F479484

General Info

Members Datasets Scaffolds Average Seq Length
759 507 590 285

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10305035|Ga0207665_103050351
Length 332
Sequence MPSDEASVPRLSAQAGLSCPGSAERHGVPHRVRDTREEIAITSAIGVTSGMAQDPQTPPALFDRALLHARQRRAQAQGAVSFLLDRVAEDMSDRLAAVMREFHTAADLWTPGEGLAVLRARLPSIRRIELDTSGAEKLPFAPESLDLVLSALALQFVNDLPGVLAQIRRALKPDGLLLAAMIGGDSLTELRQAFAAAEAECEGGVSPRVAPFADLRDVGALLQRAGFALPVTDVDRVVVRYANAFALMQDIRRMGAANVLIERRRTPSRRSTLLRMAEVYAERFADADGRIRATFDIIWLSGWAPHASQQQPLKPGSAKASLAEAVKKAGKE

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
13 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
14 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
15 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
16 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
17 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
18 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
21 2643221651 Afipia sp. Root123D2 Isolate Unclassified
22 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
23 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
24 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
25 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
26 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
27 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
28 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
29 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
30 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
31 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
32 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
33 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
34 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
35 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
36 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
37 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
38 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
39 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
40 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
41 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
42 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
43 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
44 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
45 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
46 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
47 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
48 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
49 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
50 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
51 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
52 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
53 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
54 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
55 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
56 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
57 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
58 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
59 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
60 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
61 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
62 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
63 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
64 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
65 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
66 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
67 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
68 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
69 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
70 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
71 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
72 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
73 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
74 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
75 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
76 2922368715
77 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
78 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
79 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
80 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
81 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
82 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
83 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
84 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
85 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
86 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
87 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
88 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
89 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
90 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
91 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
92 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
93 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
94 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
95 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
96 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
97 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
98 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
99 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
100 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
101 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
102 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
103 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
104 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
105 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
106 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
107 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
108 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
109 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
110 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
111 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
112 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
113 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
114 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
115 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
116 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
117 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
118 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
119 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
120 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
121 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
122 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
123 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
124 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
125 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
126 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
127 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
128 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
129 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
130 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
131 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
132 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
133 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
134 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
135 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
136 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
137 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
138 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
139 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
140 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
141 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
142 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
143 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
144 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
145 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
146 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
147 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
148 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
149 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
150 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
151 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
152 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
153 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
154 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
155 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
156 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
157 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
158 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
159 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
160 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
161 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
162 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
163 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
164 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
165 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
166 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
167 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
168 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
169 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
170 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
171 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
172 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
173 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
174 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
175 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
176 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
177 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
178 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
179 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
180 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
181 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
182 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
183 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
184 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
185 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
186 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
187 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
188 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
189 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
190 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
191 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
192 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
193 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
194 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
195 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
196 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
197 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
198 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
199 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
200 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
201 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
202 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
203 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
204 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
205 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
206 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
207 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
208 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
209 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
210 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
211 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
212 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
213 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
214 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
215 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
216 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
217 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
218 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
219 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
220 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
221 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
222 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
223 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
224 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
225 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
226 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
227 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
228 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
229 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
233 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
235 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
236 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
237 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
238 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
239 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
285 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
286 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
287 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
291 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
292 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
293 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
294 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
295 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
296 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
297 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
298 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
299 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
300 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
301 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
302 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
303 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
304 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
305 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
306 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
307 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
308 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
309 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
310 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
311 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
312 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
313 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
314 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
315 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
316 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
317 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
318 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
319 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
320 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
321 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
322 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
323 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
324 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
325 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
326 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
327 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
328 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
329 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
330 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
331 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
332 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
333 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
334 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
335 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
336 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
337 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
338 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
339 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
340 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
341 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
342 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
343 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
344 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
345 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
346 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
347 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
348 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
349 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
350 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
351 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
352 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
353 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
354 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
355 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
356 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
357 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
358 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
359 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
360 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
361 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
362 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
363 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
364 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
365 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
366 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
367 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
368 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
369 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
370 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
371 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
372 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
373 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
374 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
375 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
376 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
377 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
378 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
379 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
380 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
381 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
382 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
383 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
384 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
385 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
386 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
387 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
388 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
389 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
390 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
391 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
392 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
393 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
394 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
395 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
396 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
397 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
398 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
399 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
400 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
401 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
402 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
403 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
404 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
405 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
406 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
407 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
408 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
409 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
412 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
413 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
414 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
415 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
416 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
417 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
418 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
419 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
420 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
421 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
422 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
423 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
424 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
425 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
426 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
431 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
432 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
433 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
434 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
435 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
436 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
437 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
438 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
439 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
440 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
441 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
442 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
443 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
444 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
445 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
446 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
447 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
448 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
449 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
450 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
451 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
452 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
453 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
454 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
455 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
456 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
457 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
458 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
459 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
460 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
461 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
462 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
463 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
464 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
465 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
466 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
467 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
468 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
469 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
470 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
471 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
472 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
473 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
474 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
475 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
476 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
477 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
478 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
479 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
480 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
481 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
482 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
483 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
484 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
485 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
486 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
487 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
488 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
489 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
490 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
491 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
492 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
493 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
494 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
495 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
496 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
497 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
498 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
499 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
500 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
501 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
502 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
503 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
504 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
505 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
506 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
507 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.7
Metatranscriptomes 0.13
Isolates 22.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.7
Nodule 17.92
Rhizoplane 7.11
Rhizosphere 51.38
Stem 0
Stem Tuber 0
Unclassified 9.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1009332 3300003214 Bacteria 1483
2 JGI25153J46596_10003051 3300003215 Bacteria 9461
3 JGI25153J46596_10004570 3300003215 Bacteria 7426
4 JGI25153J46596_10006145 3300003215 Bacteria 6155
5 JGI25153J46596_10011665 3300003215 Bacteria 3863
6 JGI25153J46596_10037172 3300003215 Bacteria 1552
7 JGI25160J50197_1001574 3300003354 Bacteria 11262
8 JGI25160J50197_1001779 3300003354 Bacteria 10433
9 JGI25404J52841_10004554 3300003659 Bacteria 2818
10 Ga0055531_10005617 3300003794 Bacteria 7297
11 Ga0065165_1005041 3300005262 Bacteria 7710
12 Ga0070658_10026144 3300005327 Bacteria 4682
13 Ga0070676_10065637 3300005328 Bacteria 2167
14 Ga0070690_100046706 3300005330 Bacteria 2753
15 Ga0068869_100098356 3300005334 Bacteria 2210
16 Ga0068869_100187122 3300005334 Bacteria 1626
17 Ga0070666_10267489 3300005335 Bacteria 1213
18 Ga0070680_100171374 3300005336 Bacteria 1826
19 Ga0070682_100129177 3300005337 Bacteria 1708
20 Ga0068868_100023606 3300005338 Bacteria 4656
21 Ga0070660_100023921 3300005339 Bacteria 4530
22 Ga0070661_100270881 3300005344 Bacteria 1315
23 Ga0070668_100034627 3300005347 Bacteria 3849
24 Ga0070668_100133435 3300005347 Bacteria 1994
25 Ga0070671_100207274 3300005355 Bacteria 1663
26 Ga0070673_100413478 3300005364 Bacteria 1208
27 Ga0070688_100381699 3300005365 Bacteria 1039
28 Ga0070659_100022001 3300005366 Bacteria 4865
29 Ga0070659_100399672 3300005366 Bacteria 1160
30 Ga0070667_100064979 3300005367 Bacteria 3097
31 Ga0070667_100466714 3300005367 Bacteria 1155
32 Ga0070709_10001043 3300005434 Bacteria 15348
33 Ga0070709_10002120 3300005434 Bacteria 10732
34 Ga0070714_100040555 3300005435 Bacteria 3924
35 Ga0070713_100014537 3300005436 Bacteria 5852
36 Ga0070713_100017000 3300005436 Bacteria 5486
37 Ga0070713_100030913 3300005436 Bacteria 4258
38 Ga0070713_100122498 3300005436 Bacteria 2283
39 Ga0070710_10001640 3300005437 Bacteria 10584
40 Ga0070710_10038234 3300005437 Bacteria 2635
41 Ga0070711_100040459 3300005439 Bacteria 3144
42 Ga0070663_100109435 3300005455 Bacteria 2074
43 Ga0070663_100281085 3300005455 Bacteria 1326
44 Ga0070663_100333944 3300005455 Bacteria 1222
45 Ga0068867_100510338 3300005459 Bacteria 1035
46 Ga0070685_10347712 3300005466 Bacteria 1013
47 Ga0070679_100296853 3300005530 Bacteria 1567
48 Ga0070684_100027981 3300005535 Bacteria 4765
49 Ga0068853_100224076 3300005539 Bacteria 1718
50 Ga0070672_100012411 3300005543 Bacteria 5979
51 Ga0070672_100130698 3300005543 Bacteria 2063
52 Ga0070693_100252828 3300005547 Bacteria 1169
53 Ga0070665_100063043 3300005548 Bacteria 3717
54 Ga0070665_100140122 3300005548 Bacteria 2422
55 Ga0070665_100315868 3300005548 Bacteria 1566
56 Ga0070665_100329221 3300005548 Bacteria 1532
57 Ga0068855_100025627 3300005563 Bacteria 7054
58 Ga0068855_100212587 3300005563 Bacteria 2172
59 Ga0070664_100150931 3300005564 Bacteria 2051
60 Ga0070664_100359423 3300005564 Bacteria 1326
61 Ga0068857_100108211 3300005577 Bacteria 2498
62 Ga0068854_100152216 3300005578 Bacteria 1785
63 Ga0068854_100372222 3300005578 Bacteria 1175
64 Ga0070702_100069289 3300005615 Bacteria 2078
65 Ga0068852_100151120 3300005616 Bacteria 2159
66 Ga0068852_100293463 3300005616 Bacteria 1572
67 Ga0068859_100104583 3300005617 Bacteria 2890
68 Ga0068859_100311133 3300005617 Bacteria 1669
69 Ga0068864_100069630 3300005618 Bacteria 3060
70 Ga0068861_100058920 3300005719 Bacteria 2938
71 Ga0068861_100144444 3300005719 Bacteria 1946
72 Ga0068863_100302870 3300005841 Bacteria 1551
73 Ga0068858_100099371 3300005842 Bacteria 2713
74 Ga0068858_100109449 3300005842 Bacteria 2579
75 Ga0068860_100211678 3300005843 Bacteria 1880
76 Ga0068862_100153267 3300005844 Bacteria 2052
77 Ga0068862_100168984 3300005844 Bacteria 1957
78 Ga0081455_10005919 3300005937 Bacteria 13272
79 Ga0081455_10061026 3300005937 Bacteria 3175
80 Ga0081540_1008966 3300005983 Bacteria 6923
81 Ga0081540_1009964 3300005983 Bacteria 6481
82 Ga0081540_1014575 3300005983 Bacteria 5027
83 Ga0081539_10042554 3300005985 Bacteria 2644
84 Ga0070717_10001143 3300006028 Bacteria 17925
85 Ga0070717_10047973 3300006028 Bacteria 3502
86 Ga0070717_10289195 3300006028 Bacteria 1455
87 Ga0075365_10068554 3300006038 Bacteria 2383
88 Ga0075365_10283760 3300006038 Bacteria 1165
89 Ga0075364_10046309 3300006051 Bacteria 2831
90 Ga0070715_10002760 3300006163 Bacteria 5455
91 Ga0070716_100007223 3300006173 Bacteria 5464
92 Ga0070716_100042884 3300006173 Bacteria 2527
93 Ga0070712_100006152 3300006175 Bacteria 7426
94 Ga0070712_100182258 3300006175 Bacteria 1637
95 Ga0075366_10002600 3300006195 Bacteria 9280
96 Ga0097621_100329117 3300006237 Bacteria 1355
97 Ga0068871_100104701 3300006358 Bacteria 2373
98 Ga0097620_100104575 3300006931 Bacteria 2890
99 Ga0097620_100311137 3300006931 Bacteria 1669
100 Ga0099824_1012187 3300006942 Bacteria 9468
101 Ga0105240_10005129 3300009093 Bacteria 19597
102 Ga0105240_10035009 3300009093 Bacteria 6475
103 Ga0105245_10222206 3300009098 Bacteria 1823
104 Ga0105245_10298809 3300009098 Bacteria 1579
105 Ga0105247_10220530 3300009101 Bacteria 1283
106 Ga0105243_10134417 3300009148 Bacteria 2102
107 Ga0105241_10014074 3300009174 Bacteria 5862
108 Ga0105241_10047814 3300009174 Bacteria 3254
109 Ga0105237_10013514 3300009545 Bacteria 8556
110 Ga0105238_10694036 3300009551 Bacteria 1030
111 Ga0105249_10164886 3300009553 Bacteria 2144
112 Ga0105239_10024829 3300010375 Bacteria 6603
113 Ga0105239_10179264 3300010375 Bacteria 2370
114 Ga0105239_10488087 3300010375 Bacteria 1400
115 Ga0105239_10690001 3300010375 Bacteria 1167
116 Ga0105246_10179142 3300011119 Bacteria 1630
117 Ga0105246_10378322 3300011119 Bacteria 1169
118 Ga0157370_10093494 3300013104 Bacteria 2822
119 Ga0157369_10013512 3300013105 Bacteria 9228
120 Ga0157374_10364765 3300013296 Bacteria 1437
121 Ga0163162_10291947 3300013306 Bacteria 1762
122 Ga0163162_10300490 3300013306 Bacteria 1737
123 Ga0157375_10025269 3300013308 Bacteria 5515
124 Ga0157375_10165233 3300013308 Bacteria 2358
125 Ga0163163_10052116 3300014325 Bacteria 4036
126 Ga0163163_10133233 3300014325 Bacteria 2525
127 Ga0157377_10133500 3300014745 Bacteria 1519
128 Ga0157377_10176179 3300014745 Bacteria 1341
129 Ga0157377_10400498 3300014745 Bacteria 935
130 Ga0157376_10145982 3300014969 Bacteria 2128
131 Ga0157376_10150868 3300014969 Bacteria 2096
132 Ga0163161_10036195 3300017792 Bacteria 3535
133 Ga0206353_10623774 3300020082 Bacteria 1131
134 Ga0214544_1000087 3300021320 Bacteria 119600
135 Ga0214542_1000018 3300021321 Bacteria 202226
136 Ga0214545_1000009 3300021324 Bacteria 202915
137 Ga0214543_1000037 3300021327 Bacteria 182113
138 Ga0209563_104871 3300025230 Bacteria 2509
139 Ga0209677_105069 3300025253 Bacteria 3562
140 Ga0209148_1002285 3300025254 Bacteria 6905
141 Ga0209233_1005177 3300025261 Bacteria 4355
142 Ga0209233_1013010 3300025261 Bacteria 2391
143 Ga0209455_1003892 3300025272 Bacteria 5091
144 Ga0209455_1006163 3300025272 Bacteria 3585
145 Ga0209673_1028217 3300025273 Bacteria 1811
146 Ga0209564_1003384 3300025295 Bacteria 10997
147 Ga0209564_1007864 3300025295 Bacteria 5397
148 Ga0209758_1000030 3300025297 Bacteria 509217
149 Ga0209758_1000884 3300025297 Bacteria 41143
150 Ga0209758_1000949 3300025297 Bacteria 39098
151 Ga0209758_1006161 3300025297 Bacteria 8784
152 Ga0209758_1007096 3300025297 Bacteria 7756
153 Ga0209758_1010276 3300025297 Bacteria 5631
154 Ga0209758_1011559 3300025297 Bacteria 5089
155 Ga0209758_1017944 3300025297 Bacteria 3494
156 Ga0209758_1022776 3300025297 Bacteria 2857
157 Ga0209256_1016593 3300025299 Bacteria 2499
158 Ga0207426_1001522 3300025302 Bacteria 18884
159 Ga0207426_1015480 3300025302 Bacteria 2762
160 Ga0209257_1003355 3300025304 Bacteria 13856
161 Ga0207692_10004318 3300025898 Bacteria 5622
162 Ga0207692_10016120 3300025898 Bacteria 3301
163 Ga0207647_10019817 3300025904 Bacteria 4517
164 Ga0207699_10000360 3300025906 Bacteria 24053
165 Ga0207699_10013541 3300025906 Bacteria 4178
166 Ga0207645_10107781 3300025907 Bacteria 1802
167 Ga0207705_10142379 3300025909 Bacteria 1791
168 Ga0207654_10013203 3300025911 Bacteria 4245
169 Ga0207654_10204600 3300025911 Bacteria 1302
170 Ga0207654_10255164 3300025911 Bacteria 1177
171 Ga0207707_10111344 3300025912 Bacteria 2393
172 Ga0207695_10000059 3300025913 Bacteria 363920
173 Ga0207695_10245684 3300025913 Bacteria 1690
174 Ga0207671_10094291 3300025914 Bacteria 2259
175 Ga0207671_10235667 3300025914 Bacteria 1437
176 Ga0207671_10360461 3300025914 Bacteria 1154
177 Ga0207693_10000073 3300025915 Bacteria 89380
178 Ga0207693_10059536 3300025915 Bacteria 2992
179 Ga0207663_10000861 3300025916 Bacteria 13793
180 Ga0207660_10020024 3300025917 Bacteria 4484
181 Ga0207657_10004881 3300025919 Bacteria 14112
182 Ga0207652_10181195 3300025921 Bacteria 1893
183 Ga0207646_10473353 3300025922 Bacteria 1130
184 Ga0207687_10105091 3300025927 Bacteria 2086
185 Ga0207687_10167300 3300025927 Bacteria 1693
186 Ga0207700_10034750 3300025928 Bacteria 3622
187 Ga0207700_10052688 3300025928 Bacteria 3044
188 Ga0207700_10102804 3300025928 Bacteria 2283
189 Ga0207664_10023264 3300025929 Bacteria 4640
190 Ga0207664_10027950 3300025929 Bacteria 4282
191 Ga0207664_10209929 3300025929 Bacteria 1684
192 Ga0207664_10344058 3300025929 Bacteria 1319
193 Ga0207644_10492611 3300025931 Bacteria 1010
194 Ga0207690_10074693 3300025932 Bacteria 2349
195 Ga0207709_10104454 3300025935 Bacteria 1880
196 Ga0207669_10029822 3300025937 Bacteria 3022
197 Ga0207704_10163511 3300025938 Bacteria 1587
198 Ga0207665_10000629 3300025939 Bacteria 23661
199 Ga0207665_10045899 3300025939 Bacteria 2926
200 Ga0207665_10305035 3300025939 Bacteria 1191
201 Ga0207691_10187098 3300025940 Bacteria 1807
202 Ga0207689_10061122 3300025942 Bacteria 3098
203 Ga0207661_10551095 3300025944 Bacteria 1056
204 Ga0207679_10204384 3300025945 Bacteria 1652
205 Ga0207667_10019657 3300025949 Bacteria 7531
206 Ga0207667_10079342 3300025949 Bacteria 3402
207 Ga0207667_10275853 3300025949 Bacteria 1719
208 Ga0207667_10302771 3300025949 Bacteria 1633
209 Ga0207651_10382497 3300025960 Bacteria 1193
210 Ga0207712_10230685 3300025961 Bacteria 1486
211 Ga0207668_10015065 3300025972 Bacteria 4798
212 Ga0207668_10090760 3300025972 Bacteria 2243
213 Ga0207640_10045306 3300025981 Bacteria 2824
214 Ga0207658_10139899 3300025986 Bacteria 1957
215 Ga0207658_10378790 3300025986 Bacteria 1239
216 Ga0207677_10028452 3300026023 Bacteria 3535
217 Ga0207677_10435579 3300026023 Bacteria 1120
218 Ga0207639_10261493 3300026041 Bacteria 1514
219 Ga0207678_10029495 3300026067 Bacteria 4788
220 Ga0207678_10041959 3300026067 Bacteria 3966
221 Ga0207678_10261671 3300026067 Bacteria 1482
222 Ga0207678_10370875 3300026067 Bacteria 1236
223 Ga0207702_10140091 3300026078 Bacteria 2187
224 Ga0207702_10232705 3300026078 Bacteria 1723
225 Ga0207641_10213959 3300026088 Bacteria 1784
226 Ga0207641_10319570 3300026088 Bacteria 1472
227 Ga0207648_10063416 3300026089 Bacteria 3221
228 Ga0207648_10179191 3300026089 Bacteria 1875
229 Ga0207648_10462270 3300026089 Bacteria 1157
230 Ga0207648_10634240 3300026089 Bacteria 987
231 Ga0207676_10032534 3300026095 Bacteria 3931
232 Ga0207676_10135482 3300026095 Bacteria 2100
233 Ga0207675_100024363 3300026118 Bacteria 5628
234 Ga0207675_100060324 3300026118 Bacteria 3541
235 Ga0207683_10289750 3300026121 Bacteria 1497
236 Ga0207698_10325690 3300026142 Bacteria 1441
237 Ga0209389_1000161 3300027296 Bacteria 55526
238 Ga0209589_1000103 3300027357 Bacteria 86516
239 Ga0209489_100304 3300027361 Bacteria 86516
240 Ga0268266_10011749 3300028379 Bacteria 7594
241 Ga0268266_10020841 3300028379 Bacteria 5590
242 Ga0268266_10027183 3300028379 Bacteria 4866
243 Ga0268266_10239769 3300028379 Bacteria 1673
244 Ga0268266_10371567 3300028379 Bacteria 1347
245 Ga0268265_10020343 3300028380 Bacteria 4631
246 Ga0268265_10137061 3300028380 Bacteria 2043
247 Ga0268264_10219845 3300028381 Bacteria 1748
248 Ga0307515_10012007 3300028794 Bacteria 16357
249 Ga0265330_10055090 3300031235 Bacteria 1737
250 Ga0265332_10030006 3300031238 Bacteria 2375
251 Ga0265340_10001209 3300031247 Bacteria 14775
252 Ga0307409_100402749 3300031995 Bacteria 1307
253 Ga0307415_100123096 3300032126 Bacteria 1949
254 Ga0307510_10035286 3300033180 Bacteria 5588
255 Ga0307510_10089059 3300033180 Bacteria 2941
256 Ga0373934_0003939 3300035086 Bacteria 5458
257 Ga0373936_0010427 3300035113 Bacteria 3506
258 Ga0373936_0020794 3300035113 Bacteria 2551
259 Ga0373953_0000259 3300035117 Bacteria 14369
260 Ga0373954_0000249 3300035118 Bacteria 19692
261 Ga0373956_0018532 3300035119 Bacteria 2948
262 Ga0373957_0003088 3300035120 Bacteria 4855
263 Ga0373943_0003923 3300035170 Bacteria 6772
264 Ga0373946_0005379 3300035171 Bacteria 4615
265 Ga0373955_0009036 3300035172 Bacteria 4652
266 Ga0373924_0003664 3300035410 Bacteria 5298
267 Ga0373931_0021849 3300035691 Bacteria 3214
268 Ga0373931_0145012 3300035691 Bacteria 1379
269 Ga0373935_0000434 3300035692 Bacteria 21781
270 Ga0373935_0112742 3300035692 Bacteria 1807
271 Ga0373927_0003717 3300035695 Bacteria 10844
272 Ga0373927_0018294 3300035695 Bacteria 4605
273 Ga0373927_0163883 3300035695 Bacteria 1457
274 Ga0373933_0001831 3300035724 Bacteria 12311
275 Ga0373933_0346076 3300035724 Bacteria 965
276 Ga0373947_0003045 3300035725 Bacteria 9971
277 Ga0373947_0212569 3300035725 Bacteria 1269
278 Ga0373937_0171393 3300036401 Bacteria 2036
279 Ga0373925_0006130 3300037068 Bacteria 8881
280 Ga0373925_0458817 3300037068 Bacteria 1044
281 Ga0395900_0000696 3300037418 Bacteria 44867
282 Ga0395900_0350891 3300037418 Bacteria 1449
283 Ga0395898_0035004 3300037466 Bacteria 4998
284 Ga0395898_0107104 3300037466 Bacteria 2680
285 Ga0395905_0036154 3300037471 Bacteria 4638
286 Ga0395905_0654254 3300037471 Bacteria 953
287 Ga0395901_0048644 3300038443 Bacteria 4404
288 Ga0436365_0801382 3300039437 Bacteria 1196
289 Ga0436361_0327284 3300039447 Bacteria 2481
290 Ga0451797_1195647 3300041453 Bacteria 1069
291 Ga0466969_0030684 3300044656 Bacteria 2739
292 Ga0466972_0001053 3300044658 Bacteria 13231
293 Ga0466972_0037257 3300044658 Bacteria 2377
294 Ga0466966_0000137 3300044684 Bacteria 46695
295 Ga0466961_0000039 3300044693 Bacteria 79787
296 Ga0466963_0001672 3300044694 Bacteria 12090
297 Ga0466968_0005199 3300044735 Bacteria 4872
298 Ga0466970_0074283 3300044765 Bacteria 1830
299 Ga0466957_0090202 3300044842 Bacteria 1920
300 Ga0466960_0003772 3300044901 Bacteria 5865
301 Ga0466960_0043701 3300044901 Bacteria 2133
302 Ga0466959_0001594 3300045049 Bacteria 13987
303 Ga0466959_0249432 3300045049 Bacteria 1225
304 Ga0466967_0068542 3300045976 Bacteria 3168
305 Ga0466967_0212731 3300045976 Bacteria 1834
306 Ga0466967_0614173 3300045976 Bacteria 1074
307 Ga0495592_0011025 3300046454 Bacteria 6820
308 Ga0495592_0011508 3300046454 Bacteria 6696
309 Ga0495592_0172975 3300046454 Bacteria 1477
310 Ga0495592_0255347 3300046454 Bacteria 1157
311 Ga0495603_0000189 3300046455 Bacteria 32189
312 Ga0495603_0021216 3300046455 Bacteria 3932
313 Ga0495603_0127912 3300046455 Bacteria 1480
314 Ga0495603_0146563 3300046455 Bacteria 1372
315 Ga0495629_0000268 3300046459 Bacteria 45291
316 Ga0495629_0001490 3300046459 Bacteria 18421
317 Ga0495629_0031949 3300046459 Bacteria 3727
318 Ga0495638_0013239 3300046460 Bacteria 5625
319 Ga0495638_0019032 3300046460 Bacteria 4547
320 Ga0495638_0069119 3300046460 Bacteria 2164
321 Ga0495638_0077661 3300046460 Bacteria 2021
322 Ga0495641_0002442 3300046461 Bacteria 14667
323 Ga0495651_0011203 3300046462 Bacteria 6891
324 Ga0495653_0000300 3300046463 Bacteria 40108
325 Ga0495580_0006330 3300046472 Bacteria 9662
326 Ga0495582_0000144 3300046473 Bacteria 38436
327 Ga0495605_0184778 3300046474 Bacteria 915
328 Ga0495639_0000067 3300046475 Bacteria 47932
329 Ga0495662_0000005 3300046476 Bacteria 81157
330 Ga0495664_0052227 3300046477 Bacteria 2428
331 Ga0495584_0144600 3300046491 Bacteria 1208
332 Ga0495594_0000102 3300046499 Bacteria 39784
333 Ga0495594_0044547 3300046499 Bacteria 2434
334 Ga0495607_0111811 3300046501 Bacteria 1447
335 Ga0495607_0173690 3300046501 Bacteria 1086
336 Ga0495583_0043017 3300046506 Bacteria 2106
337 Ga0495606_0000858 3300046507 Bacteria 45651
338 Ga0495608_0000255 3300046511 Bacteria 38655
339 Ga0495608_0040269 3300046511 Bacteria 3131
340 Ga0495610_0062316 3300046512 Bacteria 1769
341 Ga0495610_0074333 3300046512 Bacteria 1577
342 Ga0495618_0039068 3300046514 Bacteria 2984
343 Ga0495620_0025893 3300046515 Bacteria 2767
344 Ga0495628_0036326 3300046516 Bacteria 3955
345 Ga0495628_0040804 3300046516 Bacteria 3707
346 Ga0495630_0014512 3300046517 Bacteria 5740
347 Ga0495643_0111638 3300046522 Bacteria 1389
348 Ga0495644_0026625 3300046523 Bacteria 2193
349 Ga0495648_0000382 3300046524 Bacteria 48626
350 Ga0495648_0050531 3300046524 Bacteria 2539
351 Ga0495648_0074678 3300046524 Bacteria 1952
352 Ga0495666_0104893 3300046526 Bacteria 1330
353 Ga0495652_0007246 3300046529 Bacteria 10238
354 Ga0495652_0048270 3300046529 Bacteria 3649
355 Ga0495652_0106931 3300046529 Bacteria 2258
356 Ga0495665_0000935 3300046531 Bacteria 15397
357 Ga0495640_0005833 3300046533 Bacteria 9779
358 Ga0495640_0012005 3300046533 Bacteria 6638
359 Ga0495640_0048180 3300046533 Bacteria 2946
360 Ga0495586_0328668 3300046535 Bacteria 877
361 Ga0495587_0008775 3300046536 Bacteria 6485
362 Ga0495587_0013918 3300046536 Bacteria 5051
363 Ga0495597_0107671 3300046542 Bacteria 1171
364 Ga0495597_0121699 3300046542 Bacteria 1087
365 Ga0495645_0027614 3300046543 Bacteria 4124
366 Ga0495645_0072463 3300046543 Bacteria 2482
367 Ga0495622_0000649 3300046557 Bacteria 19833
368 Ga0495622_0008376 3300046557 Bacteria 4787
369 Ga0495667_0000121 3300046559 Bacteria 56223
370 Ga0495667_0013372 3300046559 Bacteria 5555
371 Ga0495656_0086448 3300046615 Bacteria 1426
372 Ga0495668_0207077 3300046616 Bacteria 1074
373 Ga0495634_0001407 3300046642 Bacteria 21535
374 Ga0495634_0051027 3300046642 Bacteria 2776
375 Ga0495625_0188236 3300046660 Bacteria 1369
376 Ga0495635_0000072 3300046663 Bacteria 62736
377 Ga0495635_0002392 3300046663 Bacteria 12785
378 Ga0495635_0037151 3300046663 Bacteria 3372
379 Ga0495635_0050480 3300046663 Bacteria 2867
380 Ga0495661_0029665 3300046665 Bacteria 3489
381 Ga0495588_0002782 3300046674 Bacteria 7516
382 Ga0495588_0010392 3300046674 Bacteria 4329
383 Ga0495588_0046101 3300046674 Bacteria 2236
384 Ga0495588_0109722 3300046674 Bacteria 1453
385 Ga0495657_0004271 3300046675 Bacteria 11423
386 Ga0495657_0111504 3300046675 Bacteria 1732
387 Ga0495599_0007431 3300046678 Bacteria 6644
388 Ga0495599_0174472 3300046678 Bacteria 1326
389 Ga0495623_0010400 3300046679 Bacteria 6021
390 Ga0495646_0007628 3300046680 Bacteria 6875
391 Ga0495646_0061399 3300046680 Bacteria 2238
392 Ga0495647_0002197 3300046681 Bacteria 6102
393 Ga0495658_0000439 3300046683 Bacteria 23198
394 Ga0495669_0017393 3300046684 Bacteria 3086
395 Ga0495669_0063308 3300046684 Bacteria 1678
396 Ga0495613_0001828 3300046689 Bacteria 16171
397 Ga0495613_0055857 3300046689 Bacteria 2900
398 Ga0495613_0154119 3300046689 Bacteria 1637
399 Ga0495613_0262260 3300046689 Bacteria 1203
400 Ga0495624_0000460 3300046690 Bacteria 31973
401 Ga0495600_0001929 3300046809 Bacteria 11644
402 Ga0495600_0014429 3300046809 Bacteria 4980
403 Ga0495660_0115625 3300046810 Bacteria 1364
404 Ga0495581_0000084 3300047315 Bacteria 38216
405 Ga0495581_0127057 3300047315 Bacteria 1485
406 Ga0495604_0002223 3300047317 Bacteria 15540
407 Ga0495604_0010947 3300047317 Bacteria 7201
408 Ga0495604_0061619 3300047317 Bacteria 2868
409 Ga0495674_0004128 3300047319 Bacteria 14021
410 Ga0495674_0019201 3300047319 Bacteria 6350
411 Ga0495674_0192303 3300047319 Bacteria 1695
412 Ga0495672_0021500 3300047320 Bacteria 4207
413 Ga0495672_0097821 3300047320 Bacteria 1597
414 Ga0495676_0006985 3300047321 Bacteria 10361
415 Ga0495680_0001208 3300047322 Bacteria 28311
416 Ga0495680_0005809 3300047322 Bacteria 11550
417 Ga0495687_130376 3300047443 Bacteria 891
418 Ga0495675_0010221 3300047444 Bacteria 5856
419 Ga0495675_0070404 3300047444 Bacteria 2208
420 Ga0495673_0066228 3300047469 Bacteria 1532
421 Ga0495684_0000594 3300047471 Bacteria 29100
422 Ga0495684_0036127 3300047471 Bacteria 3789
423 Ga0495686_0093532 3300047472 Bacteria 1823
424 Ga0495593_0000038 3300047673 Bacteria 53141
425 Ga0495593_0000109 3300047673 Bacteria 38355
426 Ga0495593_0021842 3300047673 Bacteria 3571
427 Ga0495602_0025029 3300048088 Bacteria 5783
428 Ga0495602_0234433 3300048088 Bacteria 1376
429 Ga0496100_0014354 3300048903 Bacteria 4598
430 Ga0496100_0083660 3300048903 Bacteria 2161
431 Ga0496100_0151677 3300048903 Bacteria 1654
432 Ga0496101_0004551 3300048904 Bacteria 8756
433 Ga0496101_0005097 3300048904 Bacteria 8353
434 Ga0496101_0162068 3300048904 Bacteria 1715
435 Ga0496102_0030130 3300048905 Bacteria 4856
436 Ga0496102_0067141 3300048905 Bacteria 3289
437 Ga0496102_0150978 3300048905 Bacteria 2183
438 Ga0496102_0222523 3300048905 Bacteria 1779
439 Ga0496102_0246787 3300048905 Bacteria 1683
440 Ga0496102_0363315 3300048905 Bacteria 1363
441 Ga0496103_0164558 3300048906 Bacteria 1423
442 Ga0496103_0271318 3300048906 Bacteria 1091
443 Ga0496104_0010015 3300048907 Bacteria 8460
444 Ga0496104_0025881 3300048907 Bacteria 5411
445 Ga0496104_0116175 3300048907 Bacteria 2568
446 Ga0496105_0016080 3300048908 Bacteria 5968
447 Ga0496105_0106523 3300048908 Bacteria 2314
448 Ga0496106_0005291 3300048909 Bacteria 9565
449 Ga0496106_0047592 3300048909 Bacteria 3228
450 Ga0496106_0067572 3300048909 Bacteria 2725
451 Ga0496106_0315860 3300048909 Bacteria 1254
452 Ga0496106_0419485 3300048909 Bacteria 1075
453 Ga0496107_0023956 3300048910 Bacteria 4315
454 Ga0496107_0159094 3300048910 Bacteria 1673
455 Ga0496108_0036900 3300048911 Bacteria 4068
456 Ga0496108_0675490 3300048911 Bacteria 897
457 Ga0496109_0230011 3300048912 Bacteria 1744
458 Ga0496109_0380920 3300048912 Bacteria 1333
459 Ga0496110_0010473 3300048913 Bacteria 7543
460 Ga0496110_0026129 3300048913 Bacteria 4993
461 Ga0496110_0083738 3300048913 Bacteria 2846
462 Ga0496110_0137677 3300048913 Bacteria 2207
463 Ga0496110_0189228 3300048913 Bacteria 1869
464 Ga0496110_0281664 3300048913 Bacteria 1514
465 Ga0496110_0636985 3300048913 Bacteria 965
466 Ga0496111_0051658 3300048914 Bacteria 2967
467 Ga0496111_0534285 3300048914 Bacteria 862
468 Ga0496112_0000065 3300048915 Bacteria 70119
469 Ga0496112_0212900 3300048915 Bacteria 1889
470 Ga0496112_0285337 3300048915 Bacteria 1597
471 Ga0496112_0309949 3300048915 Bacteria 1523
472 Ga0496112_0394288 3300048915 Bacteria 1324
473 Ga0496112_0598785 3300048915 Bacteria 1034
474 Ga0496113_0006834 3300048916 Bacteria 7276
475 Ga0496113_0116439 3300048916 Bacteria 2085
476 Ga0496113_0178563 3300048916 Bacteria 1683
477 Ga0496113_0375907 3300048916 Bacteria 1140
478 Ga0496114_0016363 3300048917 Bacteria 5974
479 Ga0496115_0018231 3300048918 Bacteria 5385
480 Ga0496115_0033662 3300048918 Bacteria 4047
481 Ga0496116_0009854 3300048919 Bacteria 8085
482 Ga0496116_0011726 3300048919 Bacteria 7222
483 Ga0496116_0205825 3300048919 Bacteria 1025
484 Ga0496117_0086289 3300048920 Bacteria 2040
485 Ga0496117_0117523 3300048920 Bacteria 1641
486 Ga0496117_0134676 3300048920 Bacteria 1491
487 Ga0496118_0021615 3300048921 Bacteria 5656
488 Ga0496118_0063550 3300048921 Bacteria 2715
489 Ga0496118_0094591 3300048921 Bacteria 2043
490 Ga0496119_0007073 3300048922 Bacteria 10207
491 Ga0496119_0022737 3300048922 Bacteria 4477
492 Ga0496119_0079633 3300048922 Bacteria 1892
493 Ga0496120_0016701 3300048923 Bacteria 4788
494 Ga0496120_0023248 3300048923 Bacteria 3882
495 Ga0496121_0002554 3300048924 Bacteria 27574
496 Ga0496121_0033524 3300048924 Bacteria 4645
497 Ga0496121_0090747 3300048924 Bacteria 2387
498 Ga0496121_0139985 3300048924 Bacteria 1797
499 Ga0496121_0178700 3300048924 Bacteria 1534
500 Ga0496121_0189252 3300048924 Bacteria 1477
501 Ga0496123_0020379 3300048926 Bacteria 5188
502 Ga0496124_0174964 3300048927 Bacteria 1658
503 Ga0496125_0000904 3300048928 Bacteria 46904
504 Ga0496125_0004420 3300048928 Bacteria 16237
505 Ga0496125_0046908 3300048928 Bacteria 3619
506 Ga0496125_0093476 3300048928 Bacteria 2244
507 Ga0496126_0059273 3300048929 Bacteria 3447
508 Ga0496126_0070519 3300048929 Bacteria 3113
509 Ga0496126_0076086 3300048929 Bacteria 2978
510 Ga0496126_0088464 3300048929 Bacteria 2728
511 Ga0496126_0237057 3300048929 Bacteria 1526
512 Ga0496126_0304006 3300048929 Bacteria 1315
513 Ga0501034_0080710 3300049571 Bacteria 3256
514 Ga0501039_0406802 3300049575 Bacteria 1069
515 Ga0501046_0060206 3300049580 Bacteria 2972
516 Ga0501047_0275591 3300049581 Bacteria 1528
517 Ga0501067_0022379 3300049583 Bacteria 3498
518 Ga0501044_0434669 3300049823 Bacteria 1221
519 nmdc:mga03n38_45605_c1 3300050490 Bacteria 1931
520 nmdc:mga0yw44_13913_c1 3300050492 Bacteria 4253
521 nmdc:mga06z11_168018_c1 3300050494 Bacteria 1258
522 nmdc:mga07m45_137617_c1 3300050496 Bacteria 1414
523 nmdc:mga08y16_30607_c1 3300050511 Bacteria 5663
524 nmdc:mga0a205_287959_c1 3300050515 Bacteria 1517
525 nmdc:mga0sz30_185344_c1 3300050516 Bacteria 924
526 Ga0500635_0046689 3300053080 Bacteria 1469
527 Ga0495619_0010257 3300053085 Bacteria 5898
528 Ga0495619_0042088 3300053085 Bacteria 2990
529 Ga0495619_0255899 3300053085 Bacteria 1213
530 Ga0500643_006068 3300053087 Bacteria 5105
531 Ga0500643_022242 3300053087 Bacteria 2044
532 Ga0500646_0006123 3300053090 Bacteria 3057
533 Ga0500651_0008259 3300053093 Bacteria 6117
534 Ga0500651_0009030 3300053093 Bacteria 5899
535 Ga0500566_0000029 3300053094 Bacteria 75384
536 Ga0500566_0000139 3300053094 Bacteria 37343
537 Ga0500566_0078766 3300053094 Bacteria 1838
538 Ga0500640_100312 3300053095 Bacteria 1197
539 Ga0500641_0024716 3300053096 Bacteria 2318
540 Ga0500641_0083833 3300053096 Bacteria 1355
541 Ga0500650_0004684 3300053098 Bacteria 4985
542 Ga0500554_005453 3300053102 Bacteria 2775
543 Ga0500555_003871 3300053103 Bacteria 4258
544 Ga0500556_0000019 3300053104 Bacteria 186017
545 Ga0500569_000516 3300053109 Bacteria 6443
546 Ga0500569_000864 3300053109 Bacteria 5377
547 Ga0500572_018341 3300053111 Bacteria 1811
548 Ga0500592_006645 3300053116 Bacteria 1841
549 Ga0500595_001557 3300053119 Bacteria 12138
550 Ga0500595_002157 3300053119 Bacteria 10008
551 Ga0500595_012821 3300053119 Bacteria 3227
552 Ga0500595_016051 3300053119 Bacteria 2796
553 Ga0500608_035435 3300053122 Bacteria 2380
554 Ga0500614_032696 3300053123 Bacteria 1281
555 Ga0500642_0000039 3300053130 Bacteria 98235
556 Ga0500642_0002118 3300053130 Bacteria 5770
557 Ga0500642_0026140 3300053130 Bacteria 2379
558 Ga0500642_0028540 3300053130 Bacteria 2303
559 Ga0500652_001066 3300053131 Bacteria 8907
560 Ga0500655_030790 3300053133 Bacteria 1033
561 Ga0500658_0009611 3300053134 Bacteria 3565
562 Ga0500568_0001467 3300053139 Bacteria 15123
563 Ga0500568_0008598 3300053139 Bacteria 4906
564 Ga0500568_0010187 3300053139 Bacteria 4417
565 Ga0500577_0034909 3300053142 Bacteria 1790
566 Ga0500577_0092177 3300053142 Bacteria 1226
567 Ga0500585_119091 3300053144 Bacteria 942
568 Ga0500589_147594 3300053147 Bacteria 961
569 Ga0500603_002683 3300053150 Bacteria 3874
570 Ga0500604_0025269 3300053151 Bacteria 1706
571 Ga0500616_0000038 3300053153 Bacteria 386801
572 Ga0500616_0000059 3300053153 Bacteria 259741
573 Ga0500616_0015647 3300053153 Bacteria 4331
574 Ga0500619_045425 3300053154 Bacteria 1404
575 Ga0500620_054428 3300053155 Bacteria 1349
576 Ga0500620_063319 3300053155 Bacteria 1263
577 Ga0500622_0015463 3300053156 Bacteria 4084
578 Ga0500622_0185245 3300053156 Bacteria 958
579 Ga0500627_0117092 3300053158 Bacteria 1201
580 Ga0500627_0128272 3300053158 Bacteria 1145
581 Ga0500634_0143339 3300053161 Bacteria 1128
582 Ga0500638_116171 3300053162 Bacteria 1230
583 Ga0500639_007050 3300053163 Bacteria 5827
584 Ga0500636_0000563 3300053177 Bacteria 20246
585 Ga0500636_0012647 3300053177 Bacteria 4948
586 Ga0500570_087710 3300053724 Bacteria 1370
587 Ga0500625_090653 3300053729 Bacteria 1309
588 Ga0500609_002302 3300053731 Bacteria 2727
589 Ga0500599_000667 3300053736 Bacteria 3689
590 Ga0500601_000189 3300053737 Bacteria 12584

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0077661 Ga0495638_0077661_301_1167 257
2 3300053093 Ga0500651_0008259 Ga0500651_0008259_1336_2202 257
3 3300053130 Ga0500642_0028540 Ga0500642_0028540_425_1291 257
4 3300010375 Ga0105239_10024829 Ga0105239_100248297 264
5 3300037471 Ga0395905_0654254 Ga0395905_0654254_11_814 267
6 3300005937 Ga0081455_10005919 Ga0081455_1000591913 268
7 3300046491 Ga0495584_0144600 Ga0495584_0144600_57_896 268
8 3300013308 Ga0157375_10165233 Ga0157375_101652335 269
9 3300046684 Ga0495669_0017393 Ga0495669_0017393_1491_2333 269
10 3300048903 Ga0496100_0151677 Ga0496100_0151677_797_1639 269
11 3300048904 Ga0496101_0162068 Ga0496101_0162068_256_1098 269
12 3300048914 Ga0496111_0534285 Ga0496111_0534285_20_835 270
13 3300053147 Ga0500589_147594 Ga0500589_147594_81_923 270
14 3300009098 Ga0105245_10298809 Ga0105245_102988091 271
15 3300013296 Ga0157374_10364765 Ga0157374_103647652 271
16 3300013306 Ga0163162_10291947 Ga0163162_102919472 271
17 3300014745 Ga0157377_10176179 Ga0157377_101761792 271
18 3300014969 Ga0157376_10150868 Ga0157376_101508682 271
19 3300048903 Ga0496100_0014354 Ga0496100_0014354_478_1296 271
20 3300048904 Ga0496101_0005097 Ga0496101_0005097_92_910 271
21 3300048905 Ga0496102_0030130 Ga0496102_0030130_3898_4716 271
22 3300048906 Ga0496103_0271318 Ga0496103_0271318_13_831 271
23 3300048908 Ga0496105_0016080 Ga0496105_0016080_4036_4854 271
24 3300048909 Ga0496106_0005291 Ga0496106_0005291_5751_6569 271
25 3300048910 Ga0496107_0023956 Ga0496107_0023956_3071_3889 271
26 3300048911 Ga0496108_0036900 Ga0496108_0036900_3024_3842 271
27 3300048913 Ga0496110_0026129 Ga0496110_0026129_3245_4063 271
28 3300048915 Ga0496112_0309949 Ga0496112_0309949_229_1047 271
29 3300048916 Ga0496113_0006834 Ga0496113_0006834_6023_6841 271
30 3300048918 Ga0496115_0018231 Ga0496115_0018231_510_1328 271
31 3300037418 Ga0395900_0350891 Ga0395900_0350891_614_1432 272
32 3300045976 Ga0466967_0068542 Ga0466967_0068542_1868_2686 272
33 3300006051 Ga0075364_10046309 Ga0075364_100463091 273
34 iso_pu_bacteria 2929615660 2929618991 274
35 iso_pu_bacteria 2929624759 2929631068 274
36 iso_pu_bacteria 2933577622 2933580299 274
37 iso_pu_bacteria 2935675223 2935682605 274
38 iso_pu_bacteria 8055742211 8055742840 274
39 iso_pu_bacteria 2513237098 2513673923 275
40 iso_pu_bacteria 2524023210 2524468373 275
41 iso_pu_bacteria 2903768456 2903775700 275
42 3300044658 Ga0466972_0037257 Ga0466972_0037257_27_875 277
43 3300044735 Ga0466968_0005199 Ga0466968_0005199_2224_3072 277
44 3300044901 Ga0466960_0003772 Ga0466960_0003772_1628_2476 277
45 3300045976 Ga0466967_0212731 Ga0466967_0212731_821_1657 277
46 iso_pu_bacteria 2602042107 2603862313 277
47 iso_pu_bacteria 2643221651 2644290715 277
48 iso_pu_bacteria 2791355196 2793065620 277
49 iso_pu_bacteria 2791355196 2793065939 277
50 iso_pu_bacteria 2824653114 2824657433 277
51 iso_pu_bacteria 2857524615 2857525799 277
52 iso_pu_bacteria 2919073203 2919074339 277
53 3300017792 Ga0163161_10036195 Ga0163161_100361952 278
54 3300025272 Ga0209455_1006163 Ga0209455_10061632 278
55 3300046674 Ga0495588_0002782 Ga0495588_0002782_2122_2961 278
56 3300046684 Ga0495669_0063308 Ga0495669_0063308_772_1611 278
57 3300053094 Ga0500566_0000029 Ga0500566_0000029_2484_3320 278
58 iso_pu_bacteria 2513237095 2513652784 278
59 iso_pu_bacteria 2513237104 2513718815 278
60 iso_pu_bacteria 2524023205 2524440060 278
61 iso_pu_bacteria 2617270741 2617377276 278
62 iso_pu_bacteria 2744054633 2745077828 278
63 iso_pu_bacteria 2816332527 2818239236 278
64 iso_pu_bacteria 2874628541 2874636781 278
65 iso_pu_bacteria 2876761206 2876764041 278
66 iso_pu_bacteria 2888378607 2888379130 278
67 iso_pu_bacteria 2888419890 2888427528 278
68 iso_pu_bacteria 2935959822 2935967227 278
69 iso_pu_bacteria 3005483717 3005486391 278
70 iso_pu_bacteria 3005506211 3005506268 278
71 iso_pu_bacteria 3005587118 3005589048 278
72 iso_pu_bacteria 8006926726 8006931167 278
73 3300003659 JGI25404J52841_10004554 JGI25404J52841_100045543 279
74 3300005347 Ga0070668_100034627 Ga0070668_1000346274 279
75 3300005355 Ga0070671_100207274 Ga0070671_1002072742 279
76 3300005365 Ga0070688_100381699 Ga0070688_1003816991 279
77 3300005367 Ga0070667_100466714 Ga0070667_1004667142 279
78 3300005455 Ga0070663_100281085 Ga0070663_1002810852 279
79 3300005548 Ga0070665_100315868 Ga0070665_1003158682 279
80 3300005983 Ga0081540_1009964 Ga0081540_10099642 279
81 3300010375 Ga0105239_10488087 Ga0105239_104880872 279
82 3300011119 Ga0105246_10378322 Ga0105246_103783221 279
83 3300014969 Ga0157376_10145982 Ga0157376_101459822 279
84 3300025911 Ga0207654_10204600 Ga0207654_102046001 279
85 3300025914 Ga0207671_10360461 Ga0207671_103604611 279
86 3300025935 Ga0207709_10104454 Ga0207709_101044542 279
87 3300025937 Ga0207669_10029822 Ga0207669_100298222 279
88 3300025938 Ga0207704_10163511 Ga0207704_101635111 279
89 3300025961 Ga0207712_10230685 Ga0207712_102306852 279
90 3300025972 Ga0207668_10015065 Ga0207668_100150654 279
91 3300026089 Ga0207648_10063416 Ga0207648_100634163 279
92 3300026089 Ga0207648_10462270 Ga0207648_104622701 279
93 3300026121 Ga0207683_10289750 Ga0207683_102897501 279
94 3300028379 Ga0268266_10371567 Ga0268266_103715671 279
95 3300028794 Ga0307515_10012007 Ga0307515_1001200711 279
96 3300031995 Ga0307409_100402749 Ga0307409_1004027492 279
97 3300032126 Ga0307415_100123096 Ga0307415_1001230961 279
98 3300035691 Ga0373931_0021849 Ga0373931_0021849_323_1165 279
99 3300035695 Ga0373927_0163883 Ga0373927_0163883_245_1087 279
100 3300035725 Ga0373947_0212569 Ga0373947_0212569_65_907 279
101 3300044842 Ga0466957_0090202 Ga0466957_0090202_304_1146 279
102 3300045976 Ga0466967_0614173 Ga0466967_0614173_96_941 279
103 3300046460 Ga0495638_0019032 Ga0495638_0019032_1190_2032 279
104 3300047320 Ga0495672_0021500 Ga0495672_0021500_481_1323 279
105 3300048903 Ga0496100_0083660 Ga0496100_0083660_1135_1977 279
106 3300048904 Ga0496101_0004551 Ga0496101_0004551_4496_5338 279
107 3300048907 Ga0496104_0010015 Ga0496104_0010015_453_1295 279
108 3300048909 Ga0496106_0419485 Ga0496106_0419485_95_937 279
109 3300048913 Ga0496110_0010473 Ga0496110_0010473_5426_6268 279
110 3300048914 Ga0496111_0051658 Ga0496111_0051658_2050_2892 279
111 3300048916 Ga0496113_0116439 Ga0496113_0116439_1026_1868 279
112 3300048917 Ga0496114_0016363 Ga0496114_0016363_4069_4911 279
113 3300049581 Ga0501047_0275591 Ga0501047_0275591_570_1418 279
114 3300049823 Ga0501044_0434669 Ga0501044_0434669_197_1045 279
115 3300050511 nmdc:mga08y16_30607_c1 nmdc:mga08y16_30607_c1_1612_2454 279
116 3300005328 Ga0070676_10065637 Ga0070676_100656372 280
117 3300005334 Ga0068869_100098356 Ga0068869_1000983563 280
118 3300005338 Ga0068868_100023606 Ga0068868_1000236065 280
119 3300005347 Ga0070668_100133435 Ga0070668_1001334352 280
120 3300005364 Ga0070673_100413478 Ga0070673_1004134781 280
121 3300005366 Ga0070659_100399672 Ga0070659_1003996721 280
122 3300005367 Ga0070667_100064979 Ga0070667_1000649792 280
123 3300005435 Ga0070714_100040555 Ga0070714_1000405552 280
124 3300005436 Ga0070713_100017000 Ga0070713_1000170005 280
125 3300005466 Ga0070685_10347712 Ga0070685_103477121 280
126 3300005548 Ga0070665_100063043 Ga0070665_1000630432 280
127 3300005563 Ga0068855_100025627 Ga0068855_1000256272 280
128 3300005615 Ga0070702_100069289 Ga0070702_1000692892 280
129 3300005616 Ga0068852_100293463 Ga0068852_1002934632 280
130 3300005617 Ga0068859_100104583 Ga0068859_1001045832 280
131 3300005617 Ga0068859_100311133 Ga0068859_1003111331 280
132 3300005618 Ga0068864_100069630 Ga0068864_1000696304 280
133 3300005719 Ga0068861_100144444 Ga0068861_1001444442 280
134 3300005842 Ga0068858_100099371 Ga0068858_1000993713 280
135 3300005843 Ga0068860_100211678 Ga0068860_1002116783 280
136 3300005844 Ga0068862_100153267 Ga0068862_1001532672 280
137 3300005844 Ga0068862_100168984 Ga0068862_1001689842 280
138 3300005985 Ga0081539_10042554 Ga0081539_100425542 280
139 3300006028 Ga0070717_10001143 Ga0070717_100011438 280
140 3300006038 Ga0075365_10283760 Ga0075365_102837601 280
141 3300006931 Ga0097620_100104575 Ga0097620_1001045753 280
142 3300006931 Ga0097620_100311137 Ga0097620_1003111371 280
143 3300009098 Ga0105245_10222206 Ga0105245_102222063 280
144 3300009101 Ga0105247_10220530 Ga0105247_102205302 280
145 3300009174 Ga0105241_10014074 Ga0105241_100140748 280
146 3300011119 Ga0105246_10179142 Ga0105246_101791422 280
147 3300013306 Ga0163162_10300490 Ga0163162_103004902 280
148 3300013308 Ga0157375_10025269 Ga0157375_100252692 280
149 3300014325 Ga0163163_10052116 Ga0163163_100521163 280
150 3300014325 Ga0163163_10133233 Ga0163163_101332331 280
151 3300014745 Ga0157377_10133500 Ga0157377_101335002 280
152 3300025907 Ga0207645_10107781 Ga0207645_101077813 280
153 3300025911 Ga0207654_10013203 Ga0207654_100132031 280
154 3300025914 Ga0207671_10094291 Ga0207671_100942912 280
155 3300025927 Ga0207687_10105091 Ga0207687_101050913 280
156 3300025928 Ga0207700_10052688 Ga0207700_100526883 280
157 3300025929 Ga0207664_10023264 Ga0207664_100232644 280
158 3300025929 Ga0207664_10027950 Ga0207664_100279502 280
159 3300025931 Ga0207644_10492611 Ga0207644_104926111 280
160 3300025942 Ga0207689_10061122 Ga0207689_100611224 280
161 3300025949 Ga0207667_10079342 Ga0207667_100793423 280
162 3300025960 Ga0207651_10382497 Ga0207651_103824971 280
163 3300025972 Ga0207668_10090760 Ga0207668_100907603 280
164 3300025986 Ga0207658_10139899 Ga0207658_101398993 280
165 3300026023 Ga0207677_10028452 Ga0207677_100284524 280
166 3300026041 Ga0207639_10261493 Ga0207639_102614932 280
167 3300026067 Ga0207678_10261671 Ga0207678_102616712 280
168 3300026078 Ga0207702_10140091 Ga0207702_101400912 280
169 3300026089 Ga0207648_10634240 Ga0207648_106342401 280
170 3300026095 Ga0207676_10135482 Ga0207676_101354823 280
171 3300026118 Ga0207675_100024363 Ga0207675_1000243633 280
172 3300026142 Ga0207698_10325690 Ga0207698_103256902 280
173 3300028379 Ga0268266_10011749 Ga0268266_100117495 280
174 3300028379 Ga0268266_10027183 Ga0268266_100271834 280
175 3300028380 Ga0268265_10020343 Ga0268265_100203433 280
176 3300028380 Ga0268265_10137061 Ga0268265_101370612 280
177 3300028381 Ga0268264_10219845 Ga0268264_102198453 280
178 3300035691 Ga0373931_0145012 Ga0373931_0145012_129_974 280
179 3300037068 Ga0373925_0458817 Ga0373925_0458817_136_981 280
180 3300046455 Ga0495603_0146563 Ga0495603_0146563_157_1002 280
181 3300046499 Ga0495594_0044547 Ga0495594_0044547_1302_2147 280
182 3300046523 Ga0495644_0026625 Ga0495644_0026625_996_1841 280
183 3300046615 Ga0495656_0086448 Ga0495656_0086448_526_1371 280
184 3300048905 Ga0496102_0067141 Ga0496102_0067141_1330_2175 280
185 3300048907 Ga0496104_0116175 Ga0496104_0116175_1139_1984 280
186 3300048909 Ga0496106_0067572 Ga0496106_0067572_575_1420 280
187 3300048911 Ga0496108_0675490 Ga0496108_0675490_14_859 280
188 3300048912 Ga0496109_0230011 Ga0496109_0230011_861_1706 280
189 3300048913 Ga0496110_0083738 Ga0496110_0083738_543_1388 280
190 3300048913 Ga0496110_0137677 Ga0496110_0137677_94_939 280
191 3300048913 Ga0496110_0281664 Ga0496110_0281664_109_954 280
192 3300048915 Ga0496112_0285337 Ga0496112_0285337_414_1259 280
193 3300048916 Ga0496113_0178563 Ga0496113_0178563_197_1042 280
194 3300048920 Ga0496117_0086289 Ga0496117_0086289_663_1508 280
195 3300048924 Ga0496121_0189252 Ga0496121_0189252_120_965 280
196 3300048929 Ga0496126_0304006 Ga0496126_0304006_255_1100 280
197 3300049571 Ga0501034_0080710 Ga0501034_0080710_527_1375 280
198 3300049575 Ga0501039_0406802 Ga0501039_0406802_127_975 280
199 3300049580 Ga0501046_0060206 Ga0501046_0060206_160_1008 280
200 3300049583 Ga0501067_0022379 Ga0501067_0022379_1402_2247 280
201 3300050494 nmdc:mga06z11_168018_c1 nmdc:mga06z11_168018_c1_238_1083 280
202 3300050496 nmdc:mga07m45_137617_c1 nmdc:mga07m45_137617_c1_62_907 280
203 3300050515 nmdc:mga0a205_287959_c1 nmdc:mga0a205_287959_c1_629_1474 280
204 3300053096 Ga0500641_0083833 Ga0500641_0083833_282_1127 280
205 3300053119 Ga0500595_001557 Ga0500595_001557_10479_11324 280
206 iso_pu_bacteria 2507262055 2507505607 280
207 3300005327 Ga0070658_10026144 Ga0070658_100261446 281
208 3300005336 Ga0070680_100171374 Ga0070680_1001713743 281
209 3300005337 Ga0070682_100129177 Ga0070682_1001291773 281
210 3300005339 Ga0070660_100023921 Ga0070660_1000239211 281
211 3300005434 Ga0070709_10002120 Ga0070709_100021209 281
212 3300005436 Ga0070713_100014537 Ga0070713_1000145377 281
213 3300005436 Ga0070713_100122498 Ga0070713_1001224981 281
214 3300005437 Ga0070710_10001640 Ga0070710_100016409 281
215 3300005439 Ga0070711_100040459 Ga0070711_1000404593 281
216 3300005535 Ga0070684_100027981 Ga0070684_1000279813 281
217 3300005539 Ga0068853_100224076 Ga0068853_1002240761 281
218 3300005563 Ga0068855_100212587 Ga0068855_1002125873 281
219 3300005577 Ga0068857_100108211 Ga0068857_1001082113 281
220 3300005616 Ga0068852_100151120 Ga0068852_1001511201 281
221 3300005937 Ga0081455_10061026 Ga0081455_100610264 281
222 3300005983 Ga0081540_1008966 Ga0081540_10089666 281
223 3300005983 Ga0081540_1014575 Ga0081540_10145757 281
224 3300006028 Ga0070717_10047973 Ga0070717_100479734 281
225 3300006028 Ga0070717_10289195 Ga0070717_102891952 281
226 3300006163 Ga0070715_10002760 Ga0070715_100027609 281
227 3300006175 Ga0070712_100006152 Ga0070712_1000061527 281
228 3300009093 Ga0105240_10035009 Ga0105240_100350091 281
229 3300009545 Ga0105237_10013514 Ga0105237_100135142 281
230 3300013104 Ga0157370_10093494 Ga0157370_100934942 281
231 3300013105 Ga0157369_10013512 Ga0157369_100135127 281
232 3300020082 Ga0206353_10623774 Ga0206353_106237742 281
233 3300025295 Ga0209564_1003384 Ga0209564_100338412 281
234 3300025898 Ga0207692_10016120 Ga0207692_100161203 281
235 3300025906 Ga0207699_10013541 Ga0207699_100135413 281
236 3300025912 Ga0207707_10111344 Ga0207707_101113441 281
237 3300025913 Ga0207695_10245684 Ga0207695_102456843 281
238 3300025914 Ga0207671_10235667 Ga0207671_102356671 281
239 3300025915 Ga0207693_10000073 Ga0207693_1000007329 281
240 3300025916 Ga0207663_10000861 Ga0207663_100008617 281
241 3300025917 Ga0207660_10020024 Ga0207660_100200243 281
242 3300025919 Ga0207657_10004881 Ga0207657_100048811 281
243 3300025921 Ga0207652_10181195 Ga0207652_101811952 281
244 3300025922 Ga0207646_10473353 Ga0207646_104733531 281
245 3300025928 Ga0207700_10102804 Ga0207700_101028041 281
246 3300025929 Ga0207664_10209929 Ga0207664_102099293 281
247 3300025939 Ga0207665_10000629 Ga0207665_1000062913 281
248 3300025949 Ga0207667_10019657 Ga0207667_100196573 281
249 3300035113 Ga0373936_0020794 Ga0373936_0020794_48_893 281
250 3300035695 Ga0373927_0018294 Ga0373927_0018294_1350_2198 281
251 3300035724 Ga0373933_0346076 Ga0373933_0346076_34_882 281
252 3300039447 Ga0436361_0327284 Ga0436361_0327284_438_1286 281
253 3300046460 Ga0495638_0069119 Ga0495638_0069119_128_976 281
254 3300046501 Ga0495607_0111811 Ga0495607_0111811_80_928 281
255 3300046506 Ga0495583_0043017 Ga0495583_0043017_429_1277 281
256 3300046507 Ga0495606_0000858 Ga0495606_0000858_30769_31617 281
257 3300046512 Ga0495610_0062316 Ga0495610_0062316_879_1727 281
258 3300046512 Ga0495610_0074333 Ga0495610_0074333_379_1227 281
259 3300046515 Ga0495620_0025893 Ga0495620_0025893_160_1008 281
260 3300046542 Ga0495597_0107671 Ga0495597_0107671_125_973 281
261 3300046542 Ga0495597_0121699 Ga0495597_0121699_56_904 281
262 3300046665 Ga0495661_0029665 Ga0495661_0029665_921_1769 281
263 3300046674 Ga0495588_0046101 Ga0495588_0046101_1010_1858 281
264 3300046689 Ga0495613_0055857 Ga0495613_0055857_406_1254 281
265 3300046810 Ga0495660_0115625 Ga0495660_0115625_127_975 281
266 3300047320 Ga0495672_0097821 Ga0495672_0097821_691_1539 281
267 3300048919 Ga0496116_0009854 Ga0496116_0009854_4048_4896 281
268 3300048920 Ga0496117_0117523 Ga0496117_0117523_607_1455 281
269 3300048921 Ga0496118_0094591 Ga0496118_0094591_104_952 281
270 3300048922 Ga0496119_0079633 Ga0496119_0079633_874_1722 281
271 3300048924 Ga0496121_0002554 Ga0496121_0002554_2288_3136 281
272 3300048926 Ga0496123_0020379 Ga0496123_0020379_2753_3601 281
273 3300048928 Ga0496125_0000904 Ga0496125_0000904_34236_35084 281
274 3300048928 Ga0496125_0004420 Ga0496125_0004420_11107_11955 281
275 3300048928 Ga0496125_0046908 Ga0496125_0046908_1008_1856 281
276 3300048929 Ga0496126_0059273 Ga0496126_0059273_2080_2928 281
277 3300048929 Ga0496126_0070519 Ga0496126_0070519_1349_2197 281
278 3300048929 Ga0496126_0076086 Ga0496126_0076086_1396_2244 281
279 3300053087 Ga0500643_022242 Ga0500643_022242_486_1334 281
280 3300053090 Ga0500646_0006123 Ga0500646_0006123_712_1560 281
281 3300053094 Ga0500566_0000139 Ga0500566_0000139_30672_31517 281
282 3300053095 Ga0500640_100312 Ga0500640_100312_156_1001 281
283 3300053096 Ga0500641_0024716 Ga0500641_0024716_591_1439 281
284 3300053098 Ga0500650_0004684 Ga0500650_0004684_751_1599 281
285 3300053104 Ga0500556_0000019 Ga0500556_0000019_3766_4614 281
286 3300053109 Ga0500569_000864 Ga0500569_000864_1143_1991 281
287 3300053111 Ga0500572_018341 Ga0500572_018341_891_1736 281
288 3300053116 Ga0500592_006645 Ga0500592_006645_923_1771 281
289 3300053119 Ga0500595_002157 Ga0500595_002157_3440_4288 281
290 3300053122 Ga0500608_035435 Ga0500608_035435_1055_1900 281
291 3300053130 Ga0500642_0000039 Ga0500642_0000039_93726_94574 281
292 3300053131 Ga0500652_001066 Ga0500652_001066_4554_5402 281
293 3300053134 Ga0500658_0009611 Ga0500658_0009611_126_974 281
294 3300053139 Ga0500568_0001467 Ga0500568_0001467_3343_4191 281
295 3300053142 Ga0500577_0034909 Ga0500577_0034909_315_1163 281
296 3300053144 Ga0500585_119091 Ga0500585_119091_22_867 281
297 3300053151 Ga0500604_0025269 Ga0500604_0025269_433_1281 281
298 3300053153 Ga0500616_0000038 Ga0500616_0000038_150330_151187 281
299 3300053153 Ga0500616_0000059 Ga0500616_0000059_255075_255923 281
300 3300053155 Ga0500620_063319 Ga0500620_063319_24_872 281
301 3300053156 Ga0500622_0015463 Ga0500622_0015463_943_1791 281
302 3300053163 Ga0500639_007050 Ga0500639_007050_3376_4221 281
303 iso_pu_bacteria 8016583857 8016585942 281
304 3300003215 JGI25153J46596_10006145 JGI25153J46596_100061456 282
305 3300003215 JGI25153J46596_10011665 JGI25153J46596_100116655 282
306 3300005434 Ga0070709_10001043 Ga0070709_100010435 282
307 3300005436 Ga0070713_100030913 Ga0070713_1000309131 282
308 3300005437 Ga0070710_10038234 Ga0070710_100382341 282
309 3300005548 Ga0070665_100140122 Ga0070665_1001401221 282
310 3300005564 Ga0070664_100359423 Ga0070664_1003594231 282
311 3300005578 Ga0068854_100372222 Ga0068854_1003722221 282
312 3300006173 Ga0070716_100007223 Ga0070716_1000072231 282
313 3300006175 Ga0070712_100182258 Ga0070712_1001822581 282
314 3300009093 Ga0105240_10005129 Ga0105240_1000512910 282
315 3300010375 Ga0105239_10179264 Ga0105239_101792642 282
316 3300014745 Ga0157377_10400498 Ga0157377_104004981 282
317 3300021320 Ga0214544_1000087 Ga0214544_100008772 282
318 3300021321 Ga0214542_1000018 Ga0214542_1000018143 282
319 3300021324 Ga0214545_1000009 Ga0214545_100000939 282
320 3300021327 Ga0214543_1000037 Ga0214543_1000037135 282
321 3300025230 Ga0209563_104871 Ga0209563_1048713 282
322 3300025253 Ga0209677_105069 Ga0209677_1050694 282
323 3300025254 Ga0209148_1002285 Ga0209148_10022852 282
324 3300025272 Ga0209455_1003892 Ga0209455_10038925 282
325 3300025273 Ga0209673_1028217 Ga0209673_10282172 282
326 3300025295 Ga0209564_1007864 Ga0209564_10078645 282
327 3300025297 Ga0209758_1006161 Ga0209758_10061617 282
328 3300025297 Ga0209758_1011559 Ga0209758_10115597 282
329 3300025297 Ga0209758_1017944 Ga0209758_10179445 282
330 3300025297 Ga0209758_1022776 Ga0209758_10227763 282
331 3300025302 Ga0207426_1001522 Ga0207426_10015225 282
332 3300025898 Ga0207692_10004318 Ga0207692_100043184 282
333 3300025904 Ga0207647_10019817 Ga0207647_100198176 282
334 3300025906 Ga0207699_10000360 Ga0207699_100003609 282
335 3300025911 Ga0207654_10255164 Ga0207654_102551641 282
336 3300025913 Ga0207695_10000059 Ga0207695_10000059271 282
337 3300025915 Ga0207693_10059536 Ga0207693_100595365 282
338 3300025928 Ga0207700_10034750 Ga0207700_100347501 282
339 3300025929 Ga0207664_10344058 Ga0207664_103440582 282
340 3300025932 Ga0207690_10074693 Ga0207690_100746932 282
341 3300025939 Ga0207665_10045899 Ga0207665_100458991 282
342 3300025949 Ga0207667_10275853 Ga0207667_102758532 282
343 3300025949 Ga0207667_10302771 Ga0207667_103027712 282
344 3300025981 Ga0207640_10045306 Ga0207640_100453062 282
345 3300026078 Ga0207702_10232705 Ga0207702_102327052 282
346 3300026088 Ga0207641_10213959 Ga0207641_102139592 282
347 3300028379 Ga0268266_10020841 Ga0268266_100208411 282
348 3300031235 Ga0265330_10055090 Ga0265330_100550902 282
349 3300031238 Ga0265332_10030006 Ga0265332_100300063 282
350 3300031247 Ga0265340_10001209 Ga0265340_100012096 282
351 3300033180 Ga0307510_10035286 Ga0307510_100352867 282
352 3300033180 Ga0307510_10089059 Ga0307510_100890592 282
353 3300035086 Ga0373934_0003939 Ga0373934_0003939_4495_5346 282
354 3300035113 Ga0373936_0010427 Ga0373936_0010427_1852_2703 282
355 3300035117 Ga0373953_0000259 Ga0373953_0000259_4621_5472 282
356 3300035118 Ga0373954_0000249 Ga0373954_0000249_16176_17027 282
357 3300035119 Ga0373956_0018532 Ga0373956_0018532_592_1443 282
358 3300035120 Ga0373957_0003088 Ga0373957_0003088_2250_3101 282
359 3300035170 Ga0373943_0003923 Ga0373943_0003923_2326_3177 282
360 3300035171 Ga0373946_0005379 Ga0373946_0005379_2687_3538 282
361 3300035172 Ga0373955_0009036 Ga0373955_0009036_87_938 282
362 3300035410 Ga0373924_0003664 Ga0373924_0003664_1252_2103 282
363 3300035692 Ga0373935_0000434 Ga0373935_0000434_5604_6455 282
364 3300035692 Ga0373935_0112742 Ga0373935_0112742_648_1499 282
365 3300035695 Ga0373927_0003717 Ga0373927_0003717_3857_4708 282
366 3300035724 Ga0373933_0001831 Ga0373933_0001831_5767_6618 282
367 3300035725 Ga0373947_0003045 Ga0373947_0003045_3374_4225 282
368 3300036401 Ga0373937_0171393 Ga0373937_0171393_725_1576 282
369 3300037068 Ga0373925_0006130 Ga0373925_0006130_4122_4973 282
370 3300037418 Ga0395900_0000696 Ga0395900_0000696_43284_44132 282
371 3300037466 Ga0395898_0035004 Ga0395898_0035004_1604_2452 282
372 3300037466 Ga0395898_0107104 Ga0395898_0107104_1178_2032 282
373 3300038443 Ga0395901_0048644 Ga0395901_0048644_2883_3737 282
374 3300045049 Ga0466959_0249432 Ga0466959_0249432_88_939 282
375 3300046454 Ga0495592_0011508 Ga0495592_0011508_511_1362 282
376 3300046454 Ga0495592_0172975 Ga0495592_0172975_169_1020 282
377 3300046455 Ga0495603_0000189 Ga0495603_0000189_13934_14785 282
378 3300046455 Ga0495603_0021216 Ga0495603_0021216_2258_3109 282
379 3300046459 Ga0495629_0000268 Ga0495629_0000268_11958_12809 282
380 3300046459 Ga0495629_0001490 Ga0495629_0001490_14523_15374 282
381 3300046461 Ga0495641_0002442 Ga0495641_0002442_10033_10884 282
382 3300046462 Ga0495651_0011203 Ga0495651_0011203_1745_2593 282
383 3300046463 Ga0495653_0000300 Ga0495653_0000300_32776_33627 282
384 3300046472 Ga0495580_0006330 Ga0495580_0006330_2356_3207 282
385 3300046473 Ga0495582_0000144 Ga0495582_0000144_12138_12989 282
386 3300046475 Ga0495639_0000067 Ga0495639_0000067_33148_33999 282
387 3300046476 Ga0495662_0000005 Ga0495662_0000005_67265_68116 282
388 3300046477 Ga0495664_0052227 Ga0495664_0052227_12_863 282
389 3300046499 Ga0495594_0000102 Ga0495594_0000102_32497_33348 282
390 3300046511 Ga0495608_0000255 Ga0495608_0000255_36820_37671 282
391 3300046511 Ga0495608_0040269 Ga0495608_0040269_941_1789 282
392 3300046514 Ga0495618_0039068 Ga0495618_0039068_1839_2690 282
393 3300046516 Ga0495628_0036326 Ga0495628_0036326_2525_3376 282
394 3300046517 Ga0495630_0014512 Ga0495630_0014512_4635_5486 282
395 3300046522 Ga0495643_0111638 Ga0495643_0111638_31_879 282
396 3300046524 Ga0495648_0000382 Ga0495648_0000382_6575_7429 282
397 3300046526 Ga0495666_0104893 Ga0495666_0104893_292_1143 282
398 3300046529 Ga0495652_0048270 Ga0495652_0048270_120_971 282
399 3300046531 Ga0495665_0000935 Ga0495665_0000935_10142_10993 282
400 3300046533 Ga0495640_0005833 Ga0495640_0005833_8135_8986 282
401 3300046533 Ga0495640_0012005 Ga0495640_0012005_4512_5363 282
402 3300046535 Ga0495586_0328668 Ga0495586_0328668_11_862 282
403 3300046536 Ga0495587_0008775 Ga0495587_0008775_469_1317 282
404 3300046536 Ga0495587_0013918 Ga0495587_0013918_648_1499 282
405 3300046543 Ga0495645_0072463 Ga0495645_0072463_111_962 282
406 3300046557 Ga0495622_0000649 Ga0495622_0000649_16916_17767 282
407 3300046559 Ga0495667_0000121 Ga0495667_0000121_30718_31569 282
408 3300046642 Ga0495634_0001407 Ga0495634_0001407_18732_19583 282
409 3300046642 Ga0495634_0051027 Ga0495634_0051027_1891_2742 282
410 3300046660 Ga0495625_0188236 Ga0495625_0188236_81_944 282
411 3300046663 Ga0495635_0000072 Ga0495635_0000072_31740_32591 282
412 3300046663 Ga0495635_0002392 Ga0495635_0002392_2563_3414 282
413 3300046674 Ga0495588_0010392 Ga0495588_0010392_1591_2442 282
414 3300046675 Ga0495657_0004271 Ga0495657_0004271_7894_8745 282
415 3300046678 Ga0495599_0007431 Ga0495599_0007431_5707_6558 282
416 3300046678 Ga0495599_0174472 Ga0495599_0174472_31_879 282
417 3300046680 Ga0495646_0007628 Ga0495646_0007628_370_1221 282
418 3300046681 Ga0495647_0002197 Ga0495647_0002197_822_1673 282
419 3300046683 Ga0495658_0000439 Ga0495658_0000439_20555_21406 282
420 3300046689 Ga0495613_0001828 Ga0495613_0001828_7346_8197 282
421 3300046689 Ga0495613_0262260 Ga0495613_0262260_84_935 282
422 3300046690 Ga0495624_0000460 Ga0495624_0000460_17736_18587 282
423 3300046809 Ga0495600_0014429 Ga0495600_0014429_499_1350 282
424 3300047315 Ga0495581_0000084 Ga0495581_0000084_30906_31757 282
425 3300047315 Ga0495581_0127057 Ga0495581_0127057_253_1104 282
426 3300047317 Ga0495604_0002223 Ga0495604_0002223_4618_5469 282
427 3300047319 Ga0495674_0004128 Ga0495674_0004128_9621_10472 282
428 3300047319 Ga0495674_0019201 Ga0495674_0019201_2681_3532 282
429 3300047319 Ga0495674_0192303 Ga0495674_0192303_10_858 282
430 3300047321 Ga0495676_0006985 Ga0495676_0006985_4265_5116 282
431 3300047322 Ga0495680_0001208 Ga0495680_0001208_26736_27587 282
432 3300047322 Ga0495680_0005809 Ga0495680_0005809_4118_4966 282
433 3300047443 Ga0495687_130376 Ga0495687_130376_31_879 282
434 3300047444 Ga0495675_0010221 Ga0495675_0010221_835_1686 282
435 3300047471 Ga0495684_0000594 Ga0495684_0000594_20464_21315 282
436 3300047471 Ga0495684_0036127 Ga0495684_0036127_2302_3153 282
437 3300047673 Ga0495593_0000038 Ga0495593_0000038_36528_37379 282
438 3300047673 Ga0495593_0000109 Ga0495593_0000109_6386_7237 282
439 3300048088 Ga0495602_0025029 Ga0495602_0025029_3701_4549 282
440 3300048088 Ga0495602_0234433 Ga0495602_0234433_27_878 282
441 3300048905 Ga0496102_0222523 Ga0496102_0222523_422_1270 282
442 3300048905 Ga0496102_0246787 Ga0496102_0246787_128_976 282
443 3300048906 Ga0496103_0164558 Ga0496103_0164558_38_886 282
444 3300048909 Ga0496106_0315860 Ga0496106_0315860_239_1087 282
445 3300048912 Ga0496109_0380920 Ga0496109_0380920_459_1307 282
446 3300048915 Ga0496112_0000065 Ga0496112_0000065_18765_19622 282
447 3300048915 Ga0496112_0212900 Ga0496112_0212900_612_1460 282
448 3300048915 Ga0496112_0394288 Ga0496112_0394288_424_1272 282
449 3300048916 Ga0496113_0375907 Ga0496113_0375907_65_913 282
450 3300048919 Ga0496116_0205825 Ga0496116_0205825_13_870 282
451 3300048921 Ga0496118_0063550 Ga0496118_0063550_1837_2685 282
452 3300048922 Ga0496119_0022737 Ga0496119_0022737_3307_4155 282
453 3300053080 Ga0500635_0046689 Ga0500635_0046689_228_1079 282
454 3300053085 Ga0495619_0010257 Ga0495619_0010257_2679_3530 282
455 3300053085 Ga0495619_0042088 Ga0495619_0042088_103_951 282
456 3300053085 Ga0495619_0255899 Ga0495619_0255899_82_933 282
457 3300053094 Ga0500566_0078766 Ga0500566_0078766_785_1633 282
458 3300053102 Ga0500554_005453 Ga0500554_005453_209_1060 282
459 3300053119 Ga0500595_012821 Ga0500595_012821_1793_2644 282
460 3300053130 Ga0500642_0002118 Ga0500642_0002118_970_1818 282
461 3300053150 Ga0500603_002683 Ga0500603_002683_2906_3757 282
462 3300053158 Ga0500627_0117092 Ga0500627_0117092_199_1050 282
463 3300053177 Ga0500636_0012647 Ga0500636_0012647_3082_3933 282
464 3300053724 Ga0500570_087710 Ga0500570_087710_343_1194 282
465 3300053729 Ga0500625_090653 Ga0500625_090653_134_982 282
466 3300053737 Ga0500601_000189 Ga0500601_000189_4934_5782 282
467 iso_pu_bacteria 2824661429 2824670451 282
468 iso_pu_bacteria 2906626472 2906633195 282
469 iso_pu_bacteria 2935837841 2935841380 282
470 iso_pu_bacteria 2941538514 2941543606 282
471 iso_pu_bacteria 2528768022 2528852092 284
472 iso_pu_bacteria 2879099564 2879106718 284
473 iso_pu_bacteria 2922368715 2922369137 284
474 iso_pu_bacteria 2932784394 2932789033 284
475 iso_pu_bacteria 2932809354 2932814330 284
476 iso_pu_bacteria 2932818245 2932820456 284
477 iso_pu_bacteria 2932828146 2932834488 284
478 iso_pu_bacteria 2935616580 2935624471 284
479 iso_pu_bacteria 2935638405 2935645861 284
480 iso_pu_bacteria 2935665750 2935673428 284
481 iso_pu_bacteria 2935684952 2935686781 284
482 iso_pu_bacteria 2935694250 2935701539 284
483 iso_pu_bacteria 2935703347 2935710486 284
484 iso_pu_bacteria 2935713505 2935716469 284
485 iso_pu_bacteria 2935722832 2935723406 284
486 iso_pu_bacteria 2935732158 2935734962 284
487 iso_pu_bacteria 2935741537 2935744247 284
488 iso_pu_bacteria 2935750917 2935752747 284
489 iso_pu_bacteria 2935760218 2935764706 284
490 iso_pu_bacteria 2935801545 2935806183 284
491 iso_pu_bacteria 2935810662 2935816949 284
492 iso_pu_bacteria 2935827899 2935835238 284
493 iso_pu_bacteria 2935855204 2935863052 284
494 iso_pu_bacteria 2935864058 2935871862 284
495 iso_pu_bacteria 2935873716 2935882247 284
496 iso_pu_bacteria 2935908558 2935911014 284
497 iso_pu_bacteria 2935916978 2935924175 284
498 iso_pu_bacteria 2935926038 2935932772 284
499 iso_pu_bacteria 2935934488 2935937335 284
500 iso_pu_bacteria 2935942939 2935949464 284
501 iso_pu_bacteria 2935951376 2935958137 284
502 iso_pu_bacteria 2935967501 2935971208 284
503 iso_pu_bacteria 2935992306 2936000182 284
504 iso_pu_bacteria 2936002035 2936010096 284
505 iso_pu_bacteria 2936037263 2936043940 284
506 iso_pu_bacteria 2940556831 2940558660 284
507 iso_pu_bacteria 8016511872 8016517769 284
508 iso_pu_bacteria 8017057580 8017058861 284
509 iso_pu_bacteria 8019576017 8019576790 284
510 iso_pu_bacteria 8019586578 8019594846 284
511 iso_pu_bacteria 8019597564 8019606893 284
512 iso_pu_bacteria 8019608314 8019611615 284
513 iso_pu_bacteria 8019687851 8019695801 284
514 iso_pu_bacteria 2508501042 2508695869 285
515 iso_pu_bacteria 2511231028 2511401125 285
516 iso_pu_bacteria 2513237139 2513876952 285
517 iso_pu_bacteria 2515154112 2515624006 285
518 iso_pu_bacteria 2617270735 2617353230 285
519 iso_pu_bacteria 2802429603 2805921253 285
520 iso_pu_bacteria 2824773399 2824777503 285
521 iso_pu_bacteria 2847939898 2847942655 285
522 iso_pu_bacteria 2874590934 2874591116 285
523 iso_pu_bacteria 2874645413 2874647753 285
524 iso_pu_bacteria 2876771140 2876772043 285
525 iso_pu_bacteria 2876818435 2876819300 285
526 iso_pu_bacteria 2879074833 2879074960 285
527 iso_pu_bacteria 2879127579 2879135779 285
528 iso_pu_bacteria 2879142872 2879150948 285
529 iso_pu_bacteria 2885409591 2885411198 285
530 iso_pu_bacteria 2888388044 2888390307 285
531 iso_pu_bacteria 2906643746 2906648054 285
532 iso_pu_bacteria 2935648319 2935649053 285
533 iso_pu_bacteria 2935656913 2935658175 285
534 iso_pu_bacteria 2935975950 2935982198 285
535 iso_pu_bacteria 2935984226 2935985337 285
536 iso_pu_bacteria 2936011229 2936012394 285
537 iso_pu_bacteria 2936019824 2936020525 285
538 iso_pu_bacteria 2936028420 2936029687 285
539 iso_pu_bacteria 2936046547 2936051848 285
540 iso_pu_bacteria 2936055302 2936056899 285
541 iso_pu_bacteria 2941531003 2941535693 285
542 iso_pu_bacteria 8019619141 8019623346 285
543 iso_pu_bacteria 8019638758 8019640867 285
544 iso_pu_bacteria 8019659431 8019666592 285
545 iso_pu_bacteria 8019668869 8019676331 285
546 iso_pu_bacteria 8019678201 8019679666 285
547 iso_pu_bacteria 8056967851 8056975626 285
548 iso_pu_bacteria 2824679649 2824685545 286
549 iso_pu_bacteria 2841957949 2841965138 286
550 iso_pu_bacteria 2857509624 2857515616 286
551 iso_pu_bacteria 2885366525 2885368700 286
552 iso_pu_bacteria 2922393267 2922400748 286
553 iso_pu_bacteria 3005710791 3005711387 286
554 3300005455 Ga0070663_100109435 Ga0070663_1001094351 288
555 3300005459 Ga0068867_100510338 Ga0068867_1005103381 288
556 3300006038 Ga0075365_10068554 Ga0075365_100685543 288
557 3300026023 Ga0207677_10435579 Ga0207677_104355791 288
558 3300026067 Ga0207678_10041959 Ga0207678_100419591 288
559 3300026089 Ga0207648_10179191 Ga0207648_101791911 288
560 3300039437 Ga0436365_0801382 Ga0436365_0801382_96_965 288
561 3300041453 Ga0451797_1195647 Ga0451797_1195647_129_1019 288
562 3300046455 Ga0495603_0127912 Ga0495603_0127912_392_1318 288
563 3300046501 Ga0495607_0173690 Ga0495607_0173690_186_1052 288
564 3300046616 Ga0495668_0207077 Ga0495668_0207077_14_880 288
565 3300046674 Ga0495588_0109722 Ga0495588_0109722_84_950 288
566 3300047469 Ga0495673_0066228 Ga0495673_0066228_531_1457 288
567 3300047472 Ga0495686_0093532 Ga0495686_0093532_839_1765 288
568 3300048908 Ga0496105_0106523 Ga0496105_0106523_758_1684 288
569 3300048909 Ga0496106_0047592 Ga0496106_0047592_2304_3170 288
570 3300048910 Ga0496107_0159094 Ga0496107_0159094_680_1606 288
571 3300048913 Ga0496110_0189228 Ga0496110_0189228_927_1853 288
572 3300048913 Ga0496110_0636985 Ga0496110_0636985_40_906 288
573 3300048915 Ga0496112_0598785 Ga0496112_0598785_87_953 288
574 3300048919 Ga0496116_0011726 Ga0496116_0011726_1205_2071 288
575 3300048920 Ga0496117_0134676 Ga0496117_0134676_492_1418 288
576 3300048924 Ga0496121_0090747 Ga0496121_0090747_953_1879 288
577 3300048927 Ga0496124_0174964 Ga0496124_0174964_72_998 288
578 3300050492 nmdc:mga0yw44_13913_c1 nmdc:mga0yw44_13913_c1_563_1429 288
579 iso_pu_bacteria 2513237102 2513700410 288
580 iso_pu_bacteria 2513237161 2514016072 288
581 iso_pu_bacteria 2517093001 2517105903 288
582 iso_pu_bacteria 2824617872 2824624894 288
583 iso_pu_bacteria 2824626560 2824631754 288
584 iso_pu_bacteria 2824687955 2824694169 288
585 iso_pu_bacteria 2824723954 2824729549 288
586 iso_pu_bacteria 2824753945 2824762093 288
587 iso_pu_bacteria 2824763712 2824772412 288
588 iso_pu_bacteria 2838122688 2838125737 288
589 iso_pu_bacteria 2841941048 2841947948 288
590 iso_pu_bacteria 2841949485 2841957045 288
591 iso_pu_bacteria 2841966195 2841972776 288
592 iso_pu_bacteria 2841974524 2841977554 288
593 iso_pu_bacteria 2841983080 2841984889 288
594 iso_pu_bacteria 2842038055 2842041345 288
595 iso_pu_bacteria 2842045827 2842049387 288
596 iso_pu_bacteria 2844315083 2844315842 288
597 iso_pu_bacteria 2874612657 2874617131 288
598 iso_pu_bacteria 2874620515 2874621362 288
599 iso_pu_bacteria 2881364244 2881367126 288
600 iso_pu_bacteria 2881665667 2881668409 288
601 iso_pu_bacteria 2903727486 2903730858 288
602 iso_pu_bacteria 2904666416 2904668032 288
603 iso_pu_bacteria 2904711408 2904714163 288
604 iso_pu_bacteria 2906602504 2906603681 288
605 3300003215 JGI25153J46596_10003051 JGI25153J46596_100030519 289
606 3300003354 JGI25160J50197_1001574 JGI25160J50197_10015744 289
607 3300005330 Ga0070690_100046706 Ga0070690_1000467062 289
608 3300005543 Ga0070672_100012411 Ga0070672_1000124118 289
609 3300005719 Ga0068861_100058920 Ga0068861_1000589203 289
610 3300005841 Ga0068863_100302870 Ga0068863_1003028702 289
611 3300005842 Ga0068858_100109449 Ga0068858_1001094492 289
612 3300009148 Ga0105243_10134417 Ga0105243_101344172 289
613 3300009553 Ga0105249_10164886 Ga0105249_101648862 289
614 3300010375 Ga0105239_10690001 Ga0105239_106900012 289
615 3300025261 Ga0209233_1013010 Ga0209233_10130103 289
616 3300025297 Ga0209758_1000949 Ga0209758_100094910 289
617 3300025927 Ga0207687_10167300 Ga0207687_101673002 289
618 3300025940 Ga0207691_10187098 Ga0207691_101870982 289
619 3300026118 Ga0207675_100060324 Ga0207675_1000603244 289
620 3300037471 Ga0395905_0036154 Ga0395905_0036154_782_1651 289
621 3300044656 Ga0466969_0030684 Ga0466969_0030684_1054_1923 289
622 3300044658 Ga0466972_0001053 Ga0466972_0001053_5292_6161 289
623 3300044684 Ga0466966_0000137 Ga0466966_0000137_23600_24469 289
624 3300044693 Ga0466961_0000039 Ga0466961_0000039_27767_28636 289
625 3300044694 Ga0466963_0001672 Ga0466963_0001672_8967_9836 289
626 3300044765 Ga0466970_0074283 Ga0466970_0074283_800_1669 289
627 3300044901 Ga0466960_0043701 Ga0466960_0043701_428_1297 289
628 3300045049 Ga0466959_0001594 Ga0466959_0001594_9815_10684 289
629 3300046454 Ga0495592_0011025 Ga0495592_0011025_3517_4386 289
630 3300046454 Ga0495592_0255347 Ga0495592_0255347_193_1062 289
631 3300046474 Ga0495605_0184778 Ga0495605_0184778_21_890 289
632 3300046516 Ga0495628_0040804 Ga0495628_0040804_1710_2579 289
633 3300046529 Ga0495652_0007246 Ga0495652_0007246_5277_6146 289
634 3300046529 Ga0495652_0106931 Ga0495652_0106931_1327_2196 289
635 3300046533 Ga0495640_0048180 Ga0495640_0048180_2012_2881 289
636 3300046543 Ga0495645_0027614 Ga0495645_0027614_2688_3557 289
637 3300046559 Ga0495667_0013372 Ga0495667_0013372_1093_1962 289
638 3300046663 Ga0495635_0037151 Ga0495635_0037151_1629_2498 289
639 3300046675 Ga0495657_0111504 Ga0495657_0111504_185_1054 289
640 3300046679 Ga0495623_0010400 Ga0495623_0010400_3757_4626 289
641 3300046680 Ga0495646_0061399 Ga0495646_0061399_212_1081 289
642 3300046689 Ga0495613_0154119 Ga0495613_0154119_430_1299 289
643 3300046809 Ga0495600_0001929 Ga0495600_0001929_4065_4934 289
644 3300047317 Ga0495604_0010947 Ga0495604_0010947_1129_1998 289
645 3300047444 Ga0495675_0070404 Ga0495675_0070404_966_1835 289
646 3300048905 Ga0496102_0150978 Ga0496102_0150978_477_1400 289
647 3300048924 Ga0496121_0139985 Ga0496121_0139985_76_951 289
648 3300048929 Ga0496126_0088464 Ga0496126_0088464_710_1579 289
649 3300048929 Ga0496126_0237057 Ga0496126_0237057_321_1190 289
650 3300050490 nmdc:mga03n38_45605_c1 nmdc:mga03n38_45605_c1_903_1772 289
651 3300050516 nmdc:mga0sz30_185344_c1 nmdc:mga0sz30_185344_c1_17_886 289
652 3300053093 Ga0500651_0009030 Ga0500651_0009030_2924_3793 289
653 3300053103 Ga0500555_003871 Ga0500555_003871_990_1859 289
654 3300053109 Ga0500569_000516 Ga0500569_000516_2158_3027 289
655 3300053130 Ga0500642_0026140 Ga0500642_0026140_124_993 289
656 3300053133 Ga0500655_030790 Ga0500655_030790_84_953 289
657 3300053139 Ga0500568_0010187 Ga0500568_0010187_2055_2924 289
658 3300053142 Ga0500577_0092177 Ga0500577_0092177_197_1066 289
659 3300053158 Ga0500627_0128272 Ga0500627_0128272_54_923 289
660 3300053161 Ga0500634_0143339 Ga0500634_0143339_136_1005 289
661 3300053731 Ga0500609_002302 Ga0500609_002302_79_948 289
662 3300005334 Ga0068869_100187122 Ga0068869_1001871221 290
663 3300005344 Ga0070661_100270881 Ga0070661_1002708811 290
664 3300005455 Ga0070663_100333944 Ga0070663_1003339441 290
665 3300005543 Ga0070672_100130698 Ga0070672_1001306982 290
666 3300005547 Ga0070693_100252828 Ga0070693_1002528282 290
667 3300005548 Ga0070665_100329221 Ga0070665_1003292212 290
668 3300005564 Ga0070664_100150931 Ga0070664_1001509312 290
669 3300005578 Ga0068854_100152216 Ga0068854_1001522162 290
670 3300006237 Ga0097621_100329117 Ga0097621_1003291172 290
671 3300006358 Ga0068871_100104701 Ga0068871_1001047013 290
672 3300025297 Ga0209758_1007096 Ga0209758_10070962 290
673 3300025944 Ga0207661_10551095 Ga0207661_105510951 290
674 3300025945 Ga0207679_10204384 Ga0207679_102043842 290
675 3300026067 Ga0207678_10029495 Ga0207678_100294953 290
676 3300026088 Ga0207641_10319570 Ga0207641_103195702 290
677 3300026095 Ga0207676_10032534 Ga0207676_100325344 290
678 3300028379 Ga0268266_10239769 Ga0268266_102397692 290
679 3300053119 Ga0500595_016051 Ga0500595_016051_65_937 290
680 3300053123 Ga0500614_032696 Ga0500614_032696_228_1100 290
681 3300053154 Ga0500619_045425 Ga0500619_045425_474_1346 290
682 3300053155 Ga0500620_054428 Ga0500620_054428_122_994 290
683 3300053177 Ga0500636_0000563 Ga0500636_0000563_7761_8633 290
684 3300006173 Ga0070716_100042884 Ga0070716_1000428843 291
685 3300003214 JGI25165J46597_1009332 JGI25165J46597_10093322 292
686 3300003215 JGI25153J46596_10004570 JGI25153J46596_100045708 292
687 3300003215 JGI25153J46596_10037172 JGI25153J46596_100371722 292
688 3300003354 JGI25160J50197_1001779 JGI25160J50197_100177910 292
689 3300003794 Ga0055531_10005617 Ga0055531_100056178 292
690 3300005262 Ga0065165_1005041 Ga0065165_10050419 292
691 3300005335 Ga0070666_10267489 Ga0070666_102674891 292
692 3300005366 Ga0070659_100022001 Ga0070659_1000220014 292
693 3300005530 Ga0070679_100296853 Ga0070679_1002968531 292
694 3300006195 Ga0075366_10002600 Ga0075366_100026007 292
695 3300006942 Ga0099824_1012187 Ga0099824_10121875 292
696 3300009174 Ga0105241_10047814 Ga0105241_100478144 292
697 3300009551 Ga0105238_10694036 Ga0105238_106940362 292
698 3300025261 Ga0209233_1005177 Ga0209233_10051775 292
699 3300025297 Ga0209758_1000030 Ga0209758_1000030153 292
700 3300025297 Ga0209758_1000884 Ga0209758_100088410 292
701 3300025297 Ga0209758_1010276 Ga0209758_10102765 292
702 3300025299 Ga0209256_1016593 Ga0209256_10165932 292
703 3300025302 Ga0207426_1015480 Ga0207426_10154802 292
704 3300025304 Ga0209257_1003355 Ga0209257_10033555 292
705 3300025909 Ga0207705_10142379 Ga0207705_101423792 292
706 3300025939 Ga0207665_10305035 Ga0207665_103050351 292
707 3300025986 Ga0207658_10378790 Ga0207658_103787901 292
708 3300026067 Ga0207678_10370875 Ga0207678_103708751 292
709 3300027296 Ga0209389_1000161 Ga0209389_10001615 292
710 3300027357 Ga0209589_1000103 Ga0209589_100010337 292
711 3300027361 Ga0209489_100304 Ga0209489_10030437 292
712 3300046459 Ga0495629_0031949 Ga0495629_0031949_2128_3021 292
713 3300046460 Ga0495638_0013239 Ga0495638_0013239_2807_3700 292
714 3300046524 Ga0495648_0050531 Ga0495648_0050531_1557_2450 292
715 3300046524 Ga0495648_0074678 Ga0495648_0074678_1038_1931 292
716 3300046557 Ga0495622_0008376 Ga0495622_0008376_798_1691 292
717 3300046663 Ga0495635_0050480 Ga0495635_0050480_471_1364 292
718 3300047317 Ga0495604_0061619 Ga0495604_0061619_1505_2398 292
719 3300047673 Ga0495593_0021842 Ga0495593_0021842_83_976 292
720 3300048905 Ga0496102_0363315 Ga0496102_0363315_398_1291 292
721 3300048907 Ga0496104_0025881 Ga0496104_0025881_1650_2543 292
722 3300048918 Ga0496115_0033662 Ga0496115_0033662_759_1652 292
723 3300048921 Ga0496118_0021615 Ga0496118_0021615_2299_3192 292
724 3300048922 Ga0496119_0007073 Ga0496119_0007073_258_1151 292
725 3300048923 Ga0496120_0016701 Ga0496120_0016701_1672_2565 292
726 3300048923 Ga0496120_0023248 Ga0496120_0023248_980_1873 292
727 3300048924 Ga0496121_0033524 Ga0496121_0033524_2459_3364 292
728 3300048924 Ga0496121_0178700 Ga0496121_0178700_202_1095 292
729 3300048928 Ga0496125_0093476 Ga0496125_0093476_25_903 292
730 3300053087 Ga0500643_006068 Ga0500643_006068_4097_4990 292
731 3300053139 Ga0500568_0008598 Ga0500568_0008598_184_1122 292
732 3300053153 Ga0500616_0015647 Ga0500616_0015647_1326_2219 292
733 3300053156 Ga0500622_0185245 Ga0500622_0185245_38_931 292
734 3300053162 Ga0500638_116171 Ga0500638_116171_278_1171 292
735 3300053736 Ga0500599_000667 Ga0500599_000667_1054_1947 292
736 iso_pu_bacteria 2508501009 2508539500 292
737 iso_pu_bacteria 2513237092 2513628936 292
738 iso_pu_bacteria 2513237094 2513642279 292
739 iso_pu_bacteria 2932794094 2932801336 292
740 iso_pu_bacteria 2932801729 2932808849 292
741 iso_pu_bacteria 2935608549 2935614662 292
742 iso_pu_bacteria 2935785616 2935789157 292
743 iso_pu_bacteria 2935793552 2935796906 292
744 iso_pu_bacteria 2935819856 2935826297 292
745 iso_pu_bacteria 2935847175 2935853793 292
746 iso_pu_bacteria 2935883170 2935883280 292
747 iso_pu_bacteria 3005594810 3005595426 292
748 iso_pu_bacteria 3005718088 3005718660 292
749 iso_pu_bacteria 8016522445 8016525830 292
750 iso_pu_bacteria 8016530956 8016539433 292
751 iso_pu_bacteria 8016548790 8016549572 292
752 iso_pu_bacteria 8016566248 8016569123 292
753 iso_pu_bacteria 8016575299 8016581760 292
754 iso_pu_bacteria 8016595262 8016596008 292
755 iso_pu_bacteria 8016603502 8016606882 292
756 iso_pu_bacteria 8019530166 8019530713 292
757 iso_pu_bacteria 8019538911 8019540872 292
758 iso_pu_bacteria 8019547302 8019549743 292
759 iso_pu_bacteria 8019648815 8019652963 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

112

200

0.88

PF13649

Methyltransf_25

Methyltransferase domain

90

175

0.86

PF08241

Methyltransf_11

Methyltransferase domain

87

179

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p35-assembly1.cif.gz_B crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.7094 52 264
7ebx-assembly1.cif.gz_A crystal structure of juvenile hormone acid methyltransferase jhamt in complex with s-adenosyl-l-homocysteine. 0.6969 40 263
3ccf-assembly1.cif.gz_A crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.695 49 263
2p35-assembly1.cif.gz_A crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.6875 46 264
7ec0-assembly1.cif.gz_A crystal structure of juvenile hormone acid methyltransferase jhamt in complex with s-adenosyl homocysteine and methyl farnesoate 0.6816 40 263
ID Description Score Start End Superfamily
af_A0A0R0II64_62_165_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9185 97 141 3.40.50.150
af_A2APY7_47_247_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8727 22 197 3.40.50.150
af_A0A1D6IAK3_2_136_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8621 39 145 3.40.50.150
af_C0PCR5_51_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8576 28 201 3.40.50.150
af_Q9NAP7_34_269_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8429 52 263 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A5S9C5X4-F1-model_v4 deleted 0.8944 19 268
AF-S9TSC2-F1-model_v4 SAM-dependent methyltransferase 0.8917 19 265 GO:0008757
GO:0032259
AF-A0A429VCV5-F1-model_v4 Methyltransferase 0.8706 48 267 GO:0008168
GO:0032259
AF-A0A1Y2K2K2-F1-model_v4 Putative type 11 methyltransferase 0.8631 16 270 GO:0008757
GO:0032259
AF-A0A429VCV5-F1-model_v4 Methyltransferase 0.8631 48 267 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
80.41 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map