F479302

General Info

Members Datasets Scaffolds Average Seq Length
755 248 1510 146

Family's Representative Sequence

Representative Sequence 3300026088|Ga0207641_10448400|Ga0207641_104484001
Length 157
Sequence MDLVLRAIFIFAFMLLLIRIIGKRELSSLQPFDLILLIVLGDALQQGLTQDDYSLTGAVLVVGTIAVLQVFVSWVSYRFPRTRPVLEGEPVVIVQDGKVIERNLQRERLTVQEVTEAARKQQIAHLAEVRWAVLDYGDLIIHLFEKDTRSYYSLERL

Samples

Sample ID Description Type Environment
1 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
86 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
132 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
154 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.89
Metatranscriptomes 4.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.38
Rhizosphere 85.3
Stem 0
Stem Tuber 0
Unclassified 23.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207641_10448400 3300026088 Bacteria 1247
2 JGI25407J50210_10006441 3300003373 Bacteria 2924
3 Ga0070658_10013356 3300005327 Bacteria 6590
4 Ga0070658_10022886 3300005327 Bacteria 5015
5 Ga0070658_10054259 3300005327 Unclassified 3255
6 Ga0070658_10089706 3300005327 Bacteria 2531
7 Ga0070658_10233268 3300005327 Bacteria 1558
8 Ga0070658_10265741 3300005327 Bacteria 1458
9 Ga0070658_10356711 3300005327 Bacteria 1252
10 Ga0070658_10903412 3300005327 Bacteria 768
11 Ga0070683_100018974 3300005329 Bacteria 6102
12 Ga0070683_100117686 3300005329 Bacteria 2509
13 Ga0070683_100193777 3300005329 Bacteria 1930
14 Ga0070683_100279974 3300005329 Bacteria 1586
15 Ga0070683_101008735 3300005329 Bacteria 799
16 Ga0070683_101505068 3300005329 Unclassified 647
17 Ga0070683_101775171 3300005329 Unclassified 593
18 Ga0070680_100020648 3300005336 Bacteria 5229
19 Ga0070680_100036319 3300005336 Bacteria 3980
20 Ga0070680_100042889 3300005336 Bacteria 3673
21 Ga0070682_100040572 3300005337 Bacteria 2865
22 Ga0070682_100124291 3300005337 Bacteria 1737
23 Ga0070682_100417252 3300005337 Bacteria 1019
24 Ga0070682_101293779 3300005337 Bacteria 619
25 Ga0068868_100195637 3300005338 Unclassified 1683
26 Ga0070660_100013224 3300005339 Bacteria 5914
27 Ga0070660_100045995 3300005339 Bacteria 3344
28 Ga0070660_100059769 3300005339 Bacteria 2956
29 Ga0070660_100065879 3300005339 Bacteria 2820
30 Ga0070660_100452308 3300005339 Bacteria 1065
31 Ga0070691_10736978 3300005341 Bacteria 595
32 Ga0070661_100014955 3300005344 Bacteria 5474
33 Ga0070661_100021648 3300005344 Bacteria 4595
34 Ga0070661_100074572 3300005344 Unclassified 2499
35 Ga0070661_100135069 3300005344 Unclassified 1855
36 Ga0070671_100053232 3300005355 Bacteria 3364
37 Ga0070671_100291406 3300005355 Bacteria 1389
38 Ga0070674_101611430 3300005356 Unclassified 585
39 Ga0070659_100098463 3300005366 Bacteria 2352
40 Ga0070659_100148182 3300005366 Bacteria 1913
41 Ga0070659_100529653 3300005366 Bacteria 1007
42 Ga0070667_101477221 3300005367 Bacteria 638
43 Ga0070703_10148867 3300005406 Bacteria 877
44 Ga0070709_10011853 3300005434 Bacteria 4868
45 Ga0070709_10113962 3300005434 Bacteria 1821
46 Ga0070714_100013640 3300005435 Bacteria 6516
47 Ga0070714_100120654 3300005435 Bacteria 2332
48 Ga0070714_100150441 3300005435 Bacteria 2097
49 Ga0070714_100214057 3300005435 Bacteria 1768
50 Ga0070714_100224966 3300005435 Bacteria 1726
51 Ga0070714_100253896 3300005435 Bacteria 1627
52 Ga0070714_100293460 3300005435 Unclassified 1514
53 Ga0070714_100844242 3300005435 Unclassified 888
54 Ga0070714_100875314 3300005435 Bacteria 872
55 Ga0070714_101082463 3300005435 Unclassified 781
56 Ga0070714_101738080 3300005435 Bacteria 609
57 Ga0070713_100055588 3300005436 Bacteria 3290
58 Ga0070713_100175164 3300005436 Bacteria 1924
59 Ga0070713_100317791 3300005436 Bacteria 1437
60 Ga0070713_100405893 3300005436 Bacteria 1273
61 Ga0070713_101399975 3300005436 Bacteria 678
62 Ga0070710_10029854 3300005437 Bacteria 2928
63 Ga0070710_10161493 3300005437 Bacteria 1390
64 Ga0070710_10772048 3300005437 Bacteria 684
65 Ga0070710_10931366 3300005437 Unclassified 629
66 Ga0070711_100067398 3300005439 Bacteria 2511
67 Ga0070711_100127897 3300005439 Bacteria 1888
68 Ga0070711_100659088 3300005439 Unclassified 878
69 Ga0070711_100666172 3300005439 Bacteria 874
70 Ga0070663_100149169 3300005455 Bacteria 1792
71 Ga0070663_101695213 3300005455 Unclassified 565
72 Ga0070678_100599533 3300005456 Bacteria 983
73 Ga0070681_10048445 3300005458 Bacteria 4246
74 Ga0070681_10066364 3300005458 Bacteria 3577
75 Ga0070681_10069520 3300005458 Bacteria 3487
76 Ga0070681_10078222 3300005458 Bacteria 3265
77 Ga0070681_10130801 3300005458 Bacteria 2442
78 Ga0070681_10145647 3300005458 Bacteria 2298
79 Ga0070681_10812886 3300005458 Bacteria 852
80 Ga0070707_100271148 3300005468 Bacteria 1650
81 Ga0070679_100041019 3300005530 Bacteria 4607
82 Ga0070679_100081140 3300005530 Bacteria 3233
83 Ga0070679_100129449 3300005530 Bacteria 2506
84 Ga0070679_100188597 3300005530 Unclassified 2031
85 Ga0070679_100305368 3300005530 Bacteria 1542
86 Ga0070684_100093953 3300005535 Bacteria 2670
87 Ga0070684_100107519 3300005535 Bacteria 2498
88 Ga0070684_100212150 3300005535 Unclassified 1765
89 Ga0070684_100316936 3300005535 Bacteria 1432
90 Ga0070684_100356573 3300005535 Unclassified 1346
91 Ga0070684_100887744 3300005535 Bacteria 835
92 Ga0068853_100164767 3300005539 Unclassified 2002
93 Ga0068853_100258839 3300005539 Unclassified 1599
94 Ga0070665_100366043 3300005548 Bacteria 1448
95 Ga0070704_100173402 3300005549 Bacteria 1718
96 Ga0068855_100014054 3300005563 Bacteria 9650
97 Ga0068855_100049101 3300005563 Bacteria 4978
98 Ga0068855_100076048 3300005563 Bacteria 3897
99 Ga0068855_100216744 3300005563 Unclassified 2148
100 Ga0068855_100236701 3300005563 Bacteria 2042
101 Ga0068855_100365400 3300005563 Bacteria 1587
102 Ga0068855_100426652 3300005563 Bacteria 1450
103 Ga0068855_100898277 3300005563 Bacteria 936
104 Ga0070664_101271846 3300005564 Bacteria 695
105 Ga0068857_100275592 3300005577 Unclassified 1546
106 Ga0068857_100367100 3300005577 Unclassified 1335
107 Ga0068857_100438106 3300005577 Bacteria 1220
108 Ga0068854_100291041 3300005578 Bacteria 1318
109 Ga0068854_100468390 3300005578 Bacteria 1056
110 Ga0068856_100041800 3300005614 Bacteria 4507
111 Ga0068856_100129436 3300005614 Bacteria 2528
112 Ga0068856_100148260 3300005614 Bacteria 2354
113 Ga0068856_100467392 3300005614 Bacteria 1282
114 Ga0068852_100026479 3300005616 Bacteria 4714
115 Ga0068852_100056211 3300005616 Bacteria 3400
116 Ga0068852_100274029 3300005616 Bacteria 1624
117 Ga0068852_100512354 3300005616 Bacteria 1196
118 Ga0068852_101375852 3300005616 Bacteria 728
119 Ga0068859_101418667 3300005617 Bacteria 766
120 Ga0068864_100865092 3300005618 Unclassified 891
121 Ga0068861_101252322 3300005719 Unclassified 719
122 Ga0068858_101298441 3300005842 Bacteria 716
123 Ga0081455_10008492 3300005937 Bacteria 10673
124 Ga0081538_10001327 3300005981 Bacteria 25495
125 Ga0081539_10114127 3300005985 Bacteria 1354
126 Ga0070717_10054961 3300006028 Bacteria 3284
127 Ga0070717_10079617 3300006028 Bacteria 2748
128 Ga0070717_10240992 3300006028 Bacteria 1595
129 Ga0070717_10324974 3300006028 Unclassified 1371
130 Ga0070715_10000748 3300006163 Bacteria 8767
131 Ga0070715_10894381 3300006163 Unclassified 546
132 Ga0070716_100012124 3300006173 Bacteria 4360
133 Ga0070712_100021648 3300006175 Bacteria 4226
134 Ga0070712_100151071 3300006175 Bacteria 1783
135 Ga0070712_100579568 3300006175 Bacteria 948
136 Ga0070712_100858680 3300006175 Unclassified 781
137 Ga0070712_101121484 3300006175 Bacteria 683
138 Ga0070712_101445304 3300006175 Unclassified 600
139 Ga0070712_101740733 3300006175 Unclassified 546
140 Ga0097621_100397230 3300006237 Unclassified 1234
141 Ga0097621_100707106 3300006237 Bacteria 928
142 Ga0075428_100008131 3300006844 Bacteria 11644
143 Ga0075433_10190599 3300006852 Bacteria 1824
144 Ga0075434_100007870 3300006871 Bacteria 9873
145 Ga0097620_101418582 3300006931 Bacteria 766
146 Ga0075435_100148471 3300007076 Bacteria 1970
147 Ga0105240_10052404 3300009093 Bacteria 5131
148 Ga0105240_10057827 3300009093 Bacteria 4842
149 Ga0105240_10073576 3300009093 Bacteria 4219
150 Ga0105240_10337176 3300009093 Bacteria 1714
151 Ga0105240_10474412 3300009093 Bacteria 1396
152 Ga0105240_10937583 3300009093 Unclassified 929
153 Ga0105240_11064727 3300009093 Bacteria 862
154 Ga0105240_11748715 3300009093 Bacteria 648
155 Ga0105240_12297915 3300009093 Bacteria 559
156 Ga0105245_10011743 3300009098 Bacteria 7619
157 Ga0105247_10330508 3300009101 Bacteria 1066
158 Ga0114129_10006703 3300009147 Bacteria 16355
159 Ga0105243_10338215 3300009148 Unclassified 1378
160 Ga0105241_10240527 3300009174 Bacteria 1530
161 Ga0105241_10339213 3300009174 Unclassified 1301
162 Ga0105241_10388525 3300009174 Bacteria 1221
163 Ga0105241_11592746 3300009174 Unclassified 631
164 Ga0105242_10018922 3300009176 Bacteria 5393
165 Ga0105248_10051830 3300009177 Bacteria 4604
166 Ga0105248_10343062 3300009177 Unclassified 1681
167 Ga0105237_10066073 3300009545 Bacteria 3612
168 Ga0105238_10100575 3300009551 Bacteria 2874
169 Ga0105238_10312234 3300009551 Unclassified 1557
170 Ga0105238_10316415 3300009551 Unclassified 1546
171 Ga0105238_10509001 3300009551 Unclassified 1206
172 Ga0105249_11221396 3300009553 Unclassified 823
173 Ga0105239_10064567 3300010375 Bacteria 4019
174 Ga0105239_10074951 3300010375 Plasmid 3720
175 Ga0105239_10372767 3300010375 Bacteria 1613
176 Ga0105239_11133371 3300010375 Bacteria 901
177 Ga0105239_11381247 3300010375 Bacteria 813
178 Ga0105246_10217246 3300011119 Unclassified 1496
179 Ga0154010_105530 3300013062 Bacteria 985
180 Ga0157373_10063948 3300013100 Bacteria 2604
181 Ga0157373_10239549 3300013100 Unclassified 1282
182 Ga0157373_11123250 3300013100 Unclassified 590
183 Ga0157371_10246545 3300013102 Bacteria 1286
184 Ga0157371_10499043 3300013102 Bacteria 899
185 Ga0157371_10784592 3300013102 Bacteria 717
186 Ga0157371_10899364 3300013102 Bacteria 671
187 Ga0157370_10015057 3300013104 Bacteria 7880
188 Ga0157370_10021166 3300013104 Bacteria 6484
189 Ga0157370_10053446 3300013104 Bacteria 3851
190 Ga0157370_10057477 3300013104 Bacteria 3699
191 Ga0157370_10159771 3300013104 Bacteria 2097
192 Ga0157370_10194594 3300013104 Bacteria 1882
193 Ga0157370_10199255 3300013104 Unclassified 1857
194 Ga0157370_10376261 3300013104 Bacteria 1308
195 Ga0157370_10430888 3300013104 Unclassified 1213
196 Ga0157370_11464744 3300013104 Unclassified 614
197 Ga0157369_10004422 3300013105 Bacteria 16592
198 Ga0157369_10029083 3300013105 Bacteria 6109
199 Ga0157369_10035320 3300013105 Bacteria 5483
200 Ga0157369_10043468 3300013105 Bacteria 4897
201 Ga0157369_10053298 3300013105 Bacteria 4373
202 Ga0157369_10091319 3300013105 Bacteria 3251
203 Ga0157369_10096223 3300013105 Bacteria 3159
204 Ga0157369_10125860 3300013105 Bacteria 2717
205 Ga0157369_10415356 3300013105 Bacteria 1395
206 Ga0157369_10744440 3300013105 Bacteria 1009
207 Ga0157369_10957756 3300013105 Bacteria 877
208 Ga0157369_11614032 3300013105 Archaea 659
209 Ga0157374_10008828 3300013296 Bacteria 8629
210 Ga0157374_10040394 3300013296 Bacteria 4296
211 Ga0157374_10373678 3300013296 Bacteria 1419
212 Ga0157374_10388242 3300013296 Bacteria 1391
213 Ga0157374_10683970 3300013296 Bacteria 1038
214 Ga0157378_10124084 3300013297 Bacteria 2384
215 Ga0157372_10037160 3300013307 Bacteria 5369
216 Ga0157372_10045886 3300013307 Bacteria 4849
217 Ga0157372_10052116 3300013307 Bacteria 4555
218 Ga0157372_10192089 3300013307 Bacteria 2365
219 Ga0157372_10509329 3300013307 Bacteria 1403
220 Ga0157372_10686033 3300013307 Bacteria 1192
221 Ga0157372_10865594 3300013307 Bacteria 1049
222 Ga0157372_10886064 3300013307 Bacteria 1036
223 Ga0157372_11101625 3300013307 Unclassified 919
224 Ga0157375_11992560 3300013308 Bacteria 690
225 Ga0157375_13073265 3300013308 Unclassified 557
226 Ga0163163_11194412 3300014325 Bacteria 823
227 Ga0182008_10002698 3300014497 Bacteria 11017
228 Ga0182008_10459632 3300014497 Unclassified 693
229 Ga0157377_10152635 3300014745 Unclassified 1429
230 Ga0157377_10231037 3300014745 Bacteria 1189
231 Ga0157379_10389783 3300014968 Bacteria 1279
232 Ga0157376_10143623 3300014969 Bacteria 2144
233 Ga0157376_10190357 3300014969 Bacteria 1881
234 Ga0182006_1004883 3300015261 Bacteria 6499
235 Ga0182006_1068509 3300015261 Bacteria 1322
236 Ga0182006_1150890 3300015261 Bacteria 788
237 Ga0182007_10076497 3300015262 Bacteria 1097
238 Ga0182005_1212163 3300015265 Bacteria 586
239 Ga0197907_10101945 3300020069 Bacteria 2719
240 Ga0197907_10566242 3300020069 Unclassified 1210
241 Ga0206356_10270218 3300020070 Bacteria 3163
242 Ga0206356_10981012 3300020070 Unclassified 1153
243 Ga0206356_11015167 3300020070 Bacteria 2510
244 Ga0206355_1521071 3300020076 Unclassified 1200
245 Ga0206351_10645199 3300020077 Unclassified 656
246 Ga0206352_10891980 3300020078 Bacteria 1195
247 Ga0206350_10834390 3300020080 Unclassified 742
248 Ga0206350_11487734 3300020080 Unclassified 1248
249 Ga0206354_10373740 3300020081 Bacteria 5241
250 Ga0206354_11513803 3300020081 Bacteria 1948
251 Ga0206353_10033469 3300020082 Bacteria 4087
252 Ga0206353_10465379 3300020082 Unclassified 1332
253 Ga0206353_10818496 3300020082 Bacteria 2782
254 Ga0206353_10843204 3300020082 Bacteria 2623
255 Ga0206353_10999856 3300020082 Bacteria 861
256 Ga0206353_12033280 3300020082 Unclassified 1651
257 Ga0206353_12052016 3300020082 Bacteria 2657
258 Ga0154015_1357428 3300020610 Bacteria 993
259 Ga0154015_1642039 3300020610 Unclassified 649
260 Ga0213874_10060377 3300021377 Unclassified 1186
261 Ga0213876_10061470 3300021384 Bacteria 1982
262 Ga0213875_10339278 3300021388 Bacteria 713
263 Ga0224712_10038636 3300022467 Bacteria 1784
264 Ga0224712_10061335 3300022467 Unclassified 1499
265 Ga0224712_10071822 3300022467 Bacteria 1407
266 Ga0224712_10154456 3300022467 Unclassified 1019
267 Ga0224712_10172128 3300022467 Bacteria 972
268 Ga0224712_10178748 3300022467 Unclassified 955
269 Ga0224712_10309316 3300022467 Bacteria 740
270 Ga0207692_10077657 3300025898 Bacteria 1767
271 Ga0207685_10257728 3300025905 Bacteria 846
272 Ga0207705_10037868 3300025909 Bacteria 3451
273 Ga0207705_10131573 3300025909 Bacteria 1862
274 Ga0207705_10297148 3300025909 Bacteria 1238
275 Ga0207705_10534235 3300025909 Bacteria 911
276 Ga0207654_10404137 3300025911 Bacteria 950
277 Ga0207654_10418555 3300025911 Unclassified 934
278 Ga0207707_10194452 3300025912 Bacteria 1769
279 Ga0207707_10197496 3300025912 Bacteria 1754
280 Ga0207707_10372094 3300025912 Unclassified 1229
281 Ga0207695_10072907 3300025913 Bacteria 3501
282 Ga0207695_10107717 3300025913 Bacteria 2772
283 Ga0207695_10353330 3300025913 Unclassified 1357
284 Ga0207695_10390610 3300025913 Bacteria 1276
285 Ga0207695_10631558 3300025913 Unclassified 952
286 Ga0207695_10950823 3300025913 Bacteria 739
287 Ga0207695_11232240 3300025913 Bacteria 628
288 Ga0207693_10001669 3300025915 Bacteria 19567
289 Ga0207663_10121181 3300025916 Bacteria 1791
290 Ga0207663_10271695 3300025916 Bacteria 1256
291 Ga0207663_10796391 3300025916 Bacteria 752
292 Ga0207660_10009676 3300025917 Bacteria 6239
293 Ga0207660_10015550 3300025917 Bacteria 5023
294 Ga0207660_10068156 3300025917 Bacteria 2580
295 Ga0207660_10231378 3300025917 Bacteria 1453
296 Ga0207657_10000610 3300025919 Bacteria 37898
297 Ga0207657_10007328 3300025919 Bacteria 11317
298 Ga0207657_10014383 3300025919 Bacteria 7727
299 Ga0207657_10015321 3300025919 Bacteria 7431
300 Ga0207657_10028466 3300025919 Bacteria 5097
301 Ga0207657_10051502 3300025919 Bacteria 3578
302 Ga0207657_10074992 3300025919 Bacteria 2855
303 Ga0207657_10791072 3300025919 Bacteria 734
304 Ga0207657_10998900 3300025919 Bacteria 642
305 Ga0207649_10030091 3300025920 Bacteria 3212
306 Ga0207649_10381068 3300025920 Bacteria 1051
307 Ga0207649_10980125 3300025920 Bacteria 665
308 Ga0207652_10043006 3300025921 Bacteria 3846
309 Ga0207652_10051041 3300025921 Bacteria 3545
310 Ga0207652_10134820 3300025921 Bacteria 2204
311 Ga0207652_10186870 3300025921 Bacteria 1863
312 Ga0207652_10290770 3300025921 Unclassified 1474
313 Ga0207652_10363953 3300025921 Bacteria 1305
314 Ga0207652_10931630 3300025921 Bacteria 766
315 Ga0207646_10283677 3300025922 Bacteria 1497
316 Ga0207694_10275505 3300025924 Unclassified 1381
317 Ga0207694_10832424 3300025924 Bacteria 780
318 Ga0207694_11339700 3300025924 Bacteria 605
319 Ga0207687_10080006 3300025927 Unclassified 2358
320 Ga0207687_10772740 3300025927 Bacteria 818
321 Ga0207700_10090896 3300025928 Bacteria 2410
322 Ga0207700_10174920 3300025928 Unclassified 1794
323 Ga0207700_10254322 3300025928 Bacteria 1502
324 Ga0207700_10486519 3300025928 Bacteria 1091
325 Ga0207664_10001873 3300025929 Bacteria 13841
326 Ga0207664_10050621 3300025929 Bacteria 3276
327 Ga0207664_10070626 3300025929 Bacteria 2811
328 Ga0207664_10070718 3300025929 Bacteria 2809
329 Ga0207664_10166324 3300025929 Bacteria 1884
330 Ga0207664_10219598 3300025929 Unclassified 1648
331 Ga0207664_10353063 3300025929 Bacteria 1302
332 Ga0207664_10835858 3300025929 Unclassified 828
333 Ga0207664_11715841 3300025929 Bacteria 550
334 Ga0207644_10104367 3300025931 Bacteria 2134
335 Ga0207644_10253236 3300025931 Bacteria 1405
336 Ga0207644_10496440 3300025931 Unclassified 1006
337 Ga0207690_10779796 3300025932 Bacteria 789
338 Ga0207709_10947906 3300025935 Bacteria 701
339 Ga0207709_11804404 3300025935 Unclassified 509
340 Ga0207669_10634159 3300025937 Unclassified 872
341 Ga0207665_10000697 3300025939 Bacteria 22783
342 Ga0207665_10369286 3300025939 Bacteria 1086
343 Ga0207665_11150337 3300025939 Bacteria 619
344 Ga0207711_10109514 3300025941 Bacteria 2454
345 Ga0207711_10576237 3300025941 Bacteria 1050
346 Ga0207661_10265081 3300025944 Unclassified 1531
347 Ga0207661_10298655 3300025944 Bacteria 1443
348 Ga0207661_11344662 3300025944 Unclassified 656
349 Ga0207661_11741922 3300025944 Unclassified 568
350 Ga0207679_10029791 3300025945 Bacteria 3804
351 Ga0207679_11611240 3300025945 Unclassified 595
352 Ga0207667_10108075 3300025949 Bacteria 2870
353 Ga0207667_10441268 3300025949 Bacteria 1323
354 Ga0207667_10642487 3300025949 Bacteria 1067
355 Ga0207667_10880719 3300025949 Unclassified 888
356 Ga0207667_11286530 3300025949 Bacteria 708
357 Ga0207712_10693394 3300025961 Unclassified 888
358 Ga0207677_10019282 3300026023 Bacteria 4117
359 Ga0207639_10253291 3300026041 Unclassified 1536
360 Ga0207639_10293066 3300026041 Bacteria 1435
361 Ga0207639_11942243 3300026041 Bacteria 549
362 Ga0207678_10061643 3300026067 Bacteria 3226
363 Ga0207678_11347821 3300026067 Bacteria 631
364 Ga0207702_10027351 3300026078 Bacteria 4736
365 Ga0207702_10114004 3300026078 Bacteria 2408
366 Ga0207702_10249755 3300026078 Unclassified 1665
367 Ga0207702_10574363 3300026078 Bacteria 1105
368 Ga0207702_10697563 3300026078 Bacteria 1000
369 Ga0207702_10741031 3300026078 Unclassified 970
370 Ga0207674_10020357 3300026116 Bacteria 7168
371 Ga0207674_10974624 3300026116 Unclassified 817
372 Ga0207698_10014358 3300026142 Bacteria 5262
373 Ga0207698_10068419 3300026142 Bacteria 2804
374 Ga0207698_10315668 3300026142 Unclassified 1461
375 Ga0207698_10384295 3300026142 Bacteria 1337
376 Ga0207698_11216514 3300026142 Unclassified 767
377 Ga0207698_11416092 3300026142 Unclassified 710
378 Ga0207698_11518415 3300026142 Bacteria 685
379 Ga0268266_10150474 3300028379 Bacteria 2097
380 Ga0268266_10475789 3300028379 Bacteria 1190
381 Ga0373926_0136682 3300035083 Unclassified 930
382 Ga0373940_0151560 3300035088 Bacteria 739
383 Ga0373944_0057674 3300035089 Bacteria 1238
384 Ga0373944_0105383 3300035089 Unclassified 957
385 Ga0373936_0030148 3300035113 Bacteria 2139
386 Ga0373945_0001630 3300035116 Bacteria 6879
387 Ga0373943_0045087 3300035170 Bacteria 2148
388 Ga0373946_0216545 3300035171 Unclassified 923
389 Ga0373961_0323302 3300035241 Bacteria 576
390 Ga0373931_0129252 3300035691 Bacteria 1452
391 Ga0373935_0069203 3300035692 Unclassified 2273
392 Ga0373927_0030667 3300035695 Bacteria 3508
393 Ga0373947_0011462 3300035725 Bacteria 5085
394 Ga0373947_0024837 3300035725 Bacteria 3494
395 Ga0373925_0096040 3300037068 Bacteria 2271
396 Ga0373925_0349457 3300037068 Unclassified 1200
397 Ga0373925_1433929 3300037068 Unclassified 565
398 Ga0395899_0093177 3300037312 Bacteria 2181
399 Ga0395899_0125787 3300037312 Bacteria 1833
400 Ga0395899_0243235 3300037312 Bacteria 1237
401 Ga0395899_0369479 3300037312 Unclassified 955
402 Ga0395899_0559961 3300037312 Bacteria 733
403 Ga0395900_0006366 3300037418 Bacteria 12310
404 Ga0395900_0059693 3300037418 Bacteria 3926
405 Ga0395900_0060217 3300037418 Bacteria 3908
406 Ga0395900_0114616 3300037418 Bacteria 2766
407 Ga0395900_0607575 3300037418 Bacteria 1033
408 Ga0395900_0914854 3300037418 Bacteria 800
409 Ga0395900_0932874 3300037418 Bacteria 790
410 Ga0395898_0003052 3300037466 Bacteria 18969
411 Ga0395898_0015914 3300037466 Bacteria 7707
412 Ga0395898_0039754 3300037466 Bacteria 4654
413 Ga0395898_0118398 3300037466 Bacteria 2537
414 Ga0395898_0198638 3300037466 Unclassified 1915
415 Ga0395898_0268505 3300037466 Bacteria 1627
416 Ga0395898_0364289 3300037466 Bacteria 1378
417 Ga0395898_0652545 3300037466 Bacteria 995
418 Ga0395898_0759985 3300037466 Bacteria 910
419 Ga0395898_0776044 3300037466 Unclassified 899
420 Ga0395898_0776224 3300037466 Unclassified 899
421 Ga0395898_0852343 3300037466 Bacteria 850
422 Ga0395898_1166626 3300037466 Unclassified 702
423 Ga0395905_0031972 3300037471 Bacteria 4951
424 Ga0395905_0035129 3300037471 Bacteria 4706
425 Ga0395905_0314253 3300037471 Bacteria 1455
426 Ga0395905_0590223 3300037471 Bacteria 1013
427 Ga0436364_0327379 3300037853 Bacteria 813
428 Ga0395901_0001077 3300038443 Bacteria 29182
429 Ga0395901_0002248 3300038443 Bacteria 19701
430 Ga0395901_0002794 3300038443 Bacteria 17608
431 Ga0395901_0196113 3300038443 Unclassified 2117
432 Ga0395901_0306413 3300038443 Bacteria 1646
433 Ga0395901_0331342 3300038443 Bacteria 1574
434 Ga0395901_0373439 3300038443 Unclassified 1469
435 Ga0395901_0608783 3300038443 Bacteria 1101
436 Ga0395901_0972708 3300038443 Unclassified 826
437 Ga0395901_1076895 3300038443 Bacteria 775
438 Ga0395901_2023693 3300038443 Bacteria 522
439 Ga0242420_016164 3300038996 Unclassified 1297
440 Ga0436365_0271194 3300039437 Bacteria 873
441 Ga0436365_1501848 3300039437 Bacteria 1363
442 Ga0436363_0023636 3300039450 Bacteria 661
443 Ga0436363_0204153 3300039450 Unclassified 1238
444 Ga0436363_0218760 3300039450 Bacteria 780
445 Ga0436363_1597774 3300039450 Unclassified 2596
446 Ga0439448_0332889 3300042005 Unclassified 541
447 Ga0450896_063450 3300042133 Bacteria 604
448 Ga0450910_025421 3300042147 Bacteria 911
449 Ga0466965_0161312 3300044683 Unclassified 1176
450 Ga0466965_0203792 3300044683 Bacteria 1050
451 Ga0466966_0076449 3300044684 Bacteria 2091
452 Ga0466966_0108060 3300044684 Unclassified 1716
453 Ga0466966_0179796 3300044684 Viruses 1284
454 Ga0466966_0332638 3300044684 Bacteria 913
455 Ga0466961_0030837 3300044693 Bacteria 3445
456 Ga0466961_0081812 3300044693 Bacteria 2043
457 Ga0466961_0316752 3300044693 Bacteria 952
458 Ga0466963_0000800 3300044694 Bacteria 15702
459 Ga0466963_0003084 3300044694 Bacteria 9444
460 Ga0466963_0007320 3300044694 Bacteria 6579
461 Ga0466963_0015593 3300044694 Bacteria 4710
462 Ga0466963_0022974 3300044694 Bacteria 3955
463 Ga0466963_0029600 3300044694 Bacteria 3526
464 Ga0466963_0032659 3300044694 Bacteria 3373
465 Ga0466963_0037124 3300044694 Bacteria 3180
466 Ga0466963_0041137 3300044694 Bacteria 3030
467 Ga0466963_0043211 3300044694 Bacteria 2962
468 Ga0466963_0044102 3300044694 Bacteria 2935
469 Ga0466963_0050303 3300044694 Bacteria 2758
470 Ga0466963_0058197 3300044694 Bacteria 2576
471 Ga0466963_0115475 3300044694 Bacteria 1845
472 Ga0466963_0123728 3300044694 Bacteria 1782
473 Ga0466963_0127566 3300044694 Unclassified 1755
474 Ga0466963_0204471 3300044694 Bacteria 1381
475 Ga0466963_0244999 3300044694 Unclassified 1257
476 Ga0466963_0397272 3300044694 Bacteria 972
477 Ga0466963_0475436 3300044694 Bacteria 882
478 Ga0466963_0514536 3300044694 Bacteria 845
479 Ga0466963_0759148 3300044694 Bacteria 684
480 Ga0466963_0874978 3300044694 Unclassified 633
481 Ga0466964_0006768 3300044706 Bacteria 4273
482 Ga0466964_0013339 3300044706 Bacteria 3117
483 Ga0466964_0027358 3300044706 Bacteria 2239
484 Ga0466964_0228352 3300044706 Bacteria 907
485 Ga0466964_0234041 3300044706 Bacteria 898
486 Ga0453684_0953700 3300044712 Bacteria 915
487 Ga0466971_0099835 3300044719 Unclassified 1333
488 Ga0466971_0195723 3300044719 Bacteria 953
489 Ga0466968_0023323 3300044735 Unclassified 2520
490 Ga0466968_0266383 3300044735 Unclassified 817
491 Ga0466957_0009772 3300044842 Bacteria 5482
492 Ga0466957_0020693 3300044842 Bacteria 3873
493 Ga0466957_0035751 3300044842 Bacteria 2982
494 Ga0466957_0051770 3300044842 Bacteria 2499
495 Ga0466957_0121220 3300044842 Bacteria 1667
496 Ga0466957_0148443 3300044842 Bacteria 1515
497 Ga0466957_0226062 3300044842 Unclassified 1237
498 Ga0466957_0451877 3300044842 Bacteria 885
499 Ga0466957_0576268 3300044842 Bacteria 786
500 Ga0466957_0668443 3300044842 Bacteria 731
501 Ga0466957_0809892 3300044842 Bacteria 666
502 Ga0466960_0012696 3300044901 Unclassified 3561
503 Ga0466960_0064761 3300044901 Bacteria 1803
504 Ga0466960_0116369 3300044901 Bacteria 1395
505 Ga0466960_0584063 3300044901 Unclassified 662
506 Ga0466959_0007928 3300045049 Bacteria 7480
507 Ga0466959_0137293 3300045049 Bacteria 1730
508 Ga0466959_0149398 3300045049 Bacteria 1648
509 Ga0466959_1141638 3300045049 Bacteria 518
510 Ga0466958_0009601 3300045836 Bacteria 5396
511 Ga0466958_0045871 3300045836 Bacteria 2637
512 Ga0466958_0053955 3300045836 Bacteria 2437
513 Ga0466958_0092055 3300045836 Unclassified 1877
514 Ga0466958_0112108 3300045836 Bacteria 1703
515 Ga0466958_0172711 3300045836 Bacteria 1369
516 Ga0466958_0917975 3300045836 Bacteria 571
517 Ga0466967_0001650 3300045976 Bacteria 13207
518 Ga0466967_0003929 3300045976 Bacteria 9875
519 Ga0466967_0009948 3300045976 Bacteria 7101
520 Ga0466967_0010954 3300045976 Bacteria 6835
521 Ga0466967_0011760 3300045976 Bacteria 6654
522 Ga0466967_0024940 3300045976 Bacteria 4923
523 Ga0466967_0026785 3300045976 Bacteria 4783
524 Ga0466967_0026862 3300045976 Bacteria 4778
525 Ga0466967_0032789 3300045976 Bacteria 4390
526 Ga0466967_0034755 3300045976 Bacteria 4282
527 Ga0466967_0046828 3300045976 Bacteria 3767
528 Ga0466967_0049995 3300045976 Bacteria 3659
529 Ga0466967_0064794 3300045976 Bacteria 3251
530 Ga0466967_0070542 3300045976 Bacteria 3126
531 Ga0466967_0083833 3300045976 Bacteria 2883
532 Ga0466967_0090999 3300045976 Bacteria 2772
533 Ga0466967_0099158 3300045976 Bacteria 2660
534 Ga0466967_0115828 3300045976 Bacteria 2469
535 Ga0466967_0117596 3300045976 Bacteria 2451
536 Ga0466967_0126431 3300045976 Bacteria 2368
537 Ga0466967_0138376 3300045976 Bacteria 2266
538 Ga0466967_0139084 3300045976 Archaea 2260
539 Ga0466967_0173635 3300045976 Bacteria 2029
540 Ga0466967_0241731 3300045976 Bacteria 1722
541 Ga0466967_0367264 3300045976 Bacteria 1395
542 Ga0466967_0490107 3300045976 Bacteria 1205
543 Ga0466967_0529057 3300045976 Bacteria 1159
544 Ga0466967_0539827 3300045976 Bacteria 1147
545 Ga0466967_0657172 3300045976 Unclassified 1037
546 Ga0466967_0725873 3300045976 Unclassified 985
547 Ga0466967_0828293 3300045976 Bacteria 919
548 Ga0466967_0862235 3300045976 Unclassified 900
549 Ga0466967_1109082 3300045976 Bacteria 788
550 Ga0466967_1313347 3300045976 Unclassified 720
551 Ga0466967_1743966 3300045976 Unclassified 620
552 Ga0495592_0084585 3300046454 Bacteria 2288
553 Ga0495603_0152900 3300046455 Bacteria 1340
554 Ga0495603_0216500 3300046455 Unclassified 1105
555 Ga0495641_0014671 3300046461 Bacteria 4229
556 Ga0495641_0045062 3300046461 Unclassified 2032
557 Ga0495653_0109744 3300046463 Bacteria 1985
558 Ga0495653_0277401 3300046463 Unclassified 1101
559 Ga0495582_0160736 3300046473 Unclassified 1277
560 Ga0495582_0194966 3300046473 Bacteria 1156
561 Ga0495664_0017420 3300046477 Bacteria 4107
562 Ga0495608_0454574 3300046511 Unclassified 779
563 Ga0495628_0802240 3300046516 Unclassified 658
564 Ga0495630_0094779 3300046517 Bacteria 2256
565 Ga0495630_0841849 3300046517 Unclassified 700
566 Ga0495630_1176060 3300046517 Unclassified 580
567 Ga0495652_0035618 3300046529 Bacteria 4331
568 Ga0495652_1069308 3300046529 Unclassified 525
569 Ga0495665_0193312 3300046531 Unclassified 1056
570 Ga0495665_0370990 3300046531 Bacteria 728
571 Ga0495640_0521511 3300046533 Unclassified 722
572 Ga0495640_0601894 3300046533 Bacteria 664
573 Ga0495587_0190498 3300046536 Unclassified 1161
574 Ga0495587_0392811 3300046536 Unclassified 771
575 Ga0495645_0352589 3300046543 Bacteria 948
576 Ga0495635_0084563 3300046663 Bacteria 2171
577 Ga0495635_0470007 3300046663 Unclassified 830
578 Ga0495635_1109320 3300046663 Bacteria 500
579 Ga0495657_0270888 3300046675 Bacteria 1018
580 Ga0495599_0005723 3300046678 Bacteria 7456
581 Ga0495599_0670515 3300046678 Bacteria 600
582 Ga0495623_0193197 3300046679 Bacteria 1175
583 Ga0495646_0696665 3300046680 Unclassified 511
584 Ga0495647_0100375 3300046681 Bacteria 1198
585 Ga0495658_0033856 3300046683 Unclassified 2801
586 Ga0495658_0090113 3300046683 Bacteria 1815
587 Ga0495613_0324931 3300046689 Unclassified 1061
588 Ga0495613_0367176 3300046689 Unclassified 986
589 Ga0495624_0294880 3300046690 Unclassified 978
590 Ga0495600_0209339 3300046809 Unclassified 1250
591 Ga0495600_0406951 3300046809 Bacteria 846
592 Ga0495604_0276825 3300047317 Bacteria 1135
593 Ga0495674_0208630 3300047319 Bacteria 1619
594 Ga0495676_0072676 3300047321 Bacteria 2640
595 Ga0495676_0741356 3300047321 Bacteria 634
596 Ga0495680_0206891 3300047322 Bacteria 1406
597 Ga0495684_0213316 3300047471 Unclassified 1418
598 Ga0495684_0748374 3300047471 Unclassified 643
599 Ga0495593_0139775 3300047673 Bacteria 1227
600 Ga0495602_0067123 3300048088 Bacteria 3087
601 Ga0495602_0405080 3300048088 Bacteria 972
602 Ga0496100_0007242 3300048903 Bacteria 6102
603 Ga0496100_0028330 3300048903 Bacteria 3454
604 Ga0496100_0029834 3300048903 Bacteria 3377
605 Ga0496100_0066666 3300048903 Bacteria 2388
606 Ga0496100_0189091 3300048903 Bacteria 1494
607 Ga0496101_0000942 3300048904 Bacteria 17171
608 Ga0496101_0004779 3300048904 Bacteria 8591
609 Ga0496101_0192197 3300048904 Bacteria 1575
610 Ga0496101_0691558 3300048904 Bacteria 805
611 Ga0496101_1232979 3300048904 Unclassified 586
612 Ga0496102_0022352 3300048905 Bacteria 5604
613 Ga0496102_0045321 3300048905 Bacteria 3993
614 Ga0496102_0082660 3300048905 Bacteria 2962
615 Ga0496102_0083397 3300048905 Bacteria 2949
616 Ga0496102_0481964 3300048905 Bacteria 1162
617 Ga0496102_0705276 3300048905 Unclassified 932
618 Ga0496102_0817054 3300048905 Unclassified 854
619 Ga0496102_1350070 3300048905 Bacteria 632
620 Ga0496103_0022510 3300048906 Bacteria 3795
621 Ga0496103_0087031 3300048906 Bacteria 1969
622 Ga0496103_0164166 3300048906 Bacteria 1425
623 Ga0496103_0389610 3300048906 Unclassified 895
624 Ga0496104_0003290 3300048907 Bacteria 13945
625 Ga0496104_0003782 3300048907 Bacteria 13095
626 Ga0496104_0026674 3300048907 Bacteria 5338
627 Ga0496104_0434976 3300048907 Bacteria 1224
628 Ga0496104_0712001 3300048907 Bacteria 911
629 Ga0496104_0802276 3300048907 Unclassified 847
630 Ga0496104_0973212 3300048907 Bacteria 753
631 Ga0496105_0000305 3300048908 Bacteria 32361
632 Ga0496105_0002512 3300048908 Bacteria 13305
633 Ga0496105_0026985 3300048908 Bacteria 4688
634 Ga0496105_0053883 3300048908 Bacteria 3322
635 Ga0496105_0170292 3300048908 Bacteria 1785
636 Ga0496105_0243423 3300048908 Bacteria 1459
637 Ga0496105_0386525 3300048908 Bacteria 1113
638 Ga0496105_0418663 3300048908 Unclassified 1061
639 Ga0496105_0550130 3300048908 Bacteria 901
640 Ga0496106_0000850 3300048909 Bacteria 22149
641 Ga0496106_0038856 3300048909 Bacteria 3563
642 Ga0496106_0047021 3300048909 Bacteria 3245
643 Ga0496106_0060710 3300048909 Bacteria 2866
644 Ga0496106_0085795 3300048909 Bacteria 2424
645 Ga0496106_0238636 3300048909 Bacteria 1452
646 Ga0496106_0608939 3300048909 Bacteria 875
647 Ga0496107_0004295 3300048910 Bacteria 9643
648 Ga0496107_0022389 3300048910 Bacteria 4465
649 Ga0496107_0026465 3300048910 Bacteria 4112
650 Ga0496107_0103432 3300048910 Bacteria 2089
651 Ga0496107_0104721 3300048910 Bacteria 2076
652 Ga0496107_0117846 3300048910 Bacteria 1955
653 Ga0496107_0630077 3300048910 Bacteria 791
654 Ga0496108_0026954 3300048911 Bacteria 4742
655 Ga0496108_0030948 3300048911 Bacteria 4436
656 Ga0496108_0134819 3300048911 Unclassified 2123
657 Ga0496108_0414994 3300048911 Unclassified 1176
658 Ga0496108_0652541 3300048911 Unclassified 915
659 Ga0496108_0837412 3300048911 Bacteria 792
660 Ga0496109_0002785 3300048912 Bacteria 14649
661 Ga0496109_0005751 3300048912 Bacteria 10374
662 Ga0496109_0037444 3300048912 Plasmid 4381
663 Ga0496109_0194815 3300048912 Bacteria 1905
664 Ga0496109_0363174 3300048912 Unclassified 1368
665 Ga0496109_0393329 3300048912 Unclassified 1310
666 Ga0496109_0486460 3300048912 Bacteria 1165
667 Ga0496109_0680722 3300048912 Bacteria 966
668 Ga0496109_0912085 3300048912 Bacteria 817
669 Ga0496109_1312715 3300048912 Bacteria 659
670 Ga0496109_1734689 3300048912 Bacteria 558
671 Ga0496110_0006758 3300048913 Bacteria 9124
672 Ga0496110_0126637 3300048913 Unclassified 2305
673 Ga0496110_0187473 3300048913 Bacteria 1878
674 Ga0496111_0022652 3300048914 Bacteria 4400
675 Ga0496111_0062911 3300048914 Unclassified 2691
676 Ga0496111_0065505 3300048914 Bacteria 2637
677 Ga0496111_0210858 3300048914 Bacteria 1443
678 Ga0496111_0868831 3300048914 Unclassified 650
679 Ga0496112_0007452 3300048915 Bacteria 9715
680 Ga0496112_0025360 3300048915 Bacteria 5693
681 Ga0496112_0043433 3300048915 Plasmid 4401
682 Ga0496112_0219121 3300048915 Bacteria 1859
683 Ga0496112_0447719 3300048915 Unclassified 1229
684 Ga0496112_0745752 3300048915 Bacteria 906
685 Ga0496112_0853353 3300048915 Bacteria 834
686 Ga0496113_0015437 3300048916 Bacteria 5248
687 Ga0496113_0069137 3300048916 Bacteria 2681
688 Ga0496113_0071154 3300048916 Bacteria 2646
689 Ga0496113_0344522 3300048916 Bacteria 1195
690 Ga0496113_0952998 3300048916 Unclassified 677
691 Ga0496114_0009801 3300048917 Bacteria 7611
692 Ga0496114_0018256 3300048917 Bacteria 5669
693 Ga0496114_0187016 3300048917 Bacteria 1810
694 Ga0496114_0251819 3300048917 Unclassified 1554
695 Ga0496114_0297427 3300048917 Bacteria 1425
696 Ga0496114_0567249 3300048917 Unclassified 1002
697 Ga0496115_0001257 3300048918 Bacteria 18199
698 Ga0496115_0080295 3300048918 Bacteria 2655
699 Ga0496115_0135068 3300048918 Bacteria 2034
700 Ga0496115_0240609 3300048918 Bacteria 1491
701 Ga0496115_0709378 3300048918 Unclassified 790
702 Ga0496115_1013354 3300048918 Unclassified 634
703 Ga0501036_0881988 3300049572 Bacteria 735
704 Ga0501038_0241788 3300049574 Bacteria 1433
705 Ga0501039_0242516 3300049575 Unclassified 1417
706 Ga0501040_0052568 3300049576 Unclassified 2789
707 Ga0501046_0295621 3300049580 Bacteria 1184
708 Ga0501047_0124743 3300049581 Bacteria 2456
709 Ga0501067_0000154 3300049583 Bacteria 38151
710 Ga0501067_0009568 3300049583 Bacteria 5368
711 Ga0501067_0167920 3300049583 Unclassified 1222
712 Ga0501067_0857999 3300049583 Unclassified 512
713 Ga0501068_0319351 3300049584 Bacteria 995
714 Ga0501068_0587466 3300049584 Unclassified 725
715 Ga0501069_0001465 3300049585 Bacteria 11614
716 Ga0501070_0080184 3300049586 Bacteria 2701
717 Ga0501070_0109291 3300049586 Bacteria 2285
718 Ga0501072_0019912 3300049588 Bacteria 5193
719 Ga0501073_0035240 3300049589 Bacteria 3558
720 Ga0501073_0904857 3300049589 Unclassified 608
721 Ga0501074_0017406 3300049590 Bacteria 5215
722 Ga0501076_0285957 3300049592 Bacteria 1351
723 Ga0501077_0014036 3300049593 Bacteria 5024
724 Ga0501079_0040961 3300049741 Bacteria 3575
725 Ga0501080_0030789 3300049742 Bacteria 4999
726 Ga0501080_0109469 3300049742 Unclassified 2561
727 Ga0501081_0039406 3300049743 Unclassified 3233
728 Ga0501083_0001263 3300049744 Bacteria 17161
729 Ga0501083_0957563 3300049744 Bacteria 557
730 Ga0501044_0317589 3300049823 Bacteria 1483
731 nmdc:mga05p37_2932_c1 3300050507 Bacteria 19794
732 nmdc:mga0n895_66084_c1 3300050512 Bacteria 3581
733 nmdc:mga0a205_21088_c2 3300050515 Bacteria 1680
734 Ga0495601_0019187 3300053077 Bacteria 4168
735 Ga0495601_0244229 3300053077 Bacteria 1172
736 Ga0495612_0003911 3300053078 Bacteria 6176
737 Ga0495612_0318304 3300053078 Bacteria 699
738 Ga0495655_0131090 3300053083 Bacteria 772
739 Ga0495595_0027283 3300053084 Bacteria 2543
740 Ga0495595_0641598 3300053084 Unclassified 543
741 Ga0495619_0111417 3300053085 Unclassified 1870
742 Ga0495619_0414568 3300053085 Unclassified 929
743 Ga0495619_0571228 3300053085 Unclassified 775
744 Ga0501084_0718257 3300054114 Unclassified 842
745 Ga0587083_0065028 3300059505 Bacteria 832
746 Ga0587128_013202 3300059630 Unclassified 1162
747 Ga0501082_0107763 3300060353 Bacteria 2410
748 Ga0501082_1802419 3300060353 Bacteria 534
749 Ga0466962_0024612 3300061719 Bacteria 2891
750 Ga0466962_0176093 3300061719 Unclassified 1042
751 Ga0466962_0289718 3300061719 Bacteria 809
752 Ga0466962_0307267 3300061719 Bacteria 785
753 Ga0466962_0496428 3300061719 Bacteria 617
754 Ga0530510_0075135 3300061734 Bacteria 2454
755 Ga0530510_0528604 3300061734 Bacteria 895
756 Ga0207641_10448400
757 JGI25407J50210_10006441
758 Ga0070658_10013356
759 Ga0070658_10022886
760 Ga0070658_10054259
761 Ga0070658_10089706
762 Ga0070658_10233268
763 Ga0070658_10265741
764 Ga0070658_10356711
765 Ga0070658_10903412
766 Ga0070683_100018974
767 Ga0070683_100117686
768 Ga0070683_100193777
769 Ga0070683_100279974
770 Ga0070683_101008735
771 Ga0070683_101505068
772 Ga0070683_101775171
773 Ga0070680_100020648
774 Ga0070680_100036319
775 Ga0070680_100042889
776 Ga0070682_100040572
777 Ga0070682_100124291
778 Ga0070682_100417252
779 Ga0070682_101293779
780 Ga0068868_100195637
781 Ga0070660_100013224
782 Ga0070660_100045995
783 Ga0070660_100059769
784 Ga0070660_100065879
785 Ga0070660_100452308
786 Ga0070691_10736978
787 Ga0070661_100014955
788 Ga0070661_100021648
789 Ga0070661_100074572
790 Ga0070661_100135069
791 Ga0070671_100053232
792 Ga0070671_100291406
793 Ga0070674_101611430
794 Ga0070659_100098463
795 Ga0070659_100148182
796 Ga0070659_100529653
797 Ga0070667_101477221
798 Ga0070703_10148867
799 Ga0070709_10011853
800 Ga0070709_10113962
801 Ga0070714_100013640
802 Ga0070714_100120654
803 Ga0070714_100150441
804 Ga0070714_100214057
805 Ga0070714_100224966
806 Ga0070714_100253896
807 Ga0070714_100293460
808 Ga0070714_100844242
809 Ga0070714_100875314
810 Ga0070714_101082463
811 Ga0070714_101738080
812 Ga0070713_100055588
813 Ga0070713_100175164
814 Ga0070713_100317791
815 Ga0070713_100405893
816 Ga0070713_101399975
817 Ga0070710_10029854
818 Ga0070710_10161493
819 Ga0070710_10772048
820 Ga0070710_10931366
821 Ga0070711_100067398
822 Ga0070711_100127897
823 Ga0070711_100659088
824 Ga0070711_100666172
825 Ga0070663_100149169
826 Ga0070663_101695213
827 Ga0070678_100599533
828 Ga0070681_10048445
829 Ga0070681_10066364
830 Ga0070681_10069520
831 Ga0070681_10078222
832 Ga0070681_10130801
833 Ga0070681_10145647
834 Ga0070681_10812886
835 Ga0070707_100271148
836 Ga0070679_100041019
837 Ga0070679_100081140
838 Ga0070679_100129449
839 Ga0070679_100188597
840 Ga0070679_100305368
841 Ga0070684_100093953
842 Ga0070684_100107519
843 Ga0070684_100212150
844 Ga0070684_100316936
845 Ga0070684_100356573
846 Ga0070684_100887744
847 Ga0068853_100164767
848 Ga0068853_100258839
849 Ga0070665_100366043
850 Ga0070704_100173402
851 Ga0068855_100014054
852 Ga0068855_100049101
853 Ga0068855_100076048
854 Ga0068855_100216744
855 Ga0068855_100236701
856 Ga0068855_100365400
857 Ga0068855_100426652
858 Ga0068855_100898277
859 Ga0070664_101271846
860 Ga0068857_100275592
861 Ga0068857_100367100
862 Ga0068857_100438106
863 Ga0068854_100291041
864 Ga0068854_100468390
865 Ga0068856_100041800
866 Ga0068856_100129436
867 Ga0068856_100148260
868 Ga0068856_100467392
869 Ga0068852_100026479
870 Ga0068852_100056211
871 Ga0068852_100274029
872 Ga0068852_100512354
873 Ga0068852_101375852
874 Ga0068859_101418667
875 Ga0068864_100865092
876 Ga0068861_101252322
877 Ga0068858_101298441
878 Ga0081455_10008492
879 Ga0081538_10001327
880 Ga0081539_10114127
881 Ga0070717_10054961
882 Ga0070717_10079617
883 Ga0070717_10240992
884 Ga0070717_10324974
885 Ga0070715_10000748
886 Ga0070715_10894381
887 Ga0070716_100012124
888 Ga0070712_100021648
889 Ga0070712_100151071
890 Ga0070712_100579568
891 Ga0070712_100858680
892 Ga0070712_101121484
893 Ga0070712_101445304
894 Ga0070712_101740733
895 Ga0097621_100397230
896 Ga0097621_100707106
897 Ga0075428_100008131
898 Ga0075433_10190599
899 Ga0075434_100007870
900 Ga0097620_101418582
901 Ga0075435_100148471
902 Ga0105240_10052404
903 Ga0105240_10057827
904 Ga0105240_10073576
905 Ga0105240_10337176
906 Ga0105240_10474412
907 Ga0105240_10937583
908 Ga0105240_11064727
909 Ga0105240_11748715
910 Ga0105240_12297915
911 Ga0105245_10011743
912 Ga0105247_10330508
913 Ga0114129_10006703
914 Ga0105243_10338215
915 Ga0105241_10240527
916 Ga0105241_10339213
917 Ga0105241_10388525
918 Ga0105241_11592746
919 Ga0105242_10018922
920 Ga0105248_10051830
921 Ga0105248_10343062
922 Ga0105237_10066073
923 Ga0105238_10100575
924 Ga0105238_10312234
925 Ga0105238_10316415
926 Ga0105238_10509001
927 Ga0105249_11221396
928 Ga0105239_10064567
929 Ga0105239_10074951
930 Ga0105239_10372767
931 Ga0105239_11133371
932 Ga0105239_11381247
933 Ga0105246_10217246
934 Ga0154010_105530
935 Ga0157373_10063948
936 Ga0157373_10239549
937 Ga0157373_11123250
938 Ga0157371_10246545
939 Ga0157371_10499043
940 Ga0157371_10784592
941 Ga0157371_10899364
942 Ga0157370_10015057
943 Ga0157370_10021166
944 Ga0157370_10053446
945 Ga0157370_10057477
946 Ga0157370_10159771
947 Ga0157370_10194594
948 Ga0157370_10199255
949 Ga0157370_10376261
950 Ga0157370_10430888
951 Ga0157370_11464744
952 Ga0157369_10004422
953 Ga0157369_10029083
954 Ga0157369_10035320
955 Ga0157369_10043468
956 Ga0157369_10053298
957 Ga0157369_10091319
958 Ga0157369_10096223
959 Ga0157369_10125860
960 Ga0157369_10415356
961 Ga0157369_10744440
962 Ga0157369_10957756
963 Ga0157369_11614032
964 Ga0157374_10008828
965 Ga0157374_10040394
966 Ga0157374_10373678
967 Ga0157374_10388242
968 Ga0157374_10683970
969 Ga0157378_10124084
970 Ga0157372_10037160
971 Ga0157372_10045886
972 Ga0157372_10052116
973 Ga0157372_10192089
974 Ga0157372_10509329
975 Ga0157372_10686033
976 Ga0157372_10865594
977 Ga0157372_10886064
978 Ga0157372_11101625
979 Ga0157375_11992560
980 Ga0157375_13073265
981 Ga0163163_11194412
982 Ga0182008_10002698
983 Ga0182008_10459632
984 Ga0157377_10152635
985 Ga0157377_10231037
986 Ga0157379_10389783
987 Ga0157376_10143623
988 Ga0157376_10190357
989 Ga0182006_1004883
990 Ga0182006_1068509
991 Ga0182006_1150890
992 Ga0182007_10076497
993 Ga0182005_1212163
994 Ga0197907_10101945
995 Ga0197907_10566242
996 Ga0206356_10270218
997 Ga0206356_10981012
998 Ga0206356_11015167
999 Ga0206355_1521071
1000 Ga0206351_10645199
1001 Ga0206352_10891980
1002 Ga0206350_10834390
1003 Ga0206350_11487734
1004 Ga0206354_10373740
1005 Ga0206354_11513803
1006 Ga0206353_10033469
1007 Ga0206353_10465379
1008 Ga0206353_10818496
1009 Ga0206353_10843204
1010 Ga0206353_10999856
1011 Ga0206353_12033280
1012 Ga0206353_12052016
1013 Ga0154015_1357428
1014 Ga0154015_1642039
1015 Ga0213874_10060377
1016 Ga0213876_10061470
1017 Ga0213875_10339278
1018 Ga0224712_10038636
1019 Ga0224712_10061335
1020 Ga0224712_10071822
1021 Ga0224712_10154456
1022 Ga0224712_10172128
1023 Ga0224712_10178748
1024 Ga0224712_10309316
1025 Ga0207692_10077657
1026 Ga0207685_10257728
1027 Ga0207705_10037868
1028 Ga0207705_10131573
1029 Ga0207705_10297148
1030 Ga0207705_10534235
1031 Ga0207654_10404137
1032 Ga0207654_10418555
1033 Ga0207707_10194452
1034 Ga0207707_10197496
1035 Ga0207707_10372094
1036 Ga0207695_10072907
1037 Ga0207695_10107717
1038 Ga0207695_10353330
1039 Ga0207695_10390610
1040 Ga0207695_10631558
1041 Ga0207695_10950823
1042 Ga0207695_11232240
1043 Ga0207693_10001669
1044 Ga0207663_10121181
1045 Ga0207663_10271695
1046 Ga0207663_10796391
1047 Ga0207660_10009676
1048 Ga0207660_10015550
1049 Ga0207660_10068156
1050 Ga0207660_10231378
1051 Ga0207657_10000610
1052 Ga0207657_10007328
1053 Ga0207657_10014383
1054 Ga0207657_10015321
1055 Ga0207657_10028466
1056 Ga0207657_10051502
1057 Ga0207657_10074992
1058 Ga0207657_10791072
1059 Ga0207657_10998900
1060 Ga0207649_10030091
1061 Ga0207649_10381068
1062 Ga0207649_10980125
1063 Ga0207652_10043006
1064 Ga0207652_10051041
1065 Ga0207652_10134820
1066 Ga0207652_10186870
1067 Ga0207652_10290770
1068 Ga0207652_10363953
1069 Ga0207652_10931630
1070 Ga0207646_10283677
1071 Ga0207694_10275505
1072 Ga0207694_10832424
1073 Ga0207694_11339700
1074 Ga0207687_10080006
1075 Ga0207687_10772740
1076 Ga0207700_10090896
1077 Ga0207700_10174920
1078 Ga0207700_10254322
1079 Ga0207700_10486519
1080 Ga0207664_10001873
1081 Ga0207664_10050621
1082 Ga0207664_10070626
1083 Ga0207664_10070718
1084 Ga0207664_10166324
1085 Ga0207664_10219598
1086 Ga0207664_10353063
1087 Ga0207664_10835858
1088 Ga0207664_11715841
1089 Ga0207644_10104367
1090 Ga0207644_10253236
1091 Ga0207644_10496440
1092 Ga0207690_10779796
1093 Ga0207709_10947906
1094 Ga0207709_11804404
1095 Ga0207669_10634159
1096 Ga0207665_10000697
1097 Ga0207665_10369286
1098 Ga0207665_11150337
1099 Ga0207711_10109514
1100 Ga0207711_10576237
1101 Ga0207661_10265081
1102 Ga0207661_10298655
1103 Ga0207661_11344662
1104 Ga0207661_11741922
1105 Ga0207679_10029791
1106 Ga0207679_11611240
1107 Ga0207667_10108075
1108 Ga0207667_10441268
1109 Ga0207667_10642487
1110 Ga0207667_10880719
1111 Ga0207667_11286530
1112 Ga0207712_10693394
1113 Ga0207677_10019282
1114 Ga0207639_10253291
1115 Ga0207639_10293066
1116 Ga0207639_11942243
1117 Ga0207678_10061643
1118 Ga0207678_11347821
1119 Ga0207702_10027351
1120 Ga0207702_10114004
1121 Ga0207702_10249755
1122 Ga0207702_10574363
1123 Ga0207702_10697563
1124 Ga0207702_10741031
1125 Ga0207674_10020357
1126 Ga0207674_10974624
1127 Ga0207698_10014358
1128 Ga0207698_10068419
1129 Ga0207698_10315668
1130 Ga0207698_10384295
1131 Ga0207698_11216514
1132 Ga0207698_11416092
1133 Ga0207698_11518415
1134 Ga0268266_10150474
1135 Ga0268266_10475789
1136 Ga0373926_0136682
1137 Ga0373940_0151560
1138 Ga0373944_0057674
1139 Ga0373944_0105383
1140 Ga0373936_0030148
1141 Ga0373945_0001630
1142 Ga0373943_0045087
1143 Ga0373946_0216545
1144 Ga0373961_0323302
1145 Ga0373931_0129252
1146 Ga0373935_0069203
1147 Ga0373927_0030667
1148 Ga0373947_0011462
1149 Ga0373947_0024837
1150 Ga0373925_0096040
1151 Ga0373925_0349457
1152 Ga0373925_1433929
1153 Ga0395899_0093177
1154 Ga0395899_0125787
1155 Ga0395899_0243235
1156 Ga0395899_0369479
1157 Ga0395899_0559961
1158 Ga0395900_0006366
1159 Ga0395900_0059693
1160 Ga0395900_0060217
1161 Ga0395900_0114616
1162 Ga0395900_0607575
1163 Ga0395900_0914854
1164 Ga0395900_0932874
1165 Ga0395898_0003052
1166 Ga0395898_0015914
1167 Ga0395898_0039754
1168 Ga0395898_0118398
1169 Ga0395898_0198638
1170 Ga0395898_0268505
1171 Ga0395898_0364289
1172 Ga0395898_0652545
1173 Ga0395898_0759985
1174 Ga0395898_0776044
1175 Ga0395898_0776224
1176 Ga0395898_0852343
1177 Ga0395898_1166626
1178 Ga0395905_0031972
1179 Ga0395905_0035129
1180 Ga0395905_0314253
1181 Ga0395905_0590223
1182 Ga0436364_0327379
1183 Ga0395901_0001077
1184 Ga0395901_0002248
1185 Ga0395901_0002794
1186 Ga0395901_0196113
1187 Ga0395901_0306413
1188 Ga0395901_0331342
1189 Ga0395901_0373439
1190 Ga0395901_0608783
1191 Ga0395901_0972708
1192 Ga0395901_1076895
1193 Ga0395901_2023693
1194 Ga0242420_016164
1195 Ga0436365_0271194
1196 Ga0436365_1501848
1197 Ga0436363_0023636
1198 Ga0436363_0204153
1199 Ga0436363_0218760
1200 Ga0436363_1597774
1201 Ga0439448_0332889
1202 Ga0450896_063450
1203 Ga0450910_025421
1204 Ga0466965_0161312
1205 Ga0466965_0203792
1206 Ga0466966_0076449
1207 Ga0466966_0108060
1208 Ga0466966_0179796
1209 Ga0466966_0332638
1210 Ga0466961_0030837
1211 Ga0466961_0081812
1212 Ga0466961_0316752
1213 Ga0466963_0000800
1214 Ga0466963_0003084
1215 Ga0466963_0007320
1216 Ga0466963_0015593
1217 Ga0466963_0022974
1218 Ga0466963_0029600
1219 Ga0466963_0032659
1220 Ga0466963_0037124
1221 Ga0466963_0041137
1222 Ga0466963_0043211
1223 Ga0466963_0044102
1224 Ga0466963_0050303
1225 Ga0466963_0058197
1226 Ga0466963_0115475
1227 Ga0466963_0123728
1228 Ga0466963_0127566
1229 Ga0466963_0204471
1230 Ga0466963_0244999
1231 Ga0466963_0397272
1232 Ga0466963_0475436
1233 Ga0466963_0514536
1234 Ga0466963_0759148
1235 Ga0466963_0874978
1236 Ga0466964_0006768
1237 Ga0466964_0013339
1238 Ga0466964_0027358
1239 Ga0466964_0228352
1240 Ga0466964_0234041
1241 Ga0453684_0953700
1242 Ga0466971_0099835
1243 Ga0466971_0195723
1244 Ga0466968_0023323
1245 Ga0466968_0266383
1246 Ga0466957_0009772
1247 Ga0466957_0020693
1248 Ga0466957_0035751
1249 Ga0466957_0051770
1250 Ga0466957_0121220
1251 Ga0466957_0148443
1252 Ga0466957_0226062
1253 Ga0466957_0451877
1254 Ga0466957_0576268
1255 Ga0466957_0668443
1256 Ga0466957_0809892
1257 Ga0466960_0012696
1258 Ga0466960_0064761
1259 Ga0466960_0116369
1260 Ga0466960_0584063
1261 Ga0466959_0007928
1262 Ga0466959_0137293
1263 Ga0466959_0149398
1264 Ga0466959_1141638
1265 Ga0466958_0009601
1266 Ga0466958_0045871
1267 Ga0466958_0053955
1268 Ga0466958_0092055
1269 Ga0466958_0112108
1270 Ga0466958_0172711
1271 Ga0466958_0917975
1272 Ga0466967_0001650
1273 Ga0466967_0003929
1274 Ga0466967_0009948
1275 Ga0466967_0010954
1276 Ga0466967_0011760
1277 Ga0466967_0024940
1278 Ga0466967_0026785
1279 Ga0466967_0026862
1280 Ga0466967_0032789
1281 Ga0466967_0034755
1282 Ga0466967_0046828
1283 Ga0466967_0049995
1284 Ga0466967_0064794
1285 Ga0466967_0070542
1286 Ga0466967_0083833
1287 Ga0466967_0090999
1288 Ga0466967_0099158
1289 Ga0466967_0115828
1290 Ga0466967_0117596
1291 Ga0466967_0126431
1292 Ga0466967_0138376
1293 Ga0466967_0139084
1294 Ga0466967_0173635
1295 Ga0466967_0241731
1296 Ga0466967_0367264
1297 Ga0466967_0490107
1298 Ga0466967_0529057
1299 Ga0466967_0539827
1300 Ga0466967_0657172
1301 Ga0466967_0725873
1302 Ga0466967_0828293
1303 Ga0466967_0862235
1304 Ga0466967_1109082
1305 Ga0466967_1313347
1306 Ga0466967_1743966
1307 Ga0495592_0084585
1308 Ga0495603_0152900
1309 Ga0495603_0216500
1310 Ga0495641_0014671
1311 Ga0495641_0045062
1312 Ga0495653_0109744
1313 Ga0495653_0277401
1314 Ga0495582_0160736
1315 Ga0495582_0194966
1316 Ga0495664_0017420
1317 Ga0495608_0454574
1318 Ga0495628_0802240
1319 Ga0495630_0094779
1320 Ga0495630_0841849
1321 Ga0495630_1176060
1322 Ga0495652_0035618
1323 Ga0495652_1069308
1324 Ga0495665_0193312
1325 Ga0495665_0370990
1326 Ga0495640_0521511
1327 Ga0495640_0601894
1328 Ga0495587_0190498
1329 Ga0495587_0392811
1330 Ga0495645_0352589
1331 Ga0495635_0084563
1332 Ga0495635_0470007
1333 Ga0495635_1109320
1334 Ga0495657_0270888
1335 Ga0495599_0005723
1336 Ga0495599_0670515
1337 Ga0495623_0193197
1338 Ga0495646_0696665
1339 Ga0495647_0100375
1340 Ga0495658_0033856
1341 Ga0495658_0090113
1342 Ga0495613_0324931
1343 Ga0495613_0367176
1344 Ga0495624_0294880
1345 Ga0495600_0209339
1346 Ga0495600_0406951
1347 Ga0495604_0276825
1348 Ga0495674_0208630
1349 Ga0495676_0072676
1350 Ga0495676_0741356
1351 Ga0495680_0206891
1352 Ga0495684_0213316
1353 Ga0495684_0748374
1354 Ga0495593_0139775
1355 Ga0495602_0067123
1356 Ga0495602_0405080
1357 Ga0496100_0007242
1358 Ga0496100_0028330
1359 Ga0496100_0029834
1360 Ga0496100_0066666
1361 Ga0496100_0189091
1362 Ga0496101_0000942
1363 Ga0496101_0004779
1364 Ga0496101_0192197
1365 Ga0496101_0691558
1366 Ga0496101_1232979
1367 Ga0496102_0022352
1368 Ga0496102_0045321
1369 Ga0496102_0082660
1370 Ga0496102_0083397
1371 Ga0496102_0481964
1372 Ga0496102_0705276
1373 Ga0496102_0817054
1374 Ga0496102_1350070
1375 Ga0496103_0022510
1376 Ga0496103_0087031
1377 Ga0496103_0164166
1378 Ga0496103_0389610
1379 Ga0496104_0003290
1380 Ga0496104_0003782
1381 Ga0496104_0026674
1382 Ga0496104_0434976
1383 Ga0496104_0712001
1384 Ga0496104_0802276
1385 Ga0496104_0973212
1386 Ga0496105_0000305
1387 Ga0496105_0002512
1388 Ga0496105_0026985
1389 Ga0496105_0053883
1390 Ga0496105_0170292
1391 Ga0496105_0243423
1392 Ga0496105_0386525
1393 Ga0496105_0418663
1394 Ga0496105_0550130
1395 Ga0496106_0000850
1396 Ga0496106_0038856
1397 Ga0496106_0047021
1398 Ga0496106_0060710
1399 Ga0496106_0085795
1400 Ga0496106_0238636
1401 Ga0496106_0608939
1402 Ga0496107_0004295
1403 Ga0496107_0022389
1404 Ga0496107_0026465
1405 Ga0496107_0103432
1406 Ga0496107_0104721
1407 Ga0496107_0117846
1408 Ga0496107_0630077
1409 Ga0496108_0026954
1410 Ga0496108_0030948
1411 Ga0496108_0134819
1412 Ga0496108_0414994
1413 Ga0496108_0652541
1414 Ga0496108_0837412
1415 Ga0496109_0002785
1416 Ga0496109_0005751
1417 Ga0496109_0037444
1418 Ga0496109_0194815
1419 Ga0496109_0363174
1420 Ga0496109_0393329
1421 Ga0496109_0486460
1422 Ga0496109_0680722
1423 Ga0496109_0912085
1424 Ga0496109_1312715
1425 Ga0496109_1734689
1426 Ga0496110_0006758
1427 Ga0496110_0126637
1428 Ga0496110_0187473
1429 Ga0496111_0022652
1430 Ga0496111_0062911
1431 Ga0496111_0065505
1432 Ga0496111_0210858
1433 Ga0496111_0868831
1434 Ga0496112_0007452
1435 Ga0496112_0025360
1436 Ga0496112_0043433
1437 Ga0496112_0219121
1438 Ga0496112_0447719
1439 Ga0496112_0745752
1440 Ga0496112_0853353
1441 Ga0496113_0015437
1442 Ga0496113_0069137
1443 Ga0496113_0071154
1444 Ga0496113_0344522
1445 Ga0496113_0952998
1446 Ga0496114_0009801
1447 Ga0496114_0018256
1448 Ga0496114_0187016
1449 Ga0496114_0251819
1450 Ga0496114_0297427
1451 Ga0496114_0567249
1452 Ga0496115_0001257
1453 Ga0496115_0080295
1454 Ga0496115_0135068
1455 Ga0496115_0240609
1456 Ga0496115_0709378
1457 Ga0496115_1013354
1458 Ga0501036_0881988
1459 Ga0501038_0241788
1460 Ga0501039_0242516
1461 Ga0501040_0052568
1462 Ga0501046_0295621
1463 Ga0501047_0124743
1464 Ga0501067_0000154
1465 Ga0501067_0009568
1466 Ga0501067_0167920
1467 Ga0501067_0857999
1468 Ga0501068_0319351
1469 Ga0501068_0587466
1470 Ga0501069_0001465
1471 Ga0501070_0080184
1472 Ga0501070_0109291
1473 Ga0501072_0019912
1474 Ga0501073_0035240
1475 Ga0501073_0904857
1476 Ga0501074_0017406
1477 Ga0501076_0285957
1478 Ga0501077_0014036
1479 Ga0501079_0040961
1480 Ga0501080_0030789
1481 Ga0501080_0109469
1482 Ga0501081_0039406
1483 Ga0501083_0001263
1484 Ga0501083_0957563
1485 Ga0501044_0317589
1486 nmdc:mga05p37_2932_c1
1487 nmdc:mga0n895_66084_c1
1488 nmdc:mga0a205_21088_c2
1489 Ga0495601_0019187
1490 Ga0495601_0244229
1491 Ga0495612_0003911
1492 Ga0495612_0318304
1493 Ga0495655_0131090
1494 Ga0495595_0027283
1495 Ga0495595_0641598
1496 Ga0495619_0111417
1497 Ga0495619_0414568
1498 Ga0495619_0571228
1499 Ga0501084_0718257
1500 Ga0587083_0065028
1501 Ga0587128_013202
1502 Ga0501082_0107763
1503 Ga0501082_1802419
1504 Ga0466962_0024612
1505 Ga0466962_0176093
1506 Ga0466962_0289718
1507 Ga0466962_0307267
1508 Ga0466962_0496428
1509 Ga0530510_0075135
1510 Ga0530510_0528604

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20730

YetF_N

YetF N-terminal transmembrane domain

1

75

0.93

PF04239

DUF421

YetF C-terminal domain

77

152

0.89

PF02410

RsfS

Ribosomal silencing factor during starvation

91

157

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c6f-assembly1.cif.gz_C crystal structure of protein bsu07140 from bacillus subtilis 0.9489 91 145
4v7j-assembly1.cif.gz_Ao structure of rele nuclease bound to the 70s ribosome (precleavage state) 0.4522 35 86
4v7w-assembly2.cif.gz_CO structure of the thermus thermophilus ribosome complexed with chloramphenicol. 0.4306 31 86
7es4-assembly1.cif.gz_A the crystral structure of dndh-c-domain 0.4241 90 145
4v7l-assembly2.cif.gz_CO the structures of viomycin bound to the 70s ribosome. 0.4128 27 86
ID Description Score Start End Superfamily
3c6fD01 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.9469 91 145 3.30.240.20
3c6fC02 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.9251 89 144 3.30.240.20
af_P75839_95_166_3.30.240.20 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.8509 77 145 3.30.240.20
3c6fD01 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.8327 91 145 3.30.240.20
3c6fC02 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.8168 89 144 3.30.240.20
ID Description Score Start End GO Terms
AF-A0A5B2TC47-F1-model_v4 DUF421 domain-containing protein 0.8932 2 145 GO:0005886
AF-A0A2W4LXT0-F1-model_v4 DUF421 domain-containing protein 0.8772 1 145 GO:0005886
AF-A0A5B2TC47-F1-model_v4 DUF421 domain-containing protein 0.8759 2 145 GO:0005886
AF-A0A2W4LXT0-F1-model_v4 DUF421 domain-containing protein 0.8717 1 145 GO:0005886
AF-A0A7W0JQC3-F1-model_v4 DUF421 domain-containing protein 0.8713 2 144 GO:0005886

Map