
262 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
263 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
268 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
271 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
274 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
288 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
289 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
293 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
294 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
297 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
298 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
322 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
323 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
324 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
325 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
326 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
327 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
328 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
331 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
335 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
336 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
337 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
338 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
345 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
346 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
347 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
348 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
349 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
350 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
351 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
352 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
353 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
359 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
360 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
361 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
362 2643221654 Rhizobacter sp. Root404 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0.79
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.17
Nodule 0
Rhizoplane 2.9
Rhizosphere 84.72
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0192770 3300046507 Bacteria 1167
2 JGI25152J39213_1005889 3300002773 Bacteria 3466
3 JGI25153J46596_10000798 3300003215 Bacteria 19252
4 JGI25153J46596_10002808 3300003215 Bacteria 9901
5 JGI26128J50194_1004038 3300003347 Unclassified 971
6 JGI26129J50193_1000637 3300003349 Unclassified 2227
7 JGI26141J51220_1000540 3300003503 Unclassified 2127
8 Ga0055526_1004131 3300003771 Bacteria 8857
9 Ga0058861_11915976 3300004800 Bacteria 2092
10 Ga0065712_10137294 3300005290 Bacteria 1485
11 Ga0065715_10193067 3300005293 Bacteria 1404
12 Ga0070658_10081824 3300005327 Bacteria 2653
13 Ga0070676_10001262 3300005328 Bacteria 12740
14 Ga0070676_10007437 3300005328 Bacteria 5881
15 Ga0070676_10052630 3300005328 Bacteria 2395
16 Ga0070683_100114667 3300005329 Bacteria 2543
17 Ga0070683_100212645 3300005329 Bacteria 1837
18 Ga0070690_100013368 3300005330 Bacteria 4846
19 Ga0070690_100136641 3300005330 Bacteria 1661
20 Ga0070690_100262786 3300005330 Bacteria 1225
21 Ga0070670_100002700 3300005331 Bacteria 14659
22 Ga0070670_100017679 3300005331 Bacteria 6118
23 Ga0070670_100093306 3300005331 Bacteria 2589
24 Ga0070670_100406438 3300005331 Bacteria 1202
25 Ga0070677_10000616 3300005333 Bacteria 11978
26 Ga0070677_10214726 3300005333 Bacteria 936
27 Ga0070677_10226762 3300005333 Bacteria 915
28 Ga0068869_100002323 3300005334 Bacteria 11439
29 Ga0068869_100003892 3300005334 Bacteria 9211
30 Ga0068869_100005979 3300005334 Bacteria 7693
31 Ga0068869_100036918 3300005334 Bacteria 3472
32 Ga0068869_100588140 3300005334 Bacteria 939
33 Ga0068869_100644211 3300005334 Bacteria 899
34 Ga0070666_10029990 3300005335 Bacteria 3580
35 Ga0070680_100002051 3300005336 Bacteria 14856
36 Ga0070680_100012045 3300005336 Bacteria 6711
37 Ga0070682_100032025 3300005337 Bacteria 3185
38 Ga0068868_100010070 3300005338 Bacteria 6831
39 Ga0068868_100021973 3300005338 Bacteria 4810
40 Ga0068868_100045018 3300005338 Bacteria 3451
41 Ga0068868_100105232 3300005338 Bacteria 2288
42 Ga0068868_100107731 3300005338 Bacteria 2261
43 Ga0068868_100259749 3300005338 Bacteria 1464
44 Ga0070660_100001240 3300005339 Bacteria 17325
45 Ga0070660_100048676 3300005339 Bacteria 3256
46 Ga0070660_100066924 3300005339 Bacteria 2798
47 Ga0070689_100234651 3300005340 Bacteria 1509
48 Ga0070691_10068542 3300005341 Bacteria 1718
49 Ga0070687_100011058 3300005343 Bacteria 3932
50 Ga0070661_100000422 3300005344 Bacteria 32487
51 Ga0070661_100011633 3300005344 Bacteria 6135
52 Ga0070661_100034265 3300005344 Bacteria 3682
53 Ga0070692_10011701 3300005345 Bacteria 4036
54 Ga0070668_100022449 3300005347 Bacteria 4771
55 Ga0070668_100043965 3300005347 Bacteria 3425
56 Ga0070669_100035576 3300005353 Bacteria 3608
57 Ga0070669_100039688 3300005353 Bacteria 3421
58 Ga0070669_100196273 3300005353 Bacteria 1586
59 Ga0070675_100000941 3300005354 Bacteria 20742
60 Ga0070675_100012464 3300005354 Bacteria 6660
61 Ga0070675_100028275 3300005354 Bacteria 4513
62 Ga0070675_100063115 3300005354 Bacteria 3062
63 Ga0070675_100139245 3300005354 Bacteria 2073
64 Ga0070671_100031986 3300005355 Bacteria 4349
65 Ga0070671_100037275 3300005355 Bacteria 4031
66 Ga0070671_100078941 3300005355 Bacteria 2751
67 Ga0070671_100316978 3300005355 Bacteria 1328
68 Ga0070674_100006525 3300005356 Bacteria 6813
69 Ga0070674_100010278 3300005356 Bacteria 5649
70 Ga0070673_100003922 3300005364 Bacteria 9342
71 Ga0070673_100026453 3300005364 Bacteria 4286
72 Ga0070673_100043982 3300005364 Bacteria 3455
73 Ga0070659_100001253 3300005366 Bacteria 18431
74 Ga0070659_100017014 3300005366 Bacteria 5466
75 Ga0070659_100027875 3300005366 Bacteria 4355
76 Ga0070667_100019278 3300005367 Bacteria 5659
77 Ga0070667_100204955 3300005367 Bacteria 1751
78 Ga0070667_100258169 3300005367 Bacteria 1559
79 Ga0070703_10002821 3300005406 Bacteria 4977
80 Ga0070709_10098871 3300005434 Bacteria 1940
81 Ga0070701_10041948 3300005438 Bacteria 2333
82 Ga0070705_100009120 3300005440 Bacteria 4924
83 Ga0070705_100019096 3300005440 Bacteria 3603
84 Ga0070705_100086644 3300005440 Bacteria 1939
85 Ga0070705_100093929 3300005440 Bacteria 1877
86 Ga0070694_100012853 3300005444 Bacteria 5218
87 Ga0070694_100021179 3300005444 Bacteria 4151
88 Ga0070694_100060133 3300005444 Bacteria 2590
89 Ga0070694_100078795 3300005444 Bacteria 2286
90 Ga0070663_100008587 3300005455 Bacteria 6292
91 Ga0070663_100009340 3300005455 Bacteria 6070
92 Ga0070663_100083011 3300005455 Bacteria 2359
93 Ga0070663_100531143 3300005455 Bacteria 981
94 Ga0070678_100028369 3300005456 Bacteria 3816
95 Ga0070678_100328785 3300005456 Bacteria 1308
96 Ga0070678_100396652 3300005456 Bacteria 1198
97 Ga0070662_100000858 3300005457 Bacteria 18683
98 Ga0070662_100033745 3300005457 Bacteria 3605
99 Ga0070662_100047690 3300005457 Bacteria 3083
100 Ga0070662_100051372 3300005457 Bacteria 2977
101 Ga0070681_10021592 3300005458 Bacteria 6454
102 Ga0070681_10049154 3300005458 Bacteria 4213
103 Ga0070681_10326316 3300005458 Bacteria 1444
104 Ga0068867_100000153 3300005459 Bacteria 44022
105 Ga0068867_100006148 3300005459 Bacteria 8500
106 Ga0068867_100016108 3300005459 Bacteria 5309
107 Ga0068867_100018163 3300005459 Bacteria 4998
108 Ga0068867_100021321 3300005459 Bacteria 4623
109 Ga0068867_100022540 3300005459 Bacteria 4504
110 Ga0068867_100060996 3300005459 Bacteria 2799
111 Ga0068867_100086362 3300005459 Bacteria 2373
112 Ga0068867_100546593 3300005459 Bacteria 1003
113 Ga0070706_100004190 3300005467 Bacteria 14003
114 Ga0070706_100008879 3300005467 Bacteria 9361
115 Ga0070706_100013341 3300005467 Bacteria 7598
116 Ga0070706_100134668 3300005467 Bacteria 2306
117 Ga0070707_100019530 3300005468 Bacteria 6384
118 Ga0070707_100066774 3300005468 Bacteria 3457
119 Ga0070707_100159827 3300005468 Bacteria 2195
120 Ga0070698_100003263 3300005471 Bacteria 17820
121 Ga0070698_100030615 3300005471 Bacteria 5579
122 Ga0070698_100076477 3300005471 Bacteria 3349
123 Ga0070698_100121726 3300005471 Bacteria 2569
124 Ga0070699_100008382 3300005518 Bacteria 8956
125 Ga0070699_100045715 3300005518 Bacteria 3789
126 Ga0070679_100006631 3300005530 Bacteria 10794
127 Ga0070679_100013264 3300005530 Bacteria 7888
128 Ga0070679_100081666 3300005530 Bacteria 3221
129 Ga0070679_100218327 3300005530 Bacteria 1868
130 Ga0070679_100443880 3300005530 Bacteria 1242
131 Ga0070679_100460631 3300005530 Bacteria 1216
132 Ga0070684_100057636 3300005535 Bacteria 3392
133 Ga0070684_100059956 3300005535 Bacteria 3327
134 Ga0070697_100003510 3300005536 Bacteria 12046
135 Ga0070697_100070844 3300005536 Bacteria 2859
136 Ga0070697_100346064 3300005536 Bacteria 1283
137 Ga0068853_100003958 3300005539 Bacteria 11380
138 Ga0068853_100053872 3300005539 Bacteria 3465
139 Ga0068853_100158679 3300005539 Bacteria 2039
140 Ga0068853_100864198 3300005539 Bacteria 868
141 Ga0070672_100006281 3300005543 Bacteria 7965
142 Ga0070672_100006413 3300005543 Bacteria 7908
143 Ga0070672_100019229 3300005543 Bacteria 4955
144 Ga0070672_100020389 3300005543 Bacteria 4834
145 Ga0070672_100095753 3300005543 Bacteria 2401
146 Ga0070695_100046025 3300005545 Bacteria 2783
147 Ga0070695_100065729 3300005545 Bacteria 2362
148 Ga0070695_100119256 3300005545 Bacteria 1802
149 Ga0070695_100139884 3300005545 Bacteria 1677
150 Ga0070696_100000636 3300005546 Bacteria 22379
151 Ga0070693_100000180 3300005547 Bacteria 29107
152 Ga0070693_100073212 3300005547 Bacteria 2023
153 Ga0070693_100374259 3300005547 Bacteria 981
154 Ga0070665_100164969 3300005548 Bacteria 2217
155 Ga0070704_100066937 3300005549 Bacteria 2592
156 Ga0070704_100142327 3300005549 Bacteria 1874
157 Ga0070704_100258623 3300005549 Bacteria 1433
158 Ga0068855_100000437 3300005563 Bacteria 51661
159 Ga0068855_100029107 3300005563 Bacteria 6605
160 Ga0068855_100165514 3300005563 Bacteria 2507
161 Ga0068855_100829883 3300005563 Bacteria 981
162 Ga0070664_100035536 3300005564 Bacteria 4183
163 Ga0070664_100211578 3300005564 Bacteria 1733
164 Ga0070664_100391135 3300005564 Bacteria 1270
165 Ga0068857_100005221 3300005577 Bacteria 11059
166 Ga0068857_100008167 3300005577 Bacteria 9040
167 Ga0068857_100026534 3300005577 Bacteria 5106
168 Ga0068857_100124042 3300005577 Bacteria 2327
169 Ga0068857_100130409 3300005577 Bacteria 2267
170 Ga0068857_100527282 3300005577 Bacteria 1111
171 Ga0068854_100006722 3300005578 Bacteria 7330
172 Ga0068854_100029414 3300005578 Bacteria 3803
173 Ga0068854_100357200 3300005578 Bacteria 1198
174 Ga0068856_100012854 3300005614 Bacteria 8102
175 Ga0068856_100027847 3300005614 Bacteria 5513
176 Ga0068856_100074996 3300005614 Bacteria 3350
177 Ga0068856_100126177 3300005614 Bacteria 2562
178 Ga0068856_100431508 3300005614 Bacteria 1338
179 Ga0068856_100899506 3300005614 Bacteria 904
180 Ga0070702_100036796 3300005615 Bacteria 2714
181 Ga0070702_100247765 3300005615 Bacteria 1206
182 Ga0068852_100036132 3300005616 Bacteria 4130
183 Ga0068852_100079518 3300005616 Bacteria 2904
184 Ga0068852_100414178 3300005616 Bacteria 1328
185 Ga0068852_100630916 3300005616 Bacteria 1078
186 Ga0068859_100015911 3300005617 Bacteria 7560
187 Ga0068859_100062475 3300005617 Bacteria 3755
188 Ga0068859_100381608 3300005617 Bacteria 1505
189 Ga0068864_100011870 3300005618 Bacteria 7193
190 Ga0068864_100016780 3300005618 Bacteria 6102
191 Ga0068864_100044367 3300005618 Bacteria 3810
192 Ga0068861_100004099 3300005719 Bacteria 9770
193 Ga0068861_100006344 3300005719 Bacteria 8052
194 Ga0068861_100113881 3300005719 Bacteria 2171
195 Ga0068851_10013881 3300005834 Bacteria 3816
196 Ga0068851_10031280 3300005834 Bacteria 2643
197 Ga0068870_10001471 3300005840 Bacteria 9538
198 Ga0068870_10035737 3300005840 Bacteria 2552
199 Ga0068870_10157697 3300005840 Bacteria 1343
200 Ga0068863_100012567 3300005841 Bacteria 8169
201 Ga0068863_100049994 3300005841 Bacteria 3964
202 Ga0068863_100268363 3300005841 Bacteria 1651
203 Ga0068858_100003457 3300005842 Bacteria 15673
204 Ga0068858_100239308 3300005842 Bacteria 1722
205 Ga0068860_100002242 3300005843 Bacteria 20354
206 Ga0068860_100010521 3300005843 Bacteria 9145
207 Ga0068860_100066431 3300005843 Bacteria 3426
208 Ga0068860_100132149 3300005843 Bacteria 2396
209 Ga0068860_100184581 3300005843 Bacteria 2017
210 Ga0081455_10008006 3300005937 Bacteria 11045
211 Ga0081455_10257427 3300005937 Bacteria 1273
212 Ga0075365_10018613 3300006038 Bacteria 4273
213 Ga0075368_10029355 3300006042 Bacteria 2126
214 Ga0075364_10435575 3300006051 Bacteria 895
215 Ga0075362_10039885 3300006177 Bacteria 2066
216 Ga0075362_10042537 3300006177 Bacteria 2008
217 Ga0075367_10003702 3300006178 Bacteria 7346
218 Ga0075367_10006367 3300006178 Bacteria 5957
219 Ga0075367_10015749 3300006178 Bacteria 4117
220 Ga0075366_10000784 3300006195 Bacteria 15195
221 Ga0075366_10004912 3300006195 Bacteria 7214
222 Ga0075366_10016047 3300006195 Bacteria 4301
223 Ga0075366_10031175 3300006195 Bacteria 3137
224 Ga0075366_10036045 3300006195 Bacteria 2915
225 Ga0075366_10155004 3300006195 Bacteria 1387
226 Ga0097621_100017940 3300006237 Bacteria 5391
227 Ga0097621_100023342 3300006237 Bacteria 4815
228 Ga0075370_10000805 3300006353 Bacteria 12565
229 Ga0075370_10001035 3300006353 Bacteria 11545
230 Ga0075370_10001039 3300006353 Bacteria 11542
231 Ga0075370_10003022 3300006353 Bacteria 7928
232 Ga0075370_10011261 3300006353 Bacteria 4695
233 Ga0075370_10050254 3300006353 Bacteria 2365
234 Ga0075370_10066811 3300006353 Bacteria 2052
235 Ga0075370_10106586 3300006353 Bacteria 1625
236 Ga0068871_100014425 3300006358 Bacteria 5893
237 Ga0075430_100018589 3300006846 Bacteria 5915
238 Ga0075430_100071576 3300006846 Bacteria 2909
239 Ga0075431_100029304 3300006847 Bacteria 5664
240 Ga0075433_10016777 3300006852 Bacteria 6047
241 Ga0075433_10057869 3300006852 Bacteria 3389
242 Ga0075433_10487550 3300006852 Bacteria 1086
243 Ga0075434_100539515 3300006871 Bacteria 1186
244 Ga0075429_100000055 3300006880 Bacteria 55152
245 Ga0075429_100095711 3300006880 Bacteria 2589
246 Ga0068865_100014114 3300006881 Bacteria 5069
247 Ga0068865_100282138 3300006881 Bacteria 1323
248 Ga0068865_100527023 3300006881 Bacteria 989
249 Ga0068865_100542464 3300006881 Bacteria 975
250 Ga0068865_100607096 3300006881 Bacteria 925
251 Ga0075436_100253088 3300006914 Bacteria 1255
252 Ga0097620_100015912 3300006931 Bacteria 7560
253 Ga0097620_100062473 3300006931 Bacteria 3755
254 Ga0097620_100381569 3300006931 Bacteria 1505
255 Ga0075435_100197589 3300007076 Bacteria 1703
256 Ga0099794_10006944 3300007265 Bacteria 4618
257 Ga0105240_10060738 3300009093 Bacteria 4711
258 Ga0105240_10926564 3300009093 Bacteria 936
259 Ga0111539_10346031 3300009094 Bacteria 1730
260 Ga0111539_10707231 3300009094 Bacteria 1173
261 Ga0105245_10021771 3300009098 Bacteria 5628
262 Ga0105245_10068553 3300009098 Bacteria 3215
263 Ga0114129_10010743 3300009147 Bacteria 13050
264 Ga0114129_10099962 3300009147 Bacteria 4014
265 Ga0114129_10144723 3300009147 Bacteria 3256
266 Ga0114129_10210258 3300009147 Bacteria 2630
267 Ga0105243_10012929 3300009148 Bacteria 6308
268 Ga0105243_10023715 3300009148 Bacteria 4676
269 Ga0105243_10067732 3300009148 Bacteria 2875
270 Ga0105243_10207399 3300009148 Bacteria 1723
271 Ga0105241_10001449 3300009174 Bacteria 18172
272 Ga0105241_10090610 3300009174 Bacteria 2412
273 Ga0105242_10005126 3300009176 Bacteria 10108
274 Ga0105248_10001754 3300009177 Bacteria 24142
275 Ga0105248_10263899 3300009177 Bacteria 1938
276 Ga0105248_10340410 3300009177 Bacteria 1689
277 Ga0105237_10126399 3300009545 Bacteria 2551
278 Ga0105237_10312830 3300009545 Bacteria 1574
279 Ga0105237_10545068 3300009545 Bacteria 1167
280 Ga0105238_10146490 3300009551 Bacteria 2338
281 Ga0105249_10118191 3300009553 Bacteria 2516
282 Ga0105239_10056746 3300010375 Bacteria 4296
283 Ga0105239_10390188 3300010375 Bacteria 1575
284 Ga0105239_10594484 3300010375 Bacteria 1262
285 Ga0105246_10028791 3300011119 Bacteria 3652
286 Ga0157373_10008985 3300013100 Bacteria 7393
287 Ga0157371_10300441 3300013102 Bacteria 1162
288 Ga0157369_10008315 3300013105 Bacteria 11894
289 Ga0157369_10059006 3300013105 Bacteria 4139
290 Ga0157374_10006883 3300013296 Bacteria 9674
291 Ga0157374_10089880 3300013296 Bacteria 2927
292 Ga0157374_10266333 3300013296 Bacteria 1689
293 Ga0163162_10004380 3300013306 Bacteria 13596
294 Ga0163162_10010478 3300013306 Bacteria 9013
295 Ga0163162_10068872 3300013306 Bacteria 3591
296 Ga0163162_10263531 3300013306 Bacteria 1855
297 Ga0163162_10289352 3300013306 Bacteria 1770
298 Ga0163162_10751239 3300013306 Bacteria 1095
299 Ga0157372_10007790 3300013307 Bacteria 11377
300 Ga0157372_10042328 3300013307 Bacteria 5037
301 Ga0157372_10127623 3300013307 Bacteria 2925
302 Ga0157372_10443476 3300013307 Bacteria 1513
303 Ga0157375_10026501 3300013308 Bacteria 5403
304 Ga0157375_10036021 3300013308 Bacteria 4729
305 Ga0157375_10049266 3300013308 Bacteria 4126
306 Ga0157375_10120675 3300013308 Bacteria 2730
307 Ga0157375_10310312 3300013308 Bacteria 1741
308 Ga0157375_10371159 3300013308 Bacteria 1597
309 Ga0157380_10017586 3300014326 Bacteria 5291
310 Ga0157380_10283959 3300014326 Bacteria 1516
311 Ga0157380_10536829 3300014326 Bacteria 1144
312 Ga0182008_10164858 3300014497 Bacteria 1117
313 Ga0157377_10029263 3300014745 Bacteria 2972
314 Ga0157379_10004851 3300014968 Bacteria 11548
315 Ga0157379_10005603 3300014968 Bacteria 10796
316 Ga0157379_10091462 3300014968 Bacteria 2729
317 Ga0157379_10273835 3300014968 Bacteria 1535
318 Ga0157379_10309071 3300014968 Bacteria 1442
319 Ga0157376_10004429 3300014969 Bacteria 9780
320 Ga0157376_10359686 3300014969 Bacteria 1396
321 Ga0157376_10469222 3300014969 Bacteria 1231
322 Ga0182007_10081963 3300015262 Bacteria 1058
323 Ga0163161_10061823 3300017792 Bacteria 2727
324 Ga0206356_10856873 3300020070 Bacteria 1151
325 Ga0213874_10034738 3300021377 Bacteria 1477
326 Ga0224712_10191535 3300022467 Bacteria 926
327 Ga0207425_1000443 3300025245 Bacteria 27130
328 Ga0209129_1000089 3300025258 Bacteria 177344
329 Ga0209673_1020376 3300025273 Bacteria 2350
330 Ga0209564_1000053 3300025295 Bacteria 351452
331 Ga0209758_1000622 3300025297 Bacteria 54385
332 Ga0209758_1001140 3300025297 Bacteria 34073
333 Ga0209256_1038912 3300025299 Bacteria 1228
334 Ga0207656_10020926 3300025321 Bacteria 2606
335 Ga0207656_10074890 3300025321 Bacteria 1511
336 Ga0207653_10044204 3300025885 Bacteria 1468
337 Ga0207682_10001856 3300025893 Bacteria 9625
338 Ga0207682_10097962 3300025893 Bacteria 1279
339 Ga0207642_10014013 3300025899 Bacteria 2944
340 Ga0207688_10026328 3300025901 Bacteria 3198
341 Ga0207680_10025463 3300025903 Bacteria 3263
342 Ga0207647_10059337 3300025904 Bacteria 2341
343 Ga0207685_10096048 3300025905 Bacteria 1258
344 Ga0207645_10000322 3300025907 Bacteria 39916
345 Ga0207645_10007230 3300025907 Bacteria 7862
346 Ga0207645_10010298 3300025907 Bacteria 6422
347 Ga0207645_10012535 3300025907 Bacteria 5749
348 Ga0207645_10040283 3300025907 Bacteria 2992
349 Ga0207645_10062647 3300025907 Bacteria 2376
350 Ga0207643_10000189 3300025908 Bacteria 42432
351 Ga0207643_10014426 3300025908 Bacteria 4292
352 Ga0207643_10042048 3300025908 Bacteria 2576
353 Ga0207705_10172325 3300025909 Bacteria 1630
354 Ga0207705_10489288 3300025909 Bacteria 955
355 Ga0207684_10000711 3300025910 Bacteria 39198
356 Ga0207684_10009886 3300025910 Bacteria 8413
357 Ga0207684_10023215 3300025910 Bacteria 5297
358 Ga0207684_10045625 3300025910 Bacteria 3716
359 Ga0207684_10071596 3300025910 Bacteria 2946
360 Ga0207684_10072587 3300025910 Bacteria 2923
361 Ga0207654_10019539 3300025911 Bacteria 3577
362 Ga0207654_10172148 3300025911 Bacteria 1407
363 Ga0207707_10000305 3300025912 Bacteria 51662
364 Ga0207671_10203682 3300025914 Bacteria 1546
365 Ga0207671_10379415 3300025914 Bacteria 1123
366 Ga0207660_10001522 3300025917 Bacteria 15576
367 Ga0207660_10006938 3300025917 Bacteria 7334
368 Ga0207662_10011093 3300025918 Bacteria 4985
369 Ga0207657_10000236 3300025919 Bacteria 58234
370 Ga0207657_10011313 3300025919 Bacteria 8863
371 Ga0207657_10019445 3300025919 Bacteria 6450
372 Ga0207657_10140364 3300025919 Bacteria 1974
373 Ga0207657_10228450 3300025919 Bacteria 1489
374 Ga0207649_10002209 3300025920 Bacteria 11006
375 Ga0207652_10003096 3300025921 Bacteria 13865
376 Ga0207652_10017336 3300025921 Bacteria 5893
377 Ga0207652_10077642 3300025921 Bacteria 2898
378 Ga0207652_10454582 3300025921 Bacteria 1154
379 Ga0207652_10576365 3300025921 Bacteria 1010
380 Ga0207646_10001556 3300025922 Bacteria 28080
381 Ga0207646_10006397 3300025922 Bacteria 12181
382 Ga0207646_10198035 3300025922 Bacteria 1814
383 Ga0207681_10017325 3300025923 Bacteria 4522
384 Ga0207681_10258891 3300025923 Bacteria 1361
385 Ga0207681_10281159 3300025923 Bacteria 1310
386 Ga0207681_10532513 3300025923 Bacteria 965
387 Ga0207694_10196236 3300025924 Bacteria 1641
388 Ga0207650_10000274 3300025925 Bacteria 54226
389 Ga0207650_10024125 3300025925 Bacteria 4320
390 Ga0207659_10004087 3300025926 Bacteria 8804
391 Ga0207659_10007965 3300025926 Bacteria 6550
392 Ga0207659_10012735 3300025926 Bacteria 5367
393 Ga0207659_10051646 3300025926 Bacteria 2925
394 Ga0207687_10020960 3300025927 Bacteria 4339
395 Ga0207644_10030694 3300025931 Bacteria 3740
396 Ga0207644_10060113 3300025931 Bacteria 2749
397 Ga0207644_10110103 3300025931 Bacteria 2081
398 Ga0207644_10136595 3300025931 Bacteria 1883
399 Ga0207644_10194882 3300025931 Bacteria 1595
400 Ga0207706_10000272 3300025933 Bacteria 56285
401 Ga0207706_10018754 3300025933 Bacteria 6223
402 Ga0207706_10020816 3300025933 Bacteria 5892
403 Ga0207706_10052654 3300025933 Bacteria 3593
404 Ga0207706_10494059 3300025933 Bacteria 1057
405 Ga0207686_10018636 3300025934 Bacteria 3932
406 Ga0207709_10001963 3300025935 Bacteria 13435
407 Ga0207709_10105499 3300025935 Bacteria 1873
408 Ga0207709_10106376 3300025935 Bacteria 1866
409 Ga0207709_10110790 3300025935 Bacteria 1835
410 Ga0207709_10186120 3300025935 Bacteria 1471
411 Ga0207709_10268522 3300025935 Bacteria 1254
412 Ga0207709_10419364 3300025935 Bacteria 1028
413 Ga0207670_10087280 3300025936 Bacteria 2197
414 Ga0207669_10001512 3300025937 Bacteria 9915
415 Ga0207669_10059825 3300025937 Bacteria 2332
416 Ga0207704_10005558 3300025938 Bacteria 5810
417 Ga0207704_10011823 3300025938 Bacteria 4313
418 Ga0207704_10461433 3300025938 Bacteria 1016
419 Ga0207665_10011914 3300025939 Bacteria 5711
420 Ga0207691_10000715 3300025940 Bacteria 32846
421 Ga0207691_10004314 3300025940 Bacteria 13814
422 Ga0207691_10009010 3300025940 Bacteria 9567
423 Ga0207691_10039309 3300025940 Bacteria 4376
424 Ga0207691_10064727 3300025940 Bacteria 3311
425 Ga0207711_10004324 3300025941 Bacteria 12137
426 Ga0207711_10077308 3300025941 Bacteria 2901
427 Ga0207711_10229030 3300025941 Bacteria 1702
428 Ga0207711_10232512 3300025941 Bacteria 1689
429 Ga0207689_10000832 3300025942 Bacteria 29759
430 Ga0207689_10001173 3300025942 Bacteria 25236
431 Ga0207689_10008002 3300025942 Bacteria 9230
432 Ga0207689_10010903 3300025942 Bacteria 7817
433 Ga0207689_10043546 3300025942 Bacteria 3711
434 Ga0207689_10155700 3300025942 Bacteria 1884
435 Ga0207689_10422118 3300025942 Bacteria 1113
436 Ga0207689_10488809 3300025942 Bacteria 1031
437 Ga0207689_10596052 3300025942 Bacteria 929
438 Ga0207661_10295863 3300025944 Bacteria 1450
439 Ga0207679_10020576 3300025945 Bacteria 4454
440 Ga0207679_10050994 3300025945 Bacteria 3027
441 Ga0207679_10415320 3300025945 Bacteria 1186
442 Ga0207679_10607702 3300025945 Bacteria 986
443 Ga0207667_10001629 3300025949 Bacteria 28252
444 Ga0207667_10036150 3300025949 Bacteria 5296
445 Ga0207651_10006282 3300025960 Bacteria 6197
446 Ga0207651_10026083 3300025960 Bacteria 3644
447 Ga0207651_10098610 3300025960 Bacteria 2161
448 Ga0207712_10017454 3300025961 Bacteria 4661
449 Ga0207712_10344323 3300025961 Bacteria 1237
450 Ga0207668_10005373 3300025972 Bacteria 7537
451 Ga0207640_10007685 3300025981 Bacteria 5958
452 Ga0207640_10052875 3300025981 Bacteria 2648
453 Ga0207658_10042974 3300025986 Bacteria 3282
454 Ga0207658_10176903 3300025986 Bacteria 1763
455 Ga0207658_10218342 3300025986 Bacteria 1602
456 Ga0207658_10280858 3300025986 Bacteria 1427
457 Ga0207677_10013008 3300026023 Bacteria 4809
458 Ga0207677_10019121 3300026023 Bacteria 4129
459 Ga0207677_10058567 3300026023 Bacteria 2653
460 Ga0207677_10130970 3300026023 Bacteria 1904
461 Ga0207703_10009878 3300026035 Bacteria 7486
462 Ga0207703_10015165 3300026035 Bacteria 6014
463 Ga0207703_10020042 3300026035 Bacteria 5225
464 Ga0207703_10020953 3300026035 Bacteria 5114
465 Ga0207639_10037103 3300026041 Bacteria 3618
466 Ga0207678_10001044 3300026067 Bacteria 25314
467 Ga0207678_10003876 3300026067 Bacteria 13447
468 Ga0207678_10087509 3300026067 Bacteria 2662
469 Ga0207708_10039235 3300026075 Bacteria 3608
470 Ga0207708_10121747 3300026075 Bacteria 2033
471 Ga0207702_10001008 3300026078 Bacteria 28905
472 Ga0207702_10018460 3300026078 Bacteria 5771
473 Ga0207702_10138804 3300026078 Bacteria 2197
474 Ga0207702_10722787 3300026078 Bacteria 982
475 Ga0207641_10020058 3300026088 Bacteria 5488
476 Ga0207641_10048631 3300026088 Bacteria 3580
477 Ga0207641_10232663 3300026088 Bacteria 1713
478 Ga0207641_10369771 3300026088 Bacteria 1371
479 Ga0207648_10001078 3300026089 Bacteria 30557
480 Ga0207648_10002589 3300026089 Bacteria 19365
481 Ga0207648_10024017 3300026089 Bacteria 5449
482 Ga0207648_10030536 3300026089 Bacteria 4771
483 Ga0207648_10036689 3300026089 Bacteria 4319
484 Ga0207648_10090922 3300026089 Bacteria 2668
485 Ga0207648_10097720 3300026089 Bacteria 2570
486 Ga0207648_10099107 3300026089 Bacteria 2552
487 Ga0207648_10247272 3300026089 Bacteria 1589
488 Ga0207648_10660586 3300026089 Bacteria 967
489 Ga0207676_10024383 3300026095 Bacteria 4475
490 Ga0207676_10041574 3300026095 Bacteria 3530
491 Ga0207674_10000170 3300026116 Bacteria 78770
492 Ga0207674_10004485 3300026116 Bacteria 16783
493 Ga0207674_10009183 3300026116 Bacteria 11338
494 Ga0207674_10100398 3300026116 Bacteria 2875
495 Ga0207675_100000729 3300026118 Bacteria 32615
496 Ga0207683_10126925 3300026121 Bacteria 2293
497 Ga0207683_10172439 3300026121 Bacteria 1960
498 Ga0207683_10270781 3300026121 Bacteria 1551
499 Ga0207698_10008751 3300026142 Bacteria 6419
500 Ga0207698_10147496 3300026142 Bacteria 2037
501 Ga0207698_10201961 3300026142 Bacteria 1781
502 Ga0207698_10444184 3300026142 Bacteria 1250
503 Ga0207698_10562292 3300026142 Bacteria 1120
504 Ga0209969_1001433 3300027360 Bacteria 3281
505 Ga0209981_1005156 3300027378 Bacteria 1729
506 Ga0209996_1003328 3300027395 Bacteria 2017
507 Ga0209984_1003684 3300027424 Bacteria 1767
508 Ga0209995_1002211 3300027471 Bacteria 3059
509 Ga0209999_1001883 3300027543 Bacteria 3648
510 Ga0209982_1007520 3300027552 Bacteria 1591
511 Ga0209983_1017287 3300027665 Bacteria 1492
512 Ga0209588_1030493 3300027671 Bacteria 1723
513 Ga0209971_1000291 3300027682 Bacteria 13987
514 Ga0209966_1000119 3300027695 Bacteria 35102
515 Ga0209998_10000058 3300027717 Bacteria 46200
516 Ga0209974_10001860 3300027876 Bacteria 7703
517 Ga0207428_10000063 3300027907 Bacteria 151868
518 Ga0268266_10126393 3300028379 Bacteria 2282
519 Ga0268265_10015672 3300028380 Bacteria 5192
520 Ga0268265_10048159 3300028380 Bacteria 3198
521 Ga0268265_10205451 3300028380 Bacteria 1712
522 Ga0268265_10445708 3300028380 Bacteria 1208
523 Ga0268264_10006835 3300028381 Bacteria 9581
524 Ga0268264_10010182 3300028381 Bacteria 7781
525 Ga0268264_10023911 3300028381 Bacteria 4984
526 Ga0268264_10168889 3300028381 Bacteria 1977
527 Ga0268264_10179073 3300028381 Bacteria 1924
528 Ga0268264_10209991 3300028381 Bacteria 1787
529 Ga0307517_10000058 3300028786 Bacteria 148725
530 Ga0307517_10162992 3300028786 Bacteria 1490
531 Ga0307515_10000824 3300028794 Bacteria 71229
532 Ga0307515_10010044 3300028794 Bacteria 18205
533 Ga0307515_10036865 3300028794 Bacteria 7890
534 Ga0307515_10248969 3300028794 Bacteria 1533
535 Ga0307512_10026527 3300030522 Bacteria 5116
536 Ga0307512_10068778 3300030522 Bacteria 2653
537 Ga0307513_10008920 3300031456 Bacteria 12750
538 Ga0307513_10045825 3300031456 Bacteria 4775
539 Ga0307509_10000409 3300031507 Bacteria 72273
540 Ga0307509_10008614 3300031507 Bacteria 12952
541 Ga0307509_10010192 3300031507 Bacteria 11560
542 Ga0307509_10013282 3300031507 Bacteria 9762
543 Ga0307408_100027867 3300031548 Bacteria 3898
544 Ga0307408_100051446 3300031548 Bacteria 2967
545 Ga0307508_10001404 3300031616 Bacteria 27112
546 Ga0307508_10002090 3300031616 Bacteria 21524
547 Ga0307514_10071040 3300031649 Bacteria 2612
548 Ga0307516_10000348 3300031730 Bacteria 60054
549 Ga0307516_10004552 3300031730 Bacteria 17049
550 Ga0307516_10016846 3300031730 Bacteria 7629
551 Ga0307516_10131082 3300031730 Bacteria 2286
552 Ga0307516_10363972 3300031730 Bacteria 1110
553 Ga0307516_10407186 3300031730 Bacteria 1019
554 Ga0307405_10014058 3300031731 Bacteria 4292
555 Ga0307405_10075426 3300031731 Bacteria 2184
556 Ga0307413_10033179 3300031824 Bacteria 2936
557 Ga0307413_10331196 3300031824 Bacteria 1167
558 Ga0307410_10072967 3300031852 Bacteria 2385
559 Ga0307406_10020138 3300031901 Bacteria 3924
560 Ga0307407_10175024 3300031903 Bacteria 1417
561 Ga0307412_10026142 3300031911 Bacteria 3625
562 Ga0307412_10074733 3300031911 Bacteria 2323
563 Ga0307409_100003728 3300031995 Bacteria 8370
564 Ga0307409_100186842 3300031995 Bacteria 1840
565 Ga0307416_100024412 3300032002 Bacteria 4413
566 Ga0307411_10002164 3300032005 Bacteria 8530
567 Ga0307411_10074095 3300032005 Bacteria 2318
568 Ga0307415_100000506 3300032126 Bacteria 16921
569 Ga0307507_10061301 3300033179 Bacteria 3503
570 Ga0307510_10004970 3300033180 Bacteria 15731
571 Ga0307510_10062999 3300033180 Bacteria 3781
572 Ga0373948_0007504 3300034817 Bacteria 1836
573 Ga0373959_0003071 3300034820 Bacteria 2654
574 Ga0373928_0023749 3300035084 Bacteria 1310
575 Ga0373929_0029222 3300035085 Bacteria 1168
576 Ga0373940_0033364 3300035088 Bacteria 1384
577 Ga0373949_0013161 3300035090 Bacteria 1833
578 Ga0373939_0032891 3300035114 Bacteria 1511
579 Ga0373960_0009270 3300035121 Bacteria 2379
580 Ga0373961_0010573 3300035241 Bacteria 2276
581 Ga0373962_0016431 3300035242 Bacteria 1908
582 Ga0373931_0020684 3300035691 Bacteria 3295
583 Ga0373933_0238316 3300035724 Bacteria 1170
584 Ga0395899_0007226 3300037312 Bacteria 8597
585 Ga0395900_0051764 3300037418 Bacteria 4229
586 Ga0395905_0006766 3300037471 Bacteria 11482
587 Ga0395905_0007991 3300037471 Bacteria 10454
588 Ga0395901_0079284 3300038443 Bacteria 3429
589 Ga0436363_0359156 3300039450 Bacteria 2119
590 Ga0451802_0716501 3300041460 Bacteria 1547
591 Ga0439431_0039210 3300041997 Bacteria 1201
592 Ga0439448_0000859 3300042005 Bacteria 7411
593 Ga0439450_025501 3300042008 Bacteria 1296
594 Ga0439450_047837 3300042008 Bacteria 1009
595 Ga0439455_0060302 3300042012 Bacteria 1005
596 Ga0450923_006436 3300042125 Bacteria 1948
597 Ga0450888_014163 3300042126 Bacteria 963
598 Ga0439435_0064024 3300042436 Bacteria 1077
599 Ga0439459_0015593 3300042438 Bacteria 1394
600 Ga0439464_0000449 3300042439 Bacteria 8208
601 Ga0439464_0005518 3300042439 Bacteria 3274
602 Ga0439460_0030291 3300042461 Bacteria 1537
603 Ga0439460_0063628 3300042461 Bacteria 1130
604 Ga0451577_0003146 3300042876 Bacteria 18592
605 Ga0451577_0046227 3300042876 Bacteria 3895
606 Ga0451577_0054892 3300042876 Bacteria 3556
607 Ga0451577_0516599 3300042876 Bacteria 1084
608 Ga0453683_0021817 3300044673 Bacteria 4084
609 Ga0453684_0008228 3300044712 Bacteria 18804
610 Ga0453684_0300507 3300044712 Bacteria 1824
611 Ga0451576_0003981 3300045051 Bacteria 19672
612 Ga0451576_0036252 3300045051 Bacteria 5229
613 Ga0451576_0047000 3300045051 Bacteria 4540
614 Ga0451576_0595884 3300045051 Bacteria 1161
615 Ga0495592_0000112 3300046454 Bacteria 71190
616 Ga0495603_0004217 3300046455 Bacteria 8564
617 Ga0495590_0009981 3300046457 Bacteria 3588
618 Ga0495629_0006604 3300046459 Bacteria 8586
619 Ga0495650_0003996 3300046471 Bacteria 10356
620 Ga0495580_0098725 3300046472 Bacteria 2031
621 Ga0495580_0253656 3300046472 Bacteria 1204
622 Ga0495580_0414766 3300046472 Bacteria 906
623 Ga0495639_0063590 3300046475 Bacteria 1694
624 Ga0495664_0024206 3300046477 Bacteria 3527
625 Ga0495584_0050670 3300046491 Bacteria 2091
626 Ga0495607_0003069 3300046501 Bacteria 12988
627 Ga0495606_0184645 3300046507 Bacteria 1200
628 Ga0495608_0090291 3300046511 Bacteria 1982
629 Ga0495610_0059070 3300046512 Bacteria 1832
630 Ga0495620_0098373 3300046515 Bacteria 1168
631 Ga0495630_0048707 3300046517 Bacteria 3171
632 Ga0495630_0060498 3300046517 Bacteria 2843
633 Ga0495632_0006278 3300046519 Bacteria 7680
634 Ga0495643_0016904 3300046522 Bacteria 4278
635 Ga0495666_0015510 3300046526 Bacteria 3793
636 Ga0495586_0019553 3300046535 Bacteria 3607
637 Ga0495586_0213417 3300046535 Bacteria 1096
638 Ga0495597_0051102 3300046542 Bacteria 1823
639 Ga0495645_0005962 3300046543 Bacteria 8424
640 Ga0495667_0131490 3300046559 Bacteria 1614
641 Ga0495611_0027388 3300046648 Bacteria 2491
642 Ga0495625_0003780 3300046660 Bacteria 14694
643 Ga0495657_0088345 3300046675 Bacteria 1993
644 Ga0495646_0046485 3300046680 Bacteria 2646
645 Ga0495658_0235150 3300046683 Bacteria 1150
646 Ga0495613_0032906 3300046689 Bacteria 3852
647 Ga0495624_0049266 3300046690 Bacteria 2672
648 Ga0495670_0030445 3300046691 Bacteria 2681
649 Ga0495649_0001025 3300046694 Bacteria 21918
650 Ga0495660_0110666 3300046810 Bacteria 1402
651 Ga0495581_0009265 3300047315 Bacteria 5697
652 Ga0495676_0029886 3300047321 Bacteria 4633
653 Ga0495687_002929 3300047443 Bacteria 12967
654 Ga0495687_017366 3300047443 Bacteria 3592
655 Ga0495675_0049837 3300047444 Bacteria 2661
656 Ga0495681_0031006 3300047470 Bacteria 2714
657 Ga0495686_0134366 3300047472 Bacteria 1464
658 Ga0495593_0070259 3300047673 Bacteria 1820
659 Ga0495614_0049469 3300048089 Bacteria 1802
660 Ga0496100_0022328 3300048903 Bacteria 3829
661 Ga0496102_0198685 3300048905 Bacteria 1890
662 Ga0496102_0287571 3300048905 Bacteria 1549
663 Ga0496103_0119282 3300048906 Bacteria 1680
664 Ga0496104_0054583 3300048907 Bacteria 3777
665 Ga0496105_0041292 3300048908 Bacteria 3802
666 Ga0496106_0013659 3300048909 Bacteria 5995
667 Ga0496106_0033856 3300048909 Bacteria 3814
668 Ga0496107_0004364 3300048910 Bacteria 9576
669 Ga0496107_0557272 3300048910 Bacteria 849
670 Ga0496108_0041706 3300048911 Bacteria 3832
671 Ga0496109_0008784 3300048912 Bacteria 8604
672 Ga0496110_0089226 3300048913 Bacteria 2755
673 Ga0496110_0225561 3300048913 Bacteria 1704
674 Ga0496111_0083588 3300048914 Bacteria 2333
675 Ga0496112_0303028 3300048915 Bacteria 1543
676 Ga0496113_0296386 3300048916 Bacteria 1294
677 Ga0496114_0007892 3300048917 Bacteria 8421
678 Ga0496114_0067040 3300048917 Bacteria 3010
679 Ga0496115_0002358 3300048918 Bacteria 13549
680 Ga0496115_0490592 3300048918 Bacteria 988
681 Ga0501038_0329262 3300049574 Bacteria 1193
682 Ga0501039_0059960 3300049575 Bacteria 2947
683 Ga0501039_0155232 3300049575 Bacteria 1798
684 Ga0501040_0036453 3300049576 Bacteria 3338
685 Ga0501041_0006894 3300049577 Bacteria 6661
686 Ga0501042_0002097 3300049578 Bacteria 12100
687 Ga0501046_0003631 3300049580 Bacteria 14135
688 Ga0501047_0170381 3300049581 Bacteria 2046
689 Ga0501048_0012174 3300049582 Bacteria 6409
690 Ga0501068_0179035 3300049584 Bacteria 1340
691 Ga0501075_0016504 3300049591 Bacteria 5320
692 Ga0501076_0075162 3300049592 Bacteria 2708
693 Ga0501077_0185099 3300049593 Bacteria 1323
694 Ga0501079_0002846 3300049741 Bacteria 12618
695 Ga0501079_0018027 3300049741 Bacteria 5391
696 Ga0501080_0470320 3300049742 Bacteria 1125
697 Ga0501081_0001320 3300049743 Bacteria 15130
698 Ga0501081_0004839 3300049743 Bacteria 8653
699 Ga0501083_0082305 3300049744 Bacteria 2133
700 Ga0501045_0007296 3300049824 Bacteria 7680
701 nmdc:mga03683_45206_c1 3300050489 Bacteria 1822
702 nmdc:mga00v17_199322_c1 3300050491 Bacteria 1294
703 nmdc:mga00v17_81790_c1 3300050491 Bacteria 2018
704 nmdc:mga0k408_11832_c2 3300050493 Bacteria 3925
705 nmdc:mga0k408_15715_c1 3300050493 Bacteria 4190
706 nmdc:mga0k408_35_c2 3300050493 Bacteria 43762
707 nmdc:mga0k408_7518_c1 3300050493 Bacteria 5818
708 nmdc:mga0k408_7977_c1 3300050493 Bacteria 5674
709 nmdc:mga06z11_81309_c1 3300050494 Bacteria 1739
710 nmdc:mga06z11_84191_c1 3300050494 Bacteria 1713
711 nmdc:mga07m45_104850_c1 3300050496 Bacteria 1626
712 nmdc:mga07m45_107921_c1 3300050496 Bacteria 1602
713 nmdc:mga07m45_12415_c1 3300050496 Bacteria 3670
714 nmdc:mga07m45_28122_c1 3300050496 Bacteria 3103
715 nmdc:mga07m45_40908_c1 3300050496 Bacteria 2595
716 nmdc:mga07m45_41340_c1 3300050496 Bacteria 2582
717 nmdc:mga07m45_91015_c1 3300050496 Bacteria 1747
718 nmdc:mga07m45_923_c1 3300050496 Bacteria 12857
719 nmdc:mga05p37_13957_c1 3300050507 Bacteria 9633
720 nmdc:mga05p37_154113_c1 3300050507 Bacteria 2809
721 nmdc:mga05p37_245262_c1 3300050507 Bacteria 2151
722 nmdc:mga05p37_82742_c1 3300050507 Bacteria 3955
723 nmdc:mga09592_1606_c1 3300050508 Bacteria 18226
724 nmdc:mga09592_56144_c1 3300050508 Bacteria 3327
725 nmdc:mga0qj67_61961_c1 3300050509 Bacteria 2971
726 nmdc:mga0qj67_885_c1 3300050509 Bacteria 20530
727 nmdc:mga06r32_233968_c1 3300050510 Bacteria 1825
728 nmdc:mga06r32_392_c1 3300050510 Bacteria 36905
729 nmdc:mga08y16_11607_c1 3300050511 Bacteria 9255
730 nmdc:mga08y16_518963_c1 3300050511 Bacteria 1208
731 nmdc:mga0n895_227658_c1 3300050512 Bacteria 1893
732 nmdc:mga0n895_25136_c1 3300050512 Bacteria 5624
733 nmdc:mga0n895_464651_c1 3300050512 Bacteria 1277
734 nmdc:mga0rr50_180216_c1 3300050513 Bacteria 1727
735 nmdc:mga0rr50_402266_c1 3300050513 Bacteria 1157
736 nmdc:mga08x19_312540_c1 3300050514 Bacteria 1093
737 nmdc:mga08x19_372326_c1 3300050514 Bacteria 1000
738 nmdc:mga0a205_114476_c1 3300050515 Bacteria 2596
739 nmdc:mga0a205_695_c1 3300050515 Bacteria 6777
740 nmdc:mga0sz30_9464_c1 3300050516 Bacteria 3710
741 Ga0500578_0010617 3300053086 Bacteria 5949
742 Ga0500644_0002391 3300053088 Bacteria 4709
743 Ga0500644_0072659 3300053088 Bacteria 1244
744 Ga0500594_0004831 3300053118 Bacteria 2978
745 Ga0500608_079263 3300053122 Bacteria 1552
746 Ga0500658_0126087 3300053134 Bacteria 1138
747 Ga0500559_0000011 3300053136 Bacteria 164751
748 Ga0500622_0007958 3300053156 Bacteria 5967
749 Ga0500645_000882 3300053730 Bacteria 17438
750 Ga0500587_004139 3300053739 Bacteria 2006
751 Ga0501084_0009429 3300054114 Bacteria 8079
752 Ga0587084_011289 3300059477 Bacteria 1188
753 Ga0587071_019689 3300060344 Bacteria 1224
754 Ga0587111_0016181 3300060346 Bacteria 1373
755 Ga0501082_0028067 3300060353 Bacteria 4849
756 2643969584 2643221592 Bacteria 6608788
757 2644143882 2643221625 Bacteria 6512927
758 2644276409 2643221648 Bacteria 6521465
759 2644304601 2643221654 Bacteria 5273570
760 Ga0495606_0192770
761 JGI25152J39213_1005889
762 JGI25153J46596_10000798
763 JGI25153J46596_10002808
764 JGI26128J50194_1004038
765 JGI26129J50193_1000637
766 JGI26141J51220_1000540
767 Ga0055526_1004131
768 Ga0058861_11915976
769 Ga0065712_10137294
770 Ga0065715_10193067
771 Ga0070658_10081824
772 Ga0070676_10001262
773 Ga0070676_10007437
774 Ga0070676_10052630
775 Ga0070683_100114667
776 Ga0070683_100212645
777 Ga0070690_100013368
778 Ga0070690_100136641
779 Ga0070690_100262786
780 Ga0070670_100002700
781 Ga0070670_100017679
782 Ga0070670_100093306
783 Ga0070670_100406438
784 Ga0070677_10000616
785 Ga0070677_10214726
786 Ga0070677_10226762
787 Ga0068869_100002323
788 Ga0068869_100003892
789 Ga0068869_100005979
790 Ga0068869_100036918
791 Ga0068869_100588140
792 Ga0068869_100644211
793 Ga0070666_10029990
794 Ga0070680_100002051
795 Ga0070680_100012045
796 Ga0070682_100032025
797 Ga0068868_100010070
798 Ga0068868_100021973
799 Ga0068868_100045018
800 Ga0068868_100105232
801 Ga0068868_100107731
802 Ga0068868_100259749
803 Ga0070660_100001240
804 Ga0070660_100048676
805 Ga0070660_100066924
806 Ga0070689_100234651
807 Ga0070691_10068542
808 Ga0070687_100011058
809 Ga0070661_100000422
810 Ga0070661_100011633
811 Ga0070661_100034265
812 Ga0070692_10011701
813 Ga0070668_100022449
814 Ga0070668_100043965
815 Ga0070669_100035576
816 Ga0070669_100039688
817 Ga0070669_100196273
818 Ga0070675_100000941
819 Ga0070675_100012464
820 Ga0070675_100028275
821 Ga0070675_100063115
822 Ga0070675_100139245
823 Ga0070671_100031986
824 Ga0070671_100037275
825 Ga0070671_100078941
826 Ga0070671_100316978
827 Ga0070674_100006525
828 Ga0070674_100010278
829 Ga0070673_100003922
830 Ga0070673_100026453
831 Ga0070673_100043982
832 Ga0070659_100001253
833 Ga0070659_100017014
834 Ga0070659_100027875
835 Ga0070667_100019278
836 Ga0070667_100204955
837 Ga0070667_100258169
838 Ga0070703_10002821
839 Ga0070709_10098871
840 Ga0070701_10041948
841 Ga0070705_100009120
842 Ga0070705_100019096
843 Ga0070705_100086644
844 Ga0070705_100093929
845 Ga0070694_100012853
846 Ga0070694_100021179
847 Ga0070694_100060133
848 Ga0070694_100078795
849 Ga0070663_100008587
850 Ga0070663_100009340
851 Ga0070663_100083011
852 Ga0070663_100531143
853 Ga0070678_100028369
854 Ga0070678_100328785
855 Ga0070678_100396652
856 Ga0070662_100000858
857 Ga0070662_100033745
858 Ga0070662_100047690
859 Ga0070662_100051372
860 Ga0070681_10021592
861 Ga0070681_10049154
862 Ga0070681_10326316
863 Ga0068867_100000153
864 Ga0068867_100006148
865 Ga0068867_100016108
866 Ga0068867_100018163
867 Ga0068867_100021321
868 Ga0068867_100022540
869 Ga0068867_100060996
870 Ga0068867_100086362
871 Ga0068867_100546593
872 Ga0070706_100004190
873 Ga0070706_100008879
874 Ga0070706_100013341
875 Ga0070706_100134668
876 Ga0070707_100019530
877 Ga0070707_100066774
878 Ga0070707_100159827
879 Ga0070698_100003263
880 Ga0070698_100030615
881 Ga0070698_100076477
882 Ga0070698_100121726
883 Ga0070699_100008382
884 Ga0070699_100045715
885 Ga0070679_100006631
886 Ga0070679_100013264
887 Ga0070679_100081666
888 Ga0070679_100218327
889 Ga0070679_100443880
890 Ga0070679_100460631
891 Ga0070684_100057636
892 Ga0070684_100059956
893 Ga0070697_100003510
894 Ga0070697_100070844
895 Ga0070697_100346064
896 Ga0068853_100003958
897 Ga0068853_100053872
898 Ga0068853_100158679
899 Ga0068853_100864198
900 Ga0070672_100006281
901 Ga0070672_100006413
902 Ga0070672_100019229
903 Ga0070672_100020389
904 Ga0070672_100095753
905 Ga0070695_100046025
906 Ga0070695_100065729
907 Ga0070695_100119256
908 Ga0070695_100139884
909 Ga0070696_100000636
910 Ga0070693_100000180
911 Ga0070693_100073212
912 Ga0070693_100374259
913 Ga0070665_100164969
914 Ga0070704_100066937
915 Ga0070704_100142327
916 Ga0070704_100258623
917 Ga0068855_100000437
918 Ga0068855_100029107
919 Ga0068855_100165514
920 Ga0068855_100829883
921 Ga0070664_100035536
922 Ga0070664_100211578
923 Ga0070664_100391135
924 Ga0068857_100005221
925 Ga0068857_100008167
926 Ga0068857_100026534
927 Ga0068857_100124042
928 Ga0068857_100130409
929 Ga0068857_100527282
930 Ga0068854_100006722
931 Ga0068854_100029414
932 Ga0068854_100357200
933 Ga0068856_100012854
934 Ga0068856_100027847
935 Ga0068856_100074996
936 Ga0068856_100126177
937 Ga0068856_100431508
938 Ga0068856_100899506
939 Ga0070702_100036796
940 Ga0070702_100247765
941 Ga0068852_100036132
942 Ga0068852_100079518
943 Ga0068852_100414178
944 Ga0068852_100630916
945 Ga0068859_100015911
946 Ga0068859_100062475
947 Ga0068859_100381608
948 Ga0068864_100011870
949 Ga0068864_100016780
950 Ga0068864_100044367
951 Ga0068861_100004099
952 Ga0068861_100006344
953 Ga0068861_100113881
954 Ga0068851_10013881
955 Ga0068851_10031280
956 Ga0068870_10001471
957 Ga0068870_10035737
958 Ga0068870_10157697
959 Ga0068863_100012567
960 Ga0068863_100049994
961 Ga0068863_100268363
962 Ga0068858_100003457
963 Ga0068858_100239308
964 Ga0068860_100002242
965 Ga0068860_100010521
966 Ga0068860_100066431
967 Ga0068860_100132149
968 Ga0068860_100184581
969 Ga0081455_10008006
970 Ga0081455_10257427
971 Ga0075365_10018613
972 Ga0075368_10029355
973 Ga0075364_10435575
974 Ga0075362_10039885
975 Ga0075362_10042537
976 Ga0075367_10003702
977 Ga0075367_10006367
978 Ga0075367_10015749
979 Ga0075366_10000784
980 Ga0075366_10004912
981 Ga0075366_10016047
982 Ga0075366_10031175
983 Ga0075366_10036045
984 Ga0075366_10155004
985 Ga0097621_100017940
986 Ga0097621_100023342
987 Ga0075370_10000805
988 Ga0075370_10001035
989 Ga0075370_10001039
990 Ga0075370_10003022
991 Ga0075370_10011261
992 Ga0075370_10050254
993 Ga0075370_10066811
994 Ga0075370_10106586
995 Ga0068871_100014425
996 Ga0075430_100018589
997 Ga0075430_100071576
998 Ga0075431_100029304
999 Ga0075433_10016777
1000 Ga0075433_10057869
1001 Ga0075433_10487550
1002 Ga0075434_100539515
1003 Ga0075429_100000055
1004 Ga0075429_100095711
1005 Ga0068865_100014114
1006 Ga0068865_100282138
1007 Ga0068865_100527023
1008 Ga0068865_100542464
1009 Ga0068865_100607096
1010 Ga0075436_100253088
1011 Ga0097620_100015912
1012 Ga0097620_100062473
1013 Ga0097620_100381569
1014 Ga0075435_100197589
1015 Ga0099794_10006944
1016 Ga0105240_10060738
1017 Ga0105240_10926564
1018 Ga0111539_10346031
1019 Ga0111539_10707231
1020 Ga0105245_10021771
1021 Ga0105245_10068553
1022 Ga0114129_10010743
1023 Ga0114129_10099962
1024 Ga0114129_10144723
1025 Ga0114129_10210258
1026 Ga0105243_10012929
1027 Ga0105243_10023715
1028 Ga0105243_10067732
1029 Ga0105243_10207399
1030 Ga0105241_10001449
1031 Ga0105241_10090610
1032 Ga0105242_10005126
1033 Ga0105248_10001754
1034 Ga0105248_10263899
1035 Ga0105248_10340410
1036 Ga0105237_10126399
1037 Ga0105237_10312830
1038 Ga0105237_10545068
1039 Ga0105238_10146490
1040 Ga0105249_10118191
1041 Ga0105239_10056746
1042 Ga0105239_10390188
1043 Ga0105239_10594484
1044 Ga0105246_10028791
1045 Ga0157373_10008985
1046 Ga0157371_10300441
1047 Ga0157369_10008315
1048 Ga0157369_10059006
1049 Ga0157374_10006883
1050 Ga0157374_10089880
1051 Ga0157374_10266333
1052 Ga0163162_10004380
1053 Ga0163162_10010478
1054 Ga0163162_10068872
1055 Ga0163162_10263531
1056 Ga0163162_10289352
1057 Ga0163162_10751239
1058 Ga0157372_10007790
1059 Ga0157372_10042328
1060 Ga0157372_10127623
1061 Ga0157372_10443476
1062 Ga0157375_10026501
1063 Ga0157375_10036021
1064 Ga0157375_10049266
1065 Ga0157375_10120675
1066 Ga0157375_10310312
1067 Ga0157375_10371159
1068 Ga0157380_10017586
1069 Ga0157380_10283959
1070 Ga0157380_10536829
1071 Ga0182008_10164858
1072 Ga0157377_10029263
1073 Ga0157379_10004851
1074 Ga0157379_10005603
1075 Ga0157379_10091462
1076 Ga0157379_10273835
1077 Ga0157379_10309071
1078 Ga0157376_10004429
1079 Ga0157376_10359686
1080 Ga0157376_10469222
1081 Ga0182007_10081963
1082 Ga0163161_10061823
1083 Ga0206356_10856873
1084 Ga0213874_10034738
1085 Ga0224712_10191535
1086 Ga0207425_1000443
1087 Ga0209129_1000089
1088 Ga0209673_1020376
1089 Ga0209564_1000053
1090 Ga0209758_1000622
1091 Ga0209758_1001140
1092 Ga0209256_1038912
1093 Ga0207656_10020926
1094 Ga0207656_10074890
1095 Ga0207653_10044204
1096 Ga0207682_10001856
1097 Ga0207682_10097962
1098 Ga0207642_10014013
1099 Ga0207688_10026328
1100 Ga0207680_10025463
1101 Ga0207647_10059337
1102 Ga0207685_10096048
1103 Ga0207645_10000322
1104 Ga0207645_10007230
1105 Ga0207645_10010298
1106 Ga0207645_10012535
1107 Ga0207645_10040283
1108 Ga0207645_10062647
1109 Ga0207643_10000189
1110 Ga0207643_10014426
1111 Ga0207643_10042048
1112 Ga0207705_10172325
1113 Ga0207705_10489288
1114 Ga0207684_10000711
1115 Ga0207684_10009886
1116 Ga0207684_10023215
1117 Ga0207684_10045625
1118 Ga0207684_10071596
1119 Ga0207684_10072587
1120 Ga0207654_10019539
1121 Ga0207654_10172148
1122 Ga0207707_10000305
1123 Ga0207671_10203682
1124 Ga0207671_10379415
1125 Ga0207660_10001522
1126 Ga0207660_10006938
1127 Ga0207662_10011093
1128 Ga0207657_10000236
1129 Ga0207657_10011313
1130 Ga0207657_10019445
1131 Ga0207657_10140364
1132 Ga0207657_10228450
1133 Ga0207649_10002209
1134 Ga0207652_10003096
1135 Ga0207652_10017336
1136 Ga0207652_10077642
1137 Ga0207652_10454582
1138 Ga0207652_10576365
1139 Ga0207646_10001556
1140 Ga0207646_10006397
1141 Ga0207646_10198035
1142 Ga0207681_10017325
1143 Ga0207681_10258891
1144 Ga0207681_10281159
1145 Ga0207681_10532513
1146 Ga0207694_10196236
1147 Ga0207650_10000274
1148 Ga0207650_10024125
1149 Ga0207659_10004087
1150 Ga0207659_10007965
1151 Ga0207659_10012735
1152 Ga0207659_10051646
1153 Ga0207687_10020960
1154 Ga0207644_10030694
1155 Ga0207644_10060113
1156 Ga0207644_10110103
1157 Ga0207644_10136595
1158 Ga0207644_10194882
1159 Ga0207706_10000272
1160 Ga0207706_10018754
1161 Ga0207706_10020816
1162 Ga0207706_10052654
1163 Ga0207706_10494059
1164 Ga0207686_10018636
1165 Ga0207709_10001963
1166 Ga0207709_10105499
1167 Ga0207709_10106376
1168 Ga0207709_10110790
1169 Ga0207709_10186120
1170 Ga0207709_10268522
1171 Ga0207709_10419364
1172 Ga0207670_10087280
1173 Ga0207669_10001512
1174 Ga0207669_10059825
1175 Ga0207704_10005558
1176 Ga0207704_10011823
1177 Ga0207704_10461433
1178 Ga0207665_10011914
1179 Ga0207691_10000715
1180 Ga0207691_10004314
1181 Ga0207691_10009010
1182 Ga0207691_10039309
1183 Ga0207691_10064727
1184 Ga0207711_10004324
1185 Ga0207711_10077308
1186 Ga0207711_10229030
1187 Ga0207711_10232512
1188 Ga0207689_10000832
1189 Ga0207689_10001173
1190 Ga0207689_10008002
1191 Ga0207689_10010903
1192 Ga0207689_10043546
1193 Ga0207689_10155700
1194 Ga0207689_10422118
1195 Ga0207689_10488809
1196 Ga0207689_10596052
1197 Ga0207661_10295863
1198 Ga0207679_10020576
1199 Ga0207679_10050994
1200 Ga0207679_10415320
1201 Ga0207679_10607702
1202 Ga0207667_10001629
1203 Ga0207667_10036150
1204 Ga0207651_10006282
1205 Ga0207651_10026083
1206 Ga0207651_10098610
1207 Ga0207712_10017454
1208 Ga0207712_10344323
1209 Ga0207668_10005373
1210 Ga0207640_10007685
1211 Ga0207640_10052875
1212 Ga0207658_10042974
1213 Ga0207658_10176903
1214 Ga0207658_10218342
1215 Ga0207658_10280858
1216 Ga0207677_10013008
1217 Ga0207677_10019121
1218 Ga0207677_10058567
1219 Ga0207677_10130970
1220 Ga0207703_10009878
1221 Ga0207703_10015165
1222 Ga0207703_10020042
1223 Ga0207703_10020953
1224 Ga0207639_10037103
1225 Ga0207678_10001044
1226 Ga0207678_10003876
1227 Ga0207678_10087509
1228 Ga0207708_10039235
1229 Ga0207708_10121747
1230 Ga0207702_10001008
1231 Ga0207702_10018460
1232 Ga0207702_10138804
1233 Ga0207702_10722787
1234 Ga0207641_10020058
1235 Ga0207641_10048631
1236 Ga0207641_10232663
1237 Ga0207641_10369771
1238 Ga0207648_10001078
1239 Ga0207648_10002589
1240 Ga0207648_10024017
1241 Ga0207648_10030536
1242 Ga0207648_10036689
1243 Ga0207648_10090922
1244 Ga0207648_10097720
1245 Ga0207648_10099107
1246 Ga0207648_10247272
1247 Ga0207648_10660586
1248 Ga0207676_10024383
1249 Ga0207676_10041574
1250 Ga0207674_10000170
1251 Ga0207674_10004485
1252 Ga0207674_10009183
1253 Ga0207674_10100398
1254 Ga0207675_100000729
1255 Ga0207683_10126925
1256 Ga0207683_10172439
1257 Ga0207683_10270781
1258 Ga0207698_10008751
1259 Ga0207698_10147496
1260 Ga0207698_10201961
1261 Ga0207698_10444184
1262 Ga0207698_10562292
1263 Ga0209969_1001433
1264 Ga0209981_1005156
1265 Ga0209996_1003328
1266 Ga0209984_1003684
1267 Ga0209995_1002211
1268 Ga0209999_1001883
1269 Ga0209982_1007520
1270 Ga0209983_1017287
1271 Ga0209588_1030493
1272 Ga0209971_1000291
1273 Ga0209966_1000119
1274 Ga0209998_10000058
1275 Ga0209974_10001860
1276 Ga0207428_10000063
1277 Ga0268266_10126393
1278 Ga0268265_10015672
1279 Ga0268265_10048159
1280 Ga0268265_10205451
1281 Ga0268265_10445708
1282 Ga0268264_10006835
1283 Ga0268264_10010182
1284 Ga0268264_10023911
1285 Ga0268264_10168889
1286 Ga0268264_10179073
1287 Ga0268264_10209991
1288 Ga0307517_10000058
1289 Ga0307517_10162992
1290 Ga0307515_10000824
1291 Ga0307515_10010044
1292 Ga0307515_10036865
1293 Ga0307515_10248969
1294 Ga0307512_10026527
1295 Ga0307512_10068778
1296 Ga0307513_10008920
1297 Ga0307513_10045825
1298 Ga0307509_10000409
1299 Ga0307509_10008614
1300 Ga0307509_10010192
1301 Ga0307509_10013282
1302 Ga0307408_100027867
1303 Ga0307408_100051446
1304 Ga0307508_10001404
1305 Ga0307508_10002090
1306 Ga0307514_10071040
1307 Ga0307516_10000348
1308 Ga0307516_10004552
1309 Ga0307516_10016846
1310 Ga0307516_10131082
1311 Ga0307516_10363972
1312 Ga0307516_10407186
1313 Ga0307405_10014058
1314 Ga0307405_10075426
1315 Ga0307413_10033179
1316 Ga0307413_10331196
1317 Ga0307410_10072967
1318 Ga0307406_10020138
1319 Ga0307407_10175024
1320 Ga0307412_10026142
1321 Ga0307412_10074733
1322 Ga0307409_100003728
1323 Ga0307409_100186842
1324 Ga0307416_100024412
1325 Ga0307411_10002164
1326 Ga0307411_10074095
1327 Ga0307415_100000506
1328 Ga0307507_10061301
1329 Ga0307510_10004970
1330 Ga0307510_10062999
1331 Ga0373948_0007504
1332 Ga0373959_0003071
1333 Ga0373928_0023749
1334 Ga0373929_0029222
1335 Ga0373940_0033364
1336 Ga0373949_0013161
1337 Ga0373939_0032891
1338 Ga0373960_0009270
1339 Ga0373961_0010573
1340 Ga0373962_0016431
1341 Ga0373931_0020684
1342 Ga0373933_0238316
1343 Ga0395899_0007226
1344 Ga0395900_0051764
1345 Ga0395905_0006766
1346 Ga0395905_0007991
1347 Ga0395901_0079284
1348 Ga0436363_0359156
1349 Ga0451802_0716501
1350 Ga0439431_0039210
1351 Ga0439448_0000859
1352 Ga0439450_025501
1353 Ga0439450_047837
1354 Ga0439455_0060302
1355 Ga0450923_006436
1356 Ga0450888_014163
1357 Ga0439435_0064024
1358 Ga0439459_0015593
1359 Ga0439464_0000449
1360 Ga0439464_0005518
1361 Ga0439460_0030291
1362 Ga0439460_0063628
1363 Ga0451577_0003146
1364 Ga0451577_0046227
1365 Ga0451577_0054892
1366 Ga0451577_0516599
1367 Ga0453683_0021817
1368 Ga0453684_0008228
1369 Ga0453684_0300507
1370 Ga0451576_0003981
1371 Ga0451576_0036252
1372 Ga0451576_0047000
1373 Ga0451576_0595884
1374 Ga0495592_0000112
1375 Ga0495603_0004217
1376 Ga0495590_0009981
1377 Ga0495629_0006604
1378 Ga0495650_0003996
1379 Ga0495580_0098725
1380 Ga0495580_0253656
1381 Ga0495580_0414766
1382 Ga0495639_0063590
1383 Ga0495664_0024206
1384 Ga0495584_0050670
1385 Ga0495607_0003069
1386 Ga0495606_0184645
1387 Ga0495608_0090291
1388 Ga0495610_0059070
1389 Ga0495620_0098373
1390 Ga0495630_0048707
1391 Ga0495630_0060498
1392 Ga0495632_0006278
1393 Ga0495643_0016904
1394 Ga0495666_0015510
1395 Ga0495586_0019553
1396 Ga0495586_0213417
1397 Ga0495597_0051102
1398 Ga0495645_0005962
1399 Ga0495667_0131490
1400 Ga0495611_0027388
1401 Ga0495625_0003780
1402 Ga0495657_0088345
1403 Ga0495646_0046485
1404 Ga0495658_0235150
1405 Ga0495613_0032906
1406 Ga0495624_0049266
1407 Ga0495670_0030445
1408 Ga0495649_0001025
1409 Ga0495660_0110666
1410 Ga0495581_0009265
1411 Ga0495676_0029886
1412 Ga0495687_002929
1413 Ga0495687_017366
1414 Ga0495675_0049837
1415 Ga0495681_0031006
1416 Ga0495686_0134366
1417 Ga0495593_0070259
1418 Ga0495614_0049469
1419 Ga0496100_0022328
1420 Ga0496102_0198685
1421 Ga0496102_0287571
1422 Ga0496103_0119282
1423 Ga0496104_0054583
1424 Ga0496105_0041292
1425 Ga0496106_0013659
1426 Ga0496106_0033856
1427 Ga0496107_0004364
1428 Ga0496107_0557272
1429 Ga0496108_0041706
1430 Ga0496109_0008784
1431 Ga0496110_0089226
1432 Ga0496110_0225561
1433 Ga0496111_0083588
1434 Ga0496112_0303028
1435 Ga0496113_0296386
1436 Ga0496114_0007892
1437 Ga0496114_0067040
1438 Ga0496115_0002358
1439 Ga0496115_0490592
1440 Ga0501038_0329262
1441 Ga0501039_0059960
1442 Ga0501039_0155232
1443 Ga0501040_0036453
1444 Ga0501041_0006894
1445 Ga0501042_0002097
1446 Ga0501046_0003631
1447 Ga0501047_0170381
1448 Ga0501048_0012174
1449 Ga0501068_0179035
1450 Ga0501075_0016504
1451 Ga0501076_0075162
1452 Ga0501077_0185099
1453 Ga0501079_0002846
1454 Ga0501079_0018027
1455 Ga0501080_0470320
1456 Ga0501081_0001320
1457 Ga0501081_0004839
1458 Ga0501083_0082305
1459 Ga0501045_0007296
1460 nmdc:mga03683_45206_c1
1461 nmdc:mga00v17_199322_c1
1462 nmdc:mga00v17_81790_c1
1463 nmdc:mga0k408_11832_c2
1464 nmdc:mga0k408_15715_c1
1465 nmdc:mga0k408_35_c2
1466 nmdc:mga0k408_7518_c1
1467 nmdc:mga0k408_7977_c1
1468 nmdc:mga06z11_81309_c1
1469 nmdc:mga06z11_84191_c1
1470 nmdc:mga07m45_104850_c1
1471 nmdc:mga07m45_107921_c1
1472 nmdc:mga07m45_12415_c1
1473 nmdc:mga07m45_28122_c1
1474 nmdc:mga07m45_40908_c1
1475 nmdc:mga07m45_41340_c1
1476 nmdc:mga07m45_91015_c1
1477 nmdc:mga07m45_923_c1
1478 nmdc:mga05p37_13957_c1
1479 nmdc:mga05p37_154113_c1
1480 nmdc:mga05p37_245262_c1
1481 nmdc:mga05p37_82742_c1
1482 nmdc:mga09592_1606_c1
1483 nmdc:mga09592_56144_c1
1484 nmdc:mga0qj67_61961_c1
1485 nmdc:mga0qj67_885_c1
1486 nmdc:mga06r32_233968_c1
1487 nmdc:mga06r32_392_c1
1488 nmdc:mga08y16_11607_c1
1489 nmdc:mga08y16_518963_c1
1490 nmdc:mga0n895_227658_c1
1491 nmdc:mga0n895_25136_c1
1492 nmdc:mga0n895_464651_c1
1493 nmdc:mga0rr50_180216_c1
1494 nmdc:mga0rr50_402266_c1
1495 nmdc:mga08x19_312540_c1
1496 nmdc:mga08x19_372326_c1
1497 nmdc:mga0a205_114476_c1
1498 nmdc:mga0a205_695_c1
1499 nmdc:mga0sz30_9464_c1
1500 Ga0500578_0010617
1501 Ga0500644_0002391
1502 Ga0500644_0072659
1503 Ga0500594_0004831
1504 Ga0500608_079263
1505 Ga0500658_0126087
1506 Ga0500559_0000011
1507 Ga0500622_0007958
1508 Ga0500645_000882
1509 Ga0500587_004139
1510 Ga0501084_0009429
1511 Ga0587084_011289
1512 Ga0587071_019689
1513 Ga0587111_0016181
1514 Ga0501082_0028067
1515 2643969584
1516 2644143882
1517 2644276409
1518 2644304601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

51

232

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ocr-assembly1.cif.gz_A crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.9413 9 253
3ocr-assembly2.cif.gz_B crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.9278 9 253
3ocr-assembly1.cif.gz_A crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.916 9 253
3ocr-assembly2.cif.gz_B crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.9133 9 253
8iai-assembly1.cif.gz_1 structure of mammalian spectrin-actin junctional complex of membrane skeleton, state ii, global map 0.8711 9 251
ID Description Score Start End Superfamily
af_Q54T47_16_268_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9444 14 253 3.40.225.10
af_Q7LKY2_67_324_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9368 13 253 3.40.225.10
af_Q20952_347_604_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9346 15 247 3.40.225.10
af_Q9U9K0_112_366_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9242 14 248 3.40.225.10
3ocrB00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9227 9 253 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A1L1PM74-F1-model_v4 Class II aldolase/adducin-like protein 0.9845 6 206 GO:0005856
GO:0051015
AF-A0A373FQE9-F1-model_v4 Class II aldolase/adducin family protein 0.9829 6 253 GO:0005856
GO:0051015
AF-A0A520FYN2-F1-model_v4 HD domain-containing protein 0.9827 12 233 GO:0005856
GO:0051015
AF-A0A4D7BWU6-F1-model_v4 Class II aldolase/adducin family protein 0.9806 6 213 GO:0005856
GO:0051015
AF-A0A165I024-F1-model_v4 Class II aldolase 0.9783 35 185 GO:0005856
GO:0005996
GO:0051015

Map