F479423
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 757 | 273 | 1514 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300059424|Ga0590075_002791|Ga0590075_002791_48_962 |
| Length | 304 |
| Sequence | MATYEAELPAPRTDDRLSARILRFLGKAPVQLLLVFVGLIWLVPTLGLFLTSLLSPADFSTEGWWQVFSEPSKLTFQNYEAIFDNETLMSSLWTTAWIAIGGTVLPIIVAALAGYAFAWLEFPGRDWLFILVIALLVVPLQMALIPIFRLYNNVGDIPVIGSFAGFDTVGSLILFHTAFGLPFAIFLLRNFFIGIPKDLMEAARIDGASEIRIFVRLILPLGLPAIASLAIFQFLWTWNDLLVALTFARETQPITVAIFSQLRQFGANIELIAPATFISLVIPLGVFFAFQRYFVQGLLAGSVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 136 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 137 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 138 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 139 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 140 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 141 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 142 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 144 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 145 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 146 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 147 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 148 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 150 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 155 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 156 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 157 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 158 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 159 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 160 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 161 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 162 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 163 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 164 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 165 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 166 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 167 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 168 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 169 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 170 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 171 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 172 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 173 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 174 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 175 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 210 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 211 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 212 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 213 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 214 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 217 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 218 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 219 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 220 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 221 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 222 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 223 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 256 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 268 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 269 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 273 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.47 |
| Metatranscriptomes | 0.53 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.66 |
| Nodule | 0 |
| Rhizoplane | 8.06 |
| Rhizosphere | 91.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0590075_002791 | 3300059424 | Bacteria | 4169 |
| 2 | JGI25406J46586_10007374 | 3300003203 | Bacteria | 5023 |
| 3 | JGI25406J46586_10018973 | 3300003203 | Bacteria | 2814 |
| 4 | JGI25407J50210_10000396 | 3300003373 | Bacteria | 8384 |
| 5 | Ga0058862_12757437 | 3300004803 | Bacteria | 1077 |
| 6 | Ga0070658_10021439 | 3300005327 | Bacteria | 5178 |
| 7 | Ga0070658_10105972 | 3300005327 | Bacteria | 2326 |
| 8 | Ga0070658_10111849 | 3300005327 | Bacteria | 2263 |
| 9 | Ga0070683_100008350 | 3300005329 | Bacteria | 8796 |
| 10 | Ga0070683_100157119 | 3300005329 | Bacteria | 2157 |
| 11 | Ga0070683_100257613 | 3300005329 | Bacteria | 1659 |
| 12 | Ga0070670_100007059 | 3300005331 | Bacteria | 9524 |
| 13 | Ga0068869_100126151 | 3300005334 | Bacteria | 1963 |
| 14 | Ga0068869_100242653 | 3300005334 | Bacteria | 1436 |
| 15 | Ga0070680_100025784 | 3300005336 | Bacteria | 4700 |
| 16 | Ga0070680_100061894 | 3300005336 | Bacteria | 3064 |
| 17 | Ga0070680_100065595 | 3300005336 | Bacteria | 2976 |
| 18 | Ga0070680_100254410 | 3300005336 | Bacteria | 1485 |
| 19 | Ga0070682_100153623 | 3300005337 | Bacteria | 1582 |
| 20 | Ga0068868_100041452 | 3300005338 | Bacteria | 3587 |
| 21 | Ga0068868_100144064 | 3300005338 | Bacteria | 1958 |
| 22 | Ga0068868_100205469 | 3300005338 | Bacteria | 1644 |
| 23 | Ga0070660_100004909 | 3300005339 | Bacteria | 9251 |
| 24 | Ga0070660_100005092 | 3300005339 | Bacteria | 9079 |
| 25 | Ga0070660_100011091 | 3300005339 | Bacteria | 6391 |
| 26 | Ga0070660_100061518 | 3300005339 | Bacteria | 2915 |
| 27 | Ga0070660_100144606 | 3300005339 | Bacteria | 1909 |
| 28 | Ga0070660_100353297 | 3300005339 | Bacteria | 1211 |
| 29 | Ga0070689_100133622 | 3300005340 | Bacteria | 1991 |
| 30 | Ga0070689_100152090 | 3300005340 | Bacteria | 1867 |
| 31 | Ga0070691_10183365 | 3300005341 | Bacteria | 1091 |
| 32 | Ga0070661_100035988 | 3300005344 | Bacteria | 3598 |
| 33 | Ga0070675_100109817 | 3300005354 | Bacteria | 2331 |
| 34 | Ga0070671_100303758 | 3300005355 | Bacteria | 1359 |
| 35 | Ga0070674_100017361 | 3300005356 | Bacteria | 4525 |
| 36 | Ga0070674_100072652 | 3300005356 | Bacteria | 2437 |
| 37 | Ga0070674_100295757 | 3300005356 | Bacteria | 1289 |
| 38 | Ga0070673_100092203 | 3300005364 | Bacteria | 2477 |
| 39 | Ga0070688_100068174 | 3300005365 | Bacteria | 2268 |
| 40 | Ga0070659_100188323 | 3300005366 | Bacteria | 1695 |
| 41 | Ga0070700_100014733 | 3300005441 | Bacteria | 4419 |
| 42 | Ga0070700_100015055 | 3300005441 | Bacteria | 4378 |
| 43 | Ga0070700_100023276 | 3300005441 | Bacteria | 3621 |
| 44 | Ga0070694_100238449 | 3300005444 | Bacteria | 1371 |
| 45 | Ga0070678_100010150 | 3300005456 | Bacteria | 5737 |
| 46 | Ga0070678_100149522 | 3300005456 | Bacteria | 1880 |
| 47 | Ga0070678_100164079 | 3300005456 | Bacteria | 1803 |
| 48 | Ga0070662_100078761 | 3300005457 | Bacteria | 2449 |
| 49 | Ga0070681_10022151 | 3300005458 | Bacteria | 6377 |
| 50 | Ga0070681_10023953 | 3300005458 | Bacteria | 6147 |
| 51 | Ga0070681_10090278 | 3300005458 | Bacteria | 3014 |
| 52 | Ga0070681_10091556 | 3300005458 | Bacteria | 2991 |
| 53 | Ga0070681_10127461 | 3300005458 | Bacteria | 2478 |
| 54 | Ga0068867_100064089 | 3300005459 | Bacteria | 2732 |
| 55 | Ga0068867_100186397 | 3300005459 | Bacteria | 1653 |
| 56 | Ga0068867_100319285 | 3300005459 | Bacteria | 1286 |
| 57 | Ga0068867_100388451 | 3300005459 | Bacteria | 1174 |
| 58 | Ga0070685_10056491 | 3300005466 | Bacteria | 2282 |
| 59 | Ga0070685_10161351 | 3300005466 | Bacteria | 1429 |
| 60 | Ga0070707_100134537 | 3300005468 | Bacteria | 2404 |
| 61 | Ga0070679_100053851 | 3300005530 | Bacteria | 4005 |
| 62 | Ga0070679_100159070 | 3300005530 | Bacteria | 2233 |
| 63 | Ga0070679_100226049 | 3300005530 | Bacteria | 1832 |
| 64 | Ga0070679_100249730 | 3300005530 | Bacteria | 1730 |
| 65 | Ga0070679_100307771 | 3300005530 | Bacteria | 1535 |
| 66 | Ga0070684_100001374 | 3300005535 | Bacteria | 17491 |
| 67 | Ga0070684_100012794 | 3300005535 | Bacteria | 6740 |
| 68 | Ga0070684_100068936 | 3300005535 | Bacteria | 3109 |
| 69 | Ga0070684_100090979 | 3300005535 | Bacteria | 2714 |
| 70 | Ga0068853_100099297 | 3300005539 | Bacteria | 2572 |
| 71 | Ga0070686_100075016 | 3300005544 | Bacteria | 2224 |
| 72 | Ga0070686_100095170 | 3300005544 | Bacteria | 2000 |
| 73 | Ga0070686_100141138 | 3300005544 | Bacteria | 1677 |
| 74 | Ga0070686_100300161 | 3300005544 | Bacteria | 1191 |
| 75 | Ga0070693_100038071 | 3300005547 | Bacteria | 2686 |
| 76 | Ga0070665_100088792 | 3300005548 | Bacteria | 3097 |
| 77 | Ga0070704_100372424 | 3300005549 | Bacteria | 1211 |
| 78 | Ga0068855_100062358 | 3300005563 | Bacteria | 4352 |
| 79 | Ga0068855_100364098 | 3300005563 | Bacteria | 1591 |
| 80 | Ga0070664_100024858 | 3300005564 | Bacteria | 4962 |
| 81 | Ga0070664_100138003 | 3300005564 | Bacteria | 2145 |
| 82 | Ga0068857_100005489 | 3300005577 | Bacteria | 10812 |
| 83 | Ga0068857_100024219 | 3300005577 | Bacteria | 5342 |
| 84 | Ga0068857_100211114 | 3300005577 | Bacteria | 1771 |
| 85 | Ga0068857_100565957 | 3300005577 | Bacteria | 1072 |
| 86 | Ga0068854_100171702 | 3300005578 | Bacteria | 1688 |
| 87 | Ga0068856_100101529 | 3300005614 | Bacteria | 2869 |
| 88 | Ga0068856_100142553 | 3300005614 | Bacteria | 2403 |
| 89 | Ga0068852_100253047 | 3300005616 | Bacteria | 1688 |
| 90 | Ga0068859_100188295 | 3300005617 | Bacteria | 2148 |
| 91 | Ga0068859_100226691 | 3300005617 | Bacteria | 1957 |
| 92 | Ga0068864_100177645 | 3300005618 | Bacteria | 1944 |
| 93 | Ga0068866_10049429 | 3300005718 | Bacteria | 2131 |
| 94 | Ga0068866_10262446 | 3300005718 | Bacteria | 1062 |
| 95 | Ga0068861_100119010 | 3300005719 | Bacteria | 2128 |
| 96 | Ga0068870_10016941 | 3300005840 | Bacteria | 3494 |
| 97 | Ga0068870_10061001 | 3300005840 | Bacteria | 2026 |
| 98 | Ga0068858_100112879 | 3300005842 | Bacteria | 2538 |
| 99 | Ga0068858_100182843 | 3300005842 | Bacteria | 1980 |
| 100 | Ga0068858_100243982 | 3300005842 | Bacteria | 1705 |
| 101 | Ga0081455_10005292 | 3300005937 | Bacteria | 14169 |
| 102 | Ga0081455_10076970 | 3300005937 | Bacteria | 2746 |
| 103 | Ga0081455_10131117 | 3300005937 | Bacteria | 1960 |
| 104 | Ga0081538_10001932 | 3300005981 | Bacteria | 20753 |
| 105 | Ga0081538_10004212 | 3300005981 | Bacteria | 13347 |
| 106 | Ga0081538_10013610 | 3300005981 | Bacteria | 6434 |
| 107 | Ga0081540_1017600 | 3300005983 | Bacteria | 4416 |
| 108 | Ga0081539_10000888 | 3300005985 | Bacteria | 57168 |
| 109 | Ga0081539_10001603 | 3300005985 | Bacteria | 37270 |
| 110 | Ga0081539_10002855 | 3300005985 | Bacteria | 22993 |
| 111 | Ga0081539_10008314 | 3300005985 | Bacteria | 9078 |
| 112 | Ga0081539_10009372 | 3300005985 | Bacteria | 8201 |
| 113 | Ga0075365_10089647 | 3300006038 | Bacteria | 2094 |
| 114 | Ga0075365_10121692 | 3300006038 | Bacteria | 1801 |
| 115 | Ga0075432_10047193 | 3300006058 | Bacteria | 1514 |
| 116 | Ga0070712_100274122 | 3300006175 | Bacteria | 1357 |
| 117 | Ga0097621_100180116 | 3300006237 | Bacteria | 1826 |
| 118 | Ga0068871_100078251 | 3300006358 | Bacteria | 2734 |
| 119 | Ga0068871_100199457 | 3300006358 | Bacteria | 1727 |
| 120 | Ga0068871_100298353 | 3300006358 | Bacteria | 1414 |
| 121 | Ga0068871_100428841 | 3300006358 | Bacteria | 1182 |
| 122 | Ga0075428_100018416 | 3300006844 | Bacteria | 7721 |
| 123 | Ga0075428_100021663 | 3300006844 | Bacteria | 7116 |
| 124 | Ga0075428_100348494 | 3300006844 | Bacteria | 1589 |
| 125 | Ga0075430_100021463 | 3300006846 | Bacteria | 5489 |
| 126 | Ga0075431_100009508 | 3300006847 | Bacteria | 9763 |
| 127 | Ga0075431_100037603 | 3300006847 | Bacteria | 4984 |
| 128 | Ga0075431_100108348 | 3300006847 | Bacteria | 2867 |
| 129 | Ga0075433_10355301 | 3300006852 | Bacteria | 1295 |
| 130 | Ga0075434_100438782 | 3300006871 | Bacteria | 1327 |
| 131 | Ga0075429_100065186 | 3300006880 | Bacteria | 3171 |
| 132 | Ga0075429_100196333 | 3300006880 | Bacteria | 1768 |
| 133 | Ga0075429_100198205 | 3300006880 | Bacteria | 1759 |
| 134 | Ga0075429_100223112 | 3300006880 | Bacteria | 1651 |
| 135 | Ga0068865_100007099 | 3300006881 | Bacteria | 6877 |
| 136 | Ga0068865_100311720 | 3300006881 | Bacteria | 1263 |
| 137 | Ga0097620_100188305 | 3300006931 | Bacteria | 2148 |
| 138 | Ga0097620_100226678 | 3300006931 | Bacteria | 1957 |
| 139 | Ga0075435_100059801 | 3300007076 | Bacteria | 3089 |
| 140 | Ga0105240_10443818 | 3300009093 | Bacteria | 1453 |
| 141 | Ga0111539_10001459 | 3300009094 | Bacteria | 31580 |
| 142 | Ga0111539_10009858 | 3300009094 | Bacteria | 12054 |
| 143 | Ga0111539_10037747 | 3300009094 | Bacteria | 5831 |
| 144 | Ga0111539_10291922 | 3300009094 | Bacteria | 1897 |
| 145 | Ga0111539_10324621 | 3300009094 | Bacteria | 1791 |
| 146 | Ga0111539_10809605 | 3300009094 | Bacteria | 1090 |
| 147 | Ga0105245_10004553 | 3300009098 | Bacteria | 12235 |
| 148 | Ga0105245_10026804 | 3300009098 | Bacteria | 5074 |
| 149 | Ga0105245_10044903 | 3300009098 | Bacteria | 3945 |
| 150 | Ga0105245_10054026 | 3300009098 | Bacteria | 3607 |
| 151 | Ga0105245_10341660 | 3300009098 | Bacteria | 1481 |
| 152 | Ga0105245_10389379 | 3300009098 | Bacteria | 1390 |
| 153 | Ga0105247_10217616 | 3300009101 | Bacteria | 1291 |
| 154 | Ga0105247_10273229 | 3300009101 | Bacteria | 1163 |
| 155 | Ga0114129_10028555 | 3300009147 | Bacteria | 7904 |
| 156 | Ga0114129_10066030 | 3300009147 | Bacteria | 5047 |
| 157 | Ga0114129_10068608 | 3300009147 | Bacteria | 4944 |
| 158 | Ga0114129_10103334 | 3300009147 | Bacteria | 3939 |
| 159 | Ga0114129_10238239 | 3300009147 | Bacteria | 2447 |
| 160 | Ga0114129_10249826 | 3300009147 | Bacteria | 2381 |
| 161 | Ga0114129_10503689 | 3300009147 | Bacteria | 1581 |
| 162 | Ga0105243_10001448 | 3300009148 | Bacteria | 20858 |
| 163 | Ga0105243_10063746 | 3300009148 | Bacteria | 2954 |
| 164 | Ga0105243_10116672 | 3300009148 | Bacteria | 2243 |
| 165 | Ga0105243_10370091 | 3300009148 | Bacteria | 1322 |
| 166 | Ga0105241_10239102 | 3300009174 | Bacteria | 1534 |
| 167 | Ga0105242_10010707 | 3300009176 | Bacteria | 7041 |
| 168 | Ga0105242_10165935 | 3300009176 | Bacteria | 1937 |
| 169 | Ga0105242_10293298 | 3300009176 | Bacteria | 1482 |
| 170 | Ga0105242_10396815 | 3300009176 | Bacteria | 1286 |
| 171 | Ga0105248_10159681 | 3300009177 | Bacteria | 2543 |
| 172 | Ga0105248_10251447 | 3300009177 | Bacteria | 1989 |
| 173 | Ga0105248_10754775 | 3300009177 | Bacteria | 1098 |
| 174 | Ga0105238_10199288 | 3300009551 | Bacteria | 1977 |
| 175 | Ga0105238_10312070 | 3300009551 | Bacteria | 1558 |
| 176 | Ga0105249_10036056 | 3300009553 | Bacteria | 4487 |
| 177 | Ga0105249_10350249 | 3300009553 | Bacteria | 1496 |
| 178 | Ga0105249_10425719 | 3300009553 | Bacteria | 1362 |
| 179 | Ga0105239_10042141 | 3300010375 | Bacteria | 5002 |
| 180 | Ga0105239_10042592 | 3300010375 | Bacteria | 4974 |
| 181 | Ga0105239_10097282 | 3300010375 | Bacteria | 3253 |
| 182 | Ga0105246_10014765 | 3300011119 | Bacteria | 4918 |
| 183 | Ga0105246_10018679 | 3300011119 | Bacteria | 4420 |
| 184 | Ga0105246_10219200 | 3300011119 | Bacteria | 1490 |
| 185 | Ga0157373_10032418 | 3300013100 | Bacteria | 3761 |
| 186 | Ga0157373_10209714 | 3300013100 | Bacteria | 1374 |
| 187 | Ga0157371_10088936 | 3300013102 | Bacteria | 2187 |
| 188 | Ga0157370_10022276 | 3300013104 | Bacteria | 6305 |
| 189 | Ga0157370_10238972 | 3300013104 | Bacteria | 1681 |
| 190 | Ga0157369_10249361 | 3300013105 | Bacteria | 1853 |
| 191 | Ga0157369_10385098 | 3300013105 | Bacteria | 1455 |
| 192 | Ga0157374_10406992 | 3300013296 | Bacteria | 1358 |
| 193 | Ga0157378_10249658 | 3300013297 | Bacteria | 1698 |
| 194 | Ga0163162_10306408 | 3300013306 | Bacteria | 1720 |
| 195 | Ga0163162_10571875 | 3300013306 | Bacteria | 1257 |
| 196 | Ga0157372_10021285 | 3300013307 | Bacteria | 7004 |
| 197 | Ga0157372_10055450 | 3300013307 | Bacteria | 4426 |
| 198 | Ga0157372_10099189 | 3300013307 | Bacteria | 3322 |
| 199 | Ga0157372_10300963 | 3300013307 | Bacteria | 1865 |
| 200 | Ga0157372_10404559 | 3300013307 | Bacteria | 1590 |
| 201 | Ga0157375_10031707 | 3300013308 | Bacteria | 5003 |
| 202 | Ga0157375_10116833 | 3300013308 | Bacteria | 2772 |
| 203 | Ga0157375_10129596 | 3300013308 | Bacteria | 2641 |
| 204 | Ga0157380_10002342 | 3300014326 | Bacteria | 12732 |
| 205 | Ga0157380_10027363 | 3300014326 | Bacteria | 4337 |
| 206 | Ga0157380_10234154 | 3300014326 | Bacteria | 1651 |
| 207 | Ga0157380_10274814 | 3300014326 | Bacteria | 1538 |
| 208 | Ga0157377_10251615 | 3300014745 | Bacteria | 1145 |
| 209 | Ga0157379_10101542 | 3300014968 | Bacteria | 2581 |
| 210 | Ga0157379_10387852 | 3300014968 | Bacteria | 1282 |
| 211 | Ga0157376_10095294 | 3300014969 | Bacteria | 2588 |
| 212 | Ga0157376_10488071 | 3300014969 | Bacteria | 1208 |
| 213 | Ga0197907_10437555 | 3300020069 | Bacteria | 1457 |
| 214 | Ga0207642_10037166 | 3300025899 | Bacteria | 2096 |
| 215 | Ga0207642_10069322 | 3300025899 | Bacteria | 1672 |
| 216 | Ga0207642_10130512 | 3300025899 | Bacteria | 1311 |
| 217 | Ga0207642_10209415 | 3300025899 | Bacteria | 1082 |
| 218 | Ga0207688_10016044 | 3300025901 | Bacteria | 4061 |
| 219 | Ga0207688_10037079 | 3300025901 | Bacteria | 2703 |
| 220 | Ga0207688_10048157 | 3300025901 | Bacteria | 2381 |
| 221 | Ga0207643_10001454 | 3300025908 | Bacteria | 13592 |
| 222 | Ga0207643_10028137 | 3300025908 | Bacteria | 3120 |
| 223 | Ga0207705_10079041 | 3300025909 | Bacteria | 2395 |
| 224 | Ga0207705_10108193 | 3300025909 | Bacteria | 2052 |
| 225 | Ga0207707_10065086 | 3300025912 | Bacteria | 3175 |
| 226 | Ga0207707_10119987 | 3300025912 | Bacteria | 2299 |
| 227 | Ga0207707_10142374 | 3300025912 | Bacteria | 2096 |
| 228 | Ga0207671_10159364 | 3300025914 | Bacteria | 1747 |
| 229 | Ga0207663_10193046 | 3300025916 | Bacteria | 1463 |
| 230 | Ga0207660_10128935 | 3300025917 | Bacteria | 1924 |
| 231 | Ga0207660_10244569 | 3300025917 | Bacteria | 1414 |
| 232 | Ga0207657_10002962 | 3300025919 | Bacteria | 18203 |
| 233 | Ga0207657_10010312 | 3300025919 | Bacteria | 9330 |
| 234 | Ga0207657_10032242 | 3300025919 | Bacteria | 4737 |
| 235 | Ga0207657_10113151 | 3300025919 | Bacteria | 2239 |
| 236 | Ga0207649_10121371 | 3300025920 | Bacteria | 1762 |
| 237 | Ga0207649_10159111 | 3300025920 | Bacteria | 1564 |
| 238 | Ga0207652_10024908 | 3300025921 | Bacteria | 4968 |
| 239 | Ga0207652_10070574 | 3300025921 | Bacteria | 3034 |
| 240 | Ga0207652_10234637 | 3300025921 | Bacteria | 1653 |
| 241 | Ga0207646_10174489 | 3300025922 | Bacteria | 1941 |
| 242 | Ga0207650_10007619 | 3300025925 | Bacteria | 7376 |
| 243 | Ga0207650_10552376 | 3300025925 | Bacteria | 966 |
| 244 | Ga0207659_10026209 | 3300025926 | Bacteria | 3931 |
| 245 | Ga0207659_10233021 | 3300025926 | Bacteria | 1486 |
| 246 | Ga0207687_10017361 | 3300025927 | Bacteria | 4737 |
| 247 | Ga0207687_10071843 | 3300025927 | Bacteria | 2474 |
| 248 | Ga0207687_10287919 | 3300025927 | Bacteria | 1319 |
| 249 | Ga0207644_10257321 | 3300025931 | Bacteria | 1395 |
| 250 | Ga0207706_10117223 | 3300025933 | Bacteria | 2342 |
| 251 | Ga0207686_10064562 | 3300025934 | Bacteria | 2331 |
| 252 | Ga0207686_10157277 | 3300025934 | Bacteria | 1589 |
| 253 | Ga0207709_10008152 | 3300025935 | Bacteria | 5802 |
| 254 | Ga0207709_10121226 | 3300025935 | Bacteria | 1766 |
| 255 | Ga0207709_10199436 | 3300025935 | Bacteria | 1428 |
| 256 | Ga0207670_10015883 | 3300025936 | Bacteria | 4509 |
| 257 | Ga0207669_10010349 | 3300025937 | Bacteria | 4486 |
| 258 | Ga0207669_10036847 | 3300025937 | Bacteria | 2799 |
| 259 | Ga0207669_10058314 | 3300025937 | Bacteria | 2355 |
| 260 | Ga0207669_10072222 | 3300025937 | Bacteria | 2172 |
| 261 | Ga0207669_10249379 | 3300025937 | Bacteria | 1321 |
| 262 | Ga0207704_10037172 | 3300025938 | Bacteria | 2810 |
| 263 | Ga0207691_10022771 | 3300025940 | Bacteria | 5906 |
| 264 | Ga0207691_10483741 | 3300025940 | Bacteria | 1052 |
| 265 | Ga0207711_10529006 | 3300025941 | Bacteria | 1099 |
| 266 | Ga0207661_10001158 | 3300025944 | Bacteria | 17611 |
| 267 | Ga0207661_10007512 | 3300025944 | Bacteria | 7750 |
| 268 | Ga0207661_10018660 | 3300025944 | Bacteria | 5156 |
| 269 | Ga0207661_10069654 | 3300025944 | Bacteria | 2869 |
| 270 | Ga0207661_10077514 | 3300025944 | Bacteria | 2734 |
| 271 | Ga0207661_10133452 | 3300025944 | Bacteria | 2130 |
| 272 | Ga0207679_10004371 | 3300025945 | Bacteria | 8798 |
| 273 | Ga0207679_10136645 | 3300025945 | Bacteria | 1975 |
| 274 | Ga0207679_10478034 | 3300025945 | Bacteria | 1109 |
| 275 | Ga0207667_10397361 | 3300025949 | Bacteria | 1404 |
| 276 | Ga0207712_10102970 | 3300025961 | Bacteria | 2126 |
| 277 | Ga0207712_10409069 | 3300025961 | Bacteria | 1142 |
| 278 | Ga0207668_10174872 | 3300025972 | Bacteria | 1688 |
| 279 | Ga0207640_10138047 | 3300025981 | Bacteria | 1773 |
| 280 | Ga0207677_10577732 | 3300026023 | Bacteria | 983 |
| 281 | Ga0207639_10244265 | 3300026041 | Bacteria | 1563 |
| 282 | Ga0207678_10121433 | 3300026067 | Bacteria | 2230 |
| 283 | Ga0207708_10014725 | 3300026075 | Bacteria | 5852 |
| 284 | Ga0207708_10022969 | 3300026075 | Bacteria | 4711 |
| 285 | Ga0207708_10048031 | 3300026075 | Bacteria | 3249 |
| 286 | Ga0207708_10056634 | 3300026075 | Bacteria | 2990 |
| 287 | Ga0207708_10057029 | 3300026075 | Bacteria | 2980 |
| 288 | Ga0207708_10147164 | 3300026075 | Bacteria | 1852 |
| 289 | Ga0207702_10113985 | 3300026078 | Bacteria | 2408 |
| 290 | Ga0207702_10138766 | 3300026078 | Bacteria | 2197 |
| 291 | Ga0207641_10297758 | 3300026088 | Bacteria | 1523 |
| 292 | Ga0207648_10061593 | 3300026089 | Bacteria | 3272 |
| 293 | Ga0207648_10101761 | 3300026089 | Bacteria | 2517 |
| 294 | Ga0207648_10210782 | 3300026089 | Bacteria | 1725 |
| 295 | Ga0207648_10299608 | 3300026089 | Bacteria | 1442 |
| 296 | Ga0207648_10490450 | 3300026089 | Bacteria | 1123 |
| 297 | Ga0207674_10003621 | 3300026116 | Bacteria | 18833 |
| 298 | Ga0207674_10034225 | 3300026116 | Bacteria | 5314 |
| 299 | Ga0207674_10067326 | 3300026116 | Bacteria | 3605 |
| 300 | Ga0207674_10443434 | 3300026116 | Bacteria | 1255 |
| 301 | Ga0207675_100107034 | 3300026118 | Bacteria | 2637 |
| 302 | Ga0207675_100159273 | 3300026118 | Bacteria | 2153 |
| 303 | Ga0207675_100304316 | 3300026118 | Bacteria | 1553 |
| 304 | Ga0207675_100475742 | 3300026118 | Bacteria | 1241 |
| 305 | Ga0207683_10019869 | 3300026121 | Bacteria | 5740 |
| 306 | Ga0207683_10020840 | 3300026121 | Bacteria | 5609 |
| 307 | Ga0207683_10103174 | 3300026121 | Bacteria | 2547 |
| 308 | Ga0207683_10110092 | 3300026121 | Bacteria | 2466 |
| 309 | Ga0207698_10489890 | 3300026142 | Bacteria | 1194 |
| 310 | Ga0207428_10004605 | 3300027907 | Bacteria | 13074 |
| 311 | Ga0207428_10006328 | 3300027907 | Bacteria | 10947 |
| 312 | Ga0207428_10020716 | 3300027907 | Bacteria | 5579 |
| 313 | Ga0207428_10085637 | 3300027907 | Bacteria | 2453 |
| 314 | Ga0207428_10187063 | 3300027907 | Bacteria | 1562 |
| 315 | Ga0307408_100045370 | 3300031548 | Bacteria | 3139 |
| 316 | Ga0307408_100067790 | 3300031548 | Bacteria | 2625 |
| 317 | Ga0307408_100114301 | 3300031548 | Bacteria | 2079 |
| 318 | Ga0307405_10004470 | 3300031731 | Bacteria | 6612 |
| 319 | Ga0307405_10023350 | 3300031731 | Bacteria | 3514 |
| 320 | Ga0307413_10002907 | 3300031824 | Bacteria | 7075 |
| 321 | Ga0307410_10147192 | 3300031852 | Bacteria | 1749 |
| 322 | Ga0307406_10029965 | 3300031901 | Bacteria | 3299 |
| 323 | Ga0307406_10035642 | 3300031901 | Bacteria | 3061 |
| 324 | Ga0307407_10071720 | 3300031903 | Bacteria | 2063 |
| 325 | Ga0307407_10098091 | 3300031903 | Bacteria | 1812 |
| 326 | Ga0307412_10011757 | 3300031911 | Bacteria | 5078 |
| 327 | Ga0307412_10018113 | 3300031911 | Bacteria | 4230 |
| 328 | Ga0307409_100005475 | 3300031995 | Bacteria | 7317 |
| 329 | Ga0307409_100013579 | 3300031995 | Bacteria | 5251 |
| 330 | Ga0307409_100035392 | 3300031995 | Bacteria | 3659 |
| 331 | Ga0307409_100100282 | 3300031995 | Bacteria | 2400 |
| 332 | Ga0307409_100331747 | 3300031995 | Bacteria | 1428 |
| 333 | Ga0307416_100004971 | 3300032002 | Bacteria | 8107 |
| 334 | Ga0307416_100026141 | 3300032002 | Bacteria | 4295 |
| 335 | Ga0307416_100030587 | 3300032002 | Bacteria | 4042 |
| 336 | Ga0307416_100079841 | 3300032002 | Bacteria | 2759 |
| 337 | Ga0307416_100568313 | 3300032002 | Bacteria | 1209 |
| 338 | Ga0307414_10004147 | 3300032004 | Bacteria | 7825 |
| 339 | Ga0307415_100003101 | 3300032126 | Bacteria | 8402 |
| 340 | Ga0307415_100026172 | 3300032126 | Bacteria | 3675 |
| 341 | Ga0307415_100037326 | 3300032126 | Bacteria | 3192 |
| 342 | Ga0307415_100120944 | 3300032126 | Bacteria | 1963 |
| 343 | Ga0307415_100155532 | 3300032126 | Bacteria | 1765 |
| 344 | Ga0307415_100489833 | 3300032126 | Bacteria | 1072 |
| 345 | Ga0373961_0077526 | 3300035241 | Bacteria | 1040 |
| 346 | Ga0373935_0527004 | 3300035692 | Bacteria | 860 |
| 347 | Ga0373947_0065875 | 3300035725 | Bacteria | 2210 |
| 348 | Ga0373947_0325754 | 3300035725 | Bacteria | 1028 |
| 349 | Ga0373925_0309906 | 3300037068 | Bacteria | 1276 |
| 350 | Ga0395899_0001679 | 3300037312 | Bacteria | 18454 |
| 351 | Ga0395899_0020651 | 3300037312 | Bacteria | 4993 |
| 352 | Ga0395899_0047484 | 3300037312 | Bacteria | 3197 |
| 353 | Ga0395899_0091558 | 3300037312 | Bacteria | 2203 |
| 354 | Ga0395899_0146651 | 3300037312 | Bacteria | 1675 |
| 355 | Ga0395900_0001628 | 3300037418 | Bacteria | 26393 |
| 356 | Ga0395900_0016846 | 3300037418 | Bacteria | 7456 |
| 357 | Ga0395900_0017898 | 3300037418 | Bacteria | 7232 |
| 358 | Ga0395900_0057834 | 3300037418 | Bacteria | 3992 |
| 359 | Ga0395900_0126221 | 3300037418 | Bacteria | 2624 |
| 360 | Ga0395900_0188962 | 3300037418 | Bacteria | 2090 |
| 361 | Ga0395900_0240753 | 3300037418 | Bacteria | 1815 |
| 362 | Ga0395900_0393318 | 3300037418 | Bacteria | 1352 |
| 363 | Ga0395900_0440644 | 3300037418 | Bacteria | 1260 |
| 364 | Ga0395900_0467355 | 3300037418 | Bacteria | 1215 |
| 365 | Ga0395898_0006200 | 3300037466 | Bacteria | 12811 |
| 366 | Ga0395898_0012345 | 3300037466 | Bacteria | 8835 |
| 367 | Ga0395898_0023126 | 3300037466 | Bacteria | 6284 |
| 368 | Ga0395898_0031702 | 3300037466 | Bacteria | 5279 |
| 369 | Ga0395898_0040359 | 3300037466 | Bacteria | 4615 |
| 370 | Ga0395898_0044736 | 3300037466 | Bacteria | 4355 |
| 371 | Ga0395898_0184930 | 3300037466 | Bacteria | 1991 |
| 372 | Ga0395898_0476738 | 3300037466 | Bacteria | 1187 |
| 373 | Ga0395905_0005468 | 3300037471 | Bacteria | 12955 |
| 374 | Ga0395905_0023211 | 3300037471 | Bacteria | 5863 |
| 375 | Ga0395905_0027457 | 3300037471 | Bacteria | 5368 |
| 376 | Ga0395905_0028629 | 3300037471 | Bacteria | 5252 |
| 377 | Ga0395905_0081164 | 3300037471 | Bacteria | 3039 |
| 378 | Ga0395905_0093556 | 3300037471 | Bacteria | 2819 |
| 379 | Ga0395905_0274727 | 3300037471 | Bacteria | 1571 |
| 380 | Ga0395905_0328194 | 3300037471 | Bacteria | 1420 |
| 381 | Ga0395905_0431085 | 3300037471 | Bacteria | 1215 |
| 382 | Ga0395901_0010498 | 3300038443 | Bacteria | 9381 |
| 383 | Ga0395901_0010987 | 3300038443 | Bacteria | 9175 |
| 384 | Ga0395901_0021193 | 3300038443 | Bacteria | 6656 |
| 385 | Ga0395901_0041876 | 3300038443 | Bacteria | 4747 |
| 386 | Ga0395901_0042749 | 3300038443 | Bacteria | 4699 |
| 387 | Ga0395901_0068280 | 3300038443 | Bacteria | 3703 |
| 388 | Ga0395901_0070030 | 3300038443 | Bacteria | 3654 |
| 389 | Ga0395901_0108037 | 3300038443 | Bacteria | 2921 |
| 390 | Ga0395901_0272576 | 3300038443 | Bacteria | 1760 |
| 391 | Ga0395901_0602362 | 3300038443 | Bacteria | 1108 |
| 392 | Ga0439439_0000324 | 3300041406 | Bacteria | 7700 |
| 393 | Ga0439431_0003239 | 3300041997 | Bacteria | 3583 |
| 394 | Ga0439433_0005743 | 3300041999 | Bacteria | 2667 |
| 395 | Ga0439445_0061401 | 3300042004 | Bacteria | 1028 |
| 396 | Ga0439448_0016986 | 3300042005 | Bacteria | 2219 |
| 397 | Ga0439448_0043069 | 3300042005 | Bacteria | 1465 |
| 398 | Ga0439454_001491 | 3300042011 | Bacteria | 2268 |
| 399 | Ga0439462_0000935 | 3300042015 | Bacteria | 6187 |
| 400 | Ga0450920_003533 | 3300042122 | Bacteria | 2713 |
| 401 | Ga0450920_011999 | 3300042122 | Bacteria | 1620 |
| 402 | Ga0439446_0003427 | 3300042156 | Bacteria | 3937 |
| 403 | Ga0439446_0021212 | 3300042156 | Bacteria | 1835 |
| 404 | Ga0439434_0000881 | 3300042435 | Bacteria | 8649 |
| 405 | Ga0466966_0005140 | 3300044684 | Bacteria | 8594 |
| 406 | Ga0466961_0006294 | 3300044693 | Bacteria | 7539 |
| 407 | Ga0466963_0009653 | 3300044694 | Bacteria | 5817 |
| 408 | Ga0466963_0015729 | 3300044694 | Bacteria | 4693 |
| 409 | Ga0466963_0089116 | 3300044694 | Bacteria | 2098 |
| 410 | Ga0466963_0153960 | 3300044694 | Bacteria | 1597 |
| 411 | Ga0466964_0001756 | 3300044706 | Bacteria | 7506 |
| 412 | Ga0466964_0038949 | 3300044706 | Bacteria | 1913 |
| 413 | Ga0466971_0002202 | 3300044719 | Bacteria | 8243 |
| 414 | Ga0466971_0057445 | 3300044719 | Bacteria | 1755 |
| 415 | Ga0466970_0229409 | 3300044765 | Bacteria | 1037 |
| 416 | Ga0466957_0000754 | 3300044842 | Bacteria | 16506 |
| 417 | Ga0466957_0086634 | 3300044842 | Bacteria | 1957 |
| 418 | Ga0466959_0020685 | 3300045049 | Bacteria | 4849 |
| 419 | Ga0466959_0065359 | 3300045049 | Bacteria | 2639 |
| 420 | Ga0451576_0263567 | 3300045051 | Bacteria | 1801 |
| 421 | Ga0466958_0001639 | 3300045836 | Bacteria | 10781 |
| 422 | Ga0466958_0003880 | 3300045836 | Bacteria | 7824 |
| 423 | Ga0466958_0064370 | 3300045836 | Bacteria | 2236 |
| 424 | Ga0466967_0002391 | 3300045976 | Bacteria | 11639 |
| 425 | Ga0466967_0007771 | 3300045976 | Bacteria | 7781 |
| 426 | Ga0466967_0023848 | 3300045976 | Bacteria | 5021 |
| 427 | Ga0466967_0056463 | 3300045976 | Bacteria | 3462 |
| 428 | Ga0466967_0069795 | 3300045976 | Bacteria | 3141 |
| 429 | Ga0466967_0106534 | 3300045976 | Bacteria | 2570 |
| 430 | Ga0495627_067801 | 3300046453 | Bacteria | 1046 |
| 431 | Ga0495603_0012937 | 3300046455 | Bacteria | 5046 |
| 432 | Ga0495629_0006407 | 3300046459 | Bacteria | 8725 |
| 433 | Ga0495582_0064021 | 3300046473 | Bacteria | 2030 |
| 434 | Ga0495605_0043533 | 3300046474 | Bacteria | 2225 |
| 435 | Ga0495605_0061806 | 3300046474 | Bacteria | 1791 |
| 436 | Ga0495584_0074336 | 3300046491 | Bacteria | 1708 |
| 437 | Ga0495585_0067070 | 3300046492 | Bacteria | 1964 |
| 438 | Ga0495596_0033161 | 3300046500 | Bacteria | 2055 |
| 439 | Ga0495596_0053029 | 3300046500 | Bacteria | 1587 |
| 440 | Ga0495608_0104607 | 3300046511 | Bacteria | 1823 |
| 441 | Ga0495616_0077768 | 3300046513 | Bacteria | 1592 |
| 442 | Ga0495637_0045743 | 3300046520 | Bacteria | 1854 |
| 443 | Ga0495644_0017662 | 3300046523 | Bacteria | 2726 |
| 444 | Ga0495609_0024905 | 3300046538 | Bacteria | 2744 |
| 445 | Ga0495621_0055161 | 3300046539 | Bacteria | 1430 |
| 446 | Ga0495597_0052855 | 3300046542 | Bacteria | 1788 |
| 447 | Ga0495667_0008766 | 3300046559 | Bacteria | 6875 |
| 448 | Ga0495656_0120355 | 3300046615 | Bacteria | 1238 |
| 449 | Ga0495656_0148322 | 3300046615 | Bacteria | 1131 |
| 450 | Ga0495635_0064332 | 3300046663 | Bacteria | 2518 |
| 451 | Ga0495659_0015159 | 3300046664 | Bacteria | 2532 |
| 452 | Ga0495669_0028021 | 3300046684 | Bacteria | 2465 |
| 453 | Ga0495624_0012722 | 3300046690 | Bacteria | 5747 |
| 454 | Ga0495670_0159815 | 3300046691 | Bacteria | 1183 |
| 455 | Ga0495670_0187363 | 3300046691 | Bacteria | 1094 |
| 456 | Ga0495671_0051766 | 3300046692 | Bacteria | 2042 |
| 457 | Ga0495589_0033852 | 3300046794 | Bacteria | 2565 |
| 458 | Ga0495589_0091245 | 3300046794 | Bacteria | 1479 |
| 459 | Ga0495589_0098504 | 3300046794 | Bacteria | 1416 |
| 460 | Ga0495636_0052264 | 3300047318 | Bacteria | 1714 |
| 461 | Ga0495636_0142423 | 3300047318 | Bacteria | 1071 |
| 462 | Ga0495674_0101302 | 3300047319 | Bacteria | 2450 |
| 463 | Ga0495676_0041758 | 3300047321 | Bacteria | 3772 |
| 464 | Ga0495680_0135483 | 3300047322 | Bacteria | 1806 |
| 465 | Ga0495602_0126372 | 3300048088 | Bacteria | 2048 |
| 466 | Ga0496100_0031099 | 3300048903 | Bacteria | 3316 |
| 467 | Ga0496101_0009361 | 3300048904 | Bacteria | 6438 |
| 468 | Ga0496101_0059488 | 3300048904 | Bacteria | 2769 |
| 469 | Ga0496102_0052856 | 3300048905 | Bacteria | 3702 |
| 470 | Ga0496103_0074092 | 3300048906 | Bacteria | 2134 |
| 471 | Ga0496103_0385623 | 3300048906 | Bacteria | 900 |
| 472 | Ga0496104_0049709 | 3300048907 | Bacteria | 3954 |
| 473 | Ga0496104_0176985 | 3300048907 | Bacteria | 2043 |
| 474 | Ga0496104_0186260 | 3300048907 | Bacteria | 1986 |
| 475 | Ga0496104_0379951 | 3300048907 | Bacteria | 1325 |
| 476 | Ga0496105_0011842 | 3300048908 | Bacteria | 6908 |
| 477 | Ga0496105_0077915 | 3300048908 | Bacteria | 2737 |
| 478 | Ga0496106_0014236 | 3300048909 | Bacteria | 5875 |
| 479 | Ga0496106_0019291 | 3300048909 | Bacteria | 5056 |
| 480 | Ga0496107_0011610 | 3300048910 | Bacteria | 6140 |
| 481 | Ga0496107_0018577 | 3300048910 | Bacteria | 4896 |
| 482 | Ga0496107_0086891 | 3300048910 | Bacteria | 2283 |
| 483 | Ga0496108_0043021 | 3300048911 | Bacteria | 3772 |
| 484 | Ga0496108_0051137 | 3300048911 | Bacteria | 3461 |
| 485 | Ga0496108_0073363 | 3300048911 | Bacteria | 2889 |
| 486 | Ga0496108_0198991 | 3300048911 | Bacteria | 1738 |
| 487 | Ga0496108_0293300 | 3300048911 | Bacteria | 1416 |
| 488 | Ga0496109_0002221 | 3300048912 | Bacteria | 16107 |
| 489 | Ga0496109_0008378 | 3300048912 | Bacteria | 8786 |
| 490 | Ga0496109_0031644 | 3300048912 | Bacteria | 4750 |
| 491 | Ga0496109_0036794 | 3300048912 | Bacteria | 4419 |
| 492 | Ga0496109_0055509 | 3300048912 | Bacteria | 3614 |
| 493 | Ga0496109_0063320 | 3300048912 | Bacteria | 3383 |
| 494 | Ga0496109_0082832 | 3300048912 | Bacteria | 2957 |
| 495 | Ga0496109_0121340 | 3300048912 | Bacteria | 2435 |
| 496 | Ga0496109_0268462 | 3300048912 | Bacteria | 1607 |
| 497 | Ga0496109_0329775 | 3300048912 | Bacteria | 1441 |
| 498 | Ga0496109_0683647 | 3300048912 | Bacteria | 963 |
| 499 | Ga0496110_0004037 | 3300048913 | Bacteria | 11323 |
| 500 | Ga0496110_0011195 | 3300048913 | Bacteria | 7333 |
| 501 | Ga0496110_0208990 | 3300048913 | Bacteria | 1774 |
| 502 | Ga0496110_0600766 | 3300048913 | Bacteria | 998 |
| 503 | Ga0496111_0000824 | 3300048914 | Bacteria | 16675 |
| 504 | Ga0496111_0008806 | 3300048914 | Bacteria | 6702 |
| 505 | Ga0496111_0052495 | 3300048914 | Bacteria | 2944 |
| 506 | Ga0496111_0235760 | 3300048914 | Bacteria | 1359 |
| 507 | Ga0496112_0001675 | 3300048915 | Bacteria | 17236 |
| 508 | Ga0496112_0009275 | 3300048915 | Bacteria | 8848 |
| 509 | Ga0496112_0015156 | 3300048915 | Bacteria | 7183 |
| 510 | Ga0496112_0019842 | 3300048915 | Bacteria | 6359 |
| 511 | Ga0496112_0027905 | 3300048915 | Bacteria | 5446 |
| 512 | Ga0496112_0067074 | 3300048915 | Bacteria | 3541 |
| 513 | Ga0496112_0071688 | 3300048915 | Bacteria | 3424 |
| 514 | Ga0496112_0115777 | 3300048915 | Bacteria | 2651 |
| 515 | Ga0496113_0087138 | 3300048916 | Bacteria | 2400 |
| 516 | Ga0496113_0140515 | 3300048916 | Bacteria | 1900 |
| 517 | Ga0496113_0145811 | 3300048916 | Bacteria | 1865 |
| 518 | Ga0496113_0270344 | 3300048916 | Bacteria | 1358 |
| 519 | Ga0496113_0429963 | 3300048916 | Bacteria | 1061 |
| 520 | Ga0496114_0031356 | 3300048917 | Bacteria | 4375 |
| 521 | Ga0496114_0033380 | 3300048917 | Bacteria | 4240 |
| 522 | Ga0496114_0034934 | 3300048917 | Bacteria | 4151 |
| 523 | Ga0496114_0100927 | 3300048917 | Bacteria | 2463 |
| 524 | Ga0496115_0031739 | 3300048918 | Bacteria | 4164 |
| 525 | Ga0496115_0054705 | 3300048918 | Bacteria | 3205 |
| 526 | Ga0496115_0349802 | 3300048918 | Bacteria | 1205 |
| 527 | Ga0496126_0333517 | 3300048929 | Bacteria | 1244 |
| 528 | Ga0501031_0000832 | 3300049568 | Bacteria | 18550 |
| 529 | Ga0501031_0002581 | 3300049568 | Bacteria | 11548 |
| 530 | Ga0501031_0010148 | 3300049568 | Bacteria | 6138 |
| 531 | Ga0501031_0024755 | 3300049568 | Bacteria | 3913 |
| 532 | Ga0501031_0060441 | 3300049568 | Bacteria | 2469 |
| 533 | Ga0501032_0003012 | 3300049569 | Bacteria | 13070 |
| 534 | Ga0501032_0004821 | 3300049569 | Bacteria | 10113 |
| 535 | Ga0501032_0015255 | 3300049569 | Bacteria | 5425 |
| 536 | Ga0501032_0068648 | 3300049569 | Bacteria | 2366 |
| 537 | Ga0501033_0008322 | 3300049570 | Bacteria | 8033 |
| 538 | Ga0501033_0019161 | 3300049570 | Bacteria | 5174 |
| 539 | Ga0501033_0082845 | 3300049570 | Bacteria | 2352 |
| 540 | Ga0501033_0099756 | 3300049570 | Bacteria | 2120 |
| 541 | Ga0501034_0016584 | 3300049571 | Bacteria | 7553 |
| 542 | Ga0501034_0446826 | 3300049571 | Bacteria | 1211 |
| 543 | Ga0501036_0011147 | 3300049572 | Bacteria | 7437 |
| 544 | Ga0501036_0039939 | 3300049572 | Bacteria | 3969 |
| 545 | Ga0501036_0040273 | 3300049572 | Bacteria | 3951 |
| 546 | Ga0501036_0071944 | 3300049572 | Bacteria | 2923 |
| 547 | Ga0501036_0202961 | 3300049572 | Bacteria | 1667 |
| 548 | Ga0501037_0061603 | 3300049573 | Bacteria | 2736 |
| 549 | Ga0501037_0234306 | 3300049573 | Bacteria | 1288 |
| 550 | Ga0501037_0446587 | 3300049573 | Bacteria | 882 |
| 551 | Ga0501038_0029025 | 3300049574 | Bacteria | 4907 |
| 552 | Ga0501038_0030565 | 3300049574 | Bacteria | 4764 |
| 553 | Ga0501038_0061211 | 3300049574 | Bacteria | 3220 |
| 554 | Ga0501038_0152740 | 3300049574 | Bacteria | 1881 |
| 555 | Ga0501039_0011875 | 3300049575 | Bacteria | 6636 |
| 556 | Ga0501039_0016896 | 3300049575 | Bacteria | 5593 |
| 557 | Ga0501039_0025338 | 3300049575 | Bacteria | 4556 |
| 558 | Ga0501039_0098625 | 3300049575 | Bacteria | 2279 |
| 559 | Ga0501039_0184098 | 3300049575 | Bacteria | 1642 |
| 560 | Ga0501039_0518667 | 3300049575 | Bacteria | 936 |
| 561 | Ga0501040_0003292 | 3300049576 | Bacteria | 10438 |
| 562 | Ga0501040_0004645 | 3300049576 | Bacteria | 8912 |
| 563 | Ga0501040_0007624 | 3300049576 | Bacteria | 7003 |
| 564 | Ga0501040_0009929 | 3300049576 | Bacteria | 6213 |
| 565 | Ga0501040_0031191 | 3300049576 | Bacteria | 3600 |
| 566 | Ga0501041_0001695 | 3300049577 | Bacteria | 12343 |
| 567 | Ga0501041_0002401 | 3300049577 | Bacteria | 10605 |
| 568 | Ga0501041_0003218 | 3300049577 | Bacteria | 9385 |
| 569 | Ga0501041_0031049 | 3300049577 | Bacteria | 3225 |
| 570 | Ga0501042_0002670 | 3300049578 | Bacteria | 10981 |
| 571 | Ga0501042_0012582 | 3300049578 | Bacteria | 5736 |
| 572 | Ga0501042_0017861 | 3300049578 | Bacteria | 4901 |
| 573 | Ga0501042_0038873 | 3300049578 | Bacteria | 3379 |
| 574 | Ga0501042_0066038 | 3300049578 | Bacteria | 2585 |
| 575 | Ga0501042_0077145 | 3300049578 | Bacteria | 2386 |
| 576 | Ga0501042_0109930 | 3300049578 | Bacteria | 1985 |
| 577 | Ga0501042_0120495 | 3300049578 | Bacteria | 1889 |
| 578 | Ga0501042_0242033 | 3300049578 | Bacteria | 1302 |
| 579 | Ga0501043_0057252 | 3300049579 | Bacteria | 3061 |
| 580 | Ga0501043_0103397 | 3300049579 | Bacteria | 2238 |
| 581 | Ga0501043_0183536 | 3300049579 | Bacteria | 1630 |
| 582 | Ga0501046_0008549 | 3300049580 | Bacteria | 8907 |
| 583 | Ga0501046_0015517 | 3300049580 | Bacteria | 6399 |
| 584 | Ga0501046_0020855 | 3300049580 | Bacteria | 5411 |
| 585 | Ga0501046_0045256 | 3300049580 | Bacteria | 3497 |
| 586 | Ga0501046_0151552 | 3300049580 | Bacteria | 1749 |
| 587 | Ga0501046_0215248 | 3300049580 | Bacteria | 1425 |
| 588 | Ga0501046_0325659 | 3300049580 | Bacteria | 1119 |
| 589 | Ga0501047_0009994 | 3300049581 | Bacteria | 8969 |
| 590 | Ga0501047_0197770 | 3300049581 | Bacteria | 1872 |
| 591 | Ga0501047_0322422 | 3300049581 | Bacteria | 1384 |
| 592 | Ga0501048_0002505 | 3300049582 | Bacteria | 14022 |
| 593 | Ga0501048_0009685 | 3300049582 | Bacteria | 7229 |
| 594 | Ga0501048_0021408 | 3300049582 | Bacteria | 4734 |
| 595 | Ga0501048_0029677 | 3300049582 | Bacteria | 3964 |
| 596 | Ga0501048_0281120 | 3300049582 | Bacteria | 1183 |
| 597 | Ga0501067_0004534 | 3300049583 | Bacteria | 7675 |
| 598 | Ga0501067_0015495 | 3300049583 | Bacteria | 4219 |
| 599 | Ga0501067_0048797 | 3300049583 | Bacteria | 2347 |
| 600 | Ga0501068_0007900 | 3300049584 | Bacteria | 5895 |
| 601 | Ga0501068_0021534 | 3300049584 | Bacteria | 3764 |
| 602 | Ga0501068_0024896 | 3300049584 | Bacteria | 3517 |
| 603 | Ga0501068_0046423 | 3300049584 | Bacteria | 2619 |
| 604 | Ga0501068_0093873 | 3300049584 | Bacteria | 1854 |
| 605 | Ga0501068_0246956 | 3300049584 | Bacteria | 1137 |
| 606 | Ga0501069_0009643 | 3300049585 | Bacteria | 5100 |
| 607 | Ga0501069_0042134 | 3300049585 | Bacteria | 2524 |
| 608 | Ga0501069_0044061 | 3300049585 | Bacteria | 2470 |
| 609 | Ga0501069_0081128 | 3300049585 | Bacteria | 1827 |
| 610 | Ga0501069_0091203 | 3300049585 | Bacteria | 1723 |
| 611 | Ga0501070_0006594 | 3300049586 | Bacteria | 9881 |
| 612 | Ga0501070_0019679 | 3300049586 | Bacteria | 5660 |
| 613 | Ga0501070_0129120 | 3300049586 | Bacteria | 2088 |
| 614 | Ga0501070_0170788 | 3300049586 | Bacteria | 1791 |
| 615 | Ga0501070_0258247 | 3300049586 | Bacteria | 1424 |
| 616 | Ga0501071_0003528 | 3300049587 | Bacteria | 9785 |
| 617 | Ga0501071_0004822 | 3300049587 | Bacteria | 8594 |
| 618 | Ga0501071_0008231 | 3300049587 | Bacteria | 6883 |
| 619 | Ga0501071_0013150 | 3300049587 | Bacteria | 5634 |
| 620 | Ga0501071_0014537 | 3300049587 | Bacteria | 5384 |
| 621 | Ga0501071_0031849 | 3300049587 | Bacteria | 3741 |
| 622 | Ga0501071_0124690 | 3300049587 | Bacteria | 1911 |
| 623 | Ga0501071_0146468 | 3300049587 | Bacteria | 1760 |
| 624 | Ga0501071_0189969 | 3300049587 | Bacteria | 1540 |
| 625 | Ga0501071_0190810 | 3300049587 | Bacteria | 1537 |
| 626 | Ga0501072_0001066 | 3300049588 | Bacteria | 20333 |
| 627 | Ga0501072_0002265 | 3300049588 | Bacteria | 14378 |
| 628 | Ga0501072_0002299 | 3300049588 | Bacteria | 14308 |
| 629 | Ga0501072_0015827 | 3300049588 | Bacteria | 5783 |
| 630 | Ga0501072_0023202 | 3300049588 | Bacteria | 4818 |
| 631 | Ga0501072_0024807 | 3300049588 | Bacteria | 4667 |
| 632 | Ga0501072_0155273 | 3300049588 | Bacteria | 1825 |
| 633 | Ga0501072_0208438 | 3300049588 | Bacteria | 1558 |
| 634 | Ga0501072_0413693 | 3300049588 | Bacteria | 1069 |
| 635 | Ga0501073_0027965 | 3300049589 | Bacteria | 4029 |
| 636 | Ga0501073_0070141 | 3300049589 | Bacteria | 2441 |
| 637 | Ga0501073_0153019 | 3300049589 | Bacteria | 1598 |
| 638 | Ga0501073_0259729 | 3300049589 | Bacteria | 1199 |
| 639 | Ga0501074_0003905 | 3300049590 | Bacteria | 10619 |
| 640 | Ga0501074_0011285 | 3300049590 | Bacteria | 6496 |
| 641 | Ga0501074_0015985 | 3300049590 | Bacteria | 5456 |
| 642 | Ga0501074_0041143 | 3300049590 | Bacteria | 3346 |
| 643 | Ga0501074_0042915 | 3300049590 | Bacteria | 3272 |
| 644 | Ga0501074_0060013 | 3300049590 | Bacteria | 2739 |
| 645 | Ga0501074_0099215 | 3300049590 | Bacteria | 2085 |
| 646 | Ga0501075_0001873 | 3300049591 | Bacteria | 13873 |
| 647 | Ga0501075_0017343 | 3300049591 | Bacteria | 5201 |
| 648 | Ga0501075_0045433 | 3300049591 | Bacteria | 3297 |
| 649 | Ga0501075_0054096 | 3300049591 | Bacteria | 3019 |
| 650 | Ga0501075_0073731 | 3300049591 | Bacteria | 2581 |
| 651 | Ga0501075_0091127 | 3300049591 | Bacteria | 2313 |
| 652 | Ga0501075_0092480 | 3300049591 | Bacteria | 2295 |
| 653 | Ga0501076_0004761 | 3300049592 | Bacteria | 9687 |
| 654 | Ga0501076_0013276 | 3300049592 | Bacteria | 6176 |
| 655 | Ga0501076_0014742 | 3300049592 | Bacteria | 5892 |
| 656 | Ga0501076_0038594 | 3300049592 | Bacteria | 3749 |
| 657 | Ga0501076_0066873 | 3300049592 | Bacteria | 2869 |
| 658 | Ga0501076_0319172 | 3300049592 | Bacteria | 1274 |
| 659 | Ga0501077_0001089 | 3300049593 | Bacteria | 16389 |
| 660 | Ga0501077_0011616 | 3300049593 | Bacteria | 5503 |
| 661 | Ga0501077_0012933 | 3300049593 | Bacteria | 5228 |
| 662 | Ga0501077_0016400 | 3300049593 | Bacteria | 4667 |
| 663 | Ga0501077_0039656 | 3300049593 | Bacteria | 3000 |
| 664 | Ga0501077_0139903 | 3300049593 | Bacteria | 1535 |
| 665 | Ga0501079_0012620 | 3300049741 | Bacteria | 6452 |
| 666 | Ga0501079_0013507 | 3300049741 | Bacteria | 6227 |
| 667 | Ga0501079_0013931 | 3300049741 | Bacteria | 6133 |
| 668 | Ga0501079_0028370 | 3300049741 | Bacteria | 4294 |
| 669 | Ga0501079_0046197 | 3300049741 | Bacteria | 3360 |
| 670 | Ga0501079_0059749 | 3300049741 | Bacteria | 2940 |
| 671 | Ga0501079_0101629 | 3300049741 | Bacteria | 2230 |
| 672 | Ga0501079_0346795 | 3300049741 | Bacteria | 1163 |
| 673 | Ga0501080_0001603 | 3300049742 | Bacteria | 19211 |
| 674 | Ga0501080_0003038 | 3300049742 | Bacteria | 14805 |
| 675 | Ga0501080_0004070 | 3300049742 | Bacteria | 12952 |
| 676 | Ga0501080_0016655 | 3300049742 | Bacteria | 6787 |
| 677 | Ga0501080_0052676 | 3300049742 | Bacteria | 3788 |
| 678 | Ga0501081_0007719 | 3300049743 | Bacteria | 6974 |
| 679 | Ga0501081_0025425 | 3300049743 | Bacteria | 3982 |
| 680 | Ga0501081_0027760 | 3300049743 | Bacteria | 3816 |
| 681 | Ga0501081_0030696 | 3300049743 | Bacteria | 3639 |
| 682 | Ga0501081_0060253 | 3300049743 | Bacteria | 2629 |
| 683 | Ga0501081_0152541 | 3300049743 | Bacteria | 1660 |
| 684 | Ga0501083_0010652 | 3300049744 | Bacteria | 6471 |
| 685 | Ga0501083_0039233 | 3300049744 | Bacteria | 3216 |
| 686 | Ga0501083_0258388 | 3300049744 | Bacteria | 1133 |
| 687 | Ga0501035_0007049 | 3300049822 | Bacteria | 10505 |
| 688 | Ga0501035_0009480 | 3300049822 | Bacteria | 9051 |
| 689 | Ga0501035_0012183 | 3300049822 | Bacteria | 7954 |
| 690 | Ga0501035_0253023 | 3300049822 | Bacteria | 1495 |
| 691 | Ga0501045_0001162 | 3300049824 | Bacteria | 17444 |
| 692 | Ga0501045_0016546 | 3300049824 | Bacteria | 5239 |
| 693 | Ga0501045_0077740 | 3300049824 | Bacteria | 2446 |
| 694 | Ga0501045_0086705 | 3300049824 | Bacteria | 2311 |
| 695 | Ga0501045_0329927 | 3300049824 | Bacteria | 1135 |
| 696 | nmdc:mga0yw44_168950_c1 | 3300050492 | Bacteria | 1435 |
| 697 | nmdc:mga0yw44_338766_c1 | 3300050492 | Bacteria | 1011 |
| 698 | nmdc:mga0yw44_470542_c1 | 3300050492 | Bacteria | 852 |
| 699 | nmdc:mga05p37_23439_c1 | 3300050507 | Bacteria | 7489 |
| 700 | nmdc:mga05p37_253283_c1 | 3300050507 | Bacteria | 2111 |
| 701 | nmdc:mga05p37_432896_c1 | 3300050507 | Bacteria | 1528 |
| 702 | nmdc:mga05p37_46011_c1 | 3300050507 | Bacteria | 5367 |
| 703 | nmdc:mga05p37_462233_c1 | 3300050507 | Bacteria | 1466 |
| 704 | nmdc:mga05p37_68939_c1 | 3300050507 | Bacteria | 4349 |
| 705 | nmdc:mga05p37_89359_c1 | 3300050507 | Bacteria | 3796 |
| 706 | nmdc:mga09592_209349_c1 | 3300050508 | Bacteria | 1689 |
| 707 | nmdc:mga09592_89406_c1 | 3300050508 | Bacteria | 2630 |
| 708 | nmdc:mga0qj67_213410_c1 | 3300050509 | Bacteria | 1567 |
| 709 | nmdc:mga0qj67_253768_c1 | 3300050509 | Bacteria | 1427 |
| 710 | nmdc:mga0qj67_274860_c1 | 3300050509 | Bacteria | 1366 |
| 711 | nmdc:mga06r32_8037_c1 | 3300050510 | Bacteria | 9491 |
| 712 | nmdc:mga08y16_10476_c1 | 3300050511 | Bacteria | 3300 |
| 713 | nmdc:mga08y16_128893_c1 | 3300050511 | Bacteria | 2632 |
| 714 | nmdc:mga08y16_20499_c1 | 3300050511 | Bacteria | 6979 |
| 715 | nmdc:mga08y16_26697_c1 | 3300050511 | Bacteria | 6086 |
| 716 | nmdc:mga08y16_644295_c1 | 3300050511 | Bacteria | 1064 |
| 717 | nmdc:mga0n895_23756_c1 | 3300050512 | Bacteria | 5767 |
| 718 | nmdc:mga08x19_300935_c1 | 3300050514 | Bacteria | 1114 |
| 719 | nmdc:mga0a205_221590_c1 | 3300050515 | Bacteria | 1777 |
| 720 | Ga0495655_0000857 | 3300053083 | Bacteria | 4737 |
| 721 | Ga0495595_0007334 | 3300053084 | Bacteria | 4515 |
| 722 | Ga0501084_0008934 | 3300054114 | Bacteria | 8289 |
| 723 | Ga0501084_0011484 | 3300054114 | Bacteria | 7333 |
| 724 | Ga0501084_0020621 | 3300054114 | Bacteria | 5496 |
| 725 | Ga0501084_0038224 | 3300054114 | Bacteria | 4012 |
| 726 | Ga0501084_0057040 | 3300054114 | Bacteria | 3268 |
| 727 | Ga0501084_0070638 | 3300054114 | Bacteria | 2923 |
| 728 | Ga0501084_0142590 | 3300054114 | Bacteria | 2018 |
| 729 | Ga0501084_0267210 | 3300054114 | Bacteria | 1444 |
| 730 | Ga0501084_0431237 | 3300054114 | Bacteria | 1114 |
| 731 | Ga0590071_017864 | 3300059421 | Bacteria | 1667 |
| 732 | Ga0590071_021833 | 3300059421 | Bacteria | 1510 |
| 733 | Ga0590075_021078 | 3300059424 | Bacteria | 1624 |
| 734 | Ga0590077_002602 | 3300059426 | Bacteria | 3826 |
| 735 | Ga0590077_007418 | 3300059426 | Bacteria | 2243 |
| 736 | Ga0587088_005931 | 3300059508 | Bacteria | 1627 |
| 737 | Ga0587075_008329 | 3300059644 | Bacteria | 1323 |
| 738 | Ga0501082_0003454 | 3300060353 | Bacteria | 13790 |
| 739 | Ga0501082_0009809 | 3300060353 | Bacteria | 8251 |
| 740 | Ga0501082_0044644 | 3300060353 | Bacteria | 3822 |
| 741 | Ga0501082_0052950 | 3300060353 | Bacteria | 3499 |
| 742 | Ga0501082_0073725 | 3300060353 | Bacteria | 2939 |
| 743 | Ga0501082_0102434 | 3300060353 | Bacteria | 2476 |
| 744 | Ga0501082_0131466 | 3300060353 | Bacteria | 2172 |
| 745 | Ga0501082_0330036 | 3300060353 | Bacteria | 1329 |
| 746 | Ga0501082_0342897 | 3300060353 | Bacteria | 1302 |
| 747 | Ga0501082_0589915 | 3300060353 | Bacteria | 972 |
| 748 | Ga0466962_0000292 | 3300061719 | Bacteria | 21309 |
| 749 | Ga0466962_0016359 | 3300061719 | Bacteria | 3576 |
| 750 | Ga0466962_0035966 | 3300061719 | Bacteria | 2370 |
| 751 | Ga0530510_0001723 | 3300061734 | Bacteria | 14867 |
| 752 | Ga0530510_0005093 | 3300061734 | Bacteria | 9065 |
| 753 | Ga0530510_0005462 | 3300061734 | Bacteria | 8797 |
| 754 | Ga0530510_0007712 | 3300061734 | Bacteria | 7496 |
| 755 | Ga0530510_0039419 | 3300061734 | Bacteria | 3410 |
| 756 | Ga0530510_0059379 | 3300061734 | Bacteria | 2766 |
| 757 | Ga0530510_0380236 | 3300061734 | Bacteria | 1063 |
| 758 | Ga0590075_002791 | |||
| 759 | JGI25406J46586_10007374 | |||
| 760 | JGI25406J46586_10018973 | |||
| 761 | JGI25407J50210_10000396 | |||
| 762 | Ga0058862_12757437 | |||
| 763 | Ga0070658_10021439 | |||
| 764 | Ga0070658_10105972 | |||
| 765 | Ga0070658_10111849 | |||
| 766 | Ga0070683_100008350 | |||
| 767 | Ga0070683_100157119 | |||
| 768 | Ga0070683_100257613 | |||
| 769 | Ga0070670_100007059 | |||
| 770 | Ga0068869_100126151 | |||
| 771 | Ga0068869_100242653 | |||
| 772 | Ga0070680_100025784 | |||
| 773 | Ga0070680_100061894 | |||
| 774 | Ga0070680_100065595 | |||
| 775 | Ga0070680_100254410 | |||
| 776 | Ga0070682_100153623 | |||
| 777 | Ga0068868_100041452 | |||
| 778 | Ga0068868_100144064 | |||
| 779 | Ga0068868_100205469 | |||
| 780 | Ga0070660_100004909 | |||
| 781 | Ga0070660_100005092 | |||
| 782 | Ga0070660_100011091 | |||
| 783 | Ga0070660_100061518 | |||
| 784 | Ga0070660_100144606 | |||
| 785 | Ga0070660_100353297 | |||
| 786 | Ga0070689_100133622 | |||
| 787 | Ga0070689_100152090 | |||
| 788 | Ga0070691_10183365 | |||
| 789 | Ga0070661_100035988 | |||
| 790 | Ga0070675_100109817 | |||
| 791 | Ga0070671_100303758 | |||
| 792 | Ga0070674_100017361 | |||
| 793 | Ga0070674_100072652 | |||
| 794 | Ga0070674_100295757 | |||
| 795 | Ga0070673_100092203 | |||
| 796 | Ga0070688_100068174 | |||
| 797 | Ga0070659_100188323 | |||
| 798 | Ga0070700_100014733 | |||
| 799 | Ga0070700_100015055 | |||
| 800 | Ga0070700_100023276 | |||
| 801 | Ga0070694_100238449 | |||
| 802 | Ga0070678_100010150 | |||
| 803 | Ga0070678_100149522 | |||
| 804 | Ga0070678_100164079 | |||
| 805 | Ga0070662_100078761 | |||
| 806 | Ga0070681_10022151 | |||
| 807 | Ga0070681_10023953 | |||
| 808 | Ga0070681_10090278 | |||
| 809 | Ga0070681_10091556 | |||
| 810 | Ga0070681_10127461 | |||
| 811 | Ga0068867_100064089 | |||
| 812 | Ga0068867_100186397 | |||
| 813 | Ga0068867_100319285 | |||
| 814 | Ga0068867_100388451 | |||
| 815 | Ga0070685_10056491 | |||
| 816 | Ga0070685_10161351 | |||
| 817 | Ga0070707_100134537 | |||
| 818 | Ga0070679_100053851 | |||
| 819 | Ga0070679_100159070 | |||
| 820 | Ga0070679_100226049 | |||
| 821 | Ga0070679_100249730 | |||
| 822 | Ga0070679_100307771 | |||
| 823 | Ga0070684_100001374 | |||
| 824 | Ga0070684_100012794 | |||
| 825 | Ga0070684_100068936 | |||
| 826 | Ga0070684_100090979 | |||
| 827 | Ga0068853_100099297 | |||
| 828 | Ga0070686_100075016 | |||
| 829 | Ga0070686_100095170 | |||
| 830 | Ga0070686_100141138 | |||
| 831 | Ga0070686_100300161 | |||
| 832 | Ga0070693_100038071 | |||
| 833 | Ga0070665_100088792 | |||
| 834 | Ga0070704_100372424 | |||
| 835 | Ga0068855_100062358 | |||
| 836 | Ga0068855_100364098 | |||
| 837 | Ga0070664_100024858 | |||
| 838 | Ga0070664_100138003 | |||
| 839 | Ga0068857_100005489 | |||
| 840 | Ga0068857_100024219 | |||
| 841 | Ga0068857_100211114 | |||
| 842 | Ga0068857_100565957 | |||
| 843 | Ga0068854_100171702 | |||
| 844 | Ga0068856_100101529 | |||
| 845 | Ga0068856_100142553 | |||
| 846 | Ga0068852_100253047 | |||
| 847 | Ga0068859_100188295 | |||
| 848 | Ga0068859_100226691 | |||
| 849 | Ga0068864_100177645 | |||
| 850 | Ga0068866_10049429 | |||
| 851 | Ga0068866_10262446 | |||
| 852 | Ga0068861_100119010 | |||
| 853 | Ga0068870_10016941 | |||
| 854 | Ga0068870_10061001 | |||
| 855 | Ga0068858_100112879 | |||
| 856 | Ga0068858_100182843 | |||
| 857 | Ga0068858_100243982 | |||
| 858 | Ga0081455_10005292 | |||
| 859 | Ga0081455_10076970 | |||
| 860 | Ga0081455_10131117 | |||
| 861 | Ga0081538_10001932 | |||
| 862 | Ga0081538_10004212 | |||
| 863 | Ga0081538_10013610 | |||
| 864 | Ga0081540_1017600 | |||
| 865 | Ga0081539_10000888 | |||
| 866 | Ga0081539_10001603 | |||
| 867 | Ga0081539_10002855 | |||
| 868 | Ga0081539_10008314 | |||
| 869 | Ga0081539_10009372 | |||
| 870 | Ga0075365_10089647 | |||
| 871 | Ga0075365_10121692 | |||
| 872 | Ga0075432_10047193 | |||
| 873 | Ga0070712_100274122 | |||
| 874 | Ga0097621_100180116 | |||
| 875 | Ga0068871_100078251 | |||
| 876 | Ga0068871_100199457 | |||
| 877 | Ga0068871_100298353 | |||
| 878 | Ga0068871_100428841 | |||
| 879 | Ga0075428_100018416 | |||
| 880 | Ga0075428_100021663 | |||
| 881 | Ga0075428_100348494 | |||
| 882 | Ga0075430_100021463 | |||
| 883 | Ga0075431_100009508 | |||
| 884 | Ga0075431_100037603 | |||
| 885 | Ga0075431_100108348 | |||
| 886 | Ga0075433_10355301 | |||
| 887 | Ga0075434_100438782 | |||
| 888 | Ga0075429_100065186 | |||
| 889 | Ga0075429_100196333 | |||
| 890 | Ga0075429_100198205 | |||
| 891 | Ga0075429_100223112 | |||
| 892 | Ga0068865_100007099 | |||
| 893 | Ga0068865_100311720 | |||
| 894 | Ga0097620_100188305 | |||
| 895 | Ga0097620_100226678 | |||
| 896 | Ga0075435_100059801 | |||
| 897 | Ga0105240_10443818 | |||
| 898 | Ga0111539_10001459 | |||
| 899 | Ga0111539_10009858 | |||
| 900 | Ga0111539_10037747 | |||
| 901 | Ga0111539_10291922 | |||
| 902 | Ga0111539_10324621 | |||
| 903 | Ga0111539_10809605 | |||
| 904 | Ga0105245_10004553 | |||
| 905 | Ga0105245_10026804 | |||
| 906 | Ga0105245_10044903 | |||
| 907 | Ga0105245_10054026 | |||
| 908 | Ga0105245_10341660 | |||
| 909 | Ga0105245_10389379 | |||
| 910 | Ga0105247_10217616 | |||
| 911 | Ga0105247_10273229 | |||
| 912 | Ga0114129_10028555 | |||
| 913 | Ga0114129_10066030 | |||
| 914 | Ga0114129_10068608 | |||
| 915 | Ga0114129_10103334 | |||
| 916 | Ga0114129_10238239 | |||
| 917 | Ga0114129_10249826 | |||
| 918 | Ga0114129_10503689 | |||
| 919 | Ga0105243_10001448 | |||
| 920 | Ga0105243_10063746 | |||
| 921 | Ga0105243_10116672 | |||
| 922 | Ga0105243_10370091 | |||
| 923 | Ga0105241_10239102 | |||
| 924 | Ga0105242_10010707 | |||
| 925 | Ga0105242_10165935 | |||
| 926 | Ga0105242_10293298 | |||
| 927 | Ga0105242_10396815 | |||
| 928 | Ga0105248_10159681 | |||
| 929 | Ga0105248_10251447 | |||
| 930 | Ga0105248_10754775 | |||
| 931 | Ga0105238_10199288 | |||
| 932 | Ga0105238_10312070 | |||
| 933 | Ga0105249_10036056 | |||
| 934 | Ga0105249_10350249 | |||
| 935 | Ga0105249_10425719 | |||
| 936 | Ga0105239_10042141 | |||
| 937 | Ga0105239_10042592 | |||
| 938 | Ga0105239_10097282 | |||
| 939 | Ga0105246_10014765 | |||
| 940 | Ga0105246_10018679 | |||
| 941 | Ga0105246_10219200 | |||
| 942 | Ga0157373_10032418 | |||
| 943 | Ga0157373_10209714 | |||
| 944 | Ga0157371_10088936 | |||
| 945 | Ga0157370_10022276 | |||
| 946 | Ga0157370_10238972 | |||
| 947 | Ga0157369_10249361 | |||
| 948 | Ga0157369_10385098 | |||
| 949 | Ga0157374_10406992 | |||
| 950 | Ga0157378_10249658 | |||
| 951 | Ga0163162_10306408 | |||
| 952 | Ga0163162_10571875 | |||
| 953 | Ga0157372_10021285 | |||
| 954 | Ga0157372_10055450 | |||
| 955 | Ga0157372_10099189 | |||
| 956 | Ga0157372_10300963 | |||
| 957 | Ga0157372_10404559 | |||
| 958 | Ga0157375_10031707 | |||
| 959 | Ga0157375_10116833 | |||
| 960 | Ga0157375_10129596 | |||
| 961 | Ga0157380_10002342 | |||
| 962 | Ga0157380_10027363 | |||
| 963 | Ga0157380_10234154 | |||
| 964 | Ga0157380_10274814 | |||
| 965 | Ga0157377_10251615 | |||
| 966 | Ga0157379_10101542 | |||
| 967 | Ga0157379_10387852 | |||
| 968 | Ga0157376_10095294 | |||
| 969 | Ga0157376_10488071 | |||
| 970 | Ga0197907_10437555 | |||
| 971 | Ga0207642_10037166 | |||
| 972 | Ga0207642_10069322 | |||
| 973 | Ga0207642_10130512 | |||
| 974 | Ga0207642_10209415 | |||
| 975 | Ga0207688_10016044 | |||
| 976 | Ga0207688_10037079 | |||
| 977 | Ga0207688_10048157 | |||
| 978 | Ga0207643_10001454 | |||
| 979 | Ga0207643_10028137 | |||
| 980 | Ga0207705_10079041 | |||
| 981 | Ga0207705_10108193 | |||
| 982 | Ga0207707_10065086 | |||
| 983 | Ga0207707_10119987 | |||
| 984 | Ga0207707_10142374 | |||
| 985 | Ga0207671_10159364 | |||
| 986 | Ga0207663_10193046 | |||
| 987 | Ga0207660_10128935 | |||
| 988 | Ga0207660_10244569 | |||
| 989 | Ga0207657_10002962 | |||
| 990 | Ga0207657_10010312 | |||
| 991 | Ga0207657_10032242 | |||
| 992 | Ga0207657_10113151 | |||
| 993 | Ga0207649_10121371 | |||
| 994 | Ga0207649_10159111 | |||
| 995 | Ga0207652_10024908 | |||
| 996 | Ga0207652_10070574 | |||
| 997 | Ga0207652_10234637 | |||
| 998 | Ga0207646_10174489 | |||
| 999 | Ga0207650_10007619 | |||
| 1000 | Ga0207650_10552376 | |||
| 1001 | Ga0207659_10026209 | |||
| 1002 | Ga0207659_10233021 | |||
| 1003 | Ga0207687_10017361 | |||
| 1004 | Ga0207687_10071843 | |||
| 1005 | Ga0207687_10287919 | |||
| 1006 | Ga0207644_10257321 | |||
| 1007 | Ga0207706_10117223 | |||
| 1008 | Ga0207686_10064562 | |||
| 1009 | Ga0207686_10157277 | |||
| 1010 | Ga0207709_10008152 | |||
| 1011 | Ga0207709_10121226 | |||
| 1012 | Ga0207709_10199436 | |||
| 1013 | Ga0207670_10015883 | |||
| 1014 | Ga0207669_10010349 | |||
| 1015 | Ga0207669_10036847 | |||
| 1016 | Ga0207669_10058314 | |||
| 1017 | Ga0207669_10072222 | |||
| 1018 | Ga0207669_10249379 | |||
| 1019 | Ga0207704_10037172 | |||
| 1020 | Ga0207691_10022771 | |||
| 1021 | Ga0207691_10483741 | |||
| 1022 | Ga0207711_10529006 | |||
| 1023 | Ga0207661_10001158 | |||
| 1024 | Ga0207661_10007512 | |||
| 1025 | Ga0207661_10018660 | |||
| 1026 | Ga0207661_10069654 | |||
| 1027 | Ga0207661_10077514 | |||
| 1028 | Ga0207661_10133452 | |||
| 1029 | Ga0207679_10004371 | |||
| 1030 | Ga0207679_10136645 | |||
| 1031 | Ga0207679_10478034 | |||
| 1032 | Ga0207667_10397361 | |||
| 1033 | Ga0207712_10102970 | |||
| 1034 | Ga0207712_10409069 | |||
| 1035 | Ga0207668_10174872 | |||
| 1036 | Ga0207640_10138047 | |||
| 1037 | Ga0207677_10577732 | |||
| 1038 | Ga0207639_10244265 | |||
| 1039 | Ga0207678_10121433 | |||
| 1040 | Ga0207708_10014725 | |||
| 1041 | Ga0207708_10022969 | |||
| 1042 | Ga0207708_10048031 | |||
| 1043 | Ga0207708_10056634 | |||
| 1044 | Ga0207708_10057029 | |||
| 1045 | Ga0207708_10147164 | |||
| 1046 | Ga0207702_10113985 | |||
| 1047 | Ga0207702_10138766 | |||
| 1048 | Ga0207641_10297758 | |||
| 1049 | Ga0207648_10061593 | |||
| 1050 | Ga0207648_10101761 | |||
| 1051 | Ga0207648_10210782 | |||
| 1052 | Ga0207648_10299608 | |||
| 1053 | Ga0207648_10490450 | |||
| 1054 | Ga0207674_10003621 | |||
| 1055 | Ga0207674_10034225 | |||
| 1056 | Ga0207674_10067326 | |||
| 1057 | Ga0207674_10443434 | |||
| 1058 | Ga0207675_100107034 | |||
| 1059 | Ga0207675_100159273 | |||
| 1060 | Ga0207675_100304316 | |||
| 1061 | Ga0207675_100475742 | |||
| 1062 | Ga0207683_10019869 | |||
| 1063 | Ga0207683_10020840 | |||
| 1064 | Ga0207683_10103174 | |||
| 1065 | Ga0207683_10110092 | |||
| 1066 | Ga0207698_10489890 | |||
| 1067 | Ga0207428_10004605 | |||
| 1068 | Ga0207428_10006328 | |||
| 1069 | Ga0207428_10020716 | |||
| 1070 | Ga0207428_10085637 | |||
| 1071 | Ga0207428_10187063 | |||
| 1072 | Ga0307408_100045370 | |||
| 1073 | Ga0307408_100067790 | |||
| 1074 | Ga0307408_100114301 | |||
| 1075 | Ga0307405_10004470 | |||
| 1076 | Ga0307405_10023350 | |||
| 1077 | Ga0307413_10002907 | |||
| 1078 | Ga0307410_10147192 | |||
| 1079 | Ga0307406_10029965 | |||
| 1080 | Ga0307406_10035642 | |||
| 1081 | Ga0307407_10071720 | |||
| 1082 | Ga0307407_10098091 | |||
| 1083 | Ga0307412_10011757 | |||
| 1084 | Ga0307412_10018113 | |||
| 1085 | Ga0307409_100005475 | |||
| 1086 | Ga0307409_100013579 | |||
| 1087 | Ga0307409_100035392 | |||
| 1088 | Ga0307409_100100282 | |||
| 1089 | Ga0307409_100331747 | |||
| 1090 | Ga0307416_100004971 | |||
| 1091 | Ga0307416_100026141 | |||
| 1092 | Ga0307416_100030587 | |||
| 1093 | Ga0307416_100079841 | |||
| 1094 | Ga0307416_100568313 | |||
| 1095 | Ga0307414_10004147 | |||
| 1096 | Ga0307415_100003101 | |||
| 1097 | Ga0307415_100026172 | |||
| 1098 | Ga0307415_100037326 | |||
| 1099 | Ga0307415_100120944 | |||
| 1100 | Ga0307415_100155532 | |||
| 1101 | Ga0307415_100489833 | |||
| 1102 | Ga0373961_0077526 | |||
| 1103 | Ga0373935_0527004 | |||
| 1104 | Ga0373947_0065875 | |||
| 1105 | Ga0373947_0325754 | |||
| 1106 | Ga0373925_0309906 | |||
| 1107 | Ga0395899_0001679 | |||
| 1108 | Ga0395899_0020651 | |||
| 1109 | Ga0395899_0047484 | |||
| 1110 | Ga0395899_0091558 | |||
| 1111 | Ga0395899_0146651 | |||
| 1112 | Ga0395900_0001628 | |||
| 1113 | Ga0395900_0016846 | |||
| 1114 | Ga0395900_0017898 | |||
| 1115 | Ga0395900_0057834 | |||
| 1116 | Ga0395900_0126221 | |||
| 1117 | Ga0395900_0188962 | |||
| 1118 | Ga0395900_0240753 | |||
| 1119 | Ga0395900_0393318 | |||
| 1120 | Ga0395900_0440644 | |||
| 1121 | Ga0395900_0467355 | |||
| 1122 | Ga0395898_0006200 | |||
| 1123 | Ga0395898_0012345 | |||
| 1124 | Ga0395898_0023126 | |||
| 1125 | Ga0395898_0031702 | |||
| 1126 | Ga0395898_0040359 | |||
| 1127 | Ga0395898_0044736 | |||
| 1128 | Ga0395898_0184930 | |||
| 1129 | Ga0395898_0476738 | |||
| 1130 | Ga0395905_0005468 | |||
| 1131 | Ga0395905_0023211 | |||
| 1132 | Ga0395905_0027457 | |||
| 1133 | Ga0395905_0028629 | |||
| 1134 | Ga0395905_0081164 | |||
| 1135 | Ga0395905_0093556 | |||
| 1136 | Ga0395905_0274727 | |||
| 1137 | Ga0395905_0328194 | |||
| 1138 | Ga0395905_0431085 | |||
| 1139 | Ga0395901_0010498 | |||
| 1140 | Ga0395901_0010987 | |||
| 1141 | Ga0395901_0021193 | |||
| 1142 | Ga0395901_0041876 | |||
| 1143 | Ga0395901_0042749 | |||
| 1144 | Ga0395901_0068280 | |||
| 1145 | Ga0395901_0070030 | |||
| 1146 | Ga0395901_0108037 | |||
| 1147 | Ga0395901_0272576 | |||
| 1148 | Ga0395901_0602362 | |||
| 1149 | Ga0439439_0000324 | |||
| 1150 | Ga0439431_0003239 | |||
| 1151 | Ga0439433_0005743 | |||
| 1152 | Ga0439445_0061401 | |||
| 1153 | Ga0439448_0016986 | |||
| 1154 | Ga0439448_0043069 | |||
| 1155 | Ga0439454_001491 | |||
| 1156 | Ga0439462_0000935 | |||
| 1157 | Ga0450920_003533 | |||
| 1158 | Ga0450920_011999 | |||
| 1159 | Ga0439446_0003427 | |||
| 1160 | Ga0439446_0021212 | |||
| 1161 | Ga0439434_0000881 | |||
| 1162 | Ga0466966_0005140 | |||
| 1163 | Ga0466961_0006294 | |||
| 1164 | Ga0466963_0009653 | |||
| 1165 | Ga0466963_0015729 | |||
| 1166 | Ga0466963_0089116 | |||
| 1167 | Ga0466963_0153960 | |||
| 1168 | Ga0466964_0001756 | |||
| 1169 | Ga0466964_0038949 | |||
| 1170 | Ga0466971_0002202 | |||
| 1171 | Ga0466971_0057445 | |||
| 1172 | Ga0466970_0229409 | |||
| 1173 | Ga0466957_0000754 | |||
| 1174 | Ga0466957_0086634 | |||
| 1175 | Ga0466959_0020685 | |||
| 1176 | Ga0466959_0065359 | |||
| 1177 | Ga0451576_0263567 | |||
| 1178 | Ga0466958_0001639 | |||
| 1179 | Ga0466958_0003880 | |||
| 1180 | Ga0466958_0064370 | |||
| 1181 | Ga0466967_0002391 | |||
| 1182 | Ga0466967_0007771 | |||
| 1183 | Ga0466967_0023848 | |||
| 1184 | Ga0466967_0056463 | |||
| 1185 | Ga0466967_0069795 | |||
| 1186 | Ga0466967_0106534 | |||
| 1187 | Ga0495627_067801 | |||
| 1188 | Ga0495603_0012937 | |||
| 1189 | Ga0495629_0006407 | |||
| 1190 | Ga0495582_0064021 | |||
| 1191 | Ga0495605_0043533 | |||
| 1192 | Ga0495605_0061806 | |||
| 1193 | Ga0495584_0074336 | |||
| 1194 | Ga0495585_0067070 | |||
| 1195 | Ga0495596_0033161 | |||
| 1196 | Ga0495596_0053029 | |||
| 1197 | Ga0495608_0104607 | |||
| 1198 | Ga0495616_0077768 | |||
| 1199 | Ga0495637_0045743 | |||
| 1200 | Ga0495644_0017662 | |||
| 1201 | Ga0495609_0024905 | |||
| 1202 | Ga0495621_0055161 | |||
| 1203 | Ga0495597_0052855 | |||
| 1204 | Ga0495667_0008766 | |||
| 1205 | Ga0495656_0120355 | |||
| 1206 | Ga0495656_0148322 | |||
| 1207 | Ga0495635_0064332 | |||
| 1208 | Ga0495659_0015159 | |||
| 1209 | Ga0495669_0028021 | |||
| 1210 | Ga0495624_0012722 | |||
| 1211 | Ga0495670_0159815 | |||
| 1212 | Ga0495670_0187363 | |||
| 1213 | Ga0495671_0051766 | |||
| 1214 | Ga0495589_0033852 | |||
| 1215 | Ga0495589_0091245 | |||
| 1216 | Ga0495589_0098504 | |||
| 1217 | Ga0495636_0052264 | |||
| 1218 | Ga0495636_0142423 | |||
| 1219 | Ga0495674_0101302 | |||
| 1220 | Ga0495676_0041758 | |||
| 1221 | Ga0495680_0135483 | |||
| 1222 | Ga0495602_0126372 | |||
| 1223 | Ga0496100_0031099 | |||
| 1224 | Ga0496101_0009361 | |||
| 1225 | Ga0496101_0059488 | |||
| 1226 | Ga0496102_0052856 | |||
| 1227 | Ga0496103_0074092 | |||
| 1228 | Ga0496103_0385623 | |||
| 1229 | Ga0496104_0049709 | |||
| 1230 | Ga0496104_0176985 | |||
| 1231 | Ga0496104_0186260 | |||
| 1232 | Ga0496104_0379951 | |||
| 1233 | Ga0496105_0011842 | |||
| 1234 | Ga0496105_0077915 | |||
| 1235 | Ga0496106_0014236 | |||
| 1236 | Ga0496106_0019291 | |||
| 1237 | Ga0496107_0011610 | |||
| 1238 | Ga0496107_0018577 | |||
| 1239 | Ga0496107_0086891 | |||
| 1240 | Ga0496108_0043021 | |||
| 1241 | Ga0496108_0051137 | |||
| 1242 | Ga0496108_0073363 | |||
| 1243 | Ga0496108_0198991 | |||
| 1244 | Ga0496108_0293300 | |||
| 1245 | Ga0496109_0002221 | |||
| 1246 | Ga0496109_0008378 | |||
| 1247 | Ga0496109_0031644 | |||
| 1248 | Ga0496109_0036794 | |||
| 1249 | Ga0496109_0055509 | |||
| 1250 | Ga0496109_0063320 | |||
| 1251 | Ga0496109_0082832 | |||
| 1252 | Ga0496109_0121340 | |||
| 1253 | Ga0496109_0268462 | |||
| 1254 | Ga0496109_0329775 | |||
| 1255 | Ga0496109_0683647 | |||
| 1256 | Ga0496110_0004037 | |||
| 1257 | Ga0496110_0011195 | |||
| 1258 | Ga0496110_0208990 | |||
| 1259 | Ga0496110_0600766 | |||
| 1260 | Ga0496111_0000824 | |||
| 1261 | Ga0496111_0008806 | |||
| 1262 | Ga0496111_0052495 | |||
| 1263 | Ga0496111_0235760 | |||
| 1264 | Ga0496112_0001675 | |||
| 1265 | Ga0496112_0009275 | |||
| 1266 | Ga0496112_0015156 | |||
| 1267 | Ga0496112_0019842 | |||
| 1268 | Ga0496112_0027905 | |||
| 1269 | Ga0496112_0067074 | |||
| 1270 | Ga0496112_0071688 | |||
| 1271 | Ga0496112_0115777 | |||
| 1272 | Ga0496113_0087138 | |||
| 1273 | Ga0496113_0140515 | |||
| 1274 | Ga0496113_0145811 | |||
| 1275 | Ga0496113_0270344 | |||
| 1276 | Ga0496113_0429963 | |||
| 1277 | Ga0496114_0031356 | |||
| 1278 | Ga0496114_0033380 | |||
| 1279 | Ga0496114_0034934 | |||
| 1280 | Ga0496114_0100927 | |||
| 1281 | Ga0496115_0031739 | |||
| 1282 | Ga0496115_0054705 | |||
| 1283 | Ga0496115_0349802 | |||
| 1284 | Ga0496126_0333517 | |||
| 1285 | Ga0501031_0000832 | |||
| 1286 | Ga0501031_0002581 | |||
| 1287 | Ga0501031_0010148 | |||
| 1288 | Ga0501031_0024755 | |||
| 1289 | Ga0501031_0060441 | |||
| 1290 | Ga0501032_0003012 | |||
| 1291 | Ga0501032_0004821 | |||
| 1292 | Ga0501032_0015255 | |||
| 1293 | Ga0501032_0068648 | |||
| 1294 | Ga0501033_0008322 | |||
| 1295 | Ga0501033_0019161 | |||
| 1296 | Ga0501033_0082845 | |||
| 1297 | Ga0501033_0099756 | |||
| 1298 | Ga0501034_0016584 | |||
| 1299 | Ga0501034_0446826 | |||
| 1300 | Ga0501036_0011147 | |||
| 1301 | Ga0501036_0039939 | |||
| 1302 | Ga0501036_0040273 | |||
| 1303 | Ga0501036_0071944 | |||
| 1304 | Ga0501036_0202961 | |||
| 1305 | Ga0501037_0061603 | |||
| 1306 | Ga0501037_0234306 | |||
| 1307 | Ga0501037_0446587 | |||
| 1308 | Ga0501038_0029025 | |||
| 1309 | Ga0501038_0030565 | |||
| 1310 | Ga0501038_0061211 | |||
| 1311 | Ga0501038_0152740 | |||
| 1312 | Ga0501039_0011875 | |||
| 1313 | Ga0501039_0016896 | |||
| 1314 | Ga0501039_0025338 | |||
| 1315 | Ga0501039_0098625 | |||
| 1316 | Ga0501039_0184098 | |||
| 1317 | Ga0501039_0518667 | |||
| 1318 | Ga0501040_0003292 | |||
| 1319 | Ga0501040_0004645 | |||
| 1320 | Ga0501040_0007624 | |||
| 1321 | Ga0501040_0009929 | |||
| 1322 | Ga0501040_0031191 | |||
| 1323 | Ga0501041_0001695 | |||
| 1324 | Ga0501041_0002401 | |||
| 1325 | Ga0501041_0003218 | |||
| 1326 | Ga0501041_0031049 | |||
| 1327 | Ga0501042_0002670 | |||
| 1328 | Ga0501042_0012582 | |||
| 1329 | Ga0501042_0017861 | |||
| 1330 | Ga0501042_0038873 | |||
| 1331 | Ga0501042_0066038 | |||
| 1332 | Ga0501042_0077145 | |||
| 1333 | Ga0501042_0109930 | |||
| 1334 | Ga0501042_0120495 | |||
| 1335 | Ga0501042_0242033 | |||
| 1336 | Ga0501043_0057252 | |||
| 1337 | Ga0501043_0103397 | |||
| 1338 | Ga0501043_0183536 | |||
| 1339 | Ga0501046_0008549 | |||
| 1340 | Ga0501046_0015517 | |||
| 1341 | Ga0501046_0020855 | |||
| 1342 | Ga0501046_0045256 | |||
| 1343 | Ga0501046_0151552 | |||
| 1344 | Ga0501046_0215248 | |||
| 1345 | Ga0501046_0325659 | |||
| 1346 | Ga0501047_0009994 | |||
| 1347 | Ga0501047_0197770 | |||
| 1348 | Ga0501047_0322422 | |||
| 1349 | Ga0501048_0002505 | |||
| 1350 | Ga0501048_0009685 | |||
| 1351 | Ga0501048_0021408 | |||
| 1352 | Ga0501048_0029677 | |||
| 1353 | Ga0501048_0281120 | |||
| 1354 | Ga0501067_0004534 | |||
| 1355 | Ga0501067_0015495 | |||
| 1356 | Ga0501067_0048797 | |||
| 1357 | Ga0501068_0007900 | |||
| 1358 | Ga0501068_0021534 | |||
| 1359 | Ga0501068_0024896 | |||
| 1360 | Ga0501068_0046423 | |||
| 1361 | Ga0501068_0093873 | |||
| 1362 | Ga0501068_0246956 | |||
| 1363 | Ga0501069_0009643 | |||
| 1364 | Ga0501069_0042134 | |||
| 1365 | Ga0501069_0044061 | |||
| 1366 | Ga0501069_0081128 | |||
| 1367 | Ga0501069_0091203 | |||
| 1368 | Ga0501070_0006594 | |||
| 1369 | Ga0501070_0019679 | |||
| 1370 | Ga0501070_0129120 | |||
| 1371 | Ga0501070_0170788 | |||
| 1372 | Ga0501070_0258247 | |||
| 1373 | Ga0501071_0003528 | |||
| 1374 | Ga0501071_0004822 | |||
| 1375 | Ga0501071_0008231 | |||
| 1376 | Ga0501071_0013150 | |||
| 1377 | Ga0501071_0014537 | |||
| 1378 | Ga0501071_0031849 | |||
| 1379 | Ga0501071_0124690 | |||
| 1380 | Ga0501071_0146468 | |||
| 1381 | Ga0501071_0189969 | |||
| 1382 | Ga0501071_0190810 | |||
| 1383 | Ga0501072_0001066 | |||
| 1384 | Ga0501072_0002265 | |||
| 1385 | Ga0501072_0002299 | |||
| 1386 | Ga0501072_0015827 | |||
| 1387 | Ga0501072_0023202 | |||
| 1388 | Ga0501072_0024807 | |||
| 1389 | Ga0501072_0155273 | |||
| 1390 | Ga0501072_0208438 | |||
| 1391 | Ga0501072_0413693 | |||
| 1392 | Ga0501073_0027965 | |||
| 1393 | Ga0501073_0070141 | |||
| 1394 | Ga0501073_0153019 | |||
| 1395 | Ga0501073_0259729 | |||
| 1396 | Ga0501074_0003905 | |||
| 1397 | Ga0501074_0011285 | |||
| 1398 | Ga0501074_0015985 | |||
| 1399 | Ga0501074_0041143 | |||
| 1400 | Ga0501074_0042915 | |||
| 1401 | Ga0501074_0060013 | |||
| 1402 | Ga0501074_0099215 | |||
| 1403 | Ga0501075_0001873 | |||
| 1404 | Ga0501075_0017343 | |||
| 1405 | Ga0501075_0045433 | |||
| 1406 | Ga0501075_0054096 | |||
| 1407 | Ga0501075_0073731 | |||
| 1408 | Ga0501075_0091127 | |||
| 1409 | Ga0501075_0092480 | |||
| 1410 | Ga0501076_0004761 | |||
| 1411 | Ga0501076_0013276 | |||
| 1412 | Ga0501076_0014742 | |||
| 1413 | Ga0501076_0038594 | |||
| 1414 | Ga0501076_0066873 | |||
| 1415 | Ga0501076_0319172 | |||
| 1416 | Ga0501077_0001089 | |||
| 1417 | Ga0501077_0011616 | |||
| 1418 | Ga0501077_0012933 | |||
| 1419 | Ga0501077_0016400 | |||
| 1420 | Ga0501077_0039656 | |||
| 1421 | Ga0501077_0139903 | |||
| 1422 | Ga0501079_0012620 | |||
| 1423 | Ga0501079_0013507 | |||
| 1424 | Ga0501079_0013931 | |||
| 1425 | Ga0501079_0028370 | |||
| 1426 | Ga0501079_0046197 | |||
| 1427 | Ga0501079_0059749 | |||
| 1428 | Ga0501079_0101629 | |||
| 1429 | Ga0501079_0346795 | |||
| 1430 | Ga0501080_0001603 | |||
| 1431 | Ga0501080_0003038 | |||
| 1432 | Ga0501080_0004070 | |||
| 1433 | Ga0501080_0016655 | |||
| 1434 | Ga0501080_0052676 | |||
| 1435 | Ga0501081_0007719 | |||
| 1436 | Ga0501081_0025425 | |||
| 1437 | Ga0501081_0027760 | |||
| 1438 | Ga0501081_0030696 | |||
| 1439 | Ga0501081_0060253 | |||
| 1440 | Ga0501081_0152541 | |||
| 1441 | Ga0501083_0010652 | |||
| 1442 | Ga0501083_0039233 | |||
| 1443 | Ga0501083_0258388 | |||
| 1444 | Ga0501035_0007049 | |||
| 1445 | Ga0501035_0009480 | |||
| 1446 | Ga0501035_0012183 | |||
| 1447 | Ga0501035_0253023 | |||
| 1448 | Ga0501045_0001162 | |||
| 1449 | Ga0501045_0016546 | |||
| 1450 | Ga0501045_0077740 | |||
| 1451 | Ga0501045_0086705 | |||
| 1452 | Ga0501045_0329927 | |||
| 1453 | nmdc:mga0yw44_168950_c1 | |||
| 1454 | nmdc:mga0yw44_338766_c1 | |||
| 1455 | nmdc:mga0yw44_470542_c1 | |||
| 1456 | nmdc:mga05p37_23439_c1 | |||
| 1457 | nmdc:mga05p37_253283_c1 | |||
| 1458 | nmdc:mga05p37_432896_c1 | |||
| 1459 | nmdc:mga05p37_46011_c1 | |||
| 1460 | nmdc:mga05p37_462233_c1 | |||
| 1461 | nmdc:mga05p37_68939_c1 | |||
| 1462 | nmdc:mga05p37_89359_c1 | |||
| 1463 | nmdc:mga09592_209349_c1 | |||
| 1464 | nmdc:mga09592_89406_c1 | |||
| 1465 | nmdc:mga0qj67_213410_c1 | |||
| 1466 | nmdc:mga0qj67_253768_c1 | |||
| 1467 | nmdc:mga0qj67_274860_c1 | |||
| 1468 | nmdc:mga06r32_8037_c1 | |||
| 1469 | nmdc:mga08y16_10476_c1 | |||
| 1470 | nmdc:mga08y16_128893_c1 | |||
| 1471 | nmdc:mga08y16_20499_c1 | |||
| 1472 | nmdc:mga08y16_26697_c1 | |||
| 1473 | nmdc:mga08y16_644295_c1 | |||
| 1474 | nmdc:mga0n895_23756_c1 | |||
| 1475 | nmdc:mga08x19_300935_c1 | |||
| 1476 | nmdc:mga0a205_221590_c1 | |||
| 1477 | Ga0495655_0000857 | |||
| 1478 | Ga0495595_0007334 | |||
| 1479 | Ga0501084_0008934 | |||
| 1480 | Ga0501084_0011484 | |||
| 1481 | Ga0501084_0020621 | |||
| 1482 | Ga0501084_0038224 | |||
| 1483 | Ga0501084_0057040 | |||
| 1484 | Ga0501084_0070638 | |||
| 1485 | Ga0501084_0142590 | |||
| 1486 | Ga0501084_0267210 | |||
| 1487 | Ga0501084_0431237 | |||
| 1488 | Ga0590071_017864 | |||
| 1489 | Ga0590071_021833 | |||
| 1490 | Ga0590075_021078 | |||
| 1491 | Ga0590077_002602 | |||
| 1492 | Ga0590077_007418 | |||
| 1493 | Ga0587088_005931 | |||
| 1494 | Ga0587075_008329 | |||
| 1495 | Ga0501082_0003454 | |||
| 1496 | Ga0501082_0009809 | |||
| 1497 | Ga0501082_0044644 | |||
| 1498 | Ga0501082_0052950 | |||
| 1499 | Ga0501082_0073725 | |||
| 1500 | Ga0501082_0102434 | |||
| 1501 | Ga0501082_0131466 | |||
| 1502 | Ga0501082_0330036 | |||
| 1503 | Ga0501082_0342897 | |||
| 1504 | Ga0501082_0589915 | |||
| 1505 | Ga0466962_0000292 | |||
| 1506 | Ga0466962_0016359 | |||
| 1507 | Ga0466962_0035966 | |||
| 1508 | Ga0530510_0001723 | |||
| 1509 | Ga0530510_0005093 | |||
| 1510 | Ga0530510_0005462 | |||
| 1511 | Ga0530510_0007712 | |||
| 1512 | Ga0530510_0039419 | |||
| 1513 | Ga0530510_0059379 | |||
| 1514 | Ga0530510_0380236 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
102
299
0.8
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hpn-assembly1.cif.gz_B | lpqy-sugabc in state 3 | 0.7493 | 27 | 289 |
| 8hpn-assembly1.cif.gz_B | lpqy-sugabc in state 3 | 0.7418 | 27 | 289 |
| 7cad-assembly1.cif.gz_B | mycobacterium smegmatis sugabc complex | 0.7312 | 27 | 294 |
| 4jbw-assembly2.cif.gz_I | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.7245 | 28 | 288 |
| 8ja7-assembly1.cif.gz_B | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.7199 | 25 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1E7_1_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7937 | 21 | 284 | 1.10.3720.10 |
| af_P77716_1_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7928 | 25 | 284 | 1.10.3720.10 |
| af_Q2G1E7_1_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7855 | 21 | 284 | 1.10.3720.10 |
| af_L7N652_1_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7779 | 27 | 288 | 1.10.3720.10 |
| af_I6Y1U3_2_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7742 | 27 | 288 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3IMJ0-F1-model_v4 | Carbohydrate ABC transporter permease | 0.9081 | 33 | 231 |
GO:0005886
GO:0055085 |
| AF-A0A7C9VC93-F1-model_v4 | Carbohydrate ABC transporter permease | 0.9081 | 33 | 231 |
GO:0005886
GO:0055085 |
| AF-A0A6B3EEN7-F1-model_v4 | Carbohydrate ABC transporter permease | 0.8924 | 40 | 221 |
GO:0005886
GO:0055085 |
| AF-A0A429SK61-F1-model_v4 | deleted | 0.8914 | 30 | 206 |
|
| AF-A0A7K2NRI0-F1-model_v4 | ABC transporter permease subunit | 0.8863 | 22 | 233 |
GO:0005886
GO:0055085 |