F479302
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 755 | 248 | 1510 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300026088|Ga0207641_10448400|Ga0207641_104484001 |
| Length | 157 |
| Sequence | MDLVLRAIFIFAFMLLLIRIIGKRELSSLQPFDLILLIVLGDALQQGLTQDDYSLTGAVLVVGTIAVLQVFVSWVSYRFPRTRPVLEGEPVVIVQDGKVIERNLQRERLTVQEVTEAARKQQIAHLAEVRWAVLDYGDLIIHLFEKDTRSYYSLERL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 77 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 86 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 92 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 95 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 131 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 132 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 133 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 134 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 137 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 138 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 139 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 140 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 141 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 142 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 144 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 147 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 148 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 149 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 150 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 151 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 152 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 153 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 154 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 155 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 156 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 157 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 158 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 159 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 160 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 161 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 162 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 163 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 164 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 165 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 166 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 167 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 168 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 203 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 204 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 205 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 206 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 207 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 210 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 211 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 212 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 215 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 248 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.89 |
| Metatranscriptomes | 4.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 13.38 |
| Rhizosphere | 85.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 23.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207641_10448400 | 3300026088 | Bacteria | 1247 |
| 2 | JGI25407J50210_10006441 | 3300003373 | Bacteria | 2924 |
| 3 | Ga0070658_10013356 | 3300005327 | Bacteria | 6590 |
| 4 | Ga0070658_10022886 | 3300005327 | Bacteria | 5015 |
| 5 | Ga0070658_10054259 | 3300005327 | Unclassified | 3255 |
| 6 | Ga0070658_10089706 | 3300005327 | Bacteria | 2531 |
| 7 | Ga0070658_10233268 | 3300005327 | Bacteria | 1558 |
| 8 | Ga0070658_10265741 | 3300005327 | Bacteria | 1458 |
| 9 | Ga0070658_10356711 | 3300005327 | Bacteria | 1252 |
| 10 | Ga0070658_10903412 | 3300005327 | Bacteria | 768 |
| 11 | Ga0070683_100018974 | 3300005329 | Bacteria | 6102 |
| 12 | Ga0070683_100117686 | 3300005329 | Bacteria | 2509 |
| 13 | Ga0070683_100193777 | 3300005329 | Bacteria | 1930 |
| 14 | Ga0070683_100279974 | 3300005329 | Bacteria | 1586 |
| 15 | Ga0070683_101008735 | 3300005329 | Bacteria | 799 |
| 16 | Ga0070683_101505068 | 3300005329 | Unclassified | 647 |
| 17 | Ga0070683_101775171 | 3300005329 | Unclassified | 593 |
| 18 | Ga0070680_100020648 | 3300005336 | Bacteria | 5229 |
| 19 | Ga0070680_100036319 | 3300005336 | Bacteria | 3980 |
| 20 | Ga0070680_100042889 | 3300005336 | Bacteria | 3673 |
| 21 | Ga0070682_100040572 | 3300005337 | Bacteria | 2865 |
| 22 | Ga0070682_100124291 | 3300005337 | Bacteria | 1737 |
| 23 | Ga0070682_100417252 | 3300005337 | Bacteria | 1019 |
| 24 | Ga0070682_101293779 | 3300005337 | Bacteria | 619 |
| 25 | Ga0068868_100195637 | 3300005338 | Unclassified | 1683 |
| 26 | Ga0070660_100013224 | 3300005339 | Bacteria | 5914 |
| 27 | Ga0070660_100045995 | 3300005339 | Bacteria | 3344 |
| 28 | Ga0070660_100059769 | 3300005339 | Bacteria | 2956 |
| 29 | Ga0070660_100065879 | 3300005339 | Bacteria | 2820 |
| 30 | Ga0070660_100452308 | 3300005339 | Bacteria | 1065 |
| 31 | Ga0070691_10736978 | 3300005341 | Bacteria | 595 |
| 32 | Ga0070661_100014955 | 3300005344 | Bacteria | 5474 |
| 33 | Ga0070661_100021648 | 3300005344 | Bacteria | 4595 |
| 34 | Ga0070661_100074572 | 3300005344 | Unclassified | 2499 |
| 35 | Ga0070661_100135069 | 3300005344 | Unclassified | 1855 |
| 36 | Ga0070671_100053232 | 3300005355 | Bacteria | 3364 |
| 37 | Ga0070671_100291406 | 3300005355 | Bacteria | 1389 |
| 38 | Ga0070674_101611430 | 3300005356 | Unclassified | 585 |
| 39 | Ga0070659_100098463 | 3300005366 | Bacteria | 2352 |
| 40 | Ga0070659_100148182 | 3300005366 | Bacteria | 1913 |
| 41 | Ga0070659_100529653 | 3300005366 | Bacteria | 1007 |
| 42 | Ga0070667_101477221 | 3300005367 | Bacteria | 638 |
| 43 | Ga0070703_10148867 | 3300005406 | Bacteria | 877 |
| 44 | Ga0070709_10011853 | 3300005434 | Bacteria | 4868 |
| 45 | Ga0070709_10113962 | 3300005434 | Bacteria | 1821 |
| 46 | Ga0070714_100013640 | 3300005435 | Bacteria | 6516 |
| 47 | Ga0070714_100120654 | 3300005435 | Bacteria | 2332 |
| 48 | Ga0070714_100150441 | 3300005435 | Bacteria | 2097 |
| 49 | Ga0070714_100214057 | 3300005435 | Bacteria | 1768 |
| 50 | Ga0070714_100224966 | 3300005435 | Bacteria | 1726 |
| 51 | Ga0070714_100253896 | 3300005435 | Bacteria | 1627 |
| 52 | Ga0070714_100293460 | 3300005435 | Unclassified | 1514 |
| 53 | Ga0070714_100844242 | 3300005435 | Unclassified | 888 |
| 54 | Ga0070714_100875314 | 3300005435 | Bacteria | 872 |
| 55 | Ga0070714_101082463 | 3300005435 | Unclassified | 781 |
| 56 | Ga0070714_101738080 | 3300005435 | Bacteria | 609 |
| 57 | Ga0070713_100055588 | 3300005436 | Bacteria | 3290 |
| 58 | Ga0070713_100175164 | 3300005436 | Bacteria | 1924 |
| 59 | Ga0070713_100317791 | 3300005436 | Bacteria | 1437 |
| 60 | Ga0070713_100405893 | 3300005436 | Bacteria | 1273 |
| 61 | Ga0070713_101399975 | 3300005436 | Bacteria | 678 |
| 62 | Ga0070710_10029854 | 3300005437 | Bacteria | 2928 |
| 63 | Ga0070710_10161493 | 3300005437 | Bacteria | 1390 |
| 64 | Ga0070710_10772048 | 3300005437 | Bacteria | 684 |
| 65 | Ga0070710_10931366 | 3300005437 | Unclassified | 629 |
| 66 | Ga0070711_100067398 | 3300005439 | Bacteria | 2511 |
| 67 | Ga0070711_100127897 | 3300005439 | Bacteria | 1888 |
| 68 | Ga0070711_100659088 | 3300005439 | Unclassified | 878 |
| 69 | Ga0070711_100666172 | 3300005439 | Bacteria | 874 |
| 70 | Ga0070663_100149169 | 3300005455 | Bacteria | 1792 |
| 71 | Ga0070663_101695213 | 3300005455 | Unclassified | 565 |
| 72 | Ga0070678_100599533 | 3300005456 | Bacteria | 983 |
| 73 | Ga0070681_10048445 | 3300005458 | Bacteria | 4246 |
| 74 | Ga0070681_10066364 | 3300005458 | Bacteria | 3577 |
| 75 | Ga0070681_10069520 | 3300005458 | Bacteria | 3487 |
| 76 | Ga0070681_10078222 | 3300005458 | Bacteria | 3265 |
| 77 | Ga0070681_10130801 | 3300005458 | Bacteria | 2442 |
| 78 | Ga0070681_10145647 | 3300005458 | Bacteria | 2298 |
| 79 | Ga0070681_10812886 | 3300005458 | Bacteria | 852 |
| 80 | Ga0070707_100271148 | 3300005468 | Bacteria | 1650 |
| 81 | Ga0070679_100041019 | 3300005530 | Bacteria | 4607 |
| 82 | Ga0070679_100081140 | 3300005530 | Bacteria | 3233 |
| 83 | Ga0070679_100129449 | 3300005530 | Bacteria | 2506 |
| 84 | Ga0070679_100188597 | 3300005530 | Unclassified | 2031 |
| 85 | Ga0070679_100305368 | 3300005530 | Bacteria | 1542 |
| 86 | Ga0070684_100093953 | 3300005535 | Bacteria | 2670 |
| 87 | Ga0070684_100107519 | 3300005535 | Bacteria | 2498 |
| 88 | Ga0070684_100212150 | 3300005535 | Unclassified | 1765 |
| 89 | Ga0070684_100316936 | 3300005535 | Bacteria | 1432 |
| 90 | Ga0070684_100356573 | 3300005535 | Unclassified | 1346 |
| 91 | Ga0070684_100887744 | 3300005535 | Bacteria | 835 |
| 92 | Ga0068853_100164767 | 3300005539 | Unclassified | 2002 |
| 93 | Ga0068853_100258839 | 3300005539 | Unclassified | 1599 |
| 94 | Ga0070665_100366043 | 3300005548 | Bacteria | 1448 |
| 95 | Ga0070704_100173402 | 3300005549 | Bacteria | 1718 |
| 96 | Ga0068855_100014054 | 3300005563 | Bacteria | 9650 |
| 97 | Ga0068855_100049101 | 3300005563 | Bacteria | 4978 |
| 98 | Ga0068855_100076048 | 3300005563 | Bacteria | 3897 |
| 99 | Ga0068855_100216744 | 3300005563 | Unclassified | 2148 |
| 100 | Ga0068855_100236701 | 3300005563 | Bacteria | 2042 |
| 101 | Ga0068855_100365400 | 3300005563 | Bacteria | 1587 |
| 102 | Ga0068855_100426652 | 3300005563 | Bacteria | 1450 |
| 103 | Ga0068855_100898277 | 3300005563 | Bacteria | 936 |
| 104 | Ga0070664_101271846 | 3300005564 | Bacteria | 695 |
| 105 | Ga0068857_100275592 | 3300005577 | Unclassified | 1546 |
| 106 | Ga0068857_100367100 | 3300005577 | Unclassified | 1335 |
| 107 | Ga0068857_100438106 | 3300005577 | Bacteria | 1220 |
| 108 | Ga0068854_100291041 | 3300005578 | Bacteria | 1318 |
| 109 | Ga0068854_100468390 | 3300005578 | Bacteria | 1056 |
| 110 | Ga0068856_100041800 | 3300005614 | Bacteria | 4507 |
| 111 | Ga0068856_100129436 | 3300005614 | Bacteria | 2528 |
| 112 | Ga0068856_100148260 | 3300005614 | Bacteria | 2354 |
| 113 | Ga0068856_100467392 | 3300005614 | Bacteria | 1282 |
| 114 | Ga0068852_100026479 | 3300005616 | Bacteria | 4714 |
| 115 | Ga0068852_100056211 | 3300005616 | Bacteria | 3400 |
| 116 | Ga0068852_100274029 | 3300005616 | Bacteria | 1624 |
| 117 | Ga0068852_100512354 | 3300005616 | Bacteria | 1196 |
| 118 | Ga0068852_101375852 | 3300005616 | Bacteria | 728 |
| 119 | Ga0068859_101418667 | 3300005617 | Bacteria | 766 |
| 120 | Ga0068864_100865092 | 3300005618 | Unclassified | 891 |
| 121 | Ga0068861_101252322 | 3300005719 | Unclassified | 719 |
| 122 | Ga0068858_101298441 | 3300005842 | Bacteria | 716 |
| 123 | Ga0081455_10008492 | 3300005937 | Bacteria | 10673 |
| 124 | Ga0081538_10001327 | 3300005981 | Bacteria | 25495 |
| 125 | Ga0081539_10114127 | 3300005985 | Bacteria | 1354 |
| 126 | Ga0070717_10054961 | 3300006028 | Bacteria | 3284 |
| 127 | Ga0070717_10079617 | 3300006028 | Bacteria | 2748 |
| 128 | Ga0070717_10240992 | 3300006028 | Bacteria | 1595 |
| 129 | Ga0070717_10324974 | 3300006028 | Unclassified | 1371 |
| 130 | Ga0070715_10000748 | 3300006163 | Bacteria | 8767 |
| 131 | Ga0070715_10894381 | 3300006163 | Unclassified | 546 |
| 132 | Ga0070716_100012124 | 3300006173 | Bacteria | 4360 |
| 133 | Ga0070712_100021648 | 3300006175 | Bacteria | 4226 |
| 134 | Ga0070712_100151071 | 3300006175 | Bacteria | 1783 |
| 135 | Ga0070712_100579568 | 3300006175 | Bacteria | 948 |
| 136 | Ga0070712_100858680 | 3300006175 | Unclassified | 781 |
| 137 | Ga0070712_101121484 | 3300006175 | Bacteria | 683 |
| 138 | Ga0070712_101445304 | 3300006175 | Unclassified | 600 |
| 139 | Ga0070712_101740733 | 3300006175 | Unclassified | 546 |
| 140 | Ga0097621_100397230 | 3300006237 | Unclassified | 1234 |
| 141 | Ga0097621_100707106 | 3300006237 | Bacteria | 928 |
| 142 | Ga0075428_100008131 | 3300006844 | Bacteria | 11644 |
| 143 | Ga0075433_10190599 | 3300006852 | Bacteria | 1824 |
| 144 | Ga0075434_100007870 | 3300006871 | Bacteria | 9873 |
| 145 | Ga0097620_101418582 | 3300006931 | Bacteria | 766 |
| 146 | Ga0075435_100148471 | 3300007076 | Bacteria | 1970 |
| 147 | Ga0105240_10052404 | 3300009093 | Bacteria | 5131 |
| 148 | Ga0105240_10057827 | 3300009093 | Bacteria | 4842 |
| 149 | Ga0105240_10073576 | 3300009093 | Bacteria | 4219 |
| 150 | Ga0105240_10337176 | 3300009093 | Bacteria | 1714 |
| 151 | Ga0105240_10474412 | 3300009093 | Bacteria | 1396 |
| 152 | Ga0105240_10937583 | 3300009093 | Unclassified | 929 |
| 153 | Ga0105240_11064727 | 3300009093 | Bacteria | 862 |
| 154 | Ga0105240_11748715 | 3300009093 | Bacteria | 648 |
| 155 | Ga0105240_12297915 | 3300009093 | Bacteria | 559 |
| 156 | Ga0105245_10011743 | 3300009098 | Bacteria | 7619 |
| 157 | Ga0105247_10330508 | 3300009101 | Bacteria | 1066 |
| 158 | Ga0114129_10006703 | 3300009147 | Bacteria | 16355 |
| 159 | Ga0105243_10338215 | 3300009148 | Unclassified | 1378 |
| 160 | Ga0105241_10240527 | 3300009174 | Bacteria | 1530 |
| 161 | Ga0105241_10339213 | 3300009174 | Unclassified | 1301 |
| 162 | Ga0105241_10388525 | 3300009174 | Bacteria | 1221 |
| 163 | Ga0105241_11592746 | 3300009174 | Unclassified | 631 |
| 164 | Ga0105242_10018922 | 3300009176 | Bacteria | 5393 |
| 165 | Ga0105248_10051830 | 3300009177 | Bacteria | 4604 |
| 166 | Ga0105248_10343062 | 3300009177 | Unclassified | 1681 |
| 167 | Ga0105237_10066073 | 3300009545 | Bacteria | 3612 |
| 168 | Ga0105238_10100575 | 3300009551 | Bacteria | 2874 |
| 169 | Ga0105238_10312234 | 3300009551 | Unclassified | 1557 |
| 170 | Ga0105238_10316415 | 3300009551 | Unclassified | 1546 |
| 171 | Ga0105238_10509001 | 3300009551 | Unclassified | 1206 |
| 172 | Ga0105249_11221396 | 3300009553 | Unclassified | 823 |
| 173 | Ga0105239_10064567 | 3300010375 | Bacteria | 4019 |
| 174 | Ga0105239_10074951 | 3300010375 | Plasmid | 3720 |
| 175 | Ga0105239_10372767 | 3300010375 | Bacteria | 1613 |
| 176 | Ga0105239_11133371 | 3300010375 | Bacteria | 901 |
| 177 | Ga0105239_11381247 | 3300010375 | Bacteria | 813 |
| 178 | Ga0105246_10217246 | 3300011119 | Unclassified | 1496 |
| 179 | Ga0154010_105530 | 3300013062 | Bacteria | 985 |
| 180 | Ga0157373_10063948 | 3300013100 | Bacteria | 2604 |
| 181 | Ga0157373_10239549 | 3300013100 | Unclassified | 1282 |
| 182 | Ga0157373_11123250 | 3300013100 | Unclassified | 590 |
| 183 | Ga0157371_10246545 | 3300013102 | Bacteria | 1286 |
| 184 | Ga0157371_10499043 | 3300013102 | Bacteria | 899 |
| 185 | Ga0157371_10784592 | 3300013102 | Bacteria | 717 |
| 186 | Ga0157371_10899364 | 3300013102 | Bacteria | 671 |
| 187 | Ga0157370_10015057 | 3300013104 | Bacteria | 7880 |
| 188 | Ga0157370_10021166 | 3300013104 | Bacteria | 6484 |
| 189 | Ga0157370_10053446 | 3300013104 | Bacteria | 3851 |
| 190 | Ga0157370_10057477 | 3300013104 | Bacteria | 3699 |
| 191 | Ga0157370_10159771 | 3300013104 | Bacteria | 2097 |
| 192 | Ga0157370_10194594 | 3300013104 | Bacteria | 1882 |
| 193 | Ga0157370_10199255 | 3300013104 | Unclassified | 1857 |
| 194 | Ga0157370_10376261 | 3300013104 | Bacteria | 1308 |
| 195 | Ga0157370_10430888 | 3300013104 | Unclassified | 1213 |
| 196 | Ga0157370_11464744 | 3300013104 | Unclassified | 614 |
| 197 | Ga0157369_10004422 | 3300013105 | Bacteria | 16592 |
| 198 | Ga0157369_10029083 | 3300013105 | Bacteria | 6109 |
| 199 | Ga0157369_10035320 | 3300013105 | Bacteria | 5483 |
| 200 | Ga0157369_10043468 | 3300013105 | Bacteria | 4897 |
| 201 | Ga0157369_10053298 | 3300013105 | Bacteria | 4373 |
| 202 | Ga0157369_10091319 | 3300013105 | Bacteria | 3251 |
| 203 | Ga0157369_10096223 | 3300013105 | Bacteria | 3159 |
| 204 | Ga0157369_10125860 | 3300013105 | Bacteria | 2717 |
| 205 | Ga0157369_10415356 | 3300013105 | Bacteria | 1395 |
| 206 | Ga0157369_10744440 | 3300013105 | Bacteria | 1009 |
| 207 | Ga0157369_10957756 | 3300013105 | Bacteria | 877 |
| 208 | Ga0157369_11614032 | 3300013105 | Archaea | 659 |
| 209 | Ga0157374_10008828 | 3300013296 | Bacteria | 8629 |
| 210 | Ga0157374_10040394 | 3300013296 | Bacteria | 4296 |
| 211 | Ga0157374_10373678 | 3300013296 | Bacteria | 1419 |
| 212 | Ga0157374_10388242 | 3300013296 | Bacteria | 1391 |
| 213 | Ga0157374_10683970 | 3300013296 | Bacteria | 1038 |
| 214 | Ga0157378_10124084 | 3300013297 | Bacteria | 2384 |
| 215 | Ga0157372_10037160 | 3300013307 | Bacteria | 5369 |
| 216 | Ga0157372_10045886 | 3300013307 | Bacteria | 4849 |
| 217 | Ga0157372_10052116 | 3300013307 | Bacteria | 4555 |
| 218 | Ga0157372_10192089 | 3300013307 | Bacteria | 2365 |
| 219 | Ga0157372_10509329 | 3300013307 | Bacteria | 1403 |
| 220 | Ga0157372_10686033 | 3300013307 | Bacteria | 1192 |
| 221 | Ga0157372_10865594 | 3300013307 | Bacteria | 1049 |
| 222 | Ga0157372_10886064 | 3300013307 | Bacteria | 1036 |
| 223 | Ga0157372_11101625 | 3300013307 | Unclassified | 919 |
| 224 | Ga0157375_11992560 | 3300013308 | Bacteria | 690 |
| 225 | Ga0157375_13073265 | 3300013308 | Unclassified | 557 |
| 226 | Ga0163163_11194412 | 3300014325 | Bacteria | 823 |
| 227 | Ga0182008_10002698 | 3300014497 | Bacteria | 11017 |
| 228 | Ga0182008_10459632 | 3300014497 | Unclassified | 693 |
| 229 | Ga0157377_10152635 | 3300014745 | Unclassified | 1429 |
| 230 | Ga0157377_10231037 | 3300014745 | Bacteria | 1189 |
| 231 | Ga0157379_10389783 | 3300014968 | Bacteria | 1279 |
| 232 | Ga0157376_10143623 | 3300014969 | Bacteria | 2144 |
| 233 | Ga0157376_10190357 | 3300014969 | Bacteria | 1881 |
| 234 | Ga0182006_1004883 | 3300015261 | Bacteria | 6499 |
| 235 | Ga0182006_1068509 | 3300015261 | Bacteria | 1322 |
| 236 | Ga0182006_1150890 | 3300015261 | Bacteria | 788 |
| 237 | Ga0182007_10076497 | 3300015262 | Bacteria | 1097 |
| 238 | Ga0182005_1212163 | 3300015265 | Bacteria | 586 |
| 239 | Ga0197907_10101945 | 3300020069 | Bacteria | 2719 |
| 240 | Ga0197907_10566242 | 3300020069 | Unclassified | 1210 |
| 241 | Ga0206356_10270218 | 3300020070 | Bacteria | 3163 |
| 242 | Ga0206356_10981012 | 3300020070 | Unclassified | 1153 |
| 243 | Ga0206356_11015167 | 3300020070 | Bacteria | 2510 |
| 244 | Ga0206355_1521071 | 3300020076 | Unclassified | 1200 |
| 245 | Ga0206351_10645199 | 3300020077 | Unclassified | 656 |
| 246 | Ga0206352_10891980 | 3300020078 | Bacteria | 1195 |
| 247 | Ga0206350_10834390 | 3300020080 | Unclassified | 742 |
| 248 | Ga0206350_11487734 | 3300020080 | Unclassified | 1248 |
| 249 | Ga0206354_10373740 | 3300020081 | Bacteria | 5241 |
| 250 | Ga0206354_11513803 | 3300020081 | Bacteria | 1948 |
| 251 | Ga0206353_10033469 | 3300020082 | Bacteria | 4087 |
| 252 | Ga0206353_10465379 | 3300020082 | Unclassified | 1332 |
| 253 | Ga0206353_10818496 | 3300020082 | Bacteria | 2782 |
| 254 | Ga0206353_10843204 | 3300020082 | Bacteria | 2623 |
| 255 | Ga0206353_10999856 | 3300020082 | Bacteria | 861 |
| 256 | Ga0206353_12033280 | 3300020082 | Unclassified | 1651 |
| 257 | Ga0206353_12052016 | 3300020082 | Bacteria | 2657 |
| 258 | Ga0154015_1357428 | 3300020610 | Bacteria | 993 |
| 259 | Ga0154015_1642039 | 3300020610 | Unclassified | 649 |
| 260 | Ga0213874_10060377 | 3300021377 | Unclassified | 1186 |
| 261 | Ga0213876_10061470 | 3300021384 | Bacteria | 1982 |
| 262 | Ga0213875_10339278 | 3300021388 | Bacteria | 713 |
| 263 | Ga0224712_10038636 | 3300022467 | Bacteria | 1784 |
| 264 | Ga0224712_10061335 | 3300022467 | Unclassified | 1499 |
| 265 | Ga0224712_10071822 | 3300022467 | Bacteria | 1407 |
| 266 | Ga0224712_10154456 | 3300022467 | Unclassified | 1019 |
| 267 | Ga0224712_10172128 | 3300022467 | Bacteria | 972 |
| 268 | Ga0224712_10178748 | 3300022467 | Unclassified | 955 |
| 269 | Ga0224712_10309316 | 3300022467 | Bacteria | 740 |
| 270 | Ga0207692_10077657 | 3300025898 | Bacteria | 1767 |
| 271 | Ga0207685_10257728 | 3300025905 | Bacteria | 846 |
| 272 | Ga0207705_10037868 | 3300025909 | Bacteria | 3451 |
| 273 | Ga0207705_10131573 | 3300025909 | Bacteria | 1862 |
| 274 | Ga0207705_10297148 | 3300025909 | Bacteria | 1238 |
| 275 | Ga0207705_10534235 | 3300025909 | Bacteria | 911 |
| 276 | Ga0207654_10404137 | 3300025911 | Bacteria | 950 |
| 277 | Ga0207654_10418555 | 3300025911 | Unclassified | 934 |
| 278 | Ga0207707_10194452 | 3300025912 | Bacteria | 1769 |
| 279 | Ga0207707_10197496 | 3300025912 | Bacteria | 1754 |
| 280 | Ga0207707_10372094 | 3300025912 | Unclassified | 1229 |
| 281 | Ga0207695_10072907 | 3300025913 | Bacteria | 3501 |
| 282 | Ga0207695_10107717 | 3300025913 | Bacteria | 2772 |
| 283 | Ga0207695_10353330 | 3300025913 | Unclassified | 1357 |
| 284 | Ga0207695_10390610 | 3300025913 | Bacteria | 1276 |
| 285 | Ga0207695_10631558 | 3300025913 | Unclassified | 952 |
| 286 | Ga0207695_10950823 | 3300025913 | Bacteria | 739 |
| 287 | Ga0207695_11232240 | 3300025913 | Bacteria | 628 |
| 288 | Ga0207693_10001669 | 3300025915 | Bacteria | 19567 |
| 289 | Ga0207663_10121181 | 3300025916 | Bacteria | 1791 |
| 290 | Ga0207663_10271695 | 3300025916 | Bacteria | 1256 |
| 291 | Ga0207663_10796391 | 3300025916 | Bacteria | 752 |
| 292 | Ga0207660_10009676 | 3300025917 | Bacteria | 6239 |
| 293 | Ga0207660_10015550 | 3300025917 | Bacteria | 5023 |
| 294 | Ga0207660_10068156 | 3300025917 | Bacteria | 2580 |
| 295 | Ga0207660_10231378 | 3300025917 | Bacteria | 1453 |
| 296 | Ga0207657_10000610 | 3300025919 | Bacteria | 37898 |
| 297 | Ga0207657_10007328 | 3300025919 | Bacteria | 11317 |
| 298 | Ga0207657_10014383 | 3300025919 | Bacteria | 7727 |
| 299 | Ga0207657_10015321 | 3300025919 | Bacteria | 7431 |
| 300 | Ga0207657_10028466 | 3300025919 | Bacteria | 5097 |
| 301 | Ga0207657_10051502 | 3300025919 | Bacteria | 3578 |
| 302 | Ga0207657_10074992 | 3300025919 | Bacteria | 2855 |
| 303 | Ga0207657_10791072 | 3300025919 | Bacteria | 734 |
| 304 | Ga0207657_10998900 | 3300025919 | Bacteria | 642 |
| 305 | Ga0207649_10030091 | 3300025920 | Bacteria | 3212 |
| 306 | Ga0207649_10381068 | 3300025920 | Bacteria | 1051 |
| 307 | Ga0207649_10980125 | 3300025920 | Bacteria | 665 |
| 308 | Ga0207652_10043006 | 3300025921 | Bacteria | 3846 |
| 309 | Ga0207652_10051041 | 3300025921 | Bacteria | 3545 |
| 310 | Ga0207652_10134820 | 3300025921 | Bacteria | 2204 |
| 311 | Ga0207652_10186870 | 3300025921 | Bacteria | 1863 |
| 312 | Ga0207652_10290770 | 3300025921 | Unclassified | 1474 |
| 313 | Ga0207652_10363953 | 3300025921 | Bacteria | 1305 |
| 314 | Ga0207652_10931630 | 3300025921 | Bacteria | 766 |
| 315 | Ga0207646_10283677 | 3300025922 | Bacteria | 1497 |
| 316 | Ga0207694_10275505 | 3300025924 | Unclassified | 1381 |
| 317 | Ga0207694_10832424 | 3300025924 | Bacteria | 780 |
| 318 | Ga0207694_11339700 | 3300025924 | Bacteria | 605 |
| 319 | Ga0207687_10080006 | 3300025927 | Unclassified | 2358 |
| 320 | Ga0207687_10772740 | 3300025927 | Bacteria | 818 |
| 321 | Ga0207700_10090896 | 3300025928 | Bacteria | 2410 |
| 322 | Ga0207700_10174920 | 3300025928 | Unclassified | 1794 |
| 323 | Ga0207700_10254322 | 3300025928 | Bacteria | 1502 |
| 324 | Ga0207700_10486519 | 3300025928 | Bacteria | 1091 |
| 325 | Ga0207664_10001873 | 3300025929 | Bacteria | 13841 |
| 326 | Ga0207664_10050621 | 3300025929 | Bacteria | 3276 |
| 327 | Ga0207664_10070626 | 3300025929 | Bacteria | 2811 |
| 328 | Ga0207664_10070718 | 3300025929 | Bacteria | 2809 |
| 329 | Ga0207664_10166324 | 3300025929 | Bacteria | 1884 |
| 330 | Ga0207664_10219598 | 3300025929 | Unclassified | 1648 |
| 331 | Ga0207664_10353063 | 3300025929 | Bacteria | 1302 |
| 332 | Ga0207664_10835858 | 3300025929 | Unclassified | 828 |
| 333 | Ga0207664_11715841 | 3300025929 | Bacteria | 550 |
| 334 | Ga0207644_10104367 | 3300025931 | Bacteria | 2134 |
| 335 | Ga0207644_10253236 | 3300025931 | Bacteria | 1405 |
| 336 | Ga0207644_10496440 | 3300025931 | Unclassified | 1006 |
| 337 | Ga0207690_10779796 | 3300025932 | Bacteria | 789 |
| 338 | Ga0207709_10947906 | 3300025935 | Bacteria | 701 |
| 339 | Ga0207709_11804404 | 3300025935 | Unclassified | 509 |
| 340 | Ga0207669_10634159 | 3300025937 | Unclassified | 872 |
| 341 | Ga0207665_10000697 | 3300025939 | Bacteria | 22783 |
| 342 | Ga0207665_10369286 | 3300025939 | Bacteria | 1086 |
| 343 | Ga0207665_11150337 | 3300025939 | Bacteria | 619 |
| 344 | Ga0207711_10109514 | 3300025941 | Bacteria | 2454 |
| 345 | Ga0207711_10576237 | 3300025941 | Bacteria | 1050 |
| 346 | Ga0207661_10265081 | 3300025944 | Unclassified | 1531 |
| 347 | Ga0207661_10298655 | 3300025944 | Bacteria | 1443 |
| 348 | Ga0207661_11344662 | 3300025944 | Unclassified | 656 |
| 349 | Ga0207661_11741922 | 3300025944 | Unclassified | 568 |
| 350 | Ga0207679_10029791 | 3300025945 | Bacteria | 3804 |
| 351 | Ga0207679_11611240 | 3300025945 | Unclassified | 595 |
| 352 | Ga0207667_10108075 | 3300025949 | Bacteria | 2870 |
| 353 | Ga0207667_10441268 | 3300025949 | Bacteria | 1323 |
| 354 | Ga0207667_10642487 | 3300025949 | Bacteria | 1067 |
| 355 | Ga0207667_10880719 | 3300025949 | Unclassified | 888 |
| 356 | Ga0207667_11286530 | 3300025949 | Bacteria | 708 |
| 357 | Ga0207712_10693394 | 3300025961 | Unclassified | 888 |
| 358 | Ga0207677_10019282 | 3300026023 | Bacteria | 4117 |
| 359 | Ga0207639_10253291 | 3300026041 | Unclassified | 1536 |
| 360 | Ga0207639_10293066 | 3300026041 | Bacteria | 1435 |
| 361 | Ga0207639_11942243 | 3300026041 | Bacteria | 549 |
| 362 | Ga0207678_10061643 | 3300026067 | Bacteria | 3226 |
| 363 | Ga0207678_11347821 | 3300026067 | Bacteria | 631 |
| 364 | Ga0207702_10027351 | 3300026078 | Bacteria | 4736 |
| 365 | Ga0207702_10114004 | 3300026078 | Bacteria | 2408 |
| 366 | Ga0207702_10249755 | 3300026078 | Unclassified | 1665 |
| 367 | Ga0207702_10574363 | 3300026078 | Bacteria | 1105 |
| 368 | Ga0207702_10697563 | 3300026078 | Bacteria | 1000 |
| 369 | Ga0207702_10741031 | 3300026078 | Unclassified | 970 |
| 370 | Ga0207674_10020357 | 3300026116 | Bacteria | 7168 |
| 371 | Ga0207674_10974624 | 3300026116 | Unclassified | 817 |
| 372 | Ga0207698_10014358 | 3300026142 | Bacteria | 5262 |
| 373 | Ga0207698_10068419 | 3300026142 | Bacteria | 2804 |
| 374 | Ga0207698_10315668 | 3300026142 | Unclassified | 1461 |
| 375 | Ga0207698_10384295 | 3300026142 | Bacteria | 1337 |
| 376 | Ga0207698_11216514 | 3300026142 | Unclassified | 767 |
| 377 | Ga0207698_11416092 | 3300026142 | Unclassified | 710 |
| 378 | Ga0207698_11518415 | 3300026142 | Bacteria | 685 |
| 379 | Ga0268266_10150474 | 3300028379 | Bacteria | 2097 |
| 380 | Ga0268266_10475789 | 3300028379 | Bacteria | 1190 |
| 381 | Ga0373926_0136682 | 3300035083 | Unclassified | 930 |
| 382 | Ga0373940_0151560 | 3300035088 | Bacteria | 739 |
| 383 | Ga0373944_0057674 | 3300035089 | Bacteria | 1238 |
| 384 | Ga0373944_0105383 | 3300035089 | Unclassified | 957 |
| 385 | Ga0373936_0030148 | 3300035113 | Bacteria | 2139 |
| 386 | Ga0373945_0001630 | 3300035116 | Bacteria | 6879 |
| 387 | Ga0373943_0045087 | 3300035170 | Bacteria | 2148 |
| 388 | Ga0373946_0216545 | 3300035171 | Unclassified | 923 |
| 389 | Ga0373961_0323302 | 3300035241 | Bacteria | 576 |
| 390 | Ga0373931_0129252 | 3300035691 | Bacteria | 1452 |
| 391 | Ga0373935_0069203 | 3300035692 | Unclassified | 2273 |
| 392 | Ga0373927_0030667 | 3300035695 | Bacteria | 3508 |
| 393 | Ga0373947_0011462 | 3300035725 | Bacteria | 5085 |
| 394 | Ga0373947_0024837 | 3300035725 | Bacteria | 3494 |
| 395 | Ga0373925_0096040 | 3300037068 | Bacteria | 2271 |
| 396 | Ga0373925_0349457 | 3300037068 | Unclassified | 1200 |
| 397 | Ga0373925_1433929 | 3300037068 | Unclassified | 565 |
| 398 | Ga0395899_0093177 | 3300037312 | Bacteria | 2181 |
| 399 | Ga0395899_0125787 | 3300037312 | Bacteria | 1833 |
| 400 | Ga0395899_0243235 | 3300037312 | Bacteria | 1237 |
| 401 | Ga0395899_0369479 | 3300037312 | Unclassified | 955 |
| 402 | Ga0395899_0559961 | 3300037312 | Bacteria | 733 |
| 403 | Ga0395900_0006366 | 3300037418 | Bacteria | 12310 |
| 404 | Ga0395900_0059693 | 3300037418 | Bacteria | 3926 |
| 405 | Ga0395900_0060217 | 3300037418 | Bacteria | 3908 |
| 406 | Ga0395900_0114616 | 3300037418 | Bacteria | 2766 |
| 407 | Ga0395900_0607575 | 3300037418 | Bacteria | 1033 |
| 408 | Ga0395900_0914854 | 3300037418 | Bacteria | 800 |
| 409 | Ga0395900_0932874 | 3300037418 | Bacteria | 790 |
| 410 | Ga0395898_0003052 | 3300037466 | Bacteria | 18969 |
| 411 | Ga0395898_0015914 | 3300037466 | Bacteria | 7707 |
| 412 | Ga0395898_0039754 | 3300037466 | Bacteria | 4654 |
| 413 | Ga0395898_0118398 | 3300037466 | Bacteria | 2537 |
| 414 | Ga0395898_0198638 | 3300037466 | Unclassified | 1915 |
| 415 | Ga0395898_0268505 | 3300037466 | Bacteria | 1627 |
| 416 | Ga0395898_0364289 | 3300037466 | Bacteria | 1378 |
| 417 | Ga0395898_0652545 | 3300037466 | Bacteria | 995 |
| 418 | Ga0395898_0759985 | 3300037466 | Bacteria | 910 |
| 419 | Ga0395898_0776044 | 3300037466 | Unclassified | 899 |
| 420 | Ga0395898_0776224 | 3300037466 | Unclassified | 899 |
| 421 | Ga0395898_0852343 | 3300037466 | Bacteria | 850 |
| 422 | Ga0395898_1166626 | 3300037466 | Unclassified | 702 |
| 423 | Ga0395905_0031972 | 3300037471 | Bacteria | 4951 |
| 424 | Ga0395905_0035129 | 3300037471 | Bacteria | 4706 |
| 425 | Ga0395905_0314253 | 3300037471 | Bacteria | 1455 |
| 426 | Ga0395905_0590223 | 3300037471 | Bacteria | 1013 |
| 427 | Ga0436364_0327379 | 3300037853 | Bacteria | 813 |
| 428 | Ga0395901_0001077 | 3300038443 | Bacteria | 29182 |
| 429 | Ga0395901_0002248 | 3300038443 | Bacteria | 19701 |
| 430 | Ga0395901_0002794 | 3300038443 | Bacteria | 17608 |
| 431 | Ga0395901_0196113 | 3300038443 | Unclassified | 2117 |
| 432 | Ga0395901_0306413 | 3300038443 | Bacteria | 1646 |
| 433 | Ga0395901_0331342 | 3300038443 | Bacteria | 1574 |
| 434 | Ga0395901_0373439 | 3300038443 | Unclassified | 1469 |
| 435 | Ga0395901_0608783 | 3300038443 | Bacteria | 1101 |
| 436 | Ga0395901_0972708 | 3300038443 | Unclassified | 826 |
| 437 | Ga0395901_1076895 | 3300038443 | Bacteria | 775 |
| 438 | Ga0395901_2023693 | 3300038443 | Bacteria | 522 |
| 439 | Ga0242420_016164 | 3300038996 | Unclassified | 1297 |
| 440 | Ga0436365_0271194 | 3300039437 | Bacteria | 873 |
| 441 | Ga0436365_1501848 | 3300039437 | Bacteria | 1363 |
| 442 | Ga0436363_0023636 | 3300039450 | Bacteria | 661 |
| 443 | Ga0436363_0204153 | 3300039450 | Unclassified | 1238 |
| 444 | Ga0436363_0218760 | 3300039450 | Bacteria | 780 |
| 445 | Ga0436363_1597774 | 3300039450 | Unclassified | 2596 |
| 446 | Ga0439448_0332889 | 3300042005 | Unclassified | 541 |
| 447 | Ga0450896_063450 | 3300042133 | Bacteria | 604 |
| 448 | Ga0450910_025421 | 3300042147 | Bacteria | 911 |
| 449 | Ga0466965_0161312 | 3300044683 | Unclassified | 1176 |
| 450 | Ga0466965_0203792 | 3300044683 | Bacteria | 1050 |
| 451 | Ga0466966_0076449 | 3300044684 | Bacteria | 2091 |
| 452 | Ga0466966_0108060 | 3300044684 | Unclassified | 1716 |
| 453 | Ga0466966_0179796 | 3300044684 | Viruses | 1284 |
| 454 | Ga0466966_0332638 | 3300044684 | Bacteria | 913 |
| 455 | Ga0466961_0030837 | 3300044693 | Bacteria | 3445 |
| 456 | Ga0466961_0081812 | 3300044693 | Bacteria | 2043 |
| 457 | Ga0466961_0316752 | 3300044693 | Bacteria | 952 |
| 458 | Ga0466963_0000800 | 3300044694 | Bacteria | 15702 |
| 459 | Ga0466963_0003084 | 3300044694 | Bacteria | 9444 |
| 460 | Ga0466963_0007320 | 3300044694 | Bacteria | 6579 |
| 461 | Ga0466963_0015593 | 3300044694 | Bacteria | 4710 |
| 462 | Ga0466963_0022974 | 3300044694 | Bacteria | 3955 |
| 463 | Ga0466963_0029600 | 3300044694 | Bacteria | 3526 |
| 464 | Ga0466963_0032659 | 3300044694 | Bacteria | 3373 |
| 465 | Ga0466963_0037124 | 3300044694 | Bacteria | 3180 |
| 466 | Ga0466963_0041137 | 3300044694 | Bacteria | 3030 |
| 467 | Ga0466963_0043211 | 3300044694 | Bacteria | 2962 |
| 468 | Ga0466963_0044102 | 3300044694 | Bacteria | 2935 |
| 469 | Ga0466963_0050303 | 3300044694 | Bacteria | 2758 |
| 470 | Ga0466963_0058197 | 3300044694 | Bacteria | 2576 |
| 471 | Ga0466963_0115475 | 3300044694 | Bacteria | 1845 |
| 472 | Ga0466963_0123728 | 3300044694 | Bacteria | 1782 |
| 473 | Ga0466963_0127566 | 3300044694 | Unclassified | 1755 |
| 474 | Ga0466963_0204471 | 3300044694 | Bacteria | 1381 |
| 475 | Ga0466963_0244999 | 3300044694 | Unclassified | 1257 |
| 476 | Ga0466963_0397272 | 3300044694 | Bacteria | 972 |
| 477 | Ga0466963_0475436 | 3300044694 | Bacteria | 882 |
| 478 | Ga0466963_0514536 | 3300044694 | Bacteria | 845 |
| 479 | Ga0466963_0759148 | 3300044694 | Bacteria | 684 |
| 480 | Ga0466963_0874978 | 3300044694 | Unclassified | 633 |
| 481 | Ga0466964_0006768 | 3300044706 | Bacteria | 4273 |
| 482 | Ga0466964_0013339 | 3300044706 | Bacteria | 3117 |
| 483 | Ga0466964_0027358 | 3300044706 | Bacteria | 2239 |
| 484 | Ga0466964_0228352 | 3300044706 | Bacteria | 907 |
| 485 | Ga0466964_0234041 | 3300044706 | Bacteria | 898 |
| 486 | Ga0453684_0953700 | 3300044712 | Bacteria | 915 |
| 487 | Ga0466971_0099835 | 3300044719 | Unclassified | 1333 |
| 488 | Ga0466971_0195723 | 3300044719 | Bacteria | 953 |
| 489 | Ga0466968_0023323 | 3300044735 | Unclassified | 2520 |
| 490 | Ga0466968_0266383 | 3300044735 | Unclassified | 817 |
| 491 | Ga0466957_0009772 | 3300044842 | Bacteria | 5482 |
| 492 | Ga0466957_0020693 | 3300044842 | Bacteria | 3873 |
| 493 | Ga0466957_0035751 | 3300044842 | Bacteria | 2982 |
| 494 | Ga0466957_0051770 | 3300044842 | Bacteria | 2499 |
| 495 | Ga0466957_0121220 | 3300044842 | Bacteria | 1667 |
| 496 | Ga0466957_0148443 | 3300044842 | Bacteria | 1515 |
| 497 | Ga0466957_0226062 | 3300044842 | Unclassified | 1237 |
| 498 | Ga0466957_0451877 | 3300044842 | Bacteria | 885 |
| 499 | Ga0466957_0576268 | 3300044842 | Bacteria | 786 |
| 500 | Ga0466957_0668443 | 3300044842 | Bacteria | 731 |
| 501 | Ga0466957_0809892 | 3300044842 | Bacteria | 666 |
| 502 | Ga0466960_0012696 | 3300044901 | Unclassified | 3561 |
| 503 | Ga0466960_0064761 | 3300044901 | Bacteria | 1803 |
| 504 | Ga0466960_0116369 | 3300044901 | Bacteria | 1395 |
| 505 | Ga0466960_0584063 | 3300044901 | Unclassified | 662 |
| 506 | Ga0466959_0007928 | 3300045049 | Bacteria | 7480 |
| 507 | Ga0466959_0137293 | 3300045049 | Bacteria | 1730 |
| 508 | Ga0466959_0149398 | 3300045049 | Bacteria | 1648 |
| 509 | Ga0466959_1141638 | 3300045049 | Bacteria | 518 |
| 510 | Ga0466958_0009601 | 3300045836 | Bacteria | 5396 |
| 511 | Ga0466958_0045871 | 3300045836 | Bacteria | 2637 |
| 512 | Ga0466958_0053955 | 3300045836 | Bacteria | 2437 |
| 513 | Ga0466958_0092055 | 3300045836 | Unclassified | 1877 |
| 514 | Ga0466958_0112108 | 3300045836 | Bacteria | 1703 |
| 515 | Ga0466958_0172711 | 3300045836 | Bacteria | 1369 |
| 516 | Ga0466958_0917975 | 3300045836 | Bacteria | 571 |
| 517 | Ga0466967_0001650 | 3300045976 | Bacteria | 13207 |
| 518 | Ga0466967_0003929 | 3300045976 | Bacteria | 9875 |
| 519 | Ga0466967_0009948 | 3300045976 | Bacteria | 7101 |
| 520 | Ga0466967_0010954 | 3300045976 | Bacteria | 6835 |
| 521 | Ga0466967_0011760 | 3300045976 | Bacteria | 6654 |
| 522 | Ga0466967_0024940 | 3300045976 | Bacteria | 4923 |
| 523 | Ga0466967_0026785 | 3300045976 | Bacteria | 4783 |
| 524 | Ga0466967_0026862 | 3300045976 | Bacteria | 4778 |
| 525 | Ga0466967_0032789 | 3300045976 | Bacteria | 4390 |
| 526 | Ga0466967_0034755 | 3300045976 | Bacteria | 4282 |
| 527 | Ga0466967_0046828 | 3300045976 | Bacteria | 3767 |
| 528 | Ga0466967_0049995 | 3300045976 | Bacteria | 3659 |
| 529 | Ga0466967_0064794 | 3300045976 | Bacteria | 3251 |
| 530 | Ga0466967_0070542 | 3300045976 | Bacteria | 3126 |
| 531 | Ga0466967_0083833 | 3300045976 | Bacteria | 2883 |
| 532 | Ga0466967_0090999 | 3300045976 | Bacteria | 2772 |
| 533 | Ga0466967_0099158 | 3300045976 | Bacteria | 2660 |
| 534 | Ga0466967_0115828 | 3300045976 | Bacteria | 2469 |
| 535 | Ga0466967_0117596 | 3300045976 | Bacteria | 2451 |
| 536 | Ga0466967_0126431 | 3300045976 | Bacteria | 2368 |
| 537 | Ga0466967_0138376 | 3300045976 | Bacteria | 2266 |
| 538 | Ga0466967_0139084 | 3300045976 | Archaea | 2260 |
| 539 | Ga0466967_0173635 | 3300045976 | Bacteria | 2029 |
| 540 | Ga0466967_0241731 | 3300045976 | Bacteria | 1722 |
| 541 | Ga0466967_0367264 | 3300045976 | Bacteria | 1395 |
| 542 | Ga0466967_0490107 | 3300045976 | Bacteria | 1205 |
| 543 | Ga0466967_0529057 | 3300045976 | Bacteria | 1159 |
| 544 | Ga0466967_0539827 | 3300045976 | Bacteria | 1147 |
| 545 | Ga0466967_0657172 | 3300045976 | Unclassified | 1037 |
| 546 | Ga0466967_0725873 | 3300045976 | Unclassified | 985 |
| 547 | Ga0466967_0828293 | 3300045976 | Bacteria | 919 |
| 548 | Ga0466967_0862235 | 3300045976 | Unclassified | 900 |
| 549 | Ga0466967_1109082 | 3300045976 | Bacteria | 788 |
| 550 | Ga0466967_1313347 | 3300045976 | Unclassified | 720 |
| 551 | Ga0466967_1743966 | 3300045976 | Unclassified | 620 |
| 552 | Ga0495592_0084585 | 3300046454 | Bacteria | 2288 |
| 553 | Ga0495603_0152900 | 3300046455 | Bacteria | 1340 |
| 554 | Ga0495603_0216500 | 3300046455 | Unclassified | 1105 |
| 555 | Ga0495641_0014671 | 3300046461 | Bacteria | 4229 |
| 556 | Ga0495641_0045062 | 3300046461 | Unclassified | 2032 |
| 557 | Ga0495653_0109744 | 3300046463 | Bacteria | 1985 |
| 558 | Ga0495653_0277401 | 3300046463 | Unclassified | 1101 |
| 559 | Ga0495582_0160736 | 3300046473 | Unclassified | 1277 |
| 560 | Ga0495582_0194966 | 3300046473 | Bacteria | 1156 |
| 561 | Ga0495664_0017420 | 3300046477 | Bacteria | 4107 |
| 562 | Ga0495608_0454574 | 3300046511 | Unclassified | 779 |
| 563 | Ga0495628_0802240 | 3300046516 | Unclassified | 658 |
| 564 | Ga0495630_0094779 | 3300046517 | Bacteria | 2256 |
| 565 | Ga0495630_0841849 | 3300046517 | Unclassified | 700 |
| 566 | Ga0495630_1176060 | 3300046517 | Unclassified | 580 |
| 567 | Ga0495652_0035618 | 3300046529 | Bacteria | 4331 |
| 568 | Ga0495652_1069308 | 3300046529 | Unclassified | 525 |
| 569 | Ga0495665_0193312 | 3300046531 | Unclassified | 1056 |
| 570 | Ga0495665_0370990 | 3300046531 | Bacteria | 728 |
| 571 | Ga0495640_0521511 | 3300046533 | Unclassified | 722 |
| 572 | Ga0495640_0601894 | 3300046533 | Bacteria | 664 |
| 573 | Ga0495587_0190498 | 3300046536 | Unclassified | 1161 |
| 574 | Ga0495587_0392811 | 3300046536 | Unclassified | 771 |
| 575 | Ga0495645_0352589 | 3300046543 | Bacteria | 948 |
| 576 | Ga0495635_0084563 | 3300046663 | Bacteria | 2171 |
| 577 | Ga0495635_0470007 | 3300046663 | Unclassified | 830 |
| 578 | Ga0495635_1109320 | 3300046663 | Bacteria | 500 |
| 579 | Ga0495657_0270888 | 3300046675 | Bacteria | 1018 |
| 580 | Ga0495599_0005723 | 3300046678 | Bacteria | 7456 |
| 581 | Ga0495599_0670515 | 3300046678 | Bacteria | 600 |
| 582 | Ga0495623_0193197 | 3300046679 | Bacteria | 1175 |
| 583 | Ga0495646_0696665 | 3300046680 | Unclassified | 511 |
| 584 | Ga0495647_0100375 | 3300046681 | Bacteria | 1198 |
| 585 | Ga0495658_0033856 | 3300046683 | Unclassified | 2801 |
| 586 | Ga0495658_0090113 | 3300046683 | Bacteria | 1815 |
| 587 | Ga0495613_0324931 | 3300046689 | Unclassified | 1061 |
| 588 | Ga0495613_0367176 | 3300046689 | Unclassified | 986 |
| 589 | Ga0495624_0294880 | 3300046690 | Unclassified | 978 |
| 590 | Ga0495600_0209339 | 3300046809 | Unclassified | 1250 |
| 591 | Ga0495600_0406951 | 3300046809 | Bacteria | 846 |
| 592 | Ga0495604_0276825 | 3300047317 | Bacteria | 1135 |
| 593 | Ga0495674_0208630 | 3300047319 | Bacteria | 1619 |
| 594 | Ga0495676_0072676 | 3300047321 | Bacteria | 2640 |
| 595 | Ga0495676_0741356 | 3300047321 | Bacteria | 634 |
| 596 | Ga0495680_0206891 | 3300047322 | Bacteria | 1406 |
| 597 | Ga0495684_0213316 | 3300047471 | Unclassified | 1418 |
| 598 | Ga0495684_0748374 | 3300047471 | Unclassified | 643 |
| 599 | Ga0495593_0139775 | 3300047673 | Bacteria | 1227 |
| 600 | Ga0495602_0067123 | 3300048088 | Bacteria | 3087 |
| 601 | Ga0495602_0405080 | 3300048088 | Bacteria | 972 |
| 602 | Ga0496100_0007242 | 3300048903 | Bacteria | 6102 |
| 603 | Ga0496100_0028330 | 3300048903 | Bacteria | 3454 |
| 604 | Ga0496100_0029834 | 3300048903 | Bacteria | 3377 |
| 605 | Ga0496100_0066666 | 3300048903 | Bacteria | 2388 |
| 606 | Ga0496100_0189091 | 3300048903 | Bacteria | 1494 |
| 607 | Ga0496101_0000942 | 3300048904 | Bacteria | 17171 |
| 608 | Ga0496101_0004779 | 3300048904 | Bacteria | 8591 |
| 609 | Ga0496101_0192197 | 3300048904 | Bacteria | 1575 |
| 610 | Ga0496101_0691558 | 3300048904 | Bacteria | 805 |
| 611 | Ga0496101_1232979 | 3300048904 | Unclassified | 586 |
| 612 | Ga0496102_0022352 | 3300048905 | Bacteria | 5604 |
| 613 | Ga0496102_0045321 | 3300048905 | Bacteria | 3993 |
| 614 | Ga0496102_0082660 | 3300048905 | Bacteria | 2962 |
| 615 | Ga0496102_0083397 | 3300048905 | Bacteria | 2949 |
| 616 | Ga0496102_0481964 | 3300048905 | Bacteria | 1162 |
| 617 | Ga0496102_0705276 | 3300048905 | Unclassified | 932 |
| 618 | Ga0496102_0817054 | 3300048905 | Unclassified | 854 |
| 619 | Ga0496102_1350070 | 3300048905 | Bacteria | 632 |
| 620 | Ga0496103_0022510 | 3300048906 | Bacteria | 3795 |
| 621 | Ga0496103_0087031 | 3300048906 | Bacteria | 1969 |
| 622 | Ga0496103_0164166 | 3300048906 | Bacteria | 1425 |
| 623 | Ga0496103_0389610 | 3300048906 | Unclassified | 895 |
| 624 | Ga0496104_0003290 | 3300048907 | Bacteria | 13945 |
| 625 | Ga0496104_0003782 | 3300048907 | Bacteria | 13095 |
| 626 | Ga0496104_0026674 | 3300048907 | Bacteria | 5338 |
| 627 | Ga0496104_0434976 | 3300048907 | Bacteria | 1224 |
| 628 | Ga0496104_0712001 | 3300048907 | Bacteria | 911 |
| 629 | Ga0496104_0802276 | 3300048907 | Unclassified | 847 |
| 630 | Ga0496104_0973212 | 3300048907 | Bacteria | 753 |
| 631 | Ga0496105_0000305 | 3300048908 | Bacteria | 32361 |
| 632 | Ga0496105_0002512 | 3300048908 | Bacteria | 13305 |
| 633 | Ga0496105_0026985 | 3300048908 | Bacteria | 4688 |
| 634 | Ga0496105_0053883 | 3300048908 | Bacteria | 3322 |
| 635 | Ga0496105_0170292 | 3300048908 | Bacteria | 1785 |
| 636 | Ga0496105_0243423 | 3300048908 | Bacteria | 1459 |
| 637 | Ga0496105_0386525 | 3300048908 | Bacteria | 1113 |
| 638 | Ga0496105_0418663 | 3300048908 | Unclassified | 1061 |
| 639 | Ga0496105_0550130 | 3300048908 | Bacteria | 901 |
| 640 | Ga0496106_0000850 | 3300048909 | Bacteria | 22149 |
| 641 | Ga0496106_0038856 | 3300048909 | Bacteria | 3563 |
| 642 | Ga0496106_0047021 | 3300048909 | Bacteria | 3245 |
| 643 | Ga0496106_0060710 | 3300048909 | Bacteria | 2866 |
| 644 | Ga0496106_0085795 | 3300048909 | Bacteria | 2424 |
| 645 | Ga0496106_0238636 | 3300048909 | Bacteria | 1452 |
| 646 | Ga0496106_0608939 | 3300048909 | Bacteria | 875 |
| 647 | Ga0496107_0004295 | 3300048910 | Bacteria | 9643 |
| 648 | Ga0496107_0022389 | 3300048910 | Bacteria | 4465 |
| 649 | Ga0496107_0026465 | 3300048910 | Bacteria | 4112 |
| 650 | Ga0496107_0103432 | 3300048910 | Bacteria | 2089 |
| 651 | Ga0496107_0104721 | 3300048910 | Bacteria | 2076 |
| 652 | Ga0496107_0117846 | 3300048910 | Bacteria | 1955 |
| 653 | Ga0496107_0630077 | 3300048910 | Bacteria | 791 |
| 654 | Ga0496108_0026954 | 3300048911 | Bacteria | 4742 |
| 655 | Ga0496108_0030948 | 3300048911 | Bacteria | 4436 |
| 656 | Ga0496108_0134819 | 3300048911 | Unclassified | 2123 |
| 657 | Ga0496108_0414994 | 3300048911 | Unclassified | 1176 |
| 658 | Ga0496108_0652541 | 3300048911 | Unclassified | 915 |
| 659 | Ga0496108_0837412 | 3300048911 | Bacteria | 792 |
| 660 | Ga0496109_0002785 | 3300048912 | Bacteria | 14649 |
| 661 | Ga0496109_0005751 | 3300048912 | Bacteria | 10374 |
| 662 | Ga0496109_0037444 | 3300048912 | Plasmid | 4381 |
| 663 | Ga0496109_0194815 | 3300048912 | Bacteria | 1905 |
| 664 | Ga0496109_0363174 | 3300048912 | Unclassified | 1368 |
| 665 | Ga0496109_0393329 | 3300048912 | Unclassified | 1310 |
| 666 | Ga0496109_0486460 | 3300048912 | Bacteria | 1165 |
| 667 | Ga0496109_0680722 | 3300048912 | Bacteria | 966 |
| 668 | Ga0496109_0912085 | 3300048912 | Bacteria | 817 |
| 669 | Ga0496109_1312715 | 3300048912 | Bacteria | 659 |
| 670 | Ga0496109_1734689 | 3300048912 | Bacteria | 558 |
| 671 | Ga0496110_0006758 | 3300048913 | Bacteria | 9124 |
| 672 | Ga0496110_0126637 | 3300048913 | Unclassified | 2305 |
| 673 | Ga0496110_0187473 | 3300048913 | Bacteria | 1878 |
| 674 | Ga0496111_0022652 | 3300048914 | Bacteria | 4400 |
| 675 | Ga0496111_0062911 | 3300048914 | Unclassified | 2691 |
| 676 | Ga0496111_0065505 | 3300048914 | Bacteria | 2637 |
| 677 | Ga0496111_0210858 | 3300048914 | Bacteria | 1443 |
| 678 | Ga0496111_0868831 | 3300048914 | Unclassified | 650 |
| 679 | Ga0496112_0007452 | 3300048915 | Bacteria | 9715 |
| 680 | Ga0496112_0025360 | 3300048915 | Bacteria | 5693 |
| 681 | Ga0496112_0043433 | 3300048915 | Plasmid | 4401 |
| 682 | Ga0496112_0219121 | 3300048915 | Bacteria | 1859 |
| 683 | Ga0496112_0447719 | 3300048915 | Unclassified | 1229 |
| 684 | Ga0496112_0745752 | 3300048915 | Bacteria | 906 |
| 685 | Ga0496112_0853353 | 3300048915 | Bacteria | 834 |
| 686 | Ga0496113_0015437 | 3300048916 | Bacteria | 5248 |
| 687 | Ga0496113_0069137 | 3300048916 | Bacteria | 2681 |
| 688 | Ga0496113_0071154 | 3300048916 | Bacteria | 2646 |
| 689 | Ga0496113_0344522 | 3300048916 | Bacteria | 1195 |
| 690 | Ga0496113_0952998 | 3300048916 | Unclassified | 677 |
| 691 | Ga0496114_0009801 | 3300048917 | Bacteria | 7611 |
| 692 | Ga0496114_0018256 | 3300048917 | Bacteria | 5669 |
| 693 | Ga0496114_0187016 | 3300048917 | Bacteria | 1810 |
| 694 | Ga0496114_0251819 | 3300048917 | Unclassified | 1554 |
| 695 | Ga0496114_0297427 | 3300048917 | Bacteria | 1425 |
| 696 | Ga0496114_0567249 | 3300048917 | Unclassified | 1002 |
| 697 | Ga0496115_0001257 | 3300048918 | Bacteria | 18199 |
| 698 | Ga0496115_0080295 | 3300048918 | Bacteria | 2655 |
| 699 | Ga0496115_0135068 | 3300048918 | Bacteria | 2034 |
| 700 | Ga0496115_0240609 | 3300048918 | Bacteria | 1491 |
| 701 | Ga0496115_0709378 | 3300048918 | Unclassified | 790 |
| 702 | Ga0496115_1013354 | 3300048918 | Unclassified | 634 |
| 703 | Ga0501036_0881988 | 3300049572 | Bacteria | 735 |
| 704 | Ga0501038_0241788 | 3300049574 | Bacteria | 1433 |
| 705 | Ga0501039_0242516 | 3300049575 | Unclassified | 1417 |
| 706 | Ga0501040_0052568 | 3300049576 | Unclassified | 2789 |
| 707 | Ga0501046_0295621 | 3300049580 | Bacteria | 1184 |
| 708 | Ga0501047_0124743 | 3300049581 | Bacteria | 2456 |
| 709 | Ga0501067_0000154 | 3300049583 | Bacteria | 38151 |
| 710 | Ga0501067_0009568 | 3300049583 | Bacteria | 5368 |
| 711 | Ga0501067_0167920 | 3300049583 | Unclassified | 1222 |
| 712 | Ga0501067_0857999 | 3300049583 | Unclassified | 512 |
| 713 | Ga0501068_0319351 | 3300049584 | Bacteria | 995 |
| 714 | Ga0501068_0587466 | 3300049584 | Unclassified | 725 |
| 715 | Ga0501069_0001465 | 3300049585 | Bacteria | 11614 |
| 716 | Ga0501070_0080184 | 3300049586 | Bacteria | 2701 |
| 717 | Ga0501070_0109291 | 3300049586 | Bacteria | 2285 |
| 718 | Ga0501072_0019912 | 3300049588 | Bacteria | 5193 |
| 719 | Ga0501073_0035240 | 3300049589 | Bacteria | 3558 |
| 720 | Ga0501073_0904857 | 3300049589 | Unclassified | 608 |
| 721 | Ga0501074_0017406 | 3300049590 | Bacteria | 5215 |
| 722 | Ga0501076_0285957 | 3300049592 | Bacteria | 1351 |
| 723 | Ga0501077_0014036 | 3300049593 | Bacteria | 5024 |
| 724 | Ga0501079_0040961 | 3300049741 | Bacteria | 3575 |
| 725 | Ga0501080_0030789 | 3300049742 | Bacteria | 4999 |
| 726 | Ga0501080_0109469 | 3300049742 | Unclassified | 2561 |
| 727 | Ga0501081_0039406 | 3300049743 | Unclassified | 3233 |
| 728 | Ga0501083_0001263 | 3300049744 | Bacteria | 17161 |
| 729 | Ga0501083_0957563 | 3300049744 | Bacteria | 557 |
| 730 | Ga0501044_0317589 | 3300049823 | Bacteria | 1483 |
| 731 | nmdc:mga05p37_2932_c1 | 3300050507 | Bacteria | 19794 |
| 732 | nmdc:mga0n895_66084_c1 | 3300050512 | Bacteria | 3581 |
| 733 | nmdc:mga0a205_21088_c2 | 3300050515 | Bacteria | 1680 |
| 734 | Ga0495601_0019187 | 3300053077 | Bacteria | 4168 |
| 735 | Ga0495601_0244229 | 3300053077 | Bacteria | 1172 |
| 736 | Ga0495612_0003911 | 3300053078 | Bacteria | 6176 |
| 737 | Ga0495612_0318304 | 3300053078 | Bacteria | 699 |
| 738 | Ga0495655_0131090 | 3300053083 | Bacteria | 772 |
| 739 | Ga0495595_0027283 | 3300053084 | Bacteria | 2543 |
| 740 | Ga0495595_0641598 | 3300053084 | Unclassified | 543 |
| 741 | Ga0495619_0111417 | 3300053085 | Unclassified | 1870 |
| 742 | Ga0495619_0414568 | 3300053085 | Unclassified | 929 |
| 743 | Ga0495619_0571228 | 3300053085 | Unclassified | 775 |
| 744 | Ga0501084_0718257 | 3300054114 | Unclassified | 842 |
| 745 | Ga0587083_0065028 | 3300059505 | Bacteria | 832 |
| 746 | Ga0587128_013202 | 3300059630 | Unclassified | 1162 |
| 747 | Ga0501082_0107763 | 3300060353 | Bacteria | 2410 |
| 748 | Ga0501082_1802419 | 3300060353 | Bacteria | 534 |
| 749 | Ga0466962_0024612 | 3300061719 | Bacteria | 2891 |
| 750 | Ga0466962_0176093 | 3300061719 | Unclassified | 1042 |
| 751 | Ga0466962_0289718 | 3300061719 | Bacteria | 809 |
| 752 | Ga0466962_0307267 | 3300061719 | Bacteria | 785 |
| 753 | Ga0466962_0496428 | 3300061719 | Bacteria | 617 |
| 754 | Ga0530510_0075135 | 3300061734 | Bacteria | 2454 |
| 755 | Ga0530510_0528604 | 3300061734 | Bacteria | 895 |
| 756 | Ga0207641_10448400 | |||
| 757 | JGI25407J50210_10006441 | |||
| 758 | Ga0070658_10013356 | |||
| 759 | Ga0070658_10022886 | |||
| 760 | Ga0070658_10054259 | |||
| 761 | Ga0070658_10089706 | |||
| 762 | Ga0070658_10233268 | |||
| 763 | Ga0070658_10265741 | |||
| 764 | Ga0070658_10356711 | |||
| 765 | Ga0070658_10903412 | |||
| 766 | Ga0070683_100018974 | |||
| 767 | Ga0070683_100117686 | |||
| 768 | Ga0070683_100193777 | |||
| 769 | Ga0070683_100279974 | |||
| 770 | Ga0070683_101008735 | |||
| 771 | Ga0070683_101505068 | |||
| 772 | Ga0070683_101775171 | |||
| 773 | Ga0070680_100020648 | |||
| 774 | Ga0070680_100036319 | |||
| 775 | Ga0070680_100042889 | |||
| 776 | Ga0070682_100040572 | |||
| 777 | Ga0070682_100124291 | |||
| 778 | Ga0070682_100417252 | |||
| 779 | Ga0070682_101293779 | |||
| 780 | Ga0068868_100195637 | |||
| 781 | Ga0070660_100013224 | |||
| 782 | Ga0070660_100045995 | |||
| 783 | Ga0070660_100059769 | |||
| 784 | Ga0070660_100065879 | |||
| 785 | Ga0070660_100452308 | |||
| 786 | Ga0070691_10736978 | |||
| 787 | Ga0070661_100014955 | |||
| 788 | Ga0070661_100021648 | |||
| 789 | Ga0070661_100074572 | |||
| 790 | Ga0070661_100135069 | |||
| 791 | Ga0070671_100053232 | |||
| 792 | Ga0070671_100291406 | |||
| 793 | Ga0070674_101611430 | |||
| 794 | Ga0070659_100098463 | |||
| 795 | Ga0070659_100148182 | |||
| 796 | Ga0070659_100529653 | |||
| 797 | Ga0070667_101477221 | |||
| 798 | Ga0070703_10148867 | |||
| 799 | Ga0070709_10011853 | |||
| 800 | Ga0070709_10113962 | |||
| 801 | Ga0070714_100013640 | |||
| 802 | Ga0070714_100120654 | |||
| 803 | Ga0070714_100150441 | |||
| 804 | Ga0070714_100214057 | |||
| 805 | Ga0070714_100224966 | |||
| 806 | Ga0070714_100253896 | |||
| 807 | Ga0070714_100293460 | |||
| 808 | Ga0070714_100844242 | |||
| 809 | Ga0070714_100875314 | |||
| 810 | Ga0070714_101082463 | |||
| 811 | Ga0070714_101738080 | |||
| 812 | Ga0070713_100055588 | |||
| 813 | Ga0070713_100175164 | |||
| 814 | Ga0070713_100317791 | |||
| 815 | Ga0070713_100405893 | |||
| 816 | Ga0070713_101399975 | |||
| 817 | Ga0070710_10029854 | |||
| 818 | Ga0070710_10161493 | |||
| 819 | Ga0070710_10772048 | |||
| 820 | Ga0070710_10931366 | |||
| 821 | Ga0070711_100067398 | |||
| 822 | Ga0070711_100127897 | |||
| 823 | Ga0070711_100659088 | |||
| 824 | Ga0070711_100666172 | |||
| 825 | Ga0070663_100149169 | |||
| 826 | Ga0070663_101695213 | |||
| 827 | Ga0070678_100599533 | |||
| 828 | Ga0070681_10048445 | |||
| 829 | Ga0070681_10066364 | |||
| 830 | Ga0070681_10069520 | |||
| 831 | Ga0070681_10078222 | |||
| 832 | Ga0070681_10130801 | |||
| 833 | Ga0070681_10145647 | |||
| 834 | Ga0070681_10812886 | |||
| 835 | Ga0070707_100271148 | |||
| 836 | Ga0070679_100041019 | |||
| 837 | Ga0070679_100081140 | |||
| 838 | Ga0070679_100129449 | |||
| 839 | Ga0070679_100188597 | |||
| 840 | Ga0070679_100305368 | |||
| 841 | Ga0070684_100093953 | |||
| 842 | Ga0070684_100107519 | |||
| 843 | Ga0070684_100212150 | |||
| 844 | Ga0070684_100316936 | |||
| 845 | Ga0070684_100356573 | |||
| 846 | Ga0070684_100887744 | |||
| 847 | Ga0068853_100164767 | |||
| 848 | Ga0068853_100258839 | |||
| 849 | Ga0070665_100366043 | |||
| 850 | Ga0070704_100173402 | |||
| 851 | Ga0068855_100014054 | |||
| 852 | Ga0068855_100049101 | |||
| 853 | Ga0068855_100076048 | |||
| 854 | Ga0068855_100216744 | |||
| 855 | Ga0068855_100236701 | |||
| 856 | Ga0068855_100365400 | |||
| 857 | Ga0068855_100426652 | |||
| 858 | Ga0068855_100898277 | |||
| 859 | Ga0070664_101271846 | |||
| 860 | Ga0068857_100275592 | |||
| 861 | Ga0068857_100367100 | |||
| 862 | Ga0068857_100438106 | |||
| 863 | Ga0068854_100291041 | |||
| 864 | Ga0068854_100468390 | |||
| 865 | Ga0068856_100041800 | |||
| 866 | Ga0068856_100129436 | |||
| 867 | Ga0068856_100148260 | |||
| 868 | Ga0068856_100467392 | |||
| 869 | Ga0068852_100026479 | |||
| 870 | Ga0068852_100056211 | |||
| 871 | Ga0068852_100274029 | |||
| 872 | Ga0068852_100512354 | |||
| 873 | Ga0068852_101375852 | |||
| 874 | Ga0068859_101418667 | |||
| 875 | Ga0068864_100865092 | |||
| 876 | Ga0068861_101252322 | |||
| 877 | Ga0068858_101298441 | |||
| 878 | Ga0081455_10008492 | |||
| 879 | Ga0081538_10001327 | |||
| 880 | Ga0081539_10114127 | |||
| 881 | Ga0070717_10054961 | |||
| 882 | Ga0070717_10079617 | |||
| 883 | Ga0070717_10240992 | |||
| 884 | Ga0070717_10324974 | |||
| 885 | Ga0070715_10000748 | |||
| 886 | Ga0070715_10894381 | |||
| 887 | Ga0070716_100012124 | |||
| 888 | Ga0070712_100021648 | |||
| 889 | Ga0070712_100151071 | |||
| 890 | Ga0070712_100579568 | |||
| 891 | Ga0070712_100858680 | |||
| 892 | Ga0070712_101121484 | |||
| 893 | Ga0070712_101445304 | |||
| 894 | Ga0070712_101740733 | |||
| 895 | Ga0097621_100397230 | |||
| 896 | Ga0097621_100707106 | |||
| 897 | Ga0075428_100008131 | |||
| 898 | Ga0075433_10190599 | |||
| 899 | Ga0075434_100007870 | |||
| 900 | Ga0097620_101418582 | |||
| 901 | Ga0075435_100148471 | |||
| 902 | Ga0105240_10052404 | |||
| 903 | Ga0105240_10057827 | |||
| 904 | Ga0105240_10073576 | |||
| 905 | Ga0105240_10337176 | |||
| 906 | Ga0105240_10474412 | |||
| 907 | Ga0105240_10937583 | |||
| 908 | Ga0105240_11064727 | |||
| 909 | Ga0105240_11748715 | |||
| 910 | Ga0105240_12297915 | |||
| 911 | Ga0105245_10011743 | |||
| 912 | Ga0105247_10330508 | |||
| 913 | Ga0114129_10006703 | |||
| 914 | Ga0105243_10338215 | |||
| 915 | Ga0105241_10240527 | |||
| 916 | Ga0105241_10339213 | |||
| 917 | Ga0105241_10388525 | |||
| 918 | Ga0105241_11592746 | |||
| 919 | Ga0105242_10018922 | |||
| 920 | Ga0105248_10051830 | |||
| 921 | Ga0105248_10343062 | |||
| 922 | Ga0105237_10066073 | |||
| 923 | Ga0105238_10100575 | |||
| 924 | Ga0105238_10312234 | |||
| 925 | Ga0105238_10316415 | |||
| 926 | Ga0105238_10509001 | |||
| 927 | Ga0105249_11221396 | |||
| 928 | Ga0105239_10064567 | |||
| 929 | Ga0105239_10074951 | |||
| 930 | Ga0105239_10372767 | |||
| 931 | Ga0105239_11133371 | |||
| 932 | Ga0105239_11381247 | |||
| 933 | Ga0105246_10217246 | |||
| 934 | Ga0154010_105530 | |||
| 935 | Ga0157373_10063948 | |||
| 936 | Ga0157373_10239549 | |||
| 937 | Ga0157373_11123250 | |||
| 938 | Ga0157371_10246545 | |||
| 939 | Ga0157371_10499043 | |||
| 940 | Ga0157371_10784592 | |||
| 941 | Ga0157371_10899364 | |||
| 942 | Ga0157370_10015057 | |||
| 943 | Ga0157370_10021166 | |||
| 944 | Ga0157370_10053446 | |||
| 945 | Ga0157370_10057477 | |||
| 946 | Ga0157370_10159771 | |||
| 947 | Ga0157370_10194594 | |||
| 948 | Ga0157370_10199255 | |||
| 949 | Ga0157370_10376261 | |||
| 950 | Ga0157370_10430888 | |||
| 951 | Ga0157370_11464744 | |||
| 952 | Ga0157369_10004422 | |||
| 953 | Ga0157369_10029083 | |||
| 954 | Ga0157369_10035320 | |||
| 955 | Ga0157369_10043468 | |||
| 956 | Ga0157369_10053298 | |||
| 957 | Ga0157369_10091319 | |||
| 958 | Ga0157369_10096223 | |||
| 959 | Ga0157369_10125860 | |||
| 960 | Ga0157369_10415356 | |||
| 961 | Ga0157369_10744440 | |||
| 962 | Ga0157369_10957756 | |||
| 963 | Ga0157369_11614032 | |||
| 964 | Ga0157374_10008828 | |||
| 965 | Ga0157374_10040394 | |||
| 966 | Ga0157374_10373678 | |||
| 967 | Ga0157374_10388242 | |||
| 968 | Ga0157374_10683970 | |||
| 969 | Ga0157378_10124084 | |||
| 970 | Ga0157372_10037160 | |||
| 971 | Ga0157372_10045886 | |||
| 972 | Ga0157372_10052116 | |||
| 973 | Ga0157372_10192089 | |||
| 974 | Ga0157372_10509329 | |||
| 975 | Ga0157372_10686033 | |||
| 976 | Ga0157372_10865594 | |||
| 977 | Ga0157372_10886064 | |||
| 978 | Ga0157372_11101625 | |||
| 979 | Ga0157375_11992560 | |||
| 980 | Ga0157375_13073265 | |||
| 981 | Ga0163163_11194412 | |||
| 982 | Ga0182008_10002698 | |||
| 983 | Ga0182008_10459632 | |||
| 984 | Ga0157377_10152635 | |||
| 985 | Ga0157377_10231037 | |||
| 986 | Ga0157379_10389783 | |||
| 987 | Ga0157376_10143623 | |||
| 988 | Ga0157376_10190357 | |||
| 989 | Ga0182006_1004883 | |||
| 990 | Ga0182006_1068509 | |||
| 991 | Ga0182006_1150890 | |||
| 992 | Ga0182007_10076497 | |||
| 993 | Ga0182005_1212163 | |||
| 994 | Ga0197907_10101945 | |||
| 995 | Ga0197907_10566242 | |||
| 996 | Ga0206356_10270218 | |||
| 997 | Ga0206356_10981012 | |||
| 998 | Ga0206356_11015167 | |||
| 999 | Ga0206355_1521071 | |||
| 1000 | Ga0206351_10645199 | |||
| 1001 | Ga0206352_10891980 | |||
| 1002 | Ga0206350_10834390 | |||
| 1003 | Ga0206350_11487734 | |||
| 1004 | Ga0206354_10373740 | |||
| 1005 | Ga0206354_11513803 | |||
| 1006 | Ga0206353_10033469 | |||
| 1007 | Ga0206353_10465379 | |||
| 1008 | Ga0206353_10818496 | |||
| 1009 | Ga0206353_10843204 | |||
| 1010 | Ga0206353_10999856 | |||
| 1011 | Ga0206353_12033280 | |||
| 1012 | Ga0206353_12052016 | |||
| 1013 | Ga0154015_1357428 | |||
| 1014 | Ga0154015_1642039 | |||
| 1015 | Ga0213874_10060377 | |||
| 1016 | Ga0213876_10061470 | |||
| 1017 | Ga0213875_10339278 | |||
| 1018 | Ga0224712_10038636 | |||
| 1019 | Ga0224712_10061335 | |||
| 1020 | Ga0224712_10071822 | |||
| 1021 | Ga0224712_10154456 | |||
| 1022 | Ga0224712_10172128 | |||
| 1023 | Ga0224712_10178748 | |||
| 1024 | Ga0224712_10309316 | |||
| 1025 | Ga0207692_10077657 | |||
| 1026 | Ga0207685_10257728 | |||
| 1027 | Ga0207705_10037868 | |||
| 1028 | Ga0207705_10131573 | |||
| 1029 | Ga0207705_10297148 | |||
| 1030 | Ga0207705_10534235 | |||
| 1031 | Ga0207654_10404137 | |||
| 1032 | Ga0207654_10418555 | |||
| 1033 | Ga0207707_10194452 | |||
| 1034 | Ga0207707_10197496 | |||
| 1035 | Ga0207707_10372094 | |||
| 1036 | Ga0207695_10072907 | |||
| 1037 | Ga0207695_10107717 | |||
| 1038 | Ga0207695_10353330 | |||
| 1039 | Ga0207695_10390610 | |||
| 1040 | Ga0207695_10631558 | |||
| 1041 | Ga0207695_10950823 | |||
| 1042 | Ga0207695_11232240 | |||
| 1043 | Ga0207693_10001669 | |||
| 1044 | Ga0207663_10121181 | |||
| 1045 | Ga0207663_10271695 | |||
| 1046 | Ga0207663_10796391 | |||
| 1047 | Ga0207660_10009676 | |||
| 1048 | Ga0207660_10015550 | |||
| 1049 | Ga0207660_10068156 | |||
| 1050 | Ga0207660_10231378 | |||
| 1051 | Ga0207657_10000610 | |||
| 1052 | Ga0207657_10007328 | |||
| 1053 | Ga0207657_10014383 | |||
| 1054 | Ga0207657_10015321 | |||
| 1055 | Ga0207657_10028466 | |||
| 1056 | Ga0207657_10051502 | |||
| 1057 | Ga0207657_10074992 | |||
| 1058 | Ga0207657_10791072 | |||
| 1059 | Ga0207657_10998900 | |||
| 1060 | Ga0207649_10030091 | |||
| 1061 | Ga0207649_10381068 | |||
| 1062 | Ga0207649_10980125 | |||
| 1063 | Ga0207652_10043006 | |||
| 1064 | Ga0207652_10051041 | |||
| 1065 | Ga0207652_10134820 | |||
| 1066 | Ga0207652_10186870 | |||
| 1067 | Ga0207652_10290770 | |||
| 1068 | Ga0207652_10363953 | |||
| 1069 | Ga0207652_10931630 | |||
| 1070 | Ga0207646_10283677 | |||
| 1071 | Ga0207694_10275505 | |||
| 1072 | Ga0207694_10832424 | |||
| 1073 | Ga0207694_11339700 | |||
| 1074 | Ga0207687_10080006 | |||
| 1075 | Ga0207687_10772740 | |||
| 1076 | Ga0207700_10090896 | |||
| 1077 | Ga0207700_10174920 | |||
| 1078 | Ga0207700_10254322 | |||
| 1079 | Ga0207700_10486519 | |||
| 1080 | Ga0207664_10001873 | |||
| 1081 | Ga0207664_10050621 | |||
| 1082 | Ga0207664_10070626 | |||
| 1083 | Ga0207664_10070718 | |||
| 1084 | Ga0207664_10166324 | |||
| 1085 | Ga0207664_10219598 | |||
| 1086 | Ga0207664_10353063 | |||
| 1087 | Ga0207664_10835858 | |||
| 1088 | Ga0207664_11715841 | |||
| 1089 | Ga0207644_10104367 | |||
| 1090 | Ga0207644_10253236 | |||
| 1091 | Ga0207644_10496440 | |||
| 1092 | Ga0207690_10779796 | |||
| 1093 | Ga0207709_10947906 | |||
| 1094 | Ga0207709_11804404 | |||
| 1095 | Ga0207669_10634159 | |||
| 1096 | Ga0207665_10000697 | |||
| 1097 | Ga0207665_10369286 | |||
| 1098 | Ga0207665_11150337 | |||
| 1099 | Ga0207711_10109514 | |||
| 1100 | Ga0207711_10576237 | |||
| 1101 | Ga0207661_10265081 | |||
| 1102 | Ga0207661_10298655 | |||
| 1103 | Ga0207661_11344662 | |||
| 1104 | Ga0207661_11741922 | |||
| 1105 | Ga0207679_10029791 | |||
| 1106 | Ga0207679_11611240 | |||
| 1107 | Ga0207667_10108075 | |||
| 1108 | Ga0207667_10441268 | |||
| 1109 | Ga0207667_10642487 | |||
| 1110 | Ga0207667_10880719 | |||
| 1111 | Ga0207667_11286530 | |||
| 1112 | Ga0207712_10693394 | |||
| 1113 | Ga0207677_10019282 | |||
| 1114 | Ga0207639_10253291 | |||
| 1115 | Ga0207639_10293066 | |||
| 1116 | Ga0207639_11942243 | |||
| 1117 | Ga0207678_10061643 | |||
| 1118 | Ga0207678_11347821 | |||
| 1119 | Ga0207702_10027351 | |||
| 1120 | Ga0207702_10114004 | |||
| 1121 | Ga0207702_10249755 | |||
| 1122 | Ga0207702_10574363 | |||
| 1123 | Ga0207702_10697563 | |||
| 1124 | Ga0207702_10741031 | |||
| 1125 | Ga0207674_10020357 | |||
| 1126 | Ga0207674_10974624 | |||
| 1127 | Ga0207698_10014358 | |||
| 1128 | Ga0207698_10068419 | |||
| 1129 | Ga0207698_10315668 | |||
| 1130 | Ga0207698_10384295 | |||
| 1131 | Ga0207698_11216514 | |||
| 1132 | Ga0207698_11416092 | |||
| 1133 | Ga0207698_11518415 | |||
| 1134 | Ga0268266_10150474 | |||
| 1135 | Ga0268266_10475789 | |||
| 1136 | Ga0373926_0136682 | |||
| 1137 | Ga0373940_0151560 | |||
| 1138 | Ga0373944_0057674 | |||
| 1139 | Ga0373944_0105383 | |||
| 1140 | Ga0373936_0030148 | |||
| 1141 | Ga0373945_0001630 | |||
| 1142 | Ga0373943_0045087 | |||
| 1143 | Ga0373946_0216545 | |||
| 1144 | Ga0373961_0323302 | |||
| 1145 | Ga0373931_0129252 | |||
| 1146 | Ga0373935_0069203 | |||
| 1147 | Ga0373927_0030667 | |||
| 1148 | Ga0373947_0011462 | |||
| 1149 | Ga0373947_0024837 | |||
| 1150 | Ga0373925_0096040 | |||
| 1151 | Ga0373925_0349457 | |||
| 1152 | Ga0373925_1433929 | |||
| 1153 | Ga0395899_0093177 | |||
| 1154 | Ga0395899_0125787 | |||
| 1155 | Ga0395899_0243235 | |||
| 1156 | Ga0395899_0369479 | |||
| 1157 | Ga0395899_0559961 | |||
| 1158 | Ga0395900_0006366 | |||
| 1159 | Ga0395900_0059693 | |||
| 1160 | Ga0395900_0060217 | |||
| 1161 | Ga0395900_0114616 | |||
| 1162 | Ga0395900_0607575 | |||
| 1163 | Ga0395900_0914854 | |||
| 1164 | Ga0395900_0932874 | |||
| 1165 | Ga0395898_0003052 | |||
| 1166 | Ga0395898_0015914 | |||
| 1167 | Ga0395898_0039754 | |||
| 1168 | Ga0395898_0118398 | |||
| 1169 | Ga0395898_0198638 | |||
| 1170 | Ga0395898_0268505 | |||
| 1171 | Ga0395898_0364289 | |||
| 1172 | Ga0395898_0652545 | |||
| 1173 | Ga0395898_0759985 | |||
| 1174 | Ga0395898_0776044 | |||
| 1175 | Ga0395898_0776224 | |||
| 1176 | Ga0395898_0852343 | |||
| 1177 | Ga0395898_1166626 | |||
| 1178 | Ga0395905_0031972 | |||
| 1179 | Ga0395905_0035129 | |||
| 1180 | Ga0395905_0314253 | |||
| 1181 | Ga0395905_0590223 | |||
| 1182 | Ga0436364_0327379 | |||
| 1183 | Ga0395901_0001077 | |||
| 1184 | Ga0395901_0002248 | |||
| 1185 | Ga0395901_0002794 | |||
| 1186 | Ga0395901_0196113 | |||
| 1187 | Ga0395901_0306413 | |||
| 1188 | Ga0395901_0331342 | |||
| 1189 | Ga0395901_0373439 | |||
| 1190 | Ga0395901_0608783 | |||
| 1191 | Ga0395901_0972708 | |||
| 1192 | Ga0395901_1076895 | |||
| 1193 | Ga0395901_2023693 | |||
| 1194 | Ga0242420_016164 | |||
| 1195 | Ga0436365_0271194 | |||
| 1196 | Ga0436365_1501848 | |||
| 1197 | Ga0436363_0023636 | |||
| 1198 | Ga0436363_0204153 | |||
| 1199 | Ga0436363_0218760 | |||
| 1200 | Ga0436363_1597774 | |||
| 1201 | Ga0439448_0332889 | |||
| 1202 | Ga0450896_063450 | |||
| 1203 | Ga0450910_025421 | |||
| 1204 | Ga0466965_0161312 | |||
| 1205 | Ga0466965_0203792 | |||
| 1206 | Ga0466966_0076449 | |||
| 1207 | Ga0466966_0108060 | |||
| 1208 | Ga0466966_0179796 | |||
| 1209 | Ga0466966_0332638 | |||
| 1210 | Ga0466961_0030837 | |||
| 1211 | Ga0466961_0081812 | |||
| 1212 | Ga0466961_0316752 | |||
| 1213 | Ga0466963_0000800 | |||
| 1214 | Ga0466963_0003084 | |||
| 1215 | Ga0466963_0007320 | |||
| 1216 | Ga0466963_0015593 | |||
| 1217 | Ga0466963_0022974 | |||
| 1218 | Ga0466963_0029600 | |||
| 1219 | Ga0466963_0032659 | |||
| 1220 | Ga0466963_0037124 | |||
| 1221 | Ga0466963_0041137 | |||
| 1222 | Ga0466963_0043211 | |||
| 1223 | Ga0466963_0044102 | |||
| 1224 | Ga0466963_0050303 | |||
| 1225 | Ga0466963_0058197 | |||
| 1226 | Ga0466963_0115475 | |||
| 1227 | Ga0466963_0123728 | |||
| 1228 | Ga0466963_0127566 | |||
| 1229 | Ga0466963_0204471 | |||
| 1230 | Ga0466963_0244999 | |||
| 1231 | Ga0466963_0397272 | |||
| 1232 | Ga0466963_0475436 | |||
| 1233 | Ga0466963_0514536 | |||
| 1234 | Ga0466963_0759148 | |||
| 1235 | Ga0466963_0874978 | |||
| 1236 | Ga0466964_0006768 | |||
| 1237 | Ga0466964_0013339 | |||
| 1238 | Ga0466964_0027358 | |||
| 1239 | Ga0466964_0228352 | |||
| 1240 | Ga0466964_0234041 | |||
| 1241 | Ga0453684_0953700 | |||
| 1242 | Ga0466971_0099835 | |||
| 1243 | Ga0466971_0195723 | |||
| 1244 | Ga0466968_0023323 | |||
| 1245 | Ga0466968_0266383 | |||
| 1246 | Ga0466957_0009772 | |||
| 1247 | Ga0466957_0020693 | |||
| 1248 | Ga0466957_0035751 | |||
| 1249 | Ga0466957_0051770 | |||
| 1250 | Ga0466957_0121220 | |||
| 1251 | Ga0466957_0148443 | |||
| 1252 | Ga0466957_0226062 | |||
| 1253 | Ga0466957_0451877 | |||
| 1254 | Ga0466957_0576268 | |||
| 1255 | Ga0466957_0668443 | |||
| 1256 | Ga0466957_0809892 | |||
| 1257 | Ga0466960_0012696 | |||
| 1258 | Ga0466960_0064761 | |||
| 1259 | Ga0466960_0116369 | |||
| 1260 | Ga0466960_0584063 | |||
| 1261 | Ga0466959_0007928 | |||
| 1262 | Ga0466959_0137293 | |||
| 1263 | Ga0466959_0149398 | |||
| 1264 | Ga0466959_1141638 | |||
| 1265 | Ga0466958_0009601 | |||
| 1266 | Ga0466958_0045871 | |||
| 1267 | Ga0466958_0053955 | |||
| 1268 | Ga0466958_0092055 | |||
| 1269 | Ga0466958_0112108 | |||
| 1270 | Ga0466958_0172711 | |||
| 1271 | Ga0466958_0917975 | |||
| 1272 | Ga0466967_0001650 | |||
| 1273 | Ga0466967_0003929 | |||
| 1274 | Ga0466967_0009948 | |||
| 1275 | Ga0466967_0010954 | |||
| 1276 | Ga0466967_0011760 | |||
| 1277 | Ga0466967_0024940 | |||
| 1278 | Ga0466967_0026785 | |||
| 1279 | Ga0466967_0026862 | |||
| 1280 | Ga0466967_0032789 | |||
| 1281 | Ga0466967_0034755 | |||
| 1282 | Ga0466967_0046828 | |||
| 1283 | Ga0466967_0049995 | |||
| 1284 | Ga0466967_0064794 | |||
| 1285 | Ga0466967_0070542 | |||
| 1286 | Ga0466967_0083833 | |||
| 1287 | Ga0466967_0090999 | |||
| 1288 | Ga0466967_0099158 | |||
| 1289 | Ga0466967_0115828 | |||
| 1290 | Ga0466967_0117596 | |||
| 1291 | Ga0466967_0126431 | |||
| 1292 | Ga0466967_0138376 | |||
| 1293 | Ga0466967_0139084 | |||
| 1294 | Ga0466967_0173635 | |||
| 1295 | Ga0466967_0241731 | |||
| 1296 | Ga0466967_0367264 | |||
| 1297 | Ga0466967_0490107 | |||
| 1298 | Ga0466967_0529057 | |||
| 1299 | Ga0466967_0539827 | |||
| 1300 | Ga0466967_0657172 | |||
| 1301 | Ga0466967_0725873 | |||
| 1302 | Ga0466967_0828293 | |||
| 1303 | Ga0466967_0862235 | |||
| 1304 | Ga0466967_1109082 | |||
| 1305 | Ga0466967_1313347 | |||
| 1306 | Ga0466967_1743966 | |||
| 1307 | Ga0495592_0084585 | |||
| 1308 | Ga0495603_0152900 | |||
| 1309 | Ga0495603_0216500 | |||
| 1310 | Ga0495641_0014671 | |||
| 1311 | Ga0495641_0045062 | |||
| 1312 | Ga0495653_0109744 | |||
| 1313 | Ga0495653_0277401 | |||
| 1314 | Ga0495582_0160736 | |||
| 1315 | Ga0495582_0194966 | |||
| 1316 | Ga0495664_0017420 | |||
| 1317 | Ga0495608_0454574 | |||
| 1318 | Ga0495628_0802240 | |||
| 1319 | Ga0495630_0094779 | |||
| 1320 | Ga0495630_0841849 | |||
| 1321 | Ga0495630_1176060 | |||
| 1322 | Ga0495652_0035618 | |||
| 1323 | Ga0495652_1069308 | |||
| 1324 | Ga0495665_0193312 | |||
| 1325 | Ga0495665_0370990 | |||
| 1326 | Ga0495640_0521511 | |||
| 1327 | Ga0495640_0601894 | |||
| 1328 | Ga0495587_0190498 | |||
| 1329 | Ga0495587_0392811 | |||
| 1330 | Ga0495645_0352589 | |||
| 1331 | Ga0495635_0084563 | |||
| 1332 | Ga0495635_0470007 | |||
| 1333 | Ga0495635_1109320 | |||
| 1334 | Ga0495657_0270888 | |||
| 1335 | Ga0495599_0005723 | |||
| 1336 | Ga0495599_0670515 | |||
| 1337 | Ga0495623_0193197 | |||
| 1338 | Ga0495646_0696665 | |||
| 1339 | Ga0495647_0100375 | |||
| 1340 | Ga0495658_0033856 | |||
| 1341 | Ga0495658_0090113 | |||
| 1342 | Ga0495613_0324931 | |||
| 1343 | Ga0495613_0367176 | |||
| 1344 | Ga0495624_0294880 | |||
| 1345 | Ga0495600_0209339 | |||
| 1346 | Ga0495600_0406951 | |||
| 1347 | Ga0495604_0276825 | |||
| 1348 | Ga0495674_0208630 | |||
| 1349 | Ga0495676_0072676 | |||
| 1350 | Ga0495676_0741356 | |||
| 1351 | Ga0495680_0206891 | |||
| 1352 | Ga0495684_0213316 | |||
| 1353 | Ga0495684_0748374 | |||
| 1354 | Ga0495593_0139775 | |||
| 1355 | Ga0495602_0067123 | |||
| 1356 | Ga0495602_0405080 | |||
| 1357 | Ga0496100_0007242 | |||
| 1358 | Ga0496100_0028330 | |||
| 1359 | Ga0496100_0029834 | |||
| 1360 | Ga0496100_0066666 | |||
| 1361 | Ga0496100_0189091 | |||
| 1362 | Ga0496101_0000942 | |||
| 1363 | Ga0496101_0004779 | |||
| 1364 | Ga0496101_0192197 | |||
| 1365 | Ga0496101_0691558 | |||
| 1366 | Ga0496101_1232979 | |||
| 1367 | Ga0496102_0022352 | |||
| 1368 | Ga0496102_0045321 | |||
| 1369 | Ga0496102_0082660 | |||
| 1370 | Ga0496102_0083397 | |||
| 1371 | Ga0496102_0481964 | |||
| 1372 | Ga0496102_0705276 | |||
| 1373 | Ga0496102_0817054 | |||
| 1374 | Ga0496102_1350070 | |||
| 1375 | Ga0496103_0022510 | |||
| 1376 | Ga0496103_0087031 | |||
| 1377 | Ga0496103_0164166 | |||
| 1378 | Ga0496103_0389610 | |||
| 1379 | Ga0496104_0003290 | |||
| 1380 | Ga0496104_0003782 | |||
| 1381 | Ga0496104_0026674 | |||
| 1382 | Ga0496104_0434976 | |||
| 1383 | Ga0496104_0712001 | |||
| 1384 | Ga0496104_0802276 | |||
| 1385 | Ga0496104_0973212 | |||
| 1386 | Ga0496105_0000305 | |||
| 1387 | Ga0496105_0002512 | |||
| 1388 | Ga0496105_0026985 | |||
| 1389 | Ga0496105_0053883 | |||
| 1390 | Ga0496105_0170292 | |||
| 1391 | Ga0496105_0243423 | |||
| 1392 | Ga0496105_0386525 | |||
| 1393 | Ga0496105_0418663 | |||
| 1394 | Ga0496105_0550130 | |||
| 1395 | Ga0496106_0000850 | |||
| 1396 | Ga0496106_0038856 | |||
| 1397 | Ga0496106_0047021 | |||
| 1398 | Ga0496106_0060710 | |||
| 1399 | Ga0496106_0085795 | |||
| 1400 | Ga0496106_0238636 | |||
| 1401 | Ga0496106_0608939 | |||
| 1402 | Ga0496107_0004295 | |||
| 1403 | Ga0496107_0022389 | |||
| 1404 | Ga0496107_0026465 | |||
| 1405 | Ga0496107_0103432 | |||
| 1406 | Ga0496107_0104721 | |||
| 1407 | Ga0496107_0117846 | |||
| 1408 | Ga0496107_0630077 | |||
| 1409 | Ga0496108_0026954 | |||
| 1410 | Ga0496108_0030948 | |||
| 1411 | Ga0496108_0134819 | |||
| 1412 | Ga0496108_0414994 | |||
| 1413 | Ga0496108_0652541 | |||
| 1414 | Ga0496108_0837412 | |||
| 1415 | Ga0496109_0002785 | |||
| 1416 | Ga0496109_0005751 | |||
| 1417 | Ga0496109_0037444 | |||
| 1418 | Ga0496109_0194815 | |||
| 1419 | Ga0496109_0363174 | |||
| 1420 | Ga0496109_0393329 | |||
| 1421 | Ga0496109_0486460 | |||
| 1422 | Ga0496109_0680722 | |||
| 1423 | Ga0496109_0912085 | |||
| 1424 | Ga0496109_1312715 | |||
| 1425 | Ga0496109_1734689 | |||
| 1426 | Ga0496110_0006758 | |||
| 1427 | Ga0496110_0126637 | |||
| 1428 | Ga0496110_0187473 | |||
| 1429 | Ga0496111_0022652 | |||
| 1430 | Ga0496111_0062911 | |||
| 1431 | Ga0496111_0065505 | |||
| 1432 | Ga0496111_0210858 | |||
| 1433 | Ga0496111_0868831 | |||
| 1434 | Ga0496112_0007452 | |||
| 1435 | Ga0496112_0025360 | |||
| 1436 | Ga0496112_0043433 | |||
| 1437 | Ga0496112_0219121 | |||
| 1438 | Ga0496112_0447719 | |||
| 1439 | Ga0496112_0745752 | |||
| 1440 | Ga0496112_0853353 | |||
| 1441 | Ga0496113_0015437 | |||
| 1442 | Ga0496113_0069137 | |||
| 1443 | Ga0496113_0071154 | |||
| 1444 | Ga0496113_0344522 | |||
| 1445 | Ga0496113_0952998 | |||
| 1446 | Ga0496114_0009801 | |||
| 1447 | Ga0496114_0018256 | |||
| 1448 | Ga0496114_0187016 | |||
| 1449 | Ga0496114_0251819 | |||
| 1450 | Ga0496114_0297427 | |||
| 1451 | Ga0496114_0567249 | |||
| 1452 | Ga0496115_0001257 | |||
| 1453 | Ga0496115_0080295 | |||
| 1454 | Ga0496115_0135068 | |||
| 1455 | Ga0496115_0240609 | |||
| 1456 | Ga0496115_0709378 | |||
| 1457 | Ga0496115_1013354 | |||
| 1458 | Ga0501036_0881988 | |||
| 1459 | Ga0501038_0241788 | |||
| 1460 | Ga0501039_0242516 | |||
| 1461 | Ga0501040_0052568 | |||
| 1462 | Ga0501046_0295621 | |||
| 1463 | Ga0501047_0124743 | |||
| 1464 | Ga0501067_0000154 | |||
| 1465 | Ga0501067_0009568 | |||
| 1466 | Ga0501067_0167920 | |||
| 1467 | Ga0501067_0857999 | |||
| 1468 | Ga0501068_0319351 | |||
| 1469 | Ga0501068_0587466 | |||
| 1470 | Ga0501069_0001465 | |||
| 1471 | Ga0501070_0080184 | |||
| 1472 | Ga0501070_0109291 | |||
| 1473 | Ga0501072_0019912 | |||
| 1474 | Ga0501073_0035240 | |||
| 1475 | Ga0501073_0904857 | |||
| 1476 | Ga0501074_0017406 | |||
| 1477 | Ga0501076_0285957 | |||
| 1478 | Ga0501077_0014036 | |||
| 1479 | Ga0501079_0040961 | |||
| 1480 | Ga0501080_0030789 | |||
| 1481 | Ga0501080_0109469 | |||
| 1482 | Ga0501081_0039406 | |||
| 1483 | Ga0501083_0001263 | |||
| 1484 | Ga0501083_0957563 | |||
| 1485 | Ga0501044_0317589 | |||
| 1486 | nmdc:mga05p37_2932_c1 | |||
| 1487 | nmdc:mga0n895_66084_c1 | |||
| 1488 | nmdc:mga0a205_21088_c2 | |||
| 1489 | Ga0495601_0019187 | |||
| 1490 | Ga0495601_0244229 | |||
| 1491 | Ga0495612_0003911 | |||
| 1492 | Ga0495612_0318304 | |||
| 1493 | Ga0495655_0131090 | |||
| 1494 | Ga0495595_0027283 | |||
| 1495 | Ga0495595_0641598 | |||
| 1496 | Ga0495619_0111417 | |||
| 1497 | Ga0495619_0414568 | |||
| 1498 | Ga0495619_0571228 | |||
| 1499 | Ga0501084_0718257 | |||
| 1500 | Ga0587083_0065028 | |||
| 1501 | Ga0587128_013202 | |||
| 1502 | Ga0501082_0107763 | |||
| 1503 | Ga0501082_1802419 | |||
| 1504 | Ga0466962_0024612 | |||
| 1505 | Ga0466962_0176093 | |||
| 1506 | Ga0466962_0289718 | |||
| 1507 | Ga0466962_0307267 | |||
| 1508 | Ga0466962_0496428 | |||
| 1509 | Ga0530510_0075135 | |||
| 1510 | Ga0530510_0528604 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3c6f-assembly1.cif.gz_C | crystal structure of protein bsu07140 from bacillus subtilis | 0.9489 | 91 | 145 |
| 4v7j-assembly1.cif.gz_Ao | structure of rele nuclease bound to the 70s ribosome (precleavage state) | 0.4522 | 35 | 86 |
| 4v7w-assembly2.cif.gz_CO | structure of the thermus thermophilus ribosome complexed with chloramphenicol. | 0.4306 | 31 | 86 |
| 7es4-assembly1.cif.gz_A | the crystral structure of dndh-c-domain | 0.4241 | 90 | 145 |
| 4v7l-assembly2.cif.gz_CO | the structures of viomycin bound to the 70s ribosome. | 0.4128 | 27 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3c6fD01 | Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains | 0.9469 | 91 | 145 | 3.30.240.20 |
| 3c6fC02 | Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains | 0.9251 | 89 | 144 | 3.30.240.20 |
| af_P75839_95_166_3.30.240.20 | Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains | 0.8509 | 77 | 145 | 3.30.240.20 |
| 3c6fD01 | Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains | 0.8327 | 91 | 145 | 3.30.240.20 |
| 3c6fC02 | Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains | 0.8168 | 89 | 144 | 3.30.240.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5B2TC47-F1-model_v4 | DUF421 domain-containing protein | 0.8932 | 2 | 145 |
GO:0005886
|
| AF-A0A2W4LXT0-F1-model_v4 | DUF421 domain-containing protein | 0.8772 | 1 | 145 |
GO:0005886
|
| AF-A0A5B2TC47-F1-model_v4 | DUF421 domain-containing protein | 0.8759 | 2 | 145 |
GO:0005886
|
| AF-A0A2W4LXT0-F1-model_v4 | DUF421 domain-containing protein | 0.8717 | 1 | 145 |
GO:0005886
|
| AF-A0A7W0JQC3-F1-model_v4 | DUF421 domain-containing protein | 0.8713 | 2 | 144 |
GO:0005886
|