F479484
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 759 | 507 | 590 | 285 |
Family's Representative Sequence
| Representative Sequence | 3300025939|Ga0207665_10305035|Ga0207665_103050351 |
| Length | 332 |
| Sequence | MPSDEASVPRLSAQAGLSCPGSAERHGVPHRVRDTREEIAITSAIGVTSGMAQDPQTPPALFDRALLHARQRRAQAQGAVSFLLDRVAEDMSDRLAAVMREFHTAADLWTPGEGLAVLRARLPSIRRIELDTSGAEKLPFAPESLDLVLSALALQFVNDLPGVLAQIRRALKPDGLLLAAMIGGDSLTELRQAFAAAEAECEGGVSPRVAPFADLRDVGALLQRAGFALPVTDVDRVVVRYANAFALMQDIRRMGAANVLIERRRTPSRRSTLLRMAEVYAERFADADGRIRATFDIIWLSGWAPHASQQQPLKPGSAKASLAEAVKKAGKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 13 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 14 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 15 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 16 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 17 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 18 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 19 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 20 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 21 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 22 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 23 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 24 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 25 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 26 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 27 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 28 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 29 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 30 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 31 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 32 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 33 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 34 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 35 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 36 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 37 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 38 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 39 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 40 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 41 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 42 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 43 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 44 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 45 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 46 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 47 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 48 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 49 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 50 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 51 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 52 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 53 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 54 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 55 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 56 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 57 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 58 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 59 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 60 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 61 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 62 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 63 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 64 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 65 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 66 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 67 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 68 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 69 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 70 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 71 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 72 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 73 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 74 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 75 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 76 | 2922368715 | |||
| 77 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 78 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 79 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 80 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 81 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 82 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 83 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 84 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 85 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 86 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 87 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 88 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 89 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 90 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 91 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 92 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 93 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 94 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 95 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 96 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 97 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 98 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 99 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 100 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 101 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 102 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 103 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 104 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 105 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 106 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 107 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 108 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 109 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 110 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 111 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 112 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 113 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 114 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 115 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 116 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 117 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 118 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 119 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 120 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 121 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 122 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 123 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 124 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 125 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 126 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 127 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 128 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 129 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 130 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 131 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 132 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 133 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 134 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 135 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 136 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 137 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 138 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 139 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 140 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 141 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 142 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 143 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 144 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 145 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 146 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 147 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 148 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 151 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 152 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 154 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 155 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 156 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 162 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 165 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 167 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 168 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 171 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 172 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 173 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 174 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 175 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 179 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 181 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 182 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 184 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 185 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 186 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 187 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 188 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 189 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 190 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 191 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 192 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 193 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 194 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 196 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 197 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 198 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 199 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 200 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 201 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 203 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 205 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 225 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 226 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 227 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 228 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 229 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 235 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 236 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 238 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 285 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 286 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 287 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 291 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 292 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 293 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 294 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 295 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 296 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 297 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 298 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 299 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 300 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 301 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 302 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 303 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 304 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 305 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 306 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 307 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 308 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 309 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 310 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 311 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 312 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 313 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 314 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 315 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 316 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 317 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 318 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 319 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 320 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 321 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 322 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 323 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 324 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 325 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 326 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 327 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 328 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 329 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 330 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 331 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 332 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 403 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 404 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 405 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 406 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 407 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 408 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 411 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 412 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 413 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 414 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 415 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 416 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 417 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 418 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 419 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 420 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 421 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 422 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 423 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 424 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 425 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 426 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 433 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 434 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 435 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 436 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 439 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 440 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 442 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 443 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 444 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 445 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 446 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 447 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 448 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 449 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 450 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 451 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 452 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 453 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 454 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 455 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 456 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 457 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 458 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 459 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 460 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 461 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 462 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 463 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 464 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 465 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 466 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 467 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 468 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 469 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 470 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 471 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 472 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 473 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 474 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 475 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 476 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 477 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 478 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 479 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 480 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 481 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 482 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 483 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 484 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 485 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 486 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 487 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 488 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 489 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 490 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 491 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 492 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 493 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 494 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 495 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 496 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 497 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 498 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 499 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 500 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 501 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 502 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 503 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 504 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 505 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 506 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 507 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.7 |
| Metatranscriptomes | 0.13 |
| Isolates | 22.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.7 |
| Nodule | 17.92 |
| Rhizoplane | 7.11 |
| Rhizosphere | 51.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1009332 | 3300003214 | Bacteria | 1483 |
| 2 | JGI25153J46596_10003051 | 3300003215 | Bacteria | 9461 |
| 3 | JGI25153J46596_10004570 | 3300003215 | Bacteria | 7426 |
| 4 | JGI25153J46596_10006145 | 3300003215 | Bacteria | 6155 |
| 5 | JGI25153J46596_10011665 | 3300003215 | Bacteria | 3863 |
| 6 | JGI25153J46596_10037172 | 3300003215 | Bacteria | 1552 |
| 7 | JGI25160J50197_1001574 | 3300003354 | Bacteria | 11262 |
| 8 | JGI25160J50197_1001779 | 3300003354 | Bacteria | 10433 |
| 9 | JGI25404J52841_10004554 | 3300003659 | Bacteria | 2818 |
| 10 | Ga0055531_10005617 | 3300003794 | Bacteria | 7297 |
| 11 | Ga0065165_1005041 | 3300005262 | Bacteria | 7710 |
| 12 | Ga0070658_10026144 | 3300005327 | Bacteria | 4682 |
| 13 | Ga0070676_10065637 | 3300005328 | Bacteria | 2167 |
| 14 | Ga0070690_100046706 | 3300005330 | Bacteria | 2753 |
| 15 | Ga0068869_100098356 | 3300005334 | Bacteria | 2210 |
| 16 | Ga0068869_100187122 | 3300005334 | Bacteria | 1626 |
| 17 | Ga0070666_10267489 | 3300005335 | Bacteria | 1213 |
| 18 | Ga0070680_100171374 | 3300005336 | Bacteria | 1826 |
| 19 | Ga0070682_100129177 | 3300005337 | Bacteria | 1708 |
| 20 | Ga0068868_100023606 | 3300005338 | Bacteria | 4656 |
| 21 | Ga0070660_100023921 | 3300005339 | Bacteria | 4530 |
| 22 | Ga0070661_100270881 | 3300005344 | Bacteria | 1315 |
| 23 | Ga0070668_100034627 | 3300005347 | Bacteria | 3849 |
| 24 | Ga0070668_100133435 | 3300005347 | Bacteria | 1994 |
| 25 | Ga0070671_100207274 | 3300005355 | Bacteria | 1663 |
| 26 | Ga0070673_100413478 | 3300005364 | Bacteria | 1208 |
| 27 | Ga0070688_100381699 | 3300005365 | Bacteria | 1039 |
| 28 | Ga0070659_100022001 | 3300005366 | Bacteria | 4865 |
| 29 | Ga0070659_100399672 | 3300005366 | Bacteria | 1160 |
| 30 | Ga0070667_100064979 | 3300005367 | Bacteria | 3097 |
| 31 | Ga0070667_100466714 | 3300005367 | Bacteria | 1155 |
| 32 | Ga0070709_10001043 | 3300005434 | Bacteria | 15348 |
| 33 | Ga0070709_10002120 | 3300005434 | Bacteria | 10732 |
| 34 | Ga0070714_100040555 | 3300005435 | Bacteria | 3924 |
| 35 | Ga0070713_100014537 | 3300005436 | Bacteria | 5852 |
| 36 | Ga0070713_100017000 | 3300005436 | Bacteria | 5486 |
| 37 | Ga0070713_100030913 | 3300005436 | Bacteria | 4258 |
| 38 | Ga0070713_100122498 | 3300005436 | Bacteria | 2283 |
| 39 | Ga0070710_10001640 | 3300005437 | Bacteria | 10584 |
| 40 | Ga0070710_10038234 | 3300005437 | Bacteria | 2635 |
| 41 | Ga0070711_100040459 | 3300005439 | Bacteria | 3144 |
| 42 | Ga0070663_100109435 | 3300005455 | Bacteria | 2074 |
| 43 | Ga0070663_100281085 | 3300005455 | Bacteria | 1326 |
| 44 | Ga0070663_100333944 | 3300005455 | Bacteria | 1222 |
| 45 | Ga0068867_100510338 | 3300005459 | Bacteria | 1035 |
| 46 | Ga0070685_10347712 | 3300005466 | Bacteria | 1013 |
| 47 | Ga0070679_100296853 | 3300005530 | Bacteria | 1567 |
| 48 | Ga0070684_100027981 | 3300005535 | Bacteria | 4765 |
| 49 | Ga0068853_100224076 | 3300005539 | Bacteria | 1718 |
| 50 | Ga0070672_100012411 | 3300005543 | Bacteria | 5979 |
| 51 | Ga0070672_100130698 | 3300005543 | Bacteria | 2063 |
| 52 | Ga0070693_100252828 | 3300005547 | Bacteria | 1169 |
| 53 | Ga0070665_100063043 | 3300005548 | Bacteria | 3717 |
| 54 | Ga0070665_100140122 | 3300005548 | Bacteria | 2422 |
| 55 | Ga0070665_100315868 | 3300005548 | Bacteria | 1566 |
| 56 | Ga0070665_100329221 | 3300005548 | Bacteria | 1532 |
| 57 | Ga0068855_100025627 | 3300005563 | Bacteria | 7054 |
| 58 | Ga0068855_100212587 | 3300005563 | Bacteria | 2172 |
| 59 | Ga0070664_100150931 | 3300005564 | Bacteria | 2051 |
| 60 | Ga0070664_100359423 | 3300005564 | Bacteria | 1326 |
| 61 | Ga0068857_100108211 | 3300005577 | Bacteria | 2498 |
| 62 | Ga0068854_100152216 | 3300005578 | Bacteria | 1785 |
| 63 | Ga0068854_100372222 | 3300005578 | Bacteria | 1175 |
| 64 | Ga0070702_100069289 | 3300005615 | Bacteria | 2078 |
| 65 | Ga0068852_100151120 | 3300005616 | Bacteria | 2159 |
| 66 | Ga0068852_100293463 | 3300005616 | Bacteria | 1572 |
| 67 | Ga0068859_100104583 | 3300005617 | Bacteria | 2890 |
| 68 | Ga0068859_100311133 | 3300005617 | Bacteria | 1669 |
| 69 | Ga0068864_100069630 | 3300005618 | Bacteria | 3060 |
| 70 | Ga0068861_100058920 | 3300005719 | Bacteria | 2938 |
| 71 | Ga0068861_100144444 | 3300005719 | Bacteria | 1946 |
| 72 | Ga0068863_100302870 | 3300005841 | Bacteria | 1551 |
| 73 | Ga0068858_100099371 | 3300005842 | Bacteria | 2713 |
| 74 | Ga0068858_100109449 | 3300005842 | Bacteria | 2579 |
| 75 | Ga0068860_100211678 | 3300005843 | Bacteria | 1880 |
| 76 | Ga0068862_100153267 | 3300005844 | Bacteria | 2052 |
| 77 | Ga0068862_100168984 | 3300005844 | Bacteria | 1957 |
| 78 | Ga0081455_10005919 | 3300005937 | Bacteria | 13272 |
| 79 | Ga0081455_10061026 | 3300005937 | Bacteria | 3175 |
| 80 | Ga0081540_1008966 | 3300005983 | Bacteria | 6923 |
| 81 | Ga0081540_1009964 | 3300005983 | Bacteria | 6481 |
| 82 | Ga0081540_1014575 | 3300005983 | Bacteria | 5027 |
| 83 | Ga0081539_10042554 | 3300005985 | Bacteria | 2644 |
| 84 | Ga0070717_10001143 | 3300006028 | Bacteria | 17925 |
| 85 | Ga0070717_10047973 | 3300006028 | Bacteria | 3502 |
| 86 | Ga0070717_10289195 | 3300006028 | Bacteria | 1455 |
| 87 | Ga0075365_10068554 | 3300006038 | Bacteria | 2383 |
| 88 | Ga0075365_10283760 | 3300006038 | Bacteria | 1165 |
| 89 | Ga0075364_10046309 | 3300006051 | Bacteria | 2831 |
| 90 | Ga0070715_10002760 | 3300006163 | Bacteria | 5455 |
| 91 | Ga0070716_100007223 | 3300006173 | Bacteria | 5464 |
| 92 | Ga0070716_100042884 | 3300006173 | Bacteria | 2527 |
| 93 | Ga0070712_100006152 | 3300006175 | Bacteria | 7426 |
| 94 | Ga0070712_100182258 | 3300006175 | Bacteria | 1637 |
| 95 | Ga0075366_10002600 | 3300006195 | Bacteria | 9280 |
| 96 | Ga0097621_100329117 | 3300006237 | Bacteria | 1355 |
| 97 | Ga0068871_100104701 | 3300006358 | Bacteria | 2373 |
| 98 | Ga0097620_100104575 | 3300006931 | Bacteria | 2890 |
| 99 | Ga0097620_100311137 | 3300006931 | Bacteria | 1669 |
| 100 | Ga0099824_1012187 | 3300006942 | Bacteria | 9468 |
| 101 | Ga0105240_10005129 | 3300009093 | Bacteria | 19597 |
| 102 | Ga0105240_10035009 | 3300009093 | Bacteria | 6475 |
| 103 | Ga0105245_10222206 | 3300009098 | Bacteria | 1823 |
| 104 | Ga0105245_10298809 | 3300009098 | Bacteria | 1579 |
| 105 | Ga0105247_10220530 | 3300009101 | Bacteria | 1283 |
| 106 | Ga0105243_10134417 | 3300009148 | Bacteria | 2102 |
| 107 | Ga0105241_10014074 | 3300009174 | Bacteria | 5862 |
| 108 | Ga0105241_10047814 | 3300009174 | Bacteria | 3254 |
| 109 | Ga0105237_10013514 | 3300009545 | Bacteria | 8556 |
| 110 | Ga0105238_10694036 | 3300009551 | Bacteria | 1030 |
| 111 | Ga0105249_10164886 | 3300009553 | Bacteria | 2144 |
| 112 | Ga0105239_10024829 | 3300010375 | Bacteria | 6603 |
| 113 | Ga0105239_10179264 | 3300010375 | Bacteria | 2370 |
| 114 | Ga0105239_10488087 | 3300010375 | Bacteria | 1400 |
| 115 | Ga0105239_10690001 | 3300010375 | Bacteria | 1167 |
| 116 | Ga0105246_10179142 | 3300011119 | Bacteria | 1630 |
| 117 | Ga0105246_10378322 | 3300011119 | Bacteria | 1169 |
| 118 | Ga0157370_10093494 | 3300013104 | Bacteria | 2822 |
| 119 | Ga0157369_10013512 | 3300013105 | Bacteria | 9228 |
| 120 | Ga0157374_10364765 | 3300013296 | Bacteria | 1437 |
| 121 | Ga0163162_10291947 | 3300013306 | Bacteria | 1762 |
| 122 | Ga0163162_10300490 | 3300013306 | Bacteria | 1737 |
| 123 | Ga0157375_10025269 | 3300013308 | Bacteria | 5515 |
| 124 | Ga0157375_10165233 | 3300013308 | Bacteria | 2358 |
| 125 | Ga0163163_10052116 | 3300014325 | Bacteria | 4036 |
| 126 | Ga0163163_10133233 | 3300014325 | Bacteria | 2525 |
| 127 | Ga0157377_10133500 | 3300014745 | Bacteria | 1519 |
| 128 | Ga0157377_10176179 | 3300014745 | Bacteria | 1341 |
| 129 | Ga0157377_10400498 | 3300014745 | Bacteria | 935 |
| 130 | Ga0157376_10145982 | 3300014969 | Bacteria | 2128 |
| 131 | Ga0157376_10150868 | 3300014969 | Bacteria | 2096 |
| 132 | Ga0163161_10036195 | 3300017792 | Bacteria | 3535 |
| 133 | Ga0206353_10623774 | 3300020082 | Bacteria | 1131 |
| 134 | Ga0214544_1000087 | 3300021320 | Bacteria | 119600 |
| 135 | Ga0214542_1000018 | 3300021321 | Bacteria | 202226 |
| 136 | Ga0214545_1000009 | 3300021324 | Bacteria | 202915 |
| 137 | Ga0214543_1000037 | 3300021327 | Bacteria | 182113 |
| 138 | Ga0209563_104871 | 3300025230 | Bacteria | 2509 |
| 139 | Ga0209677_105069 | 3300025253 | Bacteria | 3562 |
| 140 | Ga0209148_1002285 | 3300025254 | Bacteria | 6905 |
| 141 | Ga0209233_1005177 | 3300025261 | Bacteria | 4355 |
| 142 | Ga0209233_1013010 | 3300025261 | Bacteria | 2391 |
| 143 | Ga0209455_1003892 | 3300025272 | Bacteria | 5091 |
| 144 | Ga0209455_1006163 | 3300025272 | Bacteria | 3585 |
| 145 | Ga0209673_1028217 | 3300025273 | Bacteria | 1811 |
| 146 | Ga0209564_1003384 | 3300025295 | Bacteria | 10997 |
| 147 | Ga0209564_1007864 | 3300025295 | Bacteria | 5397 |
| 148 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 149 | Ga0209758_1000884 | 3300025297 | Bacteria | 41143 |
| 150 | Ga0209758_1000949 | 3300025297 | Bacteria | 39098 |
| 151 | Ga0209758_1006161 | 3300025297 | Bacteria | 8784 |
| 152 | Ga0209758_1007096 | 3300025297 | Bacteria | 7756 |
| 153 | Ga0209758_1010276 | 3300025297 | Bacteria | 5631 |
| 154 | Ga0209758_1011559 | 3300025297 | Bacteria | 5089 |
| 155 | Ga0209758_1017944 | 3300025297 | Bacteria | 3494 |
| 156 | Ga0209758_1022776 | 3300025297 | Bacteria | 2857 |
| 157 | Ga0209256_1016593 | 3300025299 | Bacteria | 2499 |
| 158 | Ga0207426_1001522 | 3300025302 | Bacteria | 18884 |
| 159 | Ga0207426_1015480 | 3300025302 | Bacteria | 2762 |
| 160 | Ga0209257_1003355 | 3300025304 | Bacteria | 13856 |
| 161 | Ga0207692_10004318 | 3300025898 | Bacteria | 5622 |
| 162 | Ga0207692_10016120 | 3300025898 | Bacteria | 3301 |
| 163 | Ga0207647_10019817 | 3300025904 | Bacteria | 4517 |
| 164 | Ga0207699_10000360 | 3300025906 | Bacteria | 24053 |
| 165 | Ga0207699_10013541 | 3300025906 | Bacteria | 4178 |
| 166 | Ga0207645_10107781 | 3300025907 | Bacteria | 1802 |
| 167 | Ga0207705_10142379 | 3300025909 | Bacteria | 1791 |
| 168 | Ga0207654_10013203 | 3300025911 | Bacteria | 4245 |
| 169 | Ga0207654_10204600 | 3300025911 | Bacteria | 1302 |
| 170 | Ga0207654_10255164 | 3300025911 | Bacteria | 1177 |
| 171 | Ga0207707_10111344 | 3300025912 | Bacteria | 2393 |
| 172 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 173 | Ga0207695_10245684 | 3300025913 | Bacteria | 1690 |
| 174 | Ga0207671_10094291 | 3300025914 | Bacteria | 2259 |
| 175 | Ga0207671_10235667 | 3300025914 | Bacteria | 1437 |
| 176 | Ga0207671_10360461 | 3300025914 | Bacteria | 1154 |
| 177 | Ga0207693_10000073 | 3300025915 | Bacteria | 89380 |
| 178 | Ga0207693_10059536 | 3300025915 | Bacteria | 2992 |
| 179 | Ga0207663_10000861 | 3300025916 | Bacteria | 13793 |
| 180 | Ga0207660_10020024 | 3300025917 | Bacteria | 4484 |
| 181 | Ga0207657_10004881 | 3300025919 | Bacteria | 14112 |
| 182 | Ga0207652_10181195 | 3300025921 | Bacteria | 1893 |
| 183 | Ga0207646_10473353 | 3300025922 | Bacteria | 1130 |
| 184 | Ga0207687_10105091 | 3300025927 | Bacteria | 2086 |
| 185 | Ga0207687_10167300 | 3300025927 | Bacteria | 1693 |
| 186 | Ga0207700_10034750 | 3300025928 | Bacteria | 3622 |
| 187 | Ga0207700_10052688 | 3300025928 | Bacteria | 3044 |
| 188 | Ga0207700_10102804 | 3300025928 | Bacteria | 2283 |
| 189 | Ga0207664_10023264 | 3300025929 | Bacteria | 4640 |
| 190 | Ga0207664_10027950 | 3300025929 | Bacteria | 4282 |
| 191 | Ga0207664_10209929 | 3300025929 | Bacteria | 1684 |
| 192 | Ga0207664_10344058 | 3300025929 | Bacteria | 1319 |
| 193 | Ga0207644_10492611 | 3300025931 | Bacteria | 1010 |
| 194 | Ga0207690_10074693 | 3300025932 | Bacteria | 2349 |
| 195 | Ga0207709_10104454 | 3300025935 | Bacteria | 1880 |
| 196 | Ga0207669_10029822 | 3300025937 | Bacteria | 3022 |
| 197 | Ga0207704_10163511 | 3300025938 | Bacteria | 1587 |
| 198 | Ga0207665_10000629 | 3300025939 | Bacteria | 23661 |
| 199 | Ga0207665_10045899 | 3300025939 | Bacteria | 2926 |
| 200 | Ga0207665_10305035 | 3300025939 | Bacteria | 1191 |
| 201 | Ga0207691_10187098 | 3300025940 | Bacteria | 1807 |
| 202 | Ga0207689_10061122 | 3300025942 | Bacteria | 3098 |
| 203 | Ga0207661_10551095 | 3300025944 | Bacteria | 1056 |
| 204 | Ga0207679_10204384 | 3300025945 | Bacteria | 1652 |
| 205 | Ga0207667_10019657 | 3300025949 | Bacteria | 7531 |
| 206 | Ga0207667_10079342 | 3300025949 | Bacteria | 3402 |
| 207 | Ga0207667_10275853 | 3300025949 | Bacteria | 1719 |
| 208 | Ga0207667_10302771 | 3300025949 | Bacteria | 1633 |
| 209 | Ga0207651_10382497 | 3300025960 | Bacteria | 1193 |
| 210 | Ga0207712_10230685 | 3300025961 | Bacteria | 1486 |
| 211 | Ga0207668_10015065 | 3300025972 | Bacteria | 4798 |
| 212 | Ga0207668_10090760 | 3300025972 | Bacteria | 2243 |
| 213 | Ga0207640_10045306 | 3300025981 | Bacteria | 2824 |
| 214 | Ga0207658_10139899 | 3300025986 | Bacteria | 1957 |
| 215 | Ga0207658_10378790 | 3300025986 | Bacteria | 1239 |
| 216 | Ga0207677_10028452 | 3300026023 | Bacteria | 3535 |
| 217 | Ga0207677_10435579 | 3300026023 | Bacteria | 1120 |
| 218 | Ga0207639_10261493 | 3300026041 | Bacteria | 1514 |
| 219 | Ga0207678_10029495 | 3300026067 | Bacteria | 4788 |
| 220 | Ga0207678_10041959 | 3300026067 | Bacteria | 3966 |
| 221 | Ga0207678_10261671 | 3300026067 | Bacteria | 1482 |
| 222 | Ga0207678_10370875 | 3300026067 | Bacteria | 1236 |
| 223 | Ga0207702_10140091 | 3300026078 | Bacteria | 2187 |
| 224 | Ga0207702_10232705 | 3300026078 | Bacteria | 1723 |
| 225 | Ga0207641_10213959 | 3300026088 | Bacteria | 1784 |
| 226 | Ga0207641_10319570 | 3300026088 | Bacteria | 1472 |
| 227 | Ga0207648_10063416 | 3300026089 | Bacteria | 3221 |
| 228 | Ga0207648_10179191 | 3300026089 | Bacteria | 1875 |
| 229 | Ga0207648_10462270 | 3300026089 | Bacteria | 1157 |
| 230 | Ga0207648_10634240 | 3300026089 | Bacteria | 987 |
| 231 | Ga0207676_10032534 | 3300026095 | Bacteria | 3931 |
| 232 | Ga0207676_10135482 | 3300026095 | Bacteria | 2100 |
| 233 | Ga0207675_100024363 | 3300026118 | Bacteria | 5628 |
| 234 | Ga0207675_100060324 | 3300026118 | Bacteria | 3541 |
| 235 | Ga0207683_10289750 | 3300026121 | Bacteria | 1497 |
| 236 | Ga0207698_10325690 | 3300026142 | Bacteria | 1441 |
| 237 | Ga0209389_1000161 | 3300027296 | Bacteria | 55526 |
| 238 | Ga0209589_1000103 | 3300027357 | Bacteria | 86516 |
| 239 | Ga0209489_100304 | 3300027361 | Bacteria | 86516 |
| 240 | Ga0268266_10011749 | 3300028379 | Bacteria | 7594 |
| 241 | Ga0268266_10020841 | 3300028379 | Bacteria | 5590 |
| 242 | Ga0268266_10027183 | 3300028379 | Bacteria | 4866 |
| 243 | Ga0268266_10239769 | 3300028379 | Bacteria | 1673 |
| 244 | Ga0268266_10371567 | 3300028379 | Bacteria | 1347 |
| 245 | Ga0268265_10020343 | 3300028380 | Bacteria | 4631 |
| 246 | Ga0268265_10137061 | 3300028380 | Bacteria | 2043 |
| 247 | Ga0268264_10219845 | 3300028381 | Bacteria | 1748 |
| 248 | Ga0307515_10012007 | 3300028794 | Bacteria | 16357 |
| 249 | Ga0265330_10055090 | 3300031235 | Bacteria | 1737 |
| 250 | Ga0265332_10030006 | 3300031238 | Bacteria | 2375 |
| 251 | Ga0265340_10001209 | 3300031247 | Bacteria | 14775 |
| 252 | Ga0307409_100402749 | 3300031995 | Bacteria | 1307 |
| 253 | Ga0307415_100123096 | 3300032126 | Bacteria | 1949 |
| 254 | Ga0307510_10035286 | 3300033180 | Bacteria | 5588 |
| 255 | Ga0307510_10089059 | 3300033180 | Bacteria | 2941 |
| 256 | Ga0373934_0003939 | 3300035086 | Bacteria | 5458 |
| 257 | Ga0373936_0010427 | 3300035113 | Bacteria | 3506 |
| 258 | Ga0373936_0020794 | 3300035113 | Bacteria | 2551 |
| 259 | Ga0373953_0000259 | 3300035117 | Bacteria | 14369 |
| 260 | Ga0373954_0000249 | 3300035118 | Bacteria | 19692 |
| 261 | Ga0373956_0018532 | 3300035119 | Bacteria | 2948 |
| 262 | Ga0373957_0003088 | 3300035120 | Bacteria | 4855 |
| 263 | Ga0373943_0003923 | 3300035170 | Bacteria | 6772 |
| 264 | Ga0373946_0005379 | 3300035171 | Bacteria | 4615 |
| 265 | Ga0373955_0009036 | 3300035172 | Bacteria | 4652 |
| 266 | Ga0373924_0003664 | 3300035410 | Bacteria | 5298 |
| 267 | Ga0373931_0021849 | 3300035691 | Bacteria | 3214 |
| 268 | Ga0373931_0145012 | 3300035691 | Bacteria | 1379 |
| 269 | Ga0373935_0000434 | 3300035692 | Bacteria | 21781 |
| 270 | Ga0373935_0112742 | 3300035692 | Bacteria | 1807 |
| 271 | Ga0373927_0003717 | 3300035695 | Bacteria | 10844 |
| 272 | Ga0373927_0018294 | 3300035695 | Bacteria | 4605 |
| 273 | Ga0373927_0163883 | 3300035695 | Bacteria | 1457 |
| 274 | Ga0373933_0001831 | 3300035724 | Bacteria | 12311 |
| 275 | Ga0373933_0346076 | 3300035724 | Bacteria | 965 |
| 276 | Ga0373947_0003045 | 3300035725 | Bacteria | 9971 |
| 277 | Ga0373947_0212569 | 3300035725 | Bacteria | 1269 |
| 278 | Ga0373937_0171393 | 3300036401 | Bacteria | 2036 |
| 279 | Ga0373925_0006130 | 3300037068 | Bacteria | 8881 |
| 280 | Ga0373925_0458817 | 3300037068 | Bacteria | 1044 |
| 281 | Ga0395900_0000696 | 3300037418 | Bacteria | 44867 |
| 282 | Ga0395900_0350891 | 3300037418 | Bacteria | 1449 |
| 283 | Ga0395898_0035004 | 3300037466 | Bacteria | 4998 |
| 284 | Ga0395898_0107104 | 3300037466 | Bacteria | 2680 |
| 285 | Ga0395905_0036154 | 3300037471 | Bacteria | 4638 |
| 286 | Ga0395905_0654254 | 3300037471 | Bacteria | 953 |
| 287 | Ga0395901_0048644 | 3300038443 | Bacteria | 4404 |
| 288 | Ga0436365_0801382 | 3300039437 | Bacteria | 1196 |
| 289 | Ga0436361_0327284 | 3300039447 | Bacteria | 2481 |
| 290 | Ga0451797_1195647 | 3300041453 | Bacteria | 1069 |
| 291 | Ga0466969_0030684 | 3300044656 | Bacteria | 2739 |
| 292 | Ga0466972_0001053 | 3300044658 | Bacteria | 13231 |
| 293 | Ga0466972_0037257 | 3300044658 | Bacteria | 2377 |
| 294 | Ga0466966_0000137 | 3300044684 | Bacteria | 46695 |
| 295 | Ga0466961_0000039 | 3300044693 | Bacteria | 79787 |
| 296 | Ga0466963_0001672 | 3300044694 | Bacteria | 12090 |
| 297 | Ga0466968_0005199 | 3300044735 | Bacteria | 4872 |
| 298 | Ga0466970_0074283 | 3300044765 | Bacteria | 1830 |
| 299 | Ga0466957_0090202 | 3300044842 | Bacteria | 1920 |
| 300 | Ga0466960_0003772 | 3300044901 | Bacteria | 5865 |
| 301 | Ga0466960_0043701 | 3300044901 | Bacteria | 2133 |
| 302 | Ga0466959_0001594 | 3300045049 | Bacteria | 13987 |
| 303 | Ga0466959_0249432 | 3300045049 | Bacteria | 1225 |
| 304 | Ga0466967_0068542 | 3300045976 | Bacteria | 3168 |
| 305 | Ga0466967_0212731 | 3300045976 | Bacteria | 1834 |
| 306 | Ga0466967_0614173 | 3300045976 | Bacteria | 1074 |
| 307 | Ga0495592_0011025 | 3300046454 | Bacteria | 6820 |
| 308 | Ga0495592_0011508 | 3300046454 | Bacteria | 6696 |
| 309 | Ga0495592_0172975 | 3300046454 | Bacteria | 1477 |
| 310 | Ga0495592_0255347 | 3300046454 | Bacteria | 1157 |
| 311 | Ga0495603_0000189 | 3300046455 | Bacteria | 32189 |
| 312 | Ga0495603_0021216 | 3300046455 | Bacteria | 3932 |
| 313 | Ga0495603_0127912 | 3300046455 | Bacteria | 1480 |
| 314 | Ga0495603_0146563 | 3300046455 | Bacteria | 1372 |
| 315 | Ga0495629_0000268 | 3300046459 | Bacteria | 45291 |
| 316 | Ga0495629_0001490 | 3300046459 | Bacteria | 18421 |
| 317 | Ga0495629_0031949 | 3300046459 | Bacteria | 3727 |
| 318 | Ga0495638_0013239 | 3300046460 | Bacteria | 5625 |
| 319 | Ga0495638_0019032 | 3300046460 | Bacteria | 4547 |
| 320 | Ga0495638_0069119 | 3300046460 | Bacteria | 2164 |
| 321 | Ga0495638_0077661 | 3300046460 | Bacteria | 2021 |
| 322 | Ga0495641_0002442 | 3300046461 | Bacteria | 14667 |
| 323 | Ga0495651_0011203 | 3300046462 | Bacteria | 6891 |
| 324 | Ga0495653_0000300 | 3300046463 | Bacteria | 40108 |
| 325 | Ga0495580_0006330 | 3300046472 | Bacteria | 9662 |
| 326 | Ga0495582_0000144 | 3300046473 | Bacteria | 38436 |
| 327 | Ga0495605_0184778 | 3300046474 | Bacteria | 915 |
| 328 | Ga0495639_0000067 | 3300046475 | Bacteria | 47932 |
| 329 | Ga0495662_0000005 | 3300046476 | Bacteria | 81157 |
| 330 | Ga0495664_0052227 | 3300046477 | Bacteria | 2428 |
| 331 | Ga0495584_0144600 | 3300046491 | Bacteria | 1208 |
| 332 | Ga0495594_0000102 | 3300046499 | Bacteria | 39784 |
| 333 | Ga0495594_0044547 | 3300046499 | Bacteria | 2434 |
| 334 | Ga0495607_0111811 | 3300046501 | Bacteria | 1447 |
| 335 | Ga0495607_0173690 | 3300046501 | Bacteria | 1086 |
| 336 | Ga0495583_0043017 | 3300046506 | Bacteria | 2106 |
| 337 | Ga0495606_0000858 | 3300046507 | Bacteria | 45651 |
| 338 | Ga0495608_0000255 | 3300046511 | Bacteria | 38655 |
| 339 | Ga0495608_0040269 | 3300046511 | Bacteria | 3131 |
| 340 | Ga0495610_0062316 | 3300046512 | Bacteria | 1769 |
| 341 | Ga0495610_0074333 | 3300046512 | Bacteria | 1577 |
| 342 | Ga0495618_0039068 | 3300046514 | Bacteria | 2984 |
| 343 | Ga0495620_0025893 | 3300046515 | Bacteria | 2767 |
| 344 | Ga0495628_0036326 | 3300046516 | Bacteria | 3955 |
| 345 | Ga0495628_0040804 | 3300046516 | Bacteria | 3707 |
| 346 | Ga0495630_0014512 | 3300046517 | Bacteria | 5740 |
| 347 | Ga0495643_0111638 | 3300046522 | Bacteria | 1389 |
| 348 | Ga0495644_0026625 | 3300046523 | Bacteria | 2193 |
| 349 | Ga0495648_0000382 | 3300046524 | Bacteria | 48626 |
| 350 | Ga0495648_0050531 | 3300046524 | Bacteria | 2539 |
| 351 | Ga0495648_0074678 | 3300046524 | Bacteria | 1952 |
| 352 | Ga0495666_0104893 | 3300046526 | Bacteria | 1330 |
| 353 | Ga0495652_0007246 | 3300046529 | Bacteria | 10238 |
| 354 | Ga0495652_0048270 | 3300046529 | Bacteria | 3649 |
| 355 | Ga0495652_0106931 | 3300046529 | Bacteria | 2258 |
| 356 | Ga0495665_0000935 | 3300046531 | Bacteria | 15397 |
| 357 | Ga0495640_0005833 | 3300046533 | Bacteria | 9779 |
| 358 | Ga0495640_0012005 | 3300046533 | Bacteria | 6638 |
| 359 | Ga0495640_0048180 | 3300046533 | Bacteria | 2946 |
| 360 | Ga0495586_0328668 | 3300046535 | Bacteria | 877 |
| 361 | Ga0495587_0008775 | 3300046536 | Bacteria | 6485 |
| 362 | Ga0495587_0013918 | 3300046536 | Bacteria | 5051 |
| 363 | Ga0495597_0107671 | 3300046542 | Bacteria | 1171 |
| 364 | Ga0495597_0121699 | 3300046542 | Bacteria | 1087 |
| 365 | Ga0495645_0027614 | 3300046543 | Bacteria | 4124 |
| 366 | Ga0495645_0072463 | 3300046543 | Bacteria | 2482 |
| 367 | Ga0495622_0000649 | 3300046557 | Bacteria | 19833 |
| 368 | Ga0495622_0008376 | 3300046557 | Bacteria | 4787 |
| 369 | Ga0495667_0000121 | 3300046559 | Bacteria | 56223 |
| 370 | Ga0495667_0013372 | 3300046559 | Bacteria | 5555 |
| 371 | Ga0495656_0086448 | 3300046615 | Bacteria | 1426 |
| 372 | Ga0495668_0207077 | 3300046616 | Bacteria | 1074 |
| 373 | Ga0495634_0001407 | 3300046642 | Bacteria | 21535 |
| 374 | Ga0495634_0051027 | 3300046642 | Bacteria | 2776 |
| 375 | Ga0495625_0188236 | 3300046660 | Bacteria | 1369 |
| 376 | Ga0495635_0000072 | 3300046663 | Bacteria | 62736 |
| 377 | Ga0495635_0002392 | 3300046663 | Bacteria | 12785 |
| 378 | Ga0495635_0037151 | 3300046663 | Bacteria | 3372 |
| 379 | Ga0495635_0050480 | 3300046663 | Bacteria | 2867 |
| 380 | Ga0495661_0029665 | 3300046665 | Bacteria | 3489 |
| 381 | Ga0495588_0002782 | 3300046674 | Bacteria | 7516 |
| 382 | Ga0495588_0010392 | 3300046674 | Bacteria | 4329 |
| 383 | Ga0495588_0046101 | 3300046674 | Bacteria | 2236 |
| 384 | Ga0495588_0109722 | 3300046674 | Bacteria | 1453 |
| 385 | Ga0495657_0004271 | 3300046675 | Bacteria | 11423 |
| 386 | Ga0495657_0111504 | 3300046675 | Bacteria | 1732 |
| 387 | Ga0495599_0007431 | 3300046678 | Bacteria | 6644 |
| 388 | Ga0495599_0174472 | 3300046678 | Bacteria | 1326 |
| 389 | Ga0495623_0010400 | 3300046679 | Bacteria | 6021 |
| 390 | Ga0495646_0007628 | 3300046680 | Bacteria | 6875 |
| 391 | Ga0495646_0061399 | 3300046680 | Bacteria | 2238 |
| 392 | Ga0495647_0002197 | 3300046681 | Bacteria | 6102 |
| 393 | Ga0495658_0000439 | 3300046683 | Bacteria | 23198 |
| 394 | Ga0495669_0017393 | 3300046684 | Bacteria | 3086 |
| 395 | Ga0495669_0063308 | 3300046684 | Bacteria | 1678 |
| 396 | Ga0495613_0001828 | 3300046689 | Bacteria | 16171 |
| 397 | Ga0495613_0055857 | 3300046689 | Bacteria | 2900 |
| 398 | Ga0495613_0154119 | 3300046689 | Bacteria | 1637 |
| 399 | Ga0495613_0262260 | 3300046689 | Bacteria | 1203 |
| 400 | Ga0495624_0000460 | 3300046690 | Bacteria | 31973 |
| 401 | Ga0495600_0001929 | 3300046809 | Bacteria | 11644 |
| 402 | Ga0495600_0014429 | 3300046809 | Bacteria | 4980 |
| 403 | Ga0495660_0115625 | 3300046810 | Bacteria | 1364 |
| 404 | Ga0495581_0000084 | 3300047315 | Bacteria | 38216 |
| 405 | Ga0495581_0127057 | 3300047315 | Bacteria | 1485 |
| 406 | Ga0495604_0002223 | 3300047317 | Bacteria | 15540 |
| 407 | Ga0495604_0010947 | 3300047317 | Bacteria | 7201 |
| 408 | Ga0495604_0061619 | 3300047317 | Bacteria | 2868 |
| 409 | Ga0495674_0004128 | 3300047319 | Bacteria | 14021 |
| 410 | Ga0495674_0019201 | 3300047319 | Bacteria | 6350 |
| 411 | Ga0495674_0192303 | 3300047319 | Bacteria | 1695 |
| 412 | Ga0495672_0021500 | 3300047320 | Bacteria | 4207 |
| 413 | Ga0495672_0097821 | 3300047320 | Bacteria | 1597 |
| 414 | Ga0495676_0006985 | 3300047321 | Bacteria | 10361 |
| 415 | Ga0495680_0001208 | 3300047322 | Bacteria | 28311 |
| 416 | Ga0495680_0005809 | 3300047322 | Bacteria | 11550 |
| 417 | Ga0495687_130376 | 3300047443 | Bacteria | 891 |
| 418 | Ga0495675_0010221 | 3300047444 | Bacteria | 5856 |
| 419 | Ga0495675_0070404 | 3300047444 | Bacteria | 2208 |
| 420 | Ga0495673_0066228 | 3300047469 | Bacteria | 1532 |
| 421 | Ga0495684_0000594 | 3300047471 | Bacteria | 29100 |
| 422 | Ga0495684_0036127 | 3300047471 | Bacteria | 3789 |
| 423 | Ga0495686_0093532 | 3300047472 | Bacteria | 1823 |
| 424 | Ga0495593_0000038 | 3300047673 | Bacteria | 53141 |
| 425 | Ga0495593_0000109 | 3300047673 | Bacteria | 38355 |
| 426 | Ga0495593_0021842 | 3300047673 | Bacteria | 3571 |
| 427 | Ga0495602_0025029 | 3300048088 | Bacteria | 5783 |
| 428 | Ga0495602_0234433 | 3300048088 | Bacteria | 1376 |
| 429 | Ga0496100_0014354 | 3300048903 | Bacteria | 4598 |
| 430 | Ga0496100_0083660 | 3300048903 | Bacteria | 2161 |
| 431 | Ga0496100_0151677 | 3300048903 | Bacteria | 1654 |
| 432 | Ga0496101_0004551 | 3300048904 | Bacteria | 8756 |
| 433 | Ga0496101_0005097 | 3300048904 | Bacteria | 8353 |
| 434 | Ga0496101_0162068 | 3300048904 | Bacteria | 1715 |
| 435 | Ga0496102_0030130 | 3300048905 | Bacteria | 4856 |
| 436 | Ga0496102_0067141 | 3300048905 | Bacteria | 3289 |
| 437 | Ga0496102_0150978 | 3300048905 | Bacteria | 2183 |
| 438 | Ga0496102_0222523 | 3300048905 | Bacteria | 1779 |
| 439 | Ga0496102_0246787 | 3300048905 | Bacteria | 1683 |
| 440 | Ga0496102_0363315 | 3300048905 | Bacteria | 1363 |
| 441 | Ga0496103_0164558 | 3300048906 | Bacteria | 1423 |
| 442 | Ga0496103_0271318 | 3300048906 | Bacteria | 1091 |
| 443 | Ga0496104_0010015 | 3300048907 | Bacteria | 8460 |
| 444 | Ga0496104_0025881 | 3300048907 | Bacteria | 5411 |
| 445 | Ga0496104_0116175 | 3300048907 | Bacteria | 2568 |
| 446 | Ga0496105_0016080 | 3300048908 | Bacteria | 5968 |
| 447 | Ga0496105_0106523 | 3300048908 | Bacteria | 2314 |
| 448 | Ga0496106_0005291 | 3300048909 | Bacteria | 9565 |
| 449 | Ga0496106_0047592 | 3300048909 | Bacteria | 3228 |
| 450 | Ga0496106_0067572 | 3300048909 | Bacteria | 2725 |
| 451 | Ga0496106_0315860 | 3300048909 | Bacteria | 1254 |
| 452 | Ga0496106_0419485 | 3300048909 | Bacteria | 1075 |
| 453 | Ga0496107_0023956 | 3300048910 | Bacteria | 4315 |
| 454 | Ga0496107_0159094 | 3300048910 | Bacteria | 1673 |
| 455 | Ga0496108_0036900 | 3300048911 | Bacteria | 4068 |
| 456 | Ga0496108_0675490 | 3300048911 | Bacteria | 897 |
| 457 | Ga0496109_0230011 | 3300048912 | Bacteria | 1744 |
| 458 | Ga0496109_0380920 | 3300048912 | Bacteria | 1333 |
| 459 | Ga0496110_0010473 | 3300048913 | Bacteria | 7543 |
| 460 | Ga0496110_0026129 | 3300048913 | Bacteria | 4993 |
| 461 | Ga0496110_0083738 | 3300048913 | Bacteria | 2846 |
| 462 | Ga0496110_0137677 | 3300048913 | Bacteria | 2207 |
| 463 | Ga0496110_0189228 | 3300048913 | Bacteria | 1869 |
| 464 | Ga0496110_0281664 | 3300048913 | Bacteria | 1514 |
| 465 | Ga0496110_0636985 | 3300048913 | Bacteria | 965 |
| 466 | Ga0496111_0051658 | 3300048914 | Bacteria | 2967 |
| 467 | Ga0496111_0534285 | 3300048914 | Bacteria | 862 |
| 468 | Ga0496112_0000065 | 3300048915 | Bacteria | 70119 |
| 469 | Ga0496112_0212900 | 3300048915 | Bacteria | 1889 |
| 470 | Ga0496112_0285337 | 3300048915 | Bacteria | 1597 |
| 471 | Ga0496112_0309949 | 3300048915 | Bacteria | 1523 |
| 472 | Ga0496112_0394288 | 3300048915 | Bacteria | 1324 |
| 473 | Ga0496112_0598785 | 3300048915 | Bacteria | 1034 |
| 474 | Ga0496113_0006834 | 3300048916 | Bacteria | 7276 |
| 475 | Ga0496113_0116439 | 3300048916 | Bacteria | 2085 |
| 476 | Ga0496113_0178563 | 3300048916 | Bacteria | 1683 |
| 477 | Ga0496113_0375907 | 3300048916 | Bacteria | 1140 |
| 478 | Ga0496114_0016363 | 3300048917 | Bacteria | 5974 |
| 479 | Ga0496115_0018231 | 3300048918 | Bacteria | 5385 |
| 480 | Ga0496115_0033662 | 3300048918 | Bacteria | 4047 |
| 481 | Ga0496116_0009854 | 3300048919 | Bacteria | 8085 |
| 482 | Ga0496116_0011726 | 3300048919 | Bacteria | 7222 |
| 483 | Ga0496116_0205825 | 3300048919 | Bacteria | 1025 |
| 484 | Ga0496117_0086289 | 3300048920 | Bacteria | 2040 |
| 485 | Ga0496117_0117523 | 3300048920 | Bacteria | 1641 |
| 486 | Ga0496117_0134676 | 3300048920 | Bacteria | 1491 |
| 487 | Ga0496118_0021615 | 3300048921 | Bacteria | 5656 |
| 488 | Ga0496118_0063550 | 3300048921 | Bacteria | 2715 |
| 489 | Ga0496118_0094591 | 3300048921 | Bacteria | 2043 |
| 490 | Ga0496119_0007073 | 3300048922 | Bacteria | 10207 |
| 491 | Ga0496119_0022737 | 3300048922 | Bacteria | 4477 |
| 492 | Ga0496119_0079633 | 3300048922 | Bacteria | 1892 |
| 493 | Ga0496120_0016701 | 3300048923 | Bacteria | 4788 |
| 494 | Ga0496120_0023248 | 3300048923 | Bacteria | 3882 |
| 495 | Ga0496121_0002554 | 3300048924 | Bacteria | 27574 |
| 496 | Ga0496121_0033524 | 3300048924 | Bacteria | 4645 |
| 497 | Ga0496121_0090747 | 3300048924 | Bacteria | 2387 |
| 498 | Ga0496121_0139985 | 3300048924 | Bacteria | 1797 |
| 499 | Ga0496121_0178700 | 3300048924 | Bacteria | 1534 |
| 500 | Ga0496121_0189252 | 3300048924 | Bacteria | 1477 |
| 501 | Ga0496123_0020379 | 3300048926 | Bacteria | 5188 |
| 502 | Ga0496124_0174964 | 3300048927 | Bacteria | 1658 |
| 503 | Ga0496125_0000904 | 3300048928 | Bacteria | 46904 |
| 504 | Ga0496125_0004420 | 3300048928 | Bacteria | 16237 |
| 505 | Ga0496125_0046908 | 3300048928 | Bacteria | 3619 |
| 506 | Ga0496125_0093476 | 3300048928 | Bacteria | 2244 |
| 507 | Ga0496126_0059273 | 3300048929 | Bacteria | 3447 |
| 508 | Ga0496126_0070519 | 3300048929 | Bacteria | 3113 |
| 509 | Ga0496126_0076086 | 3300048929 | Bacteria | 2978 |
| 510 | Ga0496126_0088464 | 3300048929 | Bacteria | 2728 |
| 511 | Ga0496126_0237057 | 3300048929 | Bacteria | 1526 |
| 512 | Ga0496126_0304006 | 3300048929 | Bacteria | 1315 |
| 513 | Ga0501034_0080710 | 3300049571 | Bacteria | 3256 |
| 514 | Ga0501039_0406802 | 3300049575 | Bacteria | 1069 |
| 515 | Ga0501046_0060206 | 3300049580 | Bacteria | 2972 |
| 516 | Ga0501047_0275591 | 3300049581 | Bacteria | 1528 |
| 517 | Ga0501067_0022379 | 3300049583 | Bacteria | 3498 |
| 518 | Ga0501044_0434669 | 3300049823 | Bacteria | 1221 |
| 519 | nmdc:mga03n38_45605_c1 | 3300050490 | Bacteria | 1931 |
| 520 | nmdc:mga0yw44_13913_c1 | 3300050492 | Bacteria | 4253 |
| 521 | nmdc:mga06z11_168018_c1 | 3300050494 | Bacteria | 1258 |
| 522 | nmdc:mga07m45_137617_c1 | 3300050496 | Bacteria | 1414 |
| 523 | nmdc:mga08y16_30607_c1 | 3300050511 | Bacteria | 5663 |
| 524 | nmdc:mga0a205_287959_c1 | 3300050515 | Bacteria | 1517 |
| 525 | nmdc:mga0sz30_185344_c1 | 3300050516 | Bacteria | 924 |
| 526 | Ga0500635_0046689 | 3300053080 | Bacteria | 1469 |
| 527 | Ga0495619_0010257 | 3300053085 | Bacteria | 5898 |
| 528 | Ga0495619_0042088 | 3300053085 | Bacteria | 2990 |
| 529 | Ga0495619_0255899 | 3300053085 | Bacteria | 1213 |
| 530 | Ga0500643_006068 | 3300053087 | Bacteria | 5105 |
| 531 | Ga0500643_022242 | 3300053087 | Bacteria | 2044 |
| 532 | Ga0500646_0006123 | 3300053090 | Bacteria | 3057 |
| 533 | Ga0500651_0008259 | 3300053093 | Bacteria | 6117 |
| 534 | Ga0500651_0009030 | 3300053093 | Bacteria | 5899 |
| 535 | Ga0500566_0000029 | 3300053094 | Bacteria | 75384 |
| 536 | Ga0500566_0000139 | 3300053094 | Bacteria | 37343 |
| 537 | Ga0500566_0078766 | 3300053094 | Bacteria | 1838 |
| 538 | Ga0500640_100312 | 3300053095 | Bacteria | 1197 |
| 539 | Ga0500641_0024716 | 3300053096 | Bacteria | 2318 |
| 540 | Ga0500641_0083833 | 3300053096 | Bacteria | 1355 |
| 541 | Ga0500650_0004684 | 3300053098 | Bacteria | 4985 |
| 542 | Ga0500554_005453 | 3300053102 | Bacteria | 2775 |
| 543 | Ga0500555_003871 | 3300053103 | Bacteria | 4258 |
| 544 | Ga0500556_0000019 | 3300053104 | Bacteria | 186017 |
| 545 | Ga0500569_000516 | 3300053109 | Bacteria | 6443 |
| 546 | Ga0500569_000864 | 3300053109 | Bacteria | 5377 |
| 547 | Ga0500572_018341 | 3300053111 | Bacteria | 1811 |
| 548 | Ga0500592_006645 | 3300053116 | Bacteria | 1841 |
| 549 | Ga0500595_001557 | 3300053119 | Bacteria | 12138 |
| 550 | Ga0500595_002157 | 3300053119 | Bacteria | 10008 |
| 551 | Ga0500595_012821 | 3300053119 | Bacteria | 3227 |
| 552 | Ga0500595_016051 | 3300053119 | Bacteria | 2796 |
| 553 | Ga0500608_035435 | 3300053122 | Bacteria | 2380 |
| 554 | Ga0500614_032696 | 3300053123 | Bacteria | 1281 |
| 555 | Ga0500642_0000039 | 3300053130 | Bacteria | 98235 |
| 556 | Ga0500642_0002118 | 3300053130 | Bacteria | 5770 |
| 557 | Ga0500642_0026140 | 3300053130 | Bacteria | 2379 |
| 558 | Ga0500642_0028540 | 3300053130 | Bacteria | 2303 |
| 559 | Ga0500652_001066 | 3300053131 | Bacteria | 8907 |
| 560 | Ga0500655_030790 | 3300053133 | Bacteria | 1033 |
| 561 | Ga0500658_0009611 | 3300053134 | Bacteria | 3565 |
| 562 | Ga0500568_0001467 | 3300053139 | Bacteria | 15123 |
| 563 | Ga0500568_0008598 | 3300053139 | Bacteria | 4906 |
| 564 | Ga0500568_0010187 | 3300053139 | Bacteria | 4417 |
| 565 | Ga0500577_0034909 | 3300053142 | Bacteria | 1790 |
| 566 | Ga0500577_0092177 | 3300053142 | Bacteria | 1226 |
| 567 | Ga0500585_119091 | 3300053144 | Bacteria | 942 |
| 568 | Ga0500589_147594 | 3300053147 | Bacteria | 961 |
| 569 | Ga0500603_002683 | 3300053150 | Bacteria | 3874 |
| 570 | Ga0500604_0025269 | 3300053151 | Bacteria | 1706 |
| 571 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 572 | Ga0500616_0000059 | 3300053153 | Bacteria | 259741 |
| 573 | Ga0500616_0015647 | 3300053153 | Bacteria | 4331 |
| 574 | Ga0500619_045425 | 3300053154 | Bacteria | 1404 |
| 575 | Ga0500620_054428 | 3300053155 | Bacteria | 1349 |
| 576 | Ga0500620_063319 | 3300053155 | Bacteria | 1263 |
| 577 | Ga0500622_0015463 | 3300053156 | Bacteria | 4084 |
| 578 | Ga0500622_0185245 | 3300053156 | Bacteria | 958 |
| 579 | Ga0500627_0117092 | 3300053158 | Bacteria | 1201 |
| 580 | Ga0500627_0128272 | 3300053158 | Bacteria | 1145 |
| 581 | Ga0500634_0143339 | 3300053161 | Bacteria | 1128 |
| 582 | Ga0500638_116171 | 3300053162 | Bacteria | 1230 |
| 583 | Ga0500639_007050 | 3300053163 | Bacteria | 5827 |
| 584 | Ga0500636_0000563 | 3300053177 | Bacteria | 20246 |
| 585 | Ga0500636_0012647 | 3300053177 | Bacteria | 4948 |
| 586 | Ga0500570_087710 | 3300053724 | Bacteria | 1370 |
| 587 | Ga0500625_090653 | 3300053729 | Bacteria | 1309 |
| 588 | Ga0500609_002302 | 3300053731 | Bacteria | 2727 |
| 589 | Ga0500599_000667 | 3300053736 | Bacteria | 3689 |
| 590 | Ga0500601_000189 | 3300053737 | Bacteria | 12584 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046460 | Ga0495638_0077661 | Ga0495638_0077661_301_1167 | 257 |
| 2 | 3300053093 | Ga0500651_0008259 | Ga0500651_0008259_1336_2202 | 257 |
| 3 | 3300053130 | Ga0500642_0028540 | Ga0500642_0028540_425_1291 | 257 |
| 4 | 3300010375 | Ga0105239_10024829 | Ga0105239_100248297 | 264 |
| 5 | 3300037471 | Ga0395905_0654254 | Ga0395905_0654254_11_814 | 267 |
| 6 | 3300005937 | Ga0081455_10005919 | Ga0081455_1000591913 | 268 |
| 7 | 3300046491 | Ga0495584_0144600 | Ga0495584_0144600_57_896 | 268 |
| 8 | 3300013308 | Ga0157375_10165233 | Ga0157375_101652335 | 269 |
| 9 | 3300046684 | Ga0495669_0017393 | Ga0495669_0017393_1491_2333 | 269 |
| 10 | 3300048903 | Ga0496100_0151677 | Ga0496100_0151677_797_1639 | 269 |
| 11 | 3300048904 | Ga0496101_0162068 | Ga0496101_0162068_256_1098 | 269 |
| 12 | 3300048914 | Ga0496111_0534285 | Ga0496111_0534285_20_835 | 270 |
| 13 | 3300053147 | Ga0500589_147594 | Ga0500589_147594_81_923 | 270 |
| 14 | 3300009098 | Ga0105245_10298809 | Ga0105245_102988091 | 271 |
| 15 | 3300013296 | Ga0157374_10364765 | Ga0157374_103647652 | 271 |
| 16 | 3300013306 | Ga0163162_10291947 | Ga0163162_102919472 | 271 |
| 17 | 3300014745 | Ga0157377_10176179 | Ga0157377_101761792 | 271 |
| 18 | 3300014969 | Ga0157376_10150868 | Ga0157376_101508682 | 271 |
| 19 | 3300048903 | Ga0496100_0014354 | Ga0496100_0014354_478_1296 | 271 |
| 20 | 3300048904 | Ga0496101_0005097 | Ga0496101_0005097_92_910 | 271 |
| 21 | 3300048905 | Ga0496102_0030130 | Ga0496102_0030130_3898_4716 | 271 |
| 22 | 3300048906 | Ga0496103_0271318 | Ga0496103_0271318_13_831 | 271 |
| 23 | 3300048908 | Ga0496105_0016080 | Ga0496105_0016080_4036_4854 | 271 |
| 24 | 3300048909 | Ga0496106_0005291 | Ga0496106_0005291_5751_6569 | 271 |
| 25 | 3300048910 | Ga0496107_0023956 | Ga0496107_0023956_3071_3889 | 271 |
| 26 | 3300048911 | Ga0496108_0036900 | Ga0496108_0036900_3024_3842 | 271 |
| 27 | 3300048913 | Ga0496110_0026129 | Ga0496110_0026129_3245_4063 | 271 |
| 28 | 3300048915 | Ga0496112_0309949 | Ga0496112_0309949_229_1047 | 271 |
| 29 | 3300048916 | Ga0496113_0006834 | Ga0496113_0006834_6023_6841 | 271 |
| 30 | 3300048918 | Ga0496115_0018231 | Ga0496115_0018231_510_1328 | 271 |
| 31 | 3300037418 | Ga0395900_0350891 | Ga0395900_0350891_614_1432 | 272 |
| 32 | 3300045976 | Ga0466967_0068542 | Ga0466967_0068542_1868_2686 | 272 |
| 33 | 3300006051 | Ga0075364_10046309 | Ga0075364_100463091 | 273 |
| 34 | iso_pu_bacteria | 2929615660 | 2929618991 | 274 |
| 35 | iso_pu_bacteria | 2929624759 | 2929631068 | 274 |
| 36 | iso_pu_bacteria | 2933577622 | 2933580299 | 274 |
| 37 | iso_pu_bacteria | 2935675223 | 2935682605 | 274 |
| 38 | iso_pu_bacteria | 8055742211 | 8055742840 | 274 |
| 39 | iso_pu_bacteria | 2513237098 | 2513673923 | 275 |
| 40 | iso_pu_bacteria | 2524023210 | 2524468373 | 275 |
| 41 | iso_pu_bacteria | 2903768456 | 2903775700 | 275 |
| 42 | 3300044658 | Ga0466972_0037257 | Ga0466972_0037257_27_875 | 277 |
| 43 | 3300044735 | Ga0466968_0005199 | Ga0466968_0005199_2224_3072 | 277 |
| 44 | 3300044901 | Ga0466960_0003772 | Ga0466960_0003772_1628_2476 | 277 |
| 45 | 3300045976 | Ga0466967_0212731 | Ga0466967_0212731_821_1657 | 277 |
| 46 | iso_pu_bacteria | 2602042107 | 2603862313 | 277 |
| 47 | iso_pu_bacteria | 2643221651 | 2644290715 | 277 |
| 48 | iso_pu_bacteria | 2791355196 | 2793065620 | 277 |
| 49 | iso_pu_bacteria | 2791355196 | 2793065939 | 277 |
| 50 | iso_pu_bacteria | 2824653114 | 2824657433 | 277 |
| 51 | iso_pu_bacteria | 2857524615 | 2857525799 | 277 |
| 52 | iso_pu_bacteria | 2919073203 | 2919074339 | 277 |
| 53 | 3300017792 | Ga0163161_10036195 | Ga0163161_100361952 | 278 |
| 54 | 3300025272 | Ga0209455_1006163 | Ga0209455_10061632 | 278 |
| 55 | 3300046674 | Ga0495588_0002782 | Ga0495588_0002782_2122_2961 | 278 |
| 56 | 3300046684 | Ga0495669_0063308 | Ga0495669_0063308_772_1611 | 278 |
| 57 | 3300053094 | Ga0500566_0000029 | Ga0500566_0000029_2484_3320 | 278 |
| 58 | iso_pu_bacteria | 2513237095 | 2513652784 | 278 |
| 59 | iso_pu_bacteria | 2513237104 | 2513718815 | 278 |
| 60 | iso_pu_bacteria | 2524023205 | 2524440060 | 278 |
| 61 | iso_pu_bacteria | 2617270741 | 2617377276 | 278 |
| 62 | iso_pu_bacteria | 2744054633 | 2745077828 | 278 |
| 63 | iso_pu_bacteria | 2816332527 | 2818239236 | 278 |
| 64 | iso_pu_bacteria | 2874628541 | 2874636781 | 278 |
| 65 | iso_pu_bacteria | 2876761206 | 2876764041 | 278 |
| 66 | iso_pu_bacteria | 2888378607 | 2888379130 | 278 |
| 67 | iso_pu_bacteria | 2888419890 | 2888427528 | 278 |
| 68 | iso_pu_bacteria | 2935959822 | 2935967227 | 278 |
| 69 | iso_pu_bacteria | 3005483717 | 3005486391 | 278 |
| 70 | iso_pu_bacteria | 3005506211 | 3005506268 | 278 |
| 71 | iso_pu_bacteria | 3005587118 | 3005589048 | 278 |
| 72 | iso_pu_bacteria | 8006926726 | 8006931167 | 278 |
| 73 | 3300003659 | JGI25404J52841_10004554 | JGI25404J52841_100045543 | 279 |
| 74 | 3300005347 | Ga0070668_100034627 | Ga0070668_1000346274 | 279 |
| 75 | 3300005355 | Ga0070671_100207274 | Ga0070671_1002072742 | 279 |
| 76 | 3300005365 | Ga0070688_100381699 | Ga0070688_1003816991 | 279 |
| 77 | 3300005367 | Ga0070667_100466714 | Ga0070667_1004667142 | 279 |
| 78 | 3300005455 | Ga0070663_100281085 | Ga0070663_1002810852 | 279 |
| 79 | 3300005548 | Ga0070665_100315868 | Ga0070665_1003158682 | 279 |
| 80 | 3300005983 | Ga0081540_1009964 | Ga0081540_10099642 | 279 |
| 81 | 3300010375 | Ga0105239_10488087 | Ga0105239_104880872 | 279 |
| 82 | 3300011119 | Ga0105246_10378322 | Ga0105246_103783221 | 279 |
| 83 | 3300014969 | Ga0157376_10145982 | Ga0157376_101459822 | 279 |
| 84 | 3300025911 | Ga0207654_10204600 | Ga0207654_102046001 | 279 |
| 85 | 3300025914 | Ga0207671_10360461 | Ga0207671_103604611 | 279 |
| 86 | 3300025935 | Ga0207709_10104454 | Ga0207709_101044542 | 279 |
| 87 | 3300025937 | Ga0207669_10029822 | Ga0207669_100298222 | 279 |
| 88 | 3300025938 | Ga0207704_10163511 | Ga0207704_101635111 | 279 |
| 89 | 3300025961 | Ga0207712_10230685 | Ga0207712_102306852 | 279 |
| 90 | 3300025972 | Ga0207668_10015065 | Ga0207668_100150654 | 279 |
| 91 | 3300026089 | Ga0207648_10063416 | Ga0207648_100634163 | 279 |
| 92 | 3300026089 | Ga0207648_10462270 | Ga0207648_104622701 | 279 |
| 93 | 3300026121 | Ga0207683_10289750 | Ga0207683_102897501 | 279 |
| 94 | 3300028379 | Ga0268266_10371567 | Ga0268266_103715671 | 279 |
| 95 | 3300028794 | Ga0307515_10012007 | Ga0307515_1001200711 | 279 |
| 96 | 3300031995 | Ga0307409_100402749 | Ga0307409_1004027492 | 279 |
| 97 | 3300032126 | Ga0307415_100123096 | Ga0307415_1001230961 | 279 |
| 98 | 3300035691 | Ga0373931_0021849 | Ga0373931_0021849_323_1165 | 279 |
| 99 | 3300035695 | Ga0373927_0163883 | Ga0373927_0163883_245_1087 | 279 |
| 100 | 3300035725 | Ga0373947_0212569 | Ga0373947_0212569_65_907 | 279 |
| 101 | 3300044842 | Ga0466957_0090202 | Ga0466957_0090202_304_1146 | 279 |
| 102 | 3300045976 | Ga0466967_0614173 | Ga0466967_0614173_96_941 | 279 |
| 103 | 3300046460 | Ga0495638_0019032 | Ga0495638_0019032_1190_2032 | 279 |
| 104 | 3300047320 | Ga0495672_0021500 | Ga0495672_0021500_481_1323 | 279 |
| 105 | 3300048903 | Ga0496100_0083660 | Ga0496100_0083660_1135_1977 | 279 |
| 106 | 3300048904 | Ga0496101_0004551 | Ga0496101_0004551_4496_5338 | 279 |
| 107 | 3300048907 | Ga0496104_0010015 | Ga0496104_0010015_453_1295 | 279 |
| 108 | 3300048909 | Ga0496106_0419485 | Ga0496106_0419485_95_937 | 279 |
| 109 | 3300048913 | Ga0496110_0010473 | Ga0496110_0010473_5426_6268 | 279 |
| 110 | 3300048914 | Ga0496111_0051658 | Ga0496111_0051658_2050_2892 | 279 |
| 111 | 3300048916 | Ga0496113_0116439 | Ga0496113_0116439_1026_1868 | 279 |
| 112 | 3300048917 | Ga0496114_0016363 | Ga0496114_0016363_4069_4911 | 279 |
| 113 | 3300049581 | Ga0501047_0275591 | Ga0501047_0275591_570_1418 | 279 |
| 114 | 3300049823 | Ga0501044_0434669 | Ga0501044_0434669_197_1045 | 279 |
| 115 | 3300050511 | nmdc:mga08y16_30607_c1 | nmdc:mga08y16_30607_c1_1612_2454 | 279 |
| 116 | 3300005328 | Ga0070676_10065637 | Ga0070676_100656372 | 280 |
| 117 | 3300005334 | Ga0068869_100098356 | Ga0068869_1000983563 | 280 |
| 118 | 3300005338 | Ga0068868_100023606 | Ga0068868_1000236065 | 280 |
| 119 | 3300005347 | Ga0070668_100133435 | Ga0070668_1001334352 | 280 |
| 120 | 3300005364 | Ga0070673_100413478 | Ga0070673_1004134781 | 280 |
| 121 | 3300005366 | Ga0070659_100399672 | Ga0070659_1003996721 | 280 |
| 122 | 3300005367 | Ga0070667_100064979 | Ga0070667_1000649792 | 280 |
| 123 | 3300005435 | Ga0070714_100040555 | Ga0070714_1000405552 | 280 |
| 124 | 3300005436 | Ga0070713_100017000 | Ga0070713_1000170005 | 280 |
| 125 | 3300005466 | Ga0070685_10347712 | Ga0070685_103477121 | 280 |
| 126 | 3300005548 | Ga0070665_100063043 | Ga0070665_1000630432 | 280 |
| 127 | 3300005563 | Ga0068855_100025627 | Ga0068855_1000256272 | 280 |
| 128 | 3300005615 | Ga0070702_100069289 | Ga0070702_1000692892 | 280 |
| 129 | 3300005616 | Ga0068852_100293463 | Ga0068852_1002934632 | 280 |
| 130 | 3300005617 | Ga0068859_100104583 | Ga0068859_1001045832 | 280 |
| 131 | 3300005617 | Ga0068859_100311133 | Ga0068859_1003111331 | 280 |
| 132 | 3300005618 | Ga0068864_100069630 | Ga0068864_1000696304 | 280 |
| 133 | 3300005719 | Ga0068861_100144444 | Ga0068861_1001444442 | 280 |
| 134 | 3300005842 | Ga0068858_100099371 | Ga0068858_1000993713 | 280 |
| 135 | 3300005843 | Ga0068860_100211678 | Ga0068860_1002116783 | 280 |
| 136 | 3300005844 | Ga0068862_100153267 | Ga0068862_1001532672 | 280 |
| 137 | 3300005844 | Ga0068862_100168984 | Ga0068862_1001689842 | 280 |
| 138 | 3300005985 | Ga0081539_10042554 | Ga0081539_100425542 | 280 |
| 139 | 3300006028 | Ga0070717_10001143 | Ga0070717_100011438 | 280 |
| 140 | 3300006038 | Ga0075365_10283760 | Ga0075365_102837601 | 280 |
| 141 | 3300006931 | Ga0097620_100104575 | Ga0097620_1001045753 | 280 |
| 142 | 3300006931 | Ga0097620_100311137 | Ga0097620_1003111371 | 280 |
| 143 | 3300009098 | Ga0105245_10222206 | Ga0105245_102222063 | 280 |
| 144 | 3300009101 | Ga0105247_10220530 | Ga0105247_102205302 | 280 |
| 145 | 3300009174 | Ga0105241_10014074 | Ga0105241_100140748 | 280 |
| 146 | 3300011119 | Ga0105246_10179142 | Ga0105246_101791422 | 280 |
| 147 | 3300013306 | Ga0163162_10300490 | Ga0163162_103004902 | 280 |
| 148 | 3300013308 | Ga0157375_10025269 | Ga0157375_100252692 | 280 |
| 149 | 3300014325 | Ga0163163_10052116 | Ga0163163_100521163 | 280 |
| 150 | 3300014325 | Ga0163163_10133233 | Ga0163163_101332331 | 280 |
| 151 | 3300014745 | Ga0157377_10133500 | Ga0157377_101335002 | 280 |
| 152 | 3300025907 | Ga0207645_10107781 | Ga0207645_101077813 | 280 |
| 153 | 3300025911 | Ga0207654_10013203 | Ga0207654_100132031 | 280 |
| 154 | 3300025914 | Ga0207671_10094291 | Ga0207671_100942912 | 280 |
| 155 | 3300025927 | Ga0207687_10105091 | Ga0207687_101050913 | 280 |
| 156 | 3300025928 | Ga0207700_10052688 | Ga0207700_100526883 | 280 |
| 157 | 3300025929 | Ga0207664_10023264 | Ga0207664_100232644 | 280 |
| 158 | 3300025929 | Ga0207664_10027950 | Ga0207664_100279502 | 280 |
| 159 | 3300025931 | Ga0207644_10492611 | Ga0207644_104926111 | 280 |
| 160 | 3300025942 | Ga0207689_10061122 | Ga0207689_100611224 | 280 |
| 161 | 3300025949 | Ga0207667_10079342 | Ga0207667_100793423 | 280 |
| 162 | 3300025960 | Ga0207651_10382497 | Ga0207651_103824971 | 280 |
| 163 | 3300025972 | Ga0207668_10090760 | Ga0207668_100907603 | 280 |
| 164 | 3300025986 | Ga0207658_10139899 | Ga0207658_101398993 | 280 |
| 165 | 3300026023 | Ga0207677_10028452 | Ga0207677_100284524 | 280 |
| 166 | 3300026041 | Ga0207639_10261493 | Ga0207639_102614932 | 280 |
| 167 | 3300026067 | Ga0207678_10261671 | Ga0207678_102616712 | 280 |
| 168 | 3300026078 | Ga0207702_10140091 | Ga0207702_101400912 | 280 |
| 169 | 3300026089 | Ga0207648_10634240 | Ga0207648_106342401 | 280 |
| 170 | 3300026095 | Ga0207676_10135482 | Ga0207676_101354823 | 280 |
| 171 | 3300026118 | Ga0207675_100024363 | Ga0207675_1000243633 | 280 |
| 172 | 3300026142 | Ga0207698_10325690 | Ga0207698_103256902 | 280 |
| 173 | 3300028379 | Ga0268266_10011749 | Ga0268266_100117495 | 280 |
| 174 | 3300028379 | Ga0268266_10027183 | Ga0268266_100271834 | 280 |
| 175 | 3300028380 | Ga0268265_10020343 | Ga0268265_100203433 | 280 |
| 176 | 3300028380 | Ga0268265_10137061 | Ga0268265_101370612 | 280 |
| 177 | 3300028381 | Ga0268264_10219845 | Ga0268264_102198453 | 280 |
| 178 | 3300035691 | Ga0373931_0145012 | Ga0373931_0145012_129_974 | 280 |
| 179 | 3300037068 | Ga0373925_0458817 | Ga0373925_0458817_136_981 | 280 |
| 180 | 3300046455 | Ga0495603_0146563 | Ga0495603_0146563_157_1002 | 280 |
| 181 | 3300046499 | Ga0495594_0044547 | Ga0495594_0044547_1302_2147 | 280 |
| 182 | 3300046523 | Ga0495644_0026625 | Ga0495644_0026625_996_1841 | 280 |
| 183 | 3300046615 | Ga0495656_0086448 | Ga0495656_0086448_526_1371 | 280 |
| 184 | 3300048905 | Ga0496102_0067141 | Ga0496102_0067141_1330_2175 | 280 |
| 185 | 3300048907 | Ga0496104_0116175 | Ga0496104_0116175_1139_1984 | 280 |
| 186 | 3300048909 | Ga0496106_0067572 | Ga0496106_0067572_575_1420 | 280 |
| 187 | 3300048911 | Ga0496108_0675490 | Ga0496108_0675490_14_859 | 280 |
| 188 | 3300048912 | Ga0496109_0230011 | Ga0496109_0230011_861_1706 | 280 |
| 189 | 3300048913 | Ga0496110_0083738 | Ga0496110_0083738_543_1388 | 280 |
| 190 | 3300048913 | Ga0496110_0137677 | Ga0496110_0137677_94_939 | 280 |
| 191 | 3300048913 | Ga0496110_0281664 | Ga0496110_0281664_109_954 | 280 |
| 192 | 3300048915 | Ga0496112_0285337 | Ga0496112_0285337_414_1259 | 280 |
| 193 | 3300048916 | Ga0496113_0178563 | Ga0496113_0178563_197_1042 | 280 |
| 194 | 3300048920 | Ga0496117_0086289 | Ga0496117_0086289_663_1508 | 280 |
| 195 | 3300048924 | Ga0496121_0189252 | Ga0496121_0189252_120_965 | 280 |
| 196 | 3300048929 | Ga0496126_0304006 | Ga0496126_0304006_255_1100 | 280 |
| 197 | 3300049571 | Ga0501034_0080710 | Ga0501034_0080710_527_1375 | 280 |
| 198 | 3300049575 | Ga0501039_0406802 | Ga0501039_0406802_127_975 | 280 |
| 199 | 3300049580 | Ga0501046_0060206 | Ga0501046_0060206_160_1008 | 280 |
| 200 | 3300049583 | Ga0501067_0022379 | Ga0501067_0022379_1402_2247 | 280 |
| 201 | 3300050494 | nmdc:mga06z11_168018_c1 | nmdc:mga06z11_168018_c1_238_1083 | 280 |
| 202 | 3300050496 | nmdc:mga07m45_137617_c1 | nmdc:mga07m45_137617_c1_62_907 | 280 |
| 203 | 3300050515 | nmdc:mga0a205_287959_c1 | nmdc:mga0a205_287959_c1_629_1474 | 280 |
| 204 | 3300053096 | Ga0500641_0083833 | Ga0500641_0083833_282_1127 | 280 |
| 205 | 3300053119 | Ga0500595_001557 | Ga0500595_001557_10479_11324 | 280 |
| 206 | iso_pu_bacteria | 2507262055 | 2507505607 | 280 |
| 207 | 3300005327 | Ga0070658_10026144 | Ga0070658_100261446 | 281 |
| 208 | 3300005336 | Ga0070680_100171374 | Ga0070680_1001713743 | 281 |
| 209 | 3300005337 | Ga0070682_100129177 | Ga0070682_1001291773 | 281 |
| 210 | 3300005339 | Ga0070660_100023921 | Ga0070660_1000239211 | 281 |
| 211 | 3300005434 | Ga0070709_10002120 | Ga0070709_100021209 | 281 |
| 212 | 3300005436 | Ga0070713_100014537 | Ga0070713_1000145377 | 281 |
| 213 | 3300005436 | Ga0070713_100122498 | Ga0070713_1001224981 | 281 |
| 214 | 3300005437 | Ga0070710_10001640 | Ga0070710_100016409 | 281 |
| 215 | 3300005439 | Ga0070711_100040459 | Ga0070711_1000404593 | 281 |
| 216 | 3300005535 | Ga0070684_100027981 | Ga0070684_1000279813 | 281 |
| 217 | 3300005539 | Ga0068853_100224076 | Ga0068853_1002240761 | 281 |
| 218 | 3300005563 | Ga0068855_100212587 | Ga0068855_1002125873 | 281 |
| 219 | 3300005577 | Ga0068857_100108211 | Ga0068857_1001082113 | 281 |
| 220 | 3300005616 | Ga0068852_100151120 | Ga0068852_1001511201 | 281 |
| 221 | 3300005937 | Ga0081455_10061026 | Ga0081455_100610264 | 281 |
| 222 | 3300005983 | Ga0081540_1008966 | Ga0081540_10089666 | 281 |
| 223 | 3300005983 | Ga0081540_1014575 | Ga0081540_10145757 | 281 |
| 224 | 3300006028 | Ga0070717_10047973 | Ga0070717_100479734 | 281 |
| 225 | 3300006028 | Ga0070717_10289195 | Ga0070717_102891952 | 281 |
| 226 | 3300006163 | Ga0070715_10002760 | Ga0070715_100027609 | 281 |
| 227 | 3300006175 | Ga0070712_100006152 | Ga0070712_1000061527 | 281 |
| 228 | 3300009093 | Ga0105240_10035009 | Ga0105240_100350091 | 281 |
| 229 | 3300009545 | Ga0105237_10013514 | Ga0105237_100135142 | 281 |
| 230 | 3300013104 | Ga0157370_10093494 | Ga0157370_100934942 | 281 |
| 231 | 3300013105 | Ga0157369_10013512 | Ga0157369_100135127 | 281 |
| 232 | 3300020082 | Ga0206353_10623774 | Ga0206353_106237742 | 281 |
| 233 | 3300025295 | Ga0209564_1003384 | Ga0209564_100338412 | 281 |
| 234 | 3300025898 | Ga0207692_10016120 | Ga0207692_100161203 | 281 |
| 235 | 3300025906 | Ga0207699_10013541 | Ga0207699_100135413 | 281 |
| 236 | 3300025912 | Ga0207707_10111344 | Ga0207707_101113441 | 281 |
| 237 | 3300025913 | Ga0207695_10245684 | Ga0207695_102456843 | 281 |
| 238 | 3300025914 | Ga0207671_10235667 | Ga0207671_102356671 | 281 |
| 239 | 3300025915 | Ga0207693_10000073 | Ga0207693_1000007329 | 281 |
| 240 | 3300025916 | Ga0207663_10000861 | Ga0207663_100008617 | 281 |
| 241 | 3300025917 | Ga0207660_10020024 | Ga0207660_100200243 | 281 |
| 242 | 3300025919 | Ga0207657_10004881 | Ga0207657_100048811 | 281 |
| 243 | 3300025921 | Ga0207652_10181195 | Ga0207652_101811952 | 281 |
| 244 | 3300025922 | Ga0207646_10473353 | Ga0207646_104733531 | 281 |
| 245 | 3300025928 | Ga0207700_10102804 | Ga0207700_101028041 | 281 |
| 246 | 3300025929 | Ga0207664_10209929 | Ga0207664_102099293 | 281 |
| 247 | 3300025939 | Ga0207665_10000629 | Ga0207665_1000062913 | 281 |
| 248 | 3300025949 | Ga0207667_10019657 | Ga0207667_100196573 | 281 |
| 249 | 3300035113 | Ga0373936_0020794 | Ga0373936_0020794_48_893 | 281 |
| 250 | 3300035695 | Ga0373927_0018294 | Ga0373927_0018294_1350_2198 | 281 |
| 251 | 3300035724 | Ga0373933_0346076 | Ga0373933_0346076_34_882 | 281 |
| 252 | 3300039447 | Ga0436361_0327284 | Ga0436361_0327284_438_1286 | 281 |
| 253 | 3300046460 | Ga0495638_0069119 | Ga0495638_0069119_128_976 | 281 |
| 254 | 3300046501 | Ga0495607_0111811 | Ga0495607_0111811_80_928 | 281 |
| 255 | 3300046506 | Ga0495583_0043017 | Ga0495583_0043017_429_1277 | 281 |
| 256 | 3300046507 | Ga0495606_0000858 | Ga0495606_0000858_30769_31617 | 281 |
| 257 | 3300046512 | Ga0495610_0062316 | Ga0495610_0062316_879_1727 | 281 |
| 258 | 3300046512 | Ga0495610_0074333 | Ga0495610_0074333_379_1227 | 281 |
| 259 | 3300046515 | Ga0495620_0025893 | Ga0495620_0025893_160_1008 | 281 |
| 260 | 3300046542 | Ga0495597_0107671 | Ga0495597_0107671_125_973 | 281 |
| 261 | 3300046542 | Ga0495597_0121699 | Ga0495597_0121699_56_904 | 281 |
| 262 | 3300046665 | Ga0495661_0029665 | Ga0495661_0029665_921_1769 | 281 |
| 263 | 3300046674 | Ga0495588_0046101 | Ga0495588_0046101_1010_1858 | 281 |
| 264 | 3300046689 | Ga0495613_0055857 | Ga0495613_0055857_406_1254 | 281 |
| 265 | 3300046810 | Ga0495660_0115625 | Ga0495660_0115625_127_975 | 281 |
| 266 | 3300047320 | Ga0495672_0097821 | Ga0495672_0097821_691_1539 | 281 |
| 267 | 3300048919 | Ga0496116_0009854 | Ga0496116_0009854_4048_4896 | 281 |
| 268 | 3300048920 | Ga0496117_0117523 | Ga0496117_0117523_607_1455 | 281 |
| 269 | 3300048921 | Ga0496118_0094591 | Ga0496118_0094591_104_952 | 281 |
| 270 | 3300048922 | Ga0496119_0079633 | Ga0496119_0079633_874_1722 | 281 |
| 271 | 3300048924 | Ga0496121_0002554 | Ga0496121_0002554_2288_3136 | 281 |
| 272 | 3300048926 | Ga0496123_0020379 | Ga0496123_0020379_2753_3601 | 281 |
| 273 | 3300048928 | Ga0496125_0000904 | Ga0496125_0000904_34236_35084 | 281 |
| 274 | 3300048928 | Ga0496125_0004420 | Ga0496125_0004420_11107_11955 | 281 |
| 275 | 3300048928 | Ga0496125_0046908 | Ga0496125_0046908_1008_1856 | 281 |
| 276 | 3300048929 | Ga0496126_0059273 | Ga0496126_0059273_2080_2928 | 281 |
| 277 | 3300048929 | Ga0496126_0070519 | Ga0496126_0070519_1349_2197 | 281 |
| 278 | 3300048929 | Ga0496126_0076086 | Ga0496126_0076086_1396_2244 | 281 |
| 279 | 3300053087 | Ga0500643_022242 | Ga0500643_022242_486_1334 | 281 |
| 280 | 3300053090 | Ga0500646_0006123 | Ga0500646_0006123_712_1560 | 281 |
| 281 | 3300053094 | Ga0500566_0000139 | Ga0500566_0000139_30672_31517 | 281 |
| 282 | 3300053095 | Ga0500640_100312 | Ga0500640_100312_156_1001 | 281 |
| 283 | 3300053096 | Ga0500641_0024716 | Ga0500641_0024716_591_1439 | 281 |
| 284 | 3300053098 | Ga0500650_0004684 | Ga0500650_0004684_751_1599 | 281 |
| 285 | 3300053104 | Ga0500556_0000019 | Ga0500556_0000019_3766_4614 | 281 |
| 286 | 3300053109 | Ga0500569_000864 | Ga0500569_000864_1143_1991 | 281 |
| 287 | 3300053111 | Ga0500572_018341 | Ga0500572_018341_891_1736 | 281 |
| 288 | 3300053116 | Ga0500592_006645 | Ga0500592_006645_923_1771 | 281 |
| 289 | 3300053119 | Ga0500595_002157 | Ga0500595_002157_3440_4288 | 281 |
| 290 | 3300053122 | Ga0500608_035435 | Ga0500608_035435_1055_1900 | 281 |
| 291 | 3300053130 | Ga0500642_0000039 | Ga0500642_0000039_93726_94574 | 281 |
| 292 | 3300053131 | Ga0500652_001066 | Ga0500652_001066_4554_5402 | 281 |
| 293 | 3300053134 | Ga0500658_0009611 | Ga0500658_0009611_126_974 | 281 |
| 294 | 3300053139 | Ga0500568_0001467 | Ga0500568_0001467_3343_4191 | 281 |
| 295 | 3300053142 | Ga0500577_0034909 | Ga0500577_0034909_315_1163 | 281 |
| 296 | 3300053144 | Ga0500585_119091 | Ga0500585_119091_22_867 | 281 |
| 297 | 3300053151 | Ga0500604_0025269 | Ga0500604_0025269_433_1281 | 281 |
| 298 | 3300053153 | Ga0500616_0000038 | Ga0500616_0000038_150330_151187 | 281 |
| 299 | 3300053153 | Ga0500616_0000059 | Ga0500616_0000059_255075_255923 | 281 |
| 300 | 3300053155 | Ga0500620_063319 | Ga0500620_063319_24_872 | 281 |
| 301 | 3300053156 | Ga0500622_0015463 | Ga0500622_0015463_943_1791 | 281 |
| 302 | 3300053163 | Ga0500639_007050 | Ga0500639_007050_3376_4221 | 281 |
| 303 | iso_pu_bacteria | 8016583857 | 8016585942 | 281 |
| 304 | 3300003215 | JGI25153J46596_10006145 | JGI25153J46596_100061456 | 282 |
| 305 | 3300003215 | JGI25153J46596_10011665 | JGI25153J46596_100116655 | 282 |
| 306 | 3300005434 | Ga0070709_10001043 | Ga0070709_100010435 | 282 |
| 307 | 3300005436 | Ga0070713_100030913 | Ga0070713_1000309131 | 282 |
| 308 | 3300005437 | Ga0070710_10038234 | Ga0070710_100382341 | 282 |
| 309 | 3300005548 | Ga0070665_100140122 | Ga0070665_1001401221 | 282 |
| 310 | 3300005564 | Ga0070664_100359423 | Ga0070664_1003594231 | 282 |
| 311 | 3300005578 | Ga0068854_100372222 | Ga0068854_1003722221 | 282 |
| 312 | 3300006173 | Ga0070716_100007223 | Ga0070716_1000072231 | 282 |
| 313 | 3300006175 | Ga0070712_100182258 | Ga0070712_1001822581 | 282 |
| 314 | 3300009093 | Ga0105240_10005129 | Ga0105240_1000512910 | 282 |
| 315 | 3300010375 | Ga0105239_10179264 | Ga0105239_101792642 | 282 |
| 316 | 3300014745 | Ga0157377_10400498 | Ga0157377_104004981 | 282 |
| 317 | 3300021320 | Ga0214544_1000087 | Ga0214544_100008772 | 282 |
| 318 | 3300021321 | Ga0214542_1000018 | Ga0214542_1000018143 | 282 |
| 319 | 3300021324 | Ga0214545_1000009 | Ga0214545_100000939 | 282 |
| 320 | 3300021327 | Ga0214543_1000037 | Ga0214543_1000037135 | 282 |
| 321 | 3300025230 | Ga0209563_104871 | Ga0209563_1048713 | 282 |
| 322 | 3300025253 | Ga0209677_105069 | Ga0209677_1050694 | 282 |
| 323 | 3300025254 | Ga0209148_1002285 | Ga0209148_10022852 | 282 |
| 324 | 3300025272 | Ga0209455_1003892 | Ga0209455_10038925 | 282 |
| 325 | 3300025273 | Ga0209673_1028217 | Ga0209673_10282172 | 282 |
| 326 | 3300025295 | Ga0209564_1007864 | Ga0209564_10078645 | 282 |
| 327 | 3300025297 | Ga0209758_1006161 | Ga0209758_10061617 | 282 |
| 328 | 3300025297 | Ga0209758_1011559 | Ga0209758_10115597 | 282 |
| 329 | 3300025297 | Ga0209758_1017944 | Ga0209758_10179445 | 282 |
| 330 | 3300025297 | Ga0209758_1022776 | Ga0209758_10227763 | 282 |
| 331 | 3300025302 | Ga0207426_1001522 | Ga0207426_10015225 | 282 |
| 332 | 3300025898 | Ga0207692_10004318 | Ga0207692_100043184 | 282 |
| 333 | 3300025904 | Ga0207647_10019817 | Ga0207647_100198176 | 282 |
| 334 | 3300025906 | Ga0207699_10000360 | Ga0207699_100003609 | 282 |
| 335 | 3300025911 | Ga0207654_10255164 | Ga0207654_102551641 | 282 |
| 336 | 3300025913 | Ga0207695_10000059 | Ga0207695_10000059271 | 282 |
| 337 | 3300025915 | Ga0207693_10059536 | Ga0207693_100595365 | 282 |
| 338 | 3300025928 | Ga0207700_10034750 | Ga0207700_100347501 | 282 |
| 339 | 3300025929 | Ga0207664_10344058 | Ga0207664_103440582 | 282 |
| 340 | 3300025932 | Ga0207690_10074693 | Ga0207690_100746932 | 282 |
| 341 | 3300025939 | Ga0207665_10045899 | Ga0207665_100458991 | 282 |
| 342 | 3300025949 | Ga0207667_10275853 | Ga0207667_102758532 | 282 |
| 343 | 3300025949 | Ga0207667_10302771 | Ga0207667_103027712 | 282 |
| 344 | 3300025981 | Ga0207640_10045306 | Ga0207640_100453062 | 282 |
| 345 | 3300026078 | Ga0207702_10232705 | Ga0207702_102327052 | 282 |
| 346 | 3300026088 | Ga0207641_10213959 | Ga0207641_102139592 | 282 |
| 347 | 3300028379 | Ga0268266_10020841 | Ga0268266_100208411 | 282 |
| 348 | 3300031235 | Ga0265330_10055090 | Ga0265330_100550902 | 282 |
| 349 | 3300031238 | Ga0265332_10030006 | Ga0265332_100300063 | 282 |
| 350 | 3300031247 | Ga0265340_10001209 | Ga0265340_100012096 | 282 |
| 351 | 3300033180 | Ga0307510_10035286 | Ga0307510_100352867 | 282 |
| 352 | 3300033180 | Ga0307510_10089059 | Ga0307510_100890592 | 282 |
| 353 | 3300035086 | Ga0373934_0003939 | Ga0373934_0003939_4495_5346 | 282 |
| 354 | 3300035113 | Ga0373936_0010427 | Ga0373936_0010427_1852_2703 | 282 |
| 355 | 3300035117 | Ga0373953_0000259 | Ga0373953_0000259_4621_5472 | 282 |
| 356 | 3300035118 | Ga0373954_0000249 | Ga0373954_0000249_16176_17027 | 282 |
| 357 | 3300035119 | Ga0373956_0018532 | Ga0373956_0018532_592_1443 | 282 |
| 358 | 3300035120 | Ga0373957_0003088 | Ga0373957_0003088_2250_3101 | 282 |
| 359 | 3300035170 | Ga0373943_0003923 | Ga0373943_0003923_2326_3177 | 282 |
| 360 | 3300035171 | Ga0373946_0005379 | Ga0373946_0005379_2687_3538 | 282 |
| 361 | 3300035172 | Ga0373955_0009036 | Ga0373955_0009036_87_938 | 282 |
| 362 | 3300035410 | Ga0373924_0003664 | Ga0373924_0003664_1252_2103 | 282 |
| 363 | 3300035692 | Ga0373935_0000434 | Ga0373935_0000434_5604_6455 | 282 |
| 364 | 3300035692 | Ga0373935_0112742 | Ga0373935_0112742_648_1499 | 282 |
| 365 | 3300035695 | Ga0373927_0003717 | Ga0373927_0003717_3857_4708 | 282 |
| 366 | 3300035724 | Ga0373933_0001831 | Ga0373933_0001831_5767_6618 | 282 |
| 367 | 3300035725 | Ga0373947_0003045 | Ga0373947_0003045_3374_4225 | 282 |
| 368 | 3300036401 | Ga0373937_0171393 | Ga0373937_0171393_725_1576 | 282 |
| 369 | 3300037068 | Ga0373925_0006130 | Ga0373925_0006130_4122_4973 | 282 |
| 370 | 3300037418 | Ga0395900_0000696 | Ga0395900_0000696_43284_44132 | 282 |
| 371 | 3300037466 | Ga0395898_0035004 | Ga0395898_0035004_1604_2452 | 282 |
| 372 | 3300037466 | Ga0395898_0107104 | Ga0395898_0107104_1178_2032 | 282 |
| 373 | 3300038443 | Ga0395901_0048644 | Ga0395901_0048644_2883_3737 | 282 |
| 374 | 3300045049 | Ga0466959_0249432 | Ga0466959_0249432_88_939 | 282 |
| 375 | 3300046454 | Ga0495592_0011508 | Ga0495592_0011508_511_1362 | 282 |
| 376 | 3300046454 | Ga0495592_0172975 | Ga0495592_0172975_169_1020 | 282 |
| 377 | 3300046455 | Ga0495603_0000189 | Ga0495603_0000189_13934_14785 | 282 |
| 378 | 3300046455 | Ga0495603_0021216 | Ga0495603_0021216_2258_3109 | 282 |
| 379 | 3300046459 | Ga0495629_0000268 | Ga0495629_0000268_11958_12809 | 282 |
| 380 | 3300046459 | Ga0495629_0001490 | Ga0495629_0001490_14523_15374 | 282 |
| 381 | 3300046461 | Ga0495641_0002442 | Ga0495641_0002442_10033_10884 | 282 |
| 382 | 3300046462 | Ga0495651_0011203 | Ga0495651_0011203_1745_2593 | 282 |
| 383 | 3300046463 | Ga0495653_0000300 | Ga0495653_0000300_32776_33627 | 282 |
| 384 | 3300046472 | Ga0495580_0006330 | Ga0495580_0006330_2356_3207 | 282 |
| 385 | 3300046473 | Ga0495582_0000144 | Ga0495582_0000144_12138_12989 | 282 |
| 386 | 3300046475 | Ga0495639_0000067 | Ga0495639_0000067_33148_33999 | 282 |
| 387 | 3300046476 | Ga0495662_0000005 | Ga0495662_0000005_67265_68116 | 282 |
| 388 | 3300046477 | Ga0495664_0052227 | Ga0495664_0052227_12_863 | 282 |
| 389 | 3300046499 | Ga0495594_0000102 | Ga0495594_0000102_32497_33348 | 282 |
| 390 | 3300046511 | Ga0495608_0000255 | Ga0495608_0000255_36820_37671 | 282 |
| 391 | 3300046511 | Ga0495608_0040269 | Ga0495608_0040269_941_1789 | 282 |
| 392 | 3300046514 | Ga0495618_0039068 | Ga0495618_0039068_1839_2690 | 282 |
| 393 | 3300046516 | Ga0495628_0036326 | Ga0495628_0036326_2525_3376 | 282 |
| 394 | 3300046517 | Ga0495630_0014512 | Ga0495630_0014512_4635_5486 | 282 |
| 395 | 3300046522 | Ga0495643_0111638 | Ga0495643_0111638_31_879 | 282 |
| 396 | 3300046524 | Ga0495648_0000382 | Ga0495648_0000382_6575_7429 | 282 |
| 397 | 3300046526 | Ga0495666_0104893 | Ga0495666_0104893_292_1143 | 282 |
| 398 | 3300046529 | Ga0495652_0048270 | Ga0495652_0048270_120_971 | 282 |
| 399 | 3300046531 | Ga0495665_0000935 | Ga0495665_0000935_10142_10993 | 282 |
| 400 | 3300046533 | Ga0495640_0005833 | Ga0495640_0005833_8135_8986 | 282 |
| 401 | 3300046533 | Ga0495640_0012005 | Ga0495640_0012005_4512_5363 | 282 |
| 402 | 3300046535 | Ga0495586_0328668 | Ga0495586_0328668_11_862 | 282 |
| 403 | 3300046536 | Ga0495587_0008775 | Ga0495587_0008775_469_1317 | 282 |
| 404 | 3300046536 | Ga0495587_0013918 | Ga0495587_0013918_648_1499 | 282 |
| 405 | 3300046543 | Ga0495645_0072463 | Ga0495645_0072463_111_962 | 282 |
| 406 | 3300046557 | Ga0495622_0000649 | Ga0495622_0000649_16916_17767 | 282 |
| 407 | 3300046559 | Ga0495667_0000121 | Ga0495667_0000121_30718_31569 | 282 |
| 408 | 3300046642 | Ga0495634_0001407 | Ga0495634_0001407_18732_19583 | 282 |
| 409 | 3300046642 | Ga0495634_0051027 | Ga0495634_0051027_1891_2742 | 282 |
| 410 | 3300046660 | Ga0495625_0188236 | Ga0495625_0188236_81_944 | 282 |
| 411 | 3300046663 | Ga0495635_0000072 | Ga0495635_0000072_31740_32591 | 282 |
| 412 | 3300046663 | Ga0495635_0002392 | Ga0495635_0002392_2563_3414 | 282 |
| 413 | 3300046674 | Ga0495588_0010392 | Ga0495588_0010392_1591_2442 | 282 |
| 414 | 3300046675 | Ga0495657_0004271 | Ga0495657_0004271_7894_8745 | 282 |
| 415 | 3300046678 | Ga0495599_0007431 | Ga0495599_0007431_5707_6558 | 282 |
| 416 | 3300046678 | Ga0495599_0174472 | Ga0495599_0174472_31_879 | 282 |
| 417 | 3300046680 | Ga0495646_0007628 | Ga0495646_0007628_370_1221 | 282 |
| 418 | 3300046681 | Ga0495647_0002197 | Ga0495647_0002197_822_1673 | 282 |
| 419 | 3300046683 | Ga0495658_0000439 | Ga0495658_0000439_20555_21406 | 282 |
| 420 | 3300046689 | Ga0495613_0001828 | Ga0495613_0001828_7346_8197 | 282 |
| 421 | 3300046689 | Ga0495613_0262260 | Ga0495613_0262260_84_935 | 282 |
| 422 | 3300046690 | Ga0495624_0000460 | Ga0495624_0000460_17736_18587 | 282 |
| 423 | 3300046809 | Ga0495600_0014429 | Ga0495600_0014429_499_1350 | 282 |
| 424 | 3300047315 | Ga0495581_0000084 | Ga0495581_0000084_30906_31757 | 282 |
| 425 | 3300047315 | Ga0495581_0127057 | Ga0495581_0127057_253_1104 | 282 |
| 426 | 3300047317 | Ga0495604_0002223 | Ga0495604_0002223_4618_5469 | 282 |
| 427 | 3300047319 | Ga0495674_0004128 | Ga0495674_0004128_9621_10472 | 282 |
| 428 | 3300047319 | Ga0495674_0019201 | Ga0495674_0019201_2681_3532 | 282 |
| 429 | 3300047319 | Ga0495674_0192303 | Ga0495674_0192303_10_858 | 282 |
| 430 | 3300047321 | Ga0495676_0006985 | Ga0495676_0006985_4265_5116 | 282 |
| 431 | 3300047322 | Ga0495680_0001208 | Ga0495680_0001208_26736_27587 | 282 |
| 432 | 3300047322 | Ga0495680_0005809 | Ga0495680_0005809_4118_4966 | 282 |
| 433 | 3300047443 | Ga0495687_130376 | Ga0495687_130376_31_879 | 282 |
| 434 | 3300047444 | Ga0495675_0010221 | Ga0495675_0010221_835_1686 | 282 |
| 435 | 3300047471 | Ga0495684_0000594 | Ga0495684_0000594_20464_21315 | 282 |
| 436 | 3300047471 | Ga0495684_0036127 | Ga0495684_0036127_2302_3153 | 282 |
| 437 | 3300047673 | Ga0495593_0000038 | Ga0495593_0000038_36528_37379 | 282 |
| 438 | 3300047673 | Ga0495593_0000109 | Ga0495593_0000109_6386_7237 | 282 |
| 439 | 3300048088 | Ga0495602_0025029 | Ga0495602_0025029_3701_4549 | 282 |
| 440 | 3300048088 | Ga0495602_0234433 | Ga0495602_0234433_27_878 | 282 |
| 441 | 3300048905 | Ga0496102_0222523 | Ga0496102_0222523_422_1270 | 282 |
| 442 | 3300048905 | Ga0496102_0246787 | Ga0496102_0246787_128_976 | 282 |
| 443 | 3300048906 | Ga0496103_0164558 | Ga0496103_0164558_38_886 | 282 |
| 444 | 3300048909 | Ga0496106_0315860 | Ga0496106_0315860_239_1087 | 282 |
| 445 | 3300048912 | Ga0496109_0380920 | Ga0496109_0380920_459_1307 | 282 |
| 446 | 3300048915 | Ga0496112_0000065 | Ga0496112_0000065_18765_19622 | 282 |
| 447 | 3300048915 | Ga0496112_0212900 | Ga0496112_0212900_612_1460 | 282 |
| 448 | 3300048915 | Ga0496112_0394288 | Ga0496112_0394288_424_1272 | 282 |
| 449 | 3300048916 | Ga0496113_0375907 | Ga0496113_0375907_65_913 | 282 |
| 450 | 3300048919 | Ga0496116_0205825 | Ga0496116_0205825_13_870 | 282 |
| 451 | 3300048921 | Ga0496118_0063550 | Ga0496118_0063550_1837_2685 | 282 |
| 452 | 3300048922 | Ga0496119_0022737 | Ga0496119_0022737_3307_4155 | 282 |
| 453 | 3300053080 | Ga0500635_0046689 | Ga0500635_0046689_228_1079 | 282 |
| 454 | 3300053085 | Ga0495619_0010257 | Ga0495619_0010257_2679_3530 | 282 |
| 455 | 3300053085 | Ga0495619_0042088 | Ga0495619_0042088_103_951 | 282 |
| 456 | 3300053085 | Ga0495619_0255899 | Ga0495619_0255899_82_933 | 282 |
| 457 | 3300053094 | Ga0500566_0078766 | Ga0500566_0078766_785_1633 | 282 |
| 458 | 3300053102 | Ga0500554_005453 | Ga0500554_005453_209_1060 | 282 |
| 459 | 3300053119 | Ga0500595_012821 | Ga0500595_012821_1793_2644 | 282 |
| 460 | 3300053130 | Ga0500642_0002118 | Ga0500642_0002118_970_1818 | 282 |
| 461 | 3300053150 | Ga0500603_002683 | Ga0500603_002683_2906_3757 | 282 |
| 462 | 3300053158 | Ga0500627_0117092 | Ga0500627_0117092_199_1050 | 282 |
| 463 | 3300053177 | Ga0500636_0012647 | Ga0500636_0012647_3082_3933 | 282 |
| 464 | 3300053724 | Ga0500570_087710 | Ga0500570_087710_343_1194 | 282 |
| 465 | 3300053729 | Ga0500625_090653 | Ga0500625_090653_134_982 | 282 |
| 466 | 3300053737 | Ga0500601_000189 | Ga0500601_000189_4934_5782 | 282 |
| 467 | iso_pu_bacteria | 2824661429 | 2824670451 | 282 |
| 468 | iso_pu_bacteria | 2906626472 | 2906633195 | 282 |
| 469 | iso_pu_bacteria | 2935837841 | 2935841380 | 282 |
| 470 | iso_pu_bacteria | 2941538514 | 2941543606 | 282 |
| 471 | iso_pu_bacteria | 2528768022 | 2528852092 | 284 |
| 472 | iso_pu_bacteria | 2879099564 | 2879106718 | 284 |
| 473 | iso_pu_bacteria | 2922368715 | 2922369137 | 284 |
| 474 | iso_pu_bacteria | 2932784394 | 2932789033 | 284 |
| 475 | iso_pu_bacteria | 2932809354 | 2932814330 | 284 |
| 476 | iso_pu_bacteria | 2932818245 | 2932820456 | 284 |
| 477 | iso_pu_bacteria | 2932828146 | 2932834488 | 284 |
| 478 | iso_pu_bacteria | 2935616580 | 2935624471 | 284 |
| 479 | iso_pu_bacteria | 2935638405 | 2935645861 | 284 |
| 480 | iso_pu_bacteria | 2935665750 | 2935673428 | 284 |
| 481 | iso_pu_bacteria | 2935684952 | 2935686781 | 284 |
| 482 | iso_pu_bacteria | 2935694250 | 2935701539 | 284 |
| 483 | iso_pu_bacteria | 2935703347 | 2935710486 | 284 |
| 484 | iso_pu_bacteria | 2935713505 | 2935716469 | 284 |
| 485 | iso_pu_bacteria | 2935722832 | 2935723406 | 284 |
| 486 | iso_pu_bacteria | 2935732158 | 2935734962 | 284 |
| 487 | iso_pu_bacteria | 2935741537 | 2935744247 | 284 |
| 488 | iso_pu_bacteria | 2935750917 | 2935752747 | 284 |
| 489 | iso_pu_bacteria | 2935760218 | 2935764706 | 284 |
| 490 | iso_pu_bacteria | 2935801545 | 2935806183 | 284 |
| 491 | iso_pu_bacteria | 2935810662 | 2935816949 | 284 |
| 492 | iso_pu_bacteria | 2935827899 | 2935835238 | 284 |
| 493 | iso_pu_bacteria | 2935855204 | 2935863052 | 284 |
| 494 | iso_pu_bacteria | 2935864058 | 2935871862 | 284 |
| 495 | iso_pu_bacteria | 2935873716 | 2935882247 | 284 |
| 496 | iso_pu_bacteria | 2935908558 | 2935911014 | 284 |
| 497 | iso_pu_bacteria | 2935916978 | 2935924175 | 284 |
| 498 | iso_pu_bacteria | 2935926038 | 2935932772 | 284 |
| 499 | iso_pu_bacteria | 2935934488 | 2935937335 | 284 |
| 500 | iso_pu_bacteria | 2935942939 | 2935949464 | 284 |
| 501 | iso_pu_bacteria | 2935951376 | 2935958137 | 284 |
| 502 | iso_pu_bacteria | 2935967501 | 2935971208 | 284 |
| 503 | iso_pu_bacteria | 2935992306 | 2936000182 | 284 |
| 504 | iso_pu_bacteria | 2936002035 | 2936010096 | 284 |
| 505 | iso_pu_bacteria | 2936037263 | 2936043940 | 284 |
| 506 | iso_pu_bacteria | 2940556831 | 2940558660 | 284 |
| 507 | iso_pu_bacteria | 8016511872 | 8016517769 | 284 |
| 508 | iso_pu_bacteria | 8017057580 | 8017058861 | 284 |
| 509 | iso_pu_bacteria | 8019576017 | 8019576790 | 284 |
| 510 | iso_pu_bacteria | 8019586578 | 8019594846 | 284 |
| 511 | iso_pu_bacteria | 8019597564 | 8019606893 | 284 |
| 512 | iso_pu_bacteria | 8019608314 | 8019611615 | 284 |
| 513 | iso_pu_bacteria | 8019687851 | 8019695801 | 284 |
| 514 | iso_pu_bacteria | 2508501042 | 2508695869 | 285 |
| 515 | iso_pu_bacteria | 2511231028 | 2511401125 | 285 |
| 516 | iso_pu_bacteria | 2513237139 | 2513876952 | 285 |
| 517 | iso_pu_bacteria | 2515154112 | 2515624006 | 285 |
| 518 | iso_pu_bacteria | 2617270735 | 2617353230 | 285 |
| 519 | iso_pu_bacteria | 2802429603 | 2805921253 | 285 |
| 520 | iso_pu_bacteria | 2824773399 | 2824777503 | 285 |
| 521 | iso_pu_bacteria | 2847939898 | 2847942655 | 285 |
| 522 | iso_pu_bacteria | 2874590934 | 2874591116 | 285 |
| 523 | iso_pu_bacteria | 2874645413 | 2874647753 | 285 |
| 524 | iso_pu_bacteria | 2876771140 | 2876772043 | 285 |
| 525 | iso_pu_bacteria | 2876818435 | 2876819300 | 285 |
| 526 | iso_pu_bacteria | 2879074833 | 2879074960 | 285 |
| 527 | iso_pu_bacteria | 2879127579 | 2879135779 | 285 |
| 528 | iso_pu_bacteria | 2879142872 | 2879150948 | 285 |
| 529 | iso_pu_bacteria | 2885409591 | 2885411198 | 285 |
| 530 | iso_pu_bacteria | 2888388044 | 2888390307 | 285 |
| 531 | iso_pu_bacteria | 2906643746 | 2906648054 | 285 |
| 532 | iso_pu_bacteria | 2935648319 | 2935649053 | 285 |
| 533 | iso_pu_bacteria | 2935656913 | 2935658175 | 285 |
| 534 | iso_pu_bacteria | 2935975950 | 2935982198 | 285 |
| 535 | iso_pu_bacteria | 2935984226 | 2935985337 | 285 |
| 536 | iso_pu_bacteria | 2936011229 | 2936012394 | 285 |
| 537 | iso_pu_bacteria | 2936019824 | 2936020525 | 285 |
| 538 | iso_pu_bacteria | 2936028420 | 2936029687 | 285 |
| 539 | iso_pu_bacteria | 2936046547 | 2936051848 | 285 |
| 540 | iso_pu_bacteria | 2936055302 | 2936056899 | 285 |
| 541 | iso_pu_bacteria | 2941531003 | 2941535693 | 285 |
| 542 | iso_pu_bacteria | 8019619141 | 8019623346 | 285 |
| 543 | iso_pu_bacteria | 8019638758 | 8019640867 | 285 |
| 544 | iso_pu_bacteria | 8019659431 | 8019666592 | 285 |
| 545 | iso_pu_bacteria | 8019668869 | 8019676331 | 285 |
| 546 | iso_pu_bacteria | 8019678201 | 8019679666 | 285 |
| 547 | iso_pu_bacteria | 8056967851 | 8056975626 | 285 |
| 548 | iso_pu_bacteria | 2824679649 | 2824685545 | 286 |
| 549 | iso_pu_bacteria | 2841957949 | 2841965138 | 286 |
| 550 | iso_pu_bacteria | 2857509624 | 2857515616 | 286 |
| 551 | iso_pu_bacteria | 2885366525 | 2885368700 | 286 |
| 552 | iso_pu_bacteria | 2922393267 | 2922400748 | 286 |
| 553 | iso_pu_bacteria | 3005710791 | 3005711387 | 286 |
| 554 | 3300005455 | Ga0070663_100109435 | Ga0070663_1001094351 | 288 |
| 555 | 3300005459 | Ga0068867_100510338 | Ga0068867_1005103381 | 288 |
| 556 | 3300006038 | Ga0075365_10068554 | Ga0075365_100685543 | 288 |
| 557 | 3300026023 | Ga0207677_10435579 | Ga0207677_104355791 | 288 |
| 558 | 3300026067 | Ga0207678_10041959 | Ga0207678_100419591 | 288 |
| 559 | 3300026089 | Ga0207648_10179191 | Ga0207648_101791911 | 288 |
| 560 | 3300039437 | Ga0436365_0801382 | Ga0436365_0801382_96_965 | 288 |
| 561 | 3300041453 | Ga0451797_1195647 | Ga0451797_1195647_129_1019 | 288 |
| 562 | 3300046455 | Ga0495603_0127912 | Ga0495603_0127912_392_1318 | 288 |
| 563 | 3300046501 | Ga0495607_0173690 | Ga0495607_0173690_186_1052 | 288 |
| 564 | 3300046616 | Ga0495668_0207077 | Ga0495668_0207077_14_880 | 288 |
| 565 | 3300046674 | Ga0495588_0109722 | Ga0495588_0109722_84_950 | 288 |
| 566 | 3300047469 | Ga0495673_0066228 | Ga0495673_0066228_531_1457 | 288 |
| 567 | 3300047472 | Ga0495686_0093532 | Ga0495686_0093532_839_1765 | 288 |
| 568 | 3300048908 | Ga0496105_0106523 | Ga0496105_0106523_758_1684 | 288 |
| 569 | 3300048909 | Ga0496106_0047592 | Ga0496106_0047592_2304_3170 | 288 |
| 570 | 3300048910 | Ga0496107_0159094 | Ga0496107_0159094_680_1606 | 288 |
| 571 | 3300048913 | Ga0496110_0189228 | Ga0496110_0189228_927_1853 | 288 |
| 572 | 3300048913 | Ga0496110_0636985 | Ga0496110_0636985_40_906 | 288 |
| 573 | 3300048915 | Ga0496112_0598785 | Ga0496112_0598785_87_953 | 288 |
| 574 | 3300048919 | Ga0496116_0011726 | Ga0496116_0011726_1205_2071 | 288 |
| 575 | 3300048920 | Ga0496117_0134676 | Ga0496117_0134676_492_1418 | 288 |
| 576 | 3300048924 | Ga0496121_0090747 | Ga0496121_0090747_953_1879 | 288 |
| 577 | 3300048927 | Ga0496124_0174964 | Ga0496124_0174964_72_998 | 288 |
| 578 | 3300050492 | nmdc:mga0yw44_13913_c1 | nmdc:mga0yw44_13913_c1_563_1429 | 288 |
| 579 | iso_pu_bacteria | 2513237102 | 2513700410 | 288 |
| 580 | iso_pu_bacteria | 2513237161 | 2514016072 | 288 |
| 581 | iso_pu_bacteria | 2517093001 | 2517105903 | 288 |
| 582 | iso_pu_bacteria | 2824617872 | 2824624894 | 288 |
| 583 | iso_pu_bacteria | 2824626560 | 2824631754 | 288 |
| 584 | iso_pu_bacteria | 2824687955 | 2824694169 | 288 |
| 585 | iso_pu_bacteria | 2824723954 | 2824729549 | 288 |
| 586 | iso_pu_bacteria | 2824753945 | 2824762093 | 288 |
| 587 | iso_pu_bacteria | 2824763712 | 2824772412 | 288 |
| 588 | iso_pu_bacteria | 2838122688 | 2838125737 | 288 |
| 589 | iso_pu_bacteria | 2841941048 | 2841947948 | 288 |
| 590 | iso_pu_bacteria | 2841949485 | 2841957045 | 288 |
| 591 | iso_pu_bacteria | 2841966195 | 2841972776 | 288 |
| 592 | iso_pu_bacteria | 2841974524 | 2841977554 | 288 |
| 593 | iso_pu_bacteria | 2841983080 | 2841984889 | 288 |
| 594 | iso_pu_bacteria | 2842038055 | 2842041345 | 288 |
| 595 | iso_pu_bacteria | 2842045827 | 2842049387 | 288 |
| 596 | iso_pu_bacteria | 2844315083 | 2844315842 | 288 |
| 597 | iso_pu_bacteria | 2874612657 | 2874617131 | 288 |
| 598 | iso_pu_bacteria | 2874620515 | 2874621362 | 288 |
| 599 | iso_pu_bacteria | 2881364244 | 2881367126 | 288 |
| 600 | iso_pu_bacteria | 2881665667 | 2881668409 | 288 |
| 601 | iso_pu_bacteria | 2903727486 | 2903730858 | 288 |
| 602 | iso_pu_bacteria | 2904666416 | 2904668032 | 288 |
| 603 | iso_pu_bacteria | 2904711408 | 2904714163 | 288 |
| 604 | iso_pu_bacteria | 2906602504 | 2906603681 | 288 |
| 605 | 3300003215 | JGI25153J46596_10003051 | JGI25153J46596_100030519 | 289 |
| 606 | 3300003354 | JGI25160J50197_1001574 | JGI25160J50197_10015744 | 289 |
| 607 | 3300005330 | Ga0070690_100046706 | Ga0070690_1000467062 | 289 |
| 608 | 3300005543 | Ga0070672_100012411 | Ga0070672_1000124118 | 289 |
| 609 | 3300005719 | Ga0068861_100058920 | Ga0068861_1000589203 | 289 |
| 610 | 3300005841 | Ga0068863_100302870 | Ga0068863_1003028702 | 289 |
| 611 | 3300005842 | Ga0068858_100109449 | Ga0068858_1001094492 | 289 |
| 612 | 3300009148 | Ga0105243_10134417 | Ga0105243_101344172 | 289 |
| 613 | 3300009553 | Ga0105249_10164886 | Ga0105249_101648862 | 289 |
| 614 | 3300010375 | Ga0105239_10690001 | Ga0105239_106900012 | 289 |
| 615 | 3300025261 | Ga0209233_1013010 | Ga0209233_10130103 | 289 |
| 616 | 3300025297 | Ga0209758_1000949 | Ga0209758_100094910 | 289 |
| 617 | 3300025927 | Ga0207687_10167300 | Ga0207687_101673002 | 289 |
| 618 | 3300025940 | Ga0207691_10187098 | Ga0207691_101870982 | 289 |
| 619 | 3300026118 | Ga0207675_100060324 | Ga0207675_1000603244 | 289 |
| 620 | 3300037471 | Ga0395905_0036154 | Ga0395905_0036154_782_1651 | 289 |
| 621 | 3300044656 | Ga0466969_0030684 | Ga0466969_0030684_1054_1923 | 289 |
| 622 | 3300044658 | Ga0466972_0001053 | Ga0466972_0001053_5292_6161 | 289 |
| 623 | 3300044684 | Ga0466966_0000137 | Ga0466966_0000137_23600_24469 | 289 |
| 624 | 3300044693 | Ga0466961_0000039 | Ga0466961_0000039_27767_28636 | 289 |
| 625 | 3300044694 | Ga0466963_0001672 | Ga0466963_0001672_8967_9836 | 289 |
| 626 | 3300044765 | Ga0466970_0074283 | Ga0466970_0074283_800_1669 | 289 |
| 627 | 3300044901 | Ga0466960_0043701 | Ga0466960_0043701_428_1297 | 289 |
| 628 | 3300045049 | Ga0466959_0001594 | Ga0466959_0001594_9815_10684 | 289 |
| 629 | 3300046454 | Ga0495592_0011025 | Ga0495592_0011025_3517_4386 | 289 |
| 630 | 3300046454 | Ga0495592_0255347 | Ga0495592_0255347_193_1062 | 289 |
| 631 | 3300046474 | Ga0495605_0184778 | Ga0495605_0184778_21_890 | 289 |
| 632 | 3300046516 | Ga0495628_0040804 | Ga0495628_0040804_1710_2579 | 289 |
| 633 | 3300046529 | Ga0495652_0007246 | Ga0495652_0007246_5277_6146 | 289 |
| 634 | 3300046529 | Ga0495652_0106931 | Ga0495652_0106931_1327_2196 | 289 |
| 635 | 3300046533 | Ga0495640_0048180 | Ga0495640_0048180_2012_2881 | 289 |
| 636 | 3300046543 | Ga0495645_0027614 | Ga0495645_0027614_2688_3557 | 289 |
| 637 | 3300046559 | Ga0495667_0013372 | Ga0495667_0013372_1093_1962 | 289 |
| 638 | 3300046663 | Ga0495635_0037151 | Ga0495635_0037151_1629_2498 | 289 |
| 639 | 3300046675 | Ga0495657_0111504 | Ga0495657_0111504_185_1054 | 289 |
| 640 | 3300046679 | Ga0495623_0010400 | Ga0495623_0010400_3757_4626 | 289 |
| 641 | 3300046680 | Ga0495646_0061399 | Ga0495646_0061399_212_1081 | 289 |
| 642 | 3300046689 | Ga0495613_0154119 | Ga0495613_0154119_430_1299 | 289 |
| 643 | 3300046809 | Ga0495600_0001929 | Ga0495600_0001929_4065_4934 | 289 |
| 644 | 3300047317 | Ga0495604_0010947 | Ga0495604_0010947_1129_1998 | 289 |
| 645 | 3300047444 | Ga0495675_0070404 | Ga0495675_0070404_966_1835 | 289 |
| 646 | 3300048905 | Ga0496102_0150978 | Ga0496102_0150978_477_1400 | 289 |
| 647 | 3300048924 | Ga0496121_0139985 | Ga0496121_0139985_76_951 | 289 |
| 648 | 3300048929 | Ga0496126_0088464 | Ga0496126_0088464_710_1579 | 289 |
| 649 | 3300048929 | Ga0496126_0237057 | Ga0496126_0237057_321_1190 | 289 |
| 650 | 3300050490 | nmdc:mga03n38_45605_c1 | nmdc:mga03n38_45605_c1_903_1772 | 289 |
| 651 | 3300050516 | nmdc:mga0sz30_185344_c1 | nmdc:mga0sz30_185344_c1_17_886 | 289 |
| 652 | 3300053093 | Ga0500651_0009030 | Ga0500651_0009030_2924_3793 | 289 |
| 653 | 3300053103 | Ga0500555_003871 | Ga0500555_003871_990_1859 | 289 |
| 654 | 3300053109 | Ga0500569_000516 | Ga0500569_000516_2158_3027 | 289 |
| 655 | 3300053130 | Ga0500642_0026140 | Ga0500642_0026140_124_993 | 289 |
| 656 | 3300053133 | Ga0500655_030790 | Ga0500655_030790_84_953 | 289 |
| 657 | 3300053139 | Ga0500568_0010187 | Ga0500568_0010187_2055_2924 | 289 |
| 658 | 3300053142 | Ga0500577_0092177 | Ga0500577_0092177_197_1066 | 289 |
| 659 | 3300053158 | Ga0500627_0128272 | Ga0500627_0128272_54_923 | 289 |
| 660 | 3300053161 | Ga0500634_0143339 | Ga0500634_0143339_136_1005 | 289 |
| 661 | 3300053731 | Ga0500609_002302 | Ga0500609_002302_79_948 | 289 |
| 662 | 3300005334 | Ga0068869_100187122 | Ga0068869_1001871221 | 290 |
| 663 | 3300005344 | Ga0070661_100270881 | Ga0070661_1002708811 | 290 |
| 664 | 3300005455 | Ga0070663_100333944 | Ga0070663_1003339441 | 290 |
| 665 | 3300005543 | Ga0070672_100130698 | Ga0070672_1001306982 | 290 |
| 666 | 3300005547 | Ga0070693_100252828 | Ga0070693_1002528282 | 290 |
| 667 | 3300005548 | Ga0070665_100329221 | Ga0070665_1003292212 | 290 |
| 668 | 3300005564 | Ga0070664_100150931 | Ga0070664_1001509312 | 290 |
| 669 | 3300005578 | Ga0068854_100152216 | Ga0068854_1001522162 | 290 |
| 670 | 3300006237 | Ga0097621_100329117 | Ga0097621_1003291172 | 290 |
| 671 | 3300006358 | Ga0068871_100104701 | Ga0068871_1001047013 | 290 |
| 672 | 3300025297 | Ga0209758_1007096 | Ga0209758_10070962 | 290 |
| 673 | 3300025944 | Ga0207661_10551095 | Ga0207661_105510951 | 290 |
| 674 | 3300025945 | Ga0207679_10204384 | Ga0207679_102043842 | 290 |
| 675 | 3300026067 | Ga0207678_10029495 | Ga0207678_100294953 | 290 |
| 676 | 3300026088 | Ga0207641_10319570 | Ga0207641_103195702 | 290 |
| 677 | 3300026095 | Ga0207676_10032534 | Ga0207676_100325344 | 290 |
| 678 | 3300028379 | Ga0268266_10239769 | Ga0268266_102397692 | 290 |
| 679 | 3300053119 | Ga0500595_016051 | Ga0500595_016051_65_937 | 290 |
| 680 | 3300053123 | Ga0500614_032696 | Ga0500614_032696_228_1100 | 290 |
| 681 | 3300053154 | Ga0500619_045425 | Ga0500619_045425_474_1346 | 290 |
| 682 | 3300053155 | Ga0500620_054428 | Ga0500620_054428_122_994 | 290 |
| 683 | 3300053177 | Ga0500636_0000563 | Ga0500636_0000563_7761_8633 | 290 |
| 684 | 3300006173 | Ga0070716_100042884 | Ga0070716_1000428843 | 291 |
| 685 | 3300003214 | JGI25165J46597_1009332 | JGI25165J46597_10093322 | 292 |
| 686 | 3300003215 | JGI25153J46596_10004570 | JGI25153J46596_100045708 | 292 |
| 687 | 3300003215 | JGI25153J46596_10037172 | JGI25153J46596_100371722 | 292 |
| 688 | 3300003354 | JGI25160J50197_1001779 | JGI25160J50197_100177910 | 292 |
| 689 | 3300003794 | Ga0055531_10005617 | Ga0055531_100056178 | 292 |
| 690 | 3300005262 | Ga0065165_1005041 | Ga0065165_10050419 | 292 |
| 691 | 3300005335 | Ga0070666_10267489 | Ga0070666_102674891 | 292 |
| 692 | 3300005366 | Ga0070659_100022001 | Ga0070659_1000220014 | 292 |
| 693 | 3300005530 | Ga0070679_100296853 | Ga0070679_1002968531 | 292 |
| 694 | 3300006195 | Ga0075366_10002600 | Ga0075366_100026007 | 292 |
| 695 | 3300006942 | Ga0099824_1012187 | Ga0099824_10121875 | 292 |
| 696 | 3300009174 | Ga0105241_10047814 | Ga0105241_100478144 | 292 |
| 697 | 3300009551 | Ga0105238_10694036 | Ga0105238_106940362 | 292 |
| 698 | 3300025261 | Ga0209233_1005177 | Ga0209233_10051775 | 292 |
| 699 | 3300025297 | Ga0209758_1000030 | Ga0209758_1000030153 | 292 |
| 700 | 3300025297 | Ga0209758_1000884 | Ga0209758_100088410 | 292 |
| 701 | 3300025297 | Ga0209758_1010276 | Ga0209758_10102765 | 292 |
| 702 | 3300025299 | Ga0209256_1016593 | Ga0209256_10165932 | 292 |
| 703 | 3300025302 | Ga0207426_1015480 | Ga0207426_10154802 | 292 |
| 704 | 3300025304 | Ga0209257_1003355 | Ga0209257_10033555 | 292 |
| 705 | 3300025909 | Ga0207705_10142379 | Ga0207705_101423792 | 292 |
| 706 | 3300025939 | Ga0207665_10305035 | Ga0207665_103050351 | 292 |
| 707 | 3300025986 | Ga0207658_10378790 | Ga0207658_103787901 | 292 |
| 708 | 3300026067 | Ga0207678_10370875 | Ga0207678_103708751 | 292 |
| 709 | 3300027296 | Ga0209389_1000161 | Ga0209389_10001615 | 292 |
| 710 | 3300027357 | Ga0209589_1000103 | Ga0209589_100010337 | 292 |
| 711 | 3300027361 | Ga0209489_100304 | Ga0209489_10030437 | 292 |
| 712 | 3300046459 | Ga0495629_0031949 | Ga0495629_0031949_2128_3021 | 292 |
| 713 | 3300046460 | Ga0495638_0013239 | Ga0495638_0013239_2807_3700 | 292 |
| 714 | 3300046524 | Ga0495648_0050531 | Ga0495648_0050531_1557_2450 | 292 |
| 715 | 3300046524 | Ga0495648_0074678 | Ga0495648_0074678_1038_1931 | 292 |
| 716 | 3300046557 | Ga0495622_0008376 | Ga0495622_0008376_798_1691 | 292 |
| 717 | 3300046663 | Ga0495635_0050480 | Ga0495635_0050480_471_1364 | 292 |
| 718 | 3300047317 | Ga0495604_0061619 | Ga0495604_0061619_1505_2398 | 292 |
| 719 | 3300047673 | Ga0495593_0021842 | Ga0495593_0021842_83_976 | 292 |
| 720 | 3300048905 | Ga0496102_0363315 | Ga0496102_0363315_398_1291 | 292 |
| 721 | 3300048907 | Ga0496104_0025881 | Ga0496104_0025881_1650_2543 | 292 |
| 722 | 3300048918 | Ga0496115_0033662 | Ga0496115_0033662_759_1652 | 292 |
| 723 | 3300048921 | Ga0496118_0021615 | Ga0496118_0021615_2299_3192 | 292 |
| 724 | 3300048922 | Ga0496119_0007073 | Ga0496119_0007073_258_1151 | 292 |
| 725 | 3300048923 | Ga0496120_0016701 | Ga0496120_0016701_1672_2565 | 292 |
| 726 | 3300048923 | Ga0496120_0023248 | Ga0496120_0023248_980_1873 | 292 |
| 727 | 3300048924 | Ga0496121_0033524 | Ga0496121_0033524_2459_3364 | 292 |
| 728 | 3300048924 | Ga0496121_0178700 | Ga0496121_0178700_202_1095 | 292 |
| 729 | 3300048928 | Ga0496125_0093476 | Ga0496125_0093476_25_903 | 292 |
| 730 | 3300053087 | Ga0500643_006068 | Ga0500643_006068_4097_4990 | 292 |
| 731 | 3300053139 | Ga0500568_0008598 | Ga0500568_0008598_184_1122 | 292 |
| 732 | 3300053153 | Ga0500616_0015647 | Ga0500616_0015647_1326_2219 | 292 |
| 733 | 3300053156 | Ga0500622_0185245 | Ga0500622_0185245_38_931 | 292 |
| 734 | 3300053162 | Ga0500638_116171 | Ga0500638_116171_278_1171 | 292 |
| 735 | 3300053736 | Ga0500599_000667 | Ga0500599_000667_1054_1947 | 292 |
| 736 | iso_pu_bacteria | 2508501009 | 2508539500 | 292 |
| 737 | iso_pu_bacteria | 2513237092 | 2513628936 | 292 |
| 738 | iso_pu_bacteria | 2513237094 | 2513642279 | 292 |
| 739 | iso_pu_bacteria | 2932794094 | 2932801336 | 292 |
| 740 | iso_pu_bacteria | 2932801729 | 2932808849 | 292 |
| 741 | iso_pu_bacteria | 2935608549 | 2935614662 | 292 |
| 742 | iso_pu_bacteria | 2935785616 | 2935789157 | 292 |
| 743 | iso_pu_bacteria | 2935793552 | 2935796906 | 292 |
| 744 | iso_pu_bacteria | 2935819856 | 2935826297 | 292 |
| 745 | iso_pu_bacteria | 2935847175 | 2935853793 | 292 |
| 746 | iso_pu_bacteria | 2935883170 | 2935883280 | 292 |
| 747 | iso_pu_bacteria | 3005594810 | 3005595426 | 292 |
| 748 | iso_pu_bacteria | 3005718088 | 3005718660 | 292 |
| 749 | iso_pu_bacteria | 8016522445 | 8016525830 | 292 |
| 750 | iso_pu_bacteria | 8016530956 | 8016539433 | 292 |
| 751 | iso_pu_bacteria | 8016548790 | 8016549572 | 292 |
| 752 | iso_pu_bacteria | 8016566248 | 8016569123 | 292 |
| 753 | iso_pu_bacteria | 8016575299 | 8016581760 | 292 |
| 754 | iso_pu_bacteria | 8016595262 | 8016596008 | 292 |
| 755 | iso_pu_bacteria | 8016603502 | 8016606882 | 292 |
| 756 | iso_pu_bacteria | 8019530166 | 8019530713 | 292 |
| 757 | iso_pu_bacteria | 8019538911 | 8019540872 | 292 |
| 758 | iso_pu_bacteria | 8019547302 | 8019549743 | 292 |
| 759 | iso_pu_bacteria | 8019648815 | 8019652963 | 292 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2p35-assembly1.cif.gz_B | crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens | 0.7094 | 52 | 264 |
| 7ebx-assembly1.cif.gz_A | crystal structure of juvenile hormone acid methyltransferase jhamt in complex with s-adenosyl-l-homocysteine. | 0.6969 | 40 | 263 |
| 3ccf-assembly1.cif.gz_A | crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution | 0.695 | 49 | 263 |
| 2p35-assembly1.cif.gz_A | crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens | 0.6875 | 46 | 264 |
| 7ec0-assembly1.cif.gz_A | crystal structure of juvenile hormone acid methyltransferase jhamt in complex with s-adenosyl homocysteine and methyl farnesoate | 0.6816 | 40 | 263 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0II64_62_165_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9185 | 97 | 141 | 3.40.50.150 |
| af_A2APY7_47_247_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8727 | 22 | 197 | 3.40.50.150 |
| af_A0A1D6IAK3_2_136_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8621 | 39 | 145 | 3.40.50.150 |
| af_C0PCR5_51_251_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8576 | 28 | 201 | 3.40.50.150 |
| af_Q9NAP7_34_269_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8429 | 52 | 263 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5S9C5X4-F1-model_v4 | deleted | 0.8944 | 19 | 268 |
|
| AF-S9TSC2-F1-model_v4 | SAM-dependent methyltransferase | 0.8917 | 19 | 265 |
GO:0008757
GO:0032259 |
| AF-A0A429VCV5-F1-model_v4 | Methyltransferase | 0.8706 | 48 | 267 |
GO:0008168
GO:0032259 |
| AF-A0A1Y2K2K2-F1-model_v4 | Putative type 11 methyltransferase | 0.8631 | 16 | 270 |
GO:0008757
GO:0032259 |
| AF-A0A429VCV5-F1-model_v4 | Methyltransferase | 0.8631 | 48 | 267 |
GO:0008168
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar