F479296

General Info

Members Datasets Scaffolds Average Seq Length
755 260 1510 79

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_11263725|Ga0105245_112637251
Length 92
Sequence LNILNPKEQQQRMPIVTAIENAVETGDSPEVDSKYRLIILAAKRSKQLQRGAQPRIEIDPQKHKPTRIALEEVIRGRVHFNIKEENIKNPAV

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
106 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
107 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
195 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
196 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
197 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
198 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
205 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
206 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
207 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
208 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
222 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
223 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
224 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
225 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
226 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
227 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
228 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
229 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
230 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
231 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
232 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
233 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
234 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
235 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
236 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
237 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
238 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
239 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
240 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
241 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
242 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
243 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
244 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
245 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
246 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
247 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
248 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
249 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 2.12
Rhizosphere 97.35
Stem 0
Stem Tuber 0
Unclassified 21.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_11263725 3300009098 Unclassified 787
2 SwRhRL2b_contig_1718611 2162886007 Unclassified 948
3 MRS1b_contig_2451402 2162886011 Unclassified 847
4 MBSR1b_contig_4086223 2162886012 Bacteria 808
5 rootL2_10113713 3300003322 Bacteria 1051
6 rootL2_10297144 3300003322 Bacteria 1201
7 Ga0065714_10288552 3300005288 Bacteria 712
8 Ga0065704_10099938 3300005289 Bacteria 2287
9 Ga0065704_10109033 3300005289 Bacteria 1972
10 Ga0065712_10000030 3300005290 Bacteria 237869
11 Ga0065712_10011438 3300005290 Bacteria 2708
12 Ga0065712_10069428 3300005290 Bacteria 7318
13 Ga0065712_10071236 3300005290 Bacteria 5356
14 Ga0065712_10407166 3300005290 Unclassified 682
15 Ga0065715_10071735 3300005293 Bacteria 714
16 Ga0065715_10089414 3300005293 Bacteria 10379
17 Ga0065715_10114553 3300005293 Bacteria 2414
18 Ga0065715_10129896 3300005293 Bacteria 2036
19 Ga0065715_10139832 3300005293 Bacteria 1870
20 Ga0065715_10246355 3300005293 Bacteria 1182
21 Ga0065715_10434520 3300005293 Unclassified 843
22 Ga0065715_10459410 3300005293 Bacteria 818
23 Ga0065715_10627764 3300005293 Unclassified 691
24 Ga0065707_10010975 3300005295 Bacteria 2012
25 Ga0065707_10144825 3300005295 Bacteria 1727
26 Ga0065707_10169903 3300005295 Bacteria 1488
27 Ga0065707_10206933 3300005295 Bacteria 1284
28 Ga0065707_10230912 3300005295 Bacteria 1177
29 Ga0065707_10534226 3300005295 Bacteria 732
30 Ga0070676_10516296 3300005328 Bacteria 850
31 Ga0070683_102180409 3300005329 Unclassified 532
32 Ga0070690_100002388 3300005330 Bacteria 10092
33 Ga0070690_100106795 3300005330 Bacteria 1863
34 Ga0070690_100826746 3300005330 Bacteria 720
35 Ga0070670_100086225 3300005331 Bacteria 2698
36 Ga0070677_10091328 3300005333 Unclassified 1325
37 Ga0068869_100046679 3300005334 Unclassified 3124
38 Ga0068869_100196140 3300005334 Bacteria 1590
39 Ga0068869_100439946 3300005334 Bacteria 1079
40 Ga0068869_100979641 3300005334 Unclassified 735
41 Ga0068869_101541982 3300005334 Unclassified 591
42 Ga0070666_10053830 3300005335 Bacteria 2715
43 Ga0070666_10759730 3300005335 Bacteria 713
44 Ga0070680_100002130 3300005336 Bacteria 14632
45 Ga0070680_100028537 3300005336 Bacteria 4477
46 Ga0070680_100164120 3300005336 Bacteria 1867
47 Ga0070680_101499428 3300005336 Unclassified 584
48 Ga0070680_101928478 3300005336 Bacteria 512
49 Ga0068868_100062207 3300005338 Unclassified 2958
50 Ga0068868_100152282 3300005338 Bacteria 1905
51 Ga0068868_100330975 3300005338 Bacteria 1300
52 Ga0068868_100923855 3300005338 Bacteria 794
53 Ga0068868_101156727 3300005338 Bacteria 714
54 Ga0068868_101519501 3300005338 Unclassified 627
55 Ga0070660_100035855 3300005339 Bacteria 3755
56 Ga0070689_100537205 3300005340 Bacteria 1006
57 Ga0070689_100552228 3300005340 Unclassified 992
58 Ga0070689_100744444 3300005340 Unclassified 859
59 Ga0070689_100804457 3300005340 Bacteria 827
60 Ga0070691_10223382 3300005341 Bacteria 999
61 Ga0070691_10696525 3300005341 Bacteria 609
62 Ga0070687_100131293 3300005343 Unclassified 1446
63 Ga0070687_100546227 3300005343 Unclassified 787
64 Ga0070687_100711573 3300005343 Bacteria 703
65 Ga0070687_100996801 3300005343 Bacteria 607
66 Ga0070687_101091146 3300005343 Unclassified 583
67 Ga0070661_100027570 3300005344 Bacteria 4091
68 Ga0070661_101750170 3300005344 Unclassified 527
69 Ga0070692_10474225 3300005345 Bacteria 806
70 Ga0070692_10598728 3300005345 Bacteria 729
71 Ga0070692_10965887 3300005345 Unclassified 593
72 Ga0070692_11086824 3300005345 Unclassified 564
73 Ga0070692_11344523 3300005345 Bacteria 514
74 Ga0070668_100015648 3300005347 Bacteria 5672
75 Ga0070668_100478696 3300005347 Bacteria 1075
76 Ga0070669_100002358 3300005353 Bacteria 13651
77 Ga0070669_100048097 3300005353 Unclassified 3112
78 Ga0070669_100100934 3300005353 Bacteria 2177
79 Ga0070669_101242716 3300005353 Unclassified 644
80 Ga0070675_100041500 3300005354 Unclassified 3758
81 Ga0070675_100069003 3300005354 Bacteria 2928
82 Ga0070675_101425166 3300005354 Bacteria 639
83 Ga0070671_100010018 3300005355 Bacteria 7612
84 Ga0070671_100032580 3300005355 Unclassified 4308
85 Ga0070671_100039259 3300005355 Bacteria 3930
86 Ga0070674_100122214 3300005356 Bacteria 1929
87 Ga0070674_100341551 3300005356 Unclassified 1206
88 Ga0070674_102112965 3300005356 Bacteria 514
89 Ga0070673_100009372 3300005364 Bacteria 6570
90 Ga0070673_100348108 3300005364 Bacteria 1314
91 Ga0070673_100376809 3300005364 Bacteria 1264
92 Ga0070673_100568710 3300005364 Bacteria 1031
93 Ga0070673_101417530 3300005364 Unclassified 654
94 Ga0070673_101629504 3300005364 Bacteria 610
95 Ga0070673_101720620 3300005364 Bacteria 593
96 Ga0070673_102110209 3300005364 Bacteria 535
97 Ga0070688_100092703 3300005365 Bacteria 1976
98 Ga0070688_100333299 3300005365 Bacteria 1106
99 Ga0070659_100002497 3300005366 Bacteria 13068
100 Ga0070659_101281333 3300005366 Bacteria 650
101 Ga0070667_100035855 3300005367 Unclassified 4157
102 Ga0070667_100171219 3300005367 Bacteria 1917
103 Ga0070667_102056464 3300005367 Bacteria 538
104 Ga0070701_10019721 3300005438 Bacteria 3190
105 Ga0070701_10032683 3300005438 Unclassified 2593
106 Ga0070701_10254985 3300005438 Bacteria 1061
107 Ga0070705_101657967 3300005440 Unclassified 539
108 Ga0070700_100000278 3300005441 Bacteria 27369
109 Ga0070700_100015785 3300005441 Bacteria 4289
110 Ga0070700_101354298 3300005441 Unclassified 600
111 Ga0070694_100047346 3300005444 Bacteria 2890
112 Ga0070694_100406646 3300005444 Bacteria 1067
113 Ga0070694_100787546 3300005444 Unclassified 779
114 Ga0070694_100855458 3300005444 Bacteria 749
115 Ga0070694_101232775 3300005444 Unclassified 627
116 Ga0070694_101376451 3300005444 Bacteria 595
117 Ga0070708_101053831 3300005445 Bacteria 762
118 Ga0070708_101492776 3300005445 Unclassified 630
119 Ga0070708_101733818 3300005445 Bacteria 580
120 Ga0070678_100422725 3300005456 Bacteria 1162
121 Ga0070662_100051556 3300005457 Unclassified 2972
122 Ga0070662_100545599 3300005457 Bacteria 971
123 Ga0070662_100725581 3300005457 Bacteria 842
124 Ga0070662_101486282 3300005457 Unclassified 584
125 Ga0070681_10000125 3300005458 Bacteria 57900
126 Ga0070681_10002764 3300005458 Bacteria 16194
127 Ga0070681_10050439 3300005458 Bacteria 4152
128 Ga0070681_10455966 3300005458 Bacteria 1191
129 Ga0068867_100172863 3300005459 Bacteria 1712
130 Ga0068867_100451042 3300005459 Bacteria 1096
131 Ga0068867_100693578 3300005459 Bacteria 898
132 Ga0068867_101192979 3300005459 Unclassified 699
133 Ga0068867_102079178 3300005459 Bacteria 538
134 Ga0070685_10085696 3300005466 Unclassified 1897
135 Ga0070685_10118192 3300005466 Bacteria 1643
136 Ga0070685_11490777 3300005466 Bacteria 521
137 Ga0070706_100109299 3300005467 Bacteria 2573
138 Ga0070707_100256128 3300005468 Bacteria 1703
139 Ga0070698_100006293 3300005471 Bacteria 12897
140 Ga0070698_100032523 3300005471 Bacteria 5402
141 Ga0070698_100219559 3300005471 Bacteria 1835
142 Ga0070698_100870867 3300005471 Bacteria 846
143 Ga0070698_101173898 3300005471 Bacteria 717
144 Ga0070699_100116537 3300005518 Bacteria 2348
145 Ga0070699_100169034 3300005518 Bacteria 1937
146 Ga0070699_101318643 3300005518 Unclassified 662
147 Ga0070699_101382873 3300005518 Bacteria 646
148 Ga0070679_100000029 3300005530 Bacteria 108401
149 Ga0070679_100086293 3300005530 Bacteria 3125
150 Ga0070684_102376189 3300005535 Bacteria 500
151 Ga0070697_100669096 3300005536 Bacteria 915
152 Ga0070697_101451764 3300005536 Bacteria 613
153 Ga0068853_100820470 3300005539 Bacteria 891
154 Ga0068853_101208163 3300005539 Bacteria 730
155 Ga0068853_101311520 3300005539 Unclassified 700
156 Ga0068853_101446053 3300005539 Bacteria 665
157 Ga0068853_101603649 3300005539 Bacteria 630
158 Ga0070672_100083084 3300005543 Bacteria 2570
159 Ga0070672_100221808 3300005543 Bacteria 1586
160 Ga0070686_100011538 3300005544 Bacteria 5014
161 Ga0070686_100027584 3300005544 Unclassified 3437
162 Ga0070686_100231139 3300005544 Bacteria 1342
163 Ga0070695_100041423 3300005545 Unclassified 2919
164 Ga0070695_100095456 3300005545 Bacteria 1993
165 Ga0070695_100281137 3300005545 Bacteria 1223
166 Ga0070695_100422778 3300005545 Bacteria 1015
167 Ga0070695_100627061 3300005545 Bacteria 847
168 Ga0070695_100730325 3300005545 Bacteria 788
169 Ga0070695_101685365 3300005545 Unclassified 530
170 Ga0070695_101902563 3300005545 Unclassified 500
171 Ga0070696_100181664 3300005546 Unclassified 1561
172 Ga0070696_100292033 3300005546 Bacteria 1246
173 Ga0070696_100315426 3300005546 Unclassified 1202
174 Ga0070696_100642255 3300005546 Unclassified 860
175 Ga0070696_100812704 3300005546 Unclassified 770
176 Ga0070693_100081651 3300005547 Bacteria 1929
177 Ga0070693_100146723 3300005547 Bacteria 1491
178 Ga0070693_100221041 3300005547 Bacteria 1241
179 Ga0070693_100267905 3300005547 Bacteria 1139
180 Ga0070693_100651789 3300005547 Bacteria 766
181 Ga0070693_100797627 3300005547 Bacteria 700
182 Ga0070693_100828297 3300005547 Bacteria 688
183 Ga0070693_101032628 3300005547 Bacteria 623
184 Ga0070693_101110500 3300005547 Unclassified 603
185 Ga0070693_101251283 3300005547 Unclassified 572
186 Ga0070693_101377520 3300005547 Unclassified 548
187 Ga0070665_100039246 3300005548 Unclassified 4761
188 Ga0070704_100123323 3300005549 Bacteria 1995
189 Ga0070704_100129865 3300005549 Bacteria 1951
190 Ga0070704_100138644 3300005549 Bacteria 1896
191 Ga0070704_100224558 3300005549 Bacteria 1529
192 Ga0070704_100277970 3300005549 Bacteria 1386
193 Ga0070704_100975148 3300005549 Bacteria 766
194 Ga0070704_101481023 3300005549 Unclassified 624
195 Ga0068855_100233669 3300005563 Bacteria 2057
196 Ga0068855_101246068 3300005563 Bacteria 772
197 Ga0068855_101578878 3300005563 Bacteria 672
198 Ga0068855_101803215 3300005563 Bacteria 622
199 Ga0070664_100005385 3300005564 Bacteria 10273
200 Ga0070664_100045465 3300005564 Unclassified 3708
201 Ga0070664_100331985 3300005564 Bacteria 1380
202 Ga0070664_100692898 3300005564 Unclassified 949
203 Ga0070664_100782264 3300005564 Bacteria 892
204 Ga0070664_102246292 3300005564 Bacteria 518
205 Ga0068857_100001334 3300005577 Bacteria 19420
206 Ga0068857_100343671 3300005577 Bacteria 1381
207 Ga0068857_100895046 3300005577 Bacteria 851
208 Ga0068857_100970790 3300005577 Bacteria 817
209 Ga0068857_101062611 3300005577 Bacteria 781
210 Ga0068854_100302855 3300005578 Bacteria 1294
211 Ga0068854_100847423 3300005578 Bacteria 800
212 Ga0068854_102195890 3300005578 Unclassified 511
213 Ga0068856_100004051 3300005614 Bacteria 14664
214 Ga0068856_100602984 3300005614 Bacteria 1119
215 Ga0068856_100774164 3300005614 Bacteria 980
216 Ga0068856_101445236 3300005614 Unclassified 702
217 Ga0070702_100006681 3300005615 Bacteria 5479
218 Ga0070702_100079051 3300005615 Bacteria 1965
219 Ga0070702_100147055 3300005615 Bacteria 1508
220 Ga0070702_101667910 3300005615 Unclassified 529
221 Ga0068852_100313787 3300005616 Bacteria 1521
222 Ga0068852_100439154 3300005616 Bacteria 1290
223 Ga0068859_100004884 3300005617 Bacteria 13652
224 Ga0068859_100060217 3300005617 Bacteria 3826
225 Ga0068859_100120595 3300005617 Bacteria 2689
226 Ga0068859_100136350 3300005617 Unclassified 2527
227 Ga0068859_100210290 3300005617 Bacteria 2031
228 Ga0068859_100440251 3300005617 Bacteria 1399
229 Ga0068859_100510882 3300005617 Bacteria 1297
230 Ga0068859_101861792 3300005617 Bacteria 664
231 Ga0068859_102436935 3300005617 Unclassified 576
232 Ga0068859_102489186 3300005617 Bacteria 570
233 Ga0068859_103111535 3300005617 Unclassified 506
234 Ga0068864_100023146 3300005618 Bacteria 5216
235 Ga0068864_100024857 3300005618 Bacteria 5039
236 Ga0068864_100119323 3300005618 Bacteria 2356
237 Ga0068864_100517685 3300005618 Unclassified 1150
238 Ga0068864_100580729 3300005618 Bacteria 1086
239 Ga0068864_101479519 3300005618 Bacteria 682
240 Ga0068864_101938864 3300005618 Unclassified 595
241 Ga0068864_102134554 3300005618 Bacteria 567
242 Ga0068866_10146065 3300005718 Bacteria 1364
243 Ga0068866_11064914 3300005718 Bacteria 578
244 Ga0068861_100047505 3300005719 Bacteria 3240
245 Ga0068861_100096134 3300005719 Bacteria 2347
246 Ga0068861_100488694 3300005719 Bacteria 1110
247 Ga0068861_100568422 3300005719 Bacteria 1036
248 Ga0068861_101785194 3300005719 Unclassified 610
249 Ga0068870_10661505 3300005840 Bacteria 717
250 Ga0068870_10666012 3300005840 Unclassified 714
251 Ga0068870_10752437 3300005840 Unclassified 677
252 Ga0068870_10912249 3300005840 Unclassified 621
253 Ga0068863_100375951 3300005841 Bacteria 1387
254 Ga0068863_100507727 3300005841 Bacteria 1188
255 Ga0068863_100667677 3300005841 Bacteria 1031
256 Ga0068863_101063753 3300005841 Unclassified 813
257 Ga0068863_101121266 3300005841 Bacteria 791
258 Ga0068863_101389505 3300005841 Unclassified 710
259 Ga0068863_102153221 3300005841 Bacteria 568
260 Ga0068863_102472795 3300005841 Unclassified 529
261 Ga0068863_102645595 3300005841 Bacteria 511
262 Ga0068858_100051357 3300005842 Unclassified 3814
263 Ga0068858_100068936 3300005842 Bacteria 3278
264 Ga0068858_100753974 3300005842 Bacteria 949
265 Ga0068858_101135578 3300005842 Bacteria 767
266 Ga0068860_100013145 3300005843 Bacteria 8124
267 Ga0068860_100199398 3300005843 Bacteria 1939
268 Ga0068860_100358291 3300005843 Bacteria 1437
269 Ga0068860_100560354 3300005843 Bacteria 1145
270 Ga0068860_100604710 3300005843 Bacteria 1102
271 Ga0068860_101434861 3300005843 Bacteria 712
272 Ga0068860_101504296 3300005843 Bacteria 695
273 Ga0068862_100013360 3300005844 Bacteria 6794
274 Ga0068862_100228967 3300005844 Bacteria 1685
275 Ga0068862_100703561 3300005844 Bacteria 979
276 Ga0068862_101803732 3300005844 Unclassified 621
277 Ga0068862_102073612 3300005844 Bacteria 580
278 Ga0081539_10002816 3300005985 Bacteria 23236
279 Ga0081539_10102455 3300005985 Bacteria 1456
280 Ga0070716_100605149 3300006173 Bacteria 825
281 Ga0097621_100017600 3300006237 Bacteria 5431
282 Ga0097621_100036233 3300006237 Unclassified 3946
283 Ga0097621_100190999 3300006237 Bacteria 1774
284 Ga0068871_100001953 3300006358 Bacteria 13959
285 Ga0068871_100024399 3300006358 Unclassified 4689
286 Ga0068871_100027952 3300006358 Bacteria 4416
287 Ga0068871_101301660 3300006358 Bacteria 684
288 Ga0068871_101968887 3300006358 Bacteria 556
289 Ga0075428_100803656 3300006844 Bacteria 1000
290 Ga0075428_101249739 3300006844 Bacteria 782
291 Ga0075428_101661432 3300006844 Bacteria 667
292 Ga0075430_100033914 3300006846 Bacteria 4332
293 Ga0075430_100165451 3300006846 Bacteria 1840
294 Ga0075430_101658881 3300006846 Bacteria 525
295 Ga0075431_100016214 3300006847 Bacteria 7558
296 Ga0075431_100103072 3300006847 Bacteria 2945
297 Ga0075431_100160745 3300006847 Bacteria 2310
298 Ga0075431_100224682 3300006847 Bacteria 1915
299 Ga0075431_101051819 3300006847 Bacteria 780
300 Ga0075433_10107338 3300006852 Bacteria 2475
301 Ga0075433_10107378 3300006852 Bacteria 2475
302 Ga0075433_10371042 3300006852 Bacteria 1264
303 Ga0075433_10951351 3300006852 Bacteria 749
304 Ga0075433_11024259 3300006852 Unclassified 719
305 Ga0075433_11080280 3300006852 Bacteria 698
306 Ga0075433_11431374 3300006852 Bacteria 598
307 Ga0075434_100018628 3300006871 Bacteria 6707
308 Ga0075434_100238661 3300006871 Unclassified 1838
309 Ga0075434_100645716 3300006871 Bacteria 1077
310 Ga0075434_101709816 3300006871 Unclassified 637
311 Ga0075429_100060463 3300006880 Bacteria 3300
312 Ga0075429_100201545 3300006880 Bacteria 1743
313 Ga0075429_100209368 3300006880 Bacteria 1708
314 Ga0075429_101156379 3300006880 Bacteria 676
315 Ga0068865_100030282 3300006881 Unclassified 3599
316 Ga0068865_101114429 3300006881 Bacteria 696
317 Ga0075436_100233069 3300006914 Bacteria 1308
318 Ga0097620_100004884 3300006931 Bacteria 13652
319 Ga0097620_100060217 3300006931 Bacteria 3826
320 Ga0097620_100120595 3300006931 Bacteria 2689
321 Ga0097620_100136344 3300006931 Unclassified 2527
322 Ga0097620_100210295 3300006931 Bacteria 2031
323 Ga0097620_100440247 3300006931 Bacteria 1399
324 Ga0097620_100510911 3300006931 Bacteria 1297
325 Ga0097620_101861796 3300006931 Bacteria 664
326 Ga0097620_102437541 3300006931 Unclassified 576
327 Ga0097620_102489363 3300006931 Bacteria 570
328 Ga0097620_103112216 3300006931 Unclassified 506
329 Ga0075435_100570291 3300007076 Bacteria 981
330 Ga0105251_10391949 3300009011 Unclassified 637
331 Ga0105250_10516546 3300009092 Bacteria 544
332 Ga0105240_10335238 3300009093 Bacteria 1720
333 Ga0105240_10634224 3300009093 Bacteria 1173
334 Ga0111539_10008790 3300009094 Bacteria 12809
335 Ga0111539_10085151 3300009094 Bacteria 3716
336 Ga0111539_10087198 3300009094 Bacteria 3667
337 Ga0105245_10659683 3300009098 Bacteria 1077
338 Ga0105245_12124492 3300009098 Unclassified 615
339 Ga0105247_10003890 3300009101 Bacteria 9648
340 Ga0105247_10052732 3300009101 Bacteria 2508
341 Ga0105247_10230118 3300009101 Bacteria 1258
342 Ga0105247_10391597 3300009101 Unclassified 988
343 Ga0114129_10003455 3300009147 Bacteria 22220
344 Ga0114129_10012499 3300009147 Bacteria 12087
345 Ga0114129_10047889 3300009147 Bacteria 6006
346 Ga0114129_10063057 3300009147 Bacteria 5177
347 Ga0114129_10226924 3300009147 Bacteria 2517
348 Ga0114129_10378622 3300009147 Bacteria 1870
349 Ga0114129_11341983 3300009147 Bacteria 885
350 Ga0114129_11925834 3300009147 Unclassified 716
351 Ga0114129_13220520 3300009147 Bacteria 530
352 Ga0105243_10227861 3300009148 Bacteria 1651
353 Ga0105243_10428219 3300009148 Bacteria 1236
354 Ga0105243_10788653 3300009148 Bacteria 935
355 Ga0105243_10992219 3300009148 Bacteria 842
356 Ga0105243_11180514 3300009148 Bacteria 778
357 Ga0105243_12456626 3300009148 Unclassified 560
358 Ga0105243_12977391 3300009148 Bacteria 514
359 Ga0105241_10206661 3300009174 Bacteria 1643
360 Ga0105241_10270462 3300009174 Bacteria 1448
361 Ga0105241_10442440 3300009174 Bacteria 1148
362 Ga0105241_10623046 3300009174 Bacteria 977
363 Ga0105241_11849207 3300009174 Unclassified 590
364 Ga0105242_10063814 3300009176 Unclassified 3034
365 Ga0105242_10218466 3300009176 Bacteria 1702
366 Ga0105242_11801095 3300009176 Unclassified 651
367 Ga0105248_10006414 3300009177 Bacteria 12907
368 Ga0105248_10033009 3300009177 Bacteria 5782
369 Ga0105248_10059409 3300009177 Bacteria 4295
370 Ga0105248_10179432 3300009177 Unclassified 2386
371 Ga0105248_10330757 3300009177 Bacteria 1716
372 Ga0105248_10392776 3300009177 Bacteria 1562
373 Ga0105248_10509605 3300009177 Bacteria 1357
374 Ga0105248_10538333 3300009177 Bacteria 1317
375 Ga0105248_11540977 3300009177 Bacteria 753
376 Ga0105248_12656485 3300009177 Bacteria 571
377 Ga0105237_10460412 3300009545 Bacteria 1278
378 Ga0105238_12393153 3300009551 Unclassified 564
379 Ga0105249_10000227 3300009553 Bacteria 63667
380 Ga0105249_10007867 3300009553 Bacteria 9286
381 Ga0105249_10009771 3300009553 Bacteria 8403
382 Ga0105249_12891068 3300009553 Bacteria 551
383 Ga0105239_10099552 3300010375 Unclassified 3214
384 Ga0105239_10122040 3300010375 Bacteria 2895
385 Ga0105239_10369291 3300010375 Bacteria 1621
386 Ga0105239_10621476 3300010375 Bacteria 1233
387 Ga0105239_11544197 3300010375 Bacteria 767
388 Ga0105246_10052760 3300011119 Bacteria 2796
389 Ga0105246_10957956 3300011119 Bacteria 772
390 Ga0105246_11149050 3300011119 Bacteria 712
391 Ga0105246_12156238 3300011119 Unclassified 541
392 Ga0157325_1033834 3300012485 Bacteria 526
393 Ga0157345_1014828 3300012498 Bacteria 732
394 Ga0157342_1057744 3300012507 Bacteria 562
395 Ga0157373_11040062 3300013100 Unclassified 612
396 Ga0157373_11564850 3300013100 Unclassified 504
397 Ga0157371_10584909 3300013102 Unclassified 829
398 Ga0157374_10029010 3300013296 Bacteria 5003
399 Ga0157374_10047830 3300013296 Unclassified 3967
400 Ga0157374_10342337 3300013296 Bacteria 1485
401 Ga0157374_10431053 3300013296 Bacteria 1318
402 Ga0157374_11896900 3300013296 Bacteria 622
403 Ga0157374_11964033 3300013296 Bacteria 611
404 Ga0157378_10061380 3300013297 Bacteria 3354
405 Ga0157378_10222880 3300013297 Bacteria 1793
406 Ga0157378_10260745 3300013297 Bacteria 1663
407 Ga0157378_10950120 3300013297 Bacteria 892
408 Ga0163162_10000047 3300013306 Bacteria 123541
409 Ga0163162_10000198 3300013306 Bacteria 55665
410 Ga0163162_10010186 3300013306 Bacteria 9131
411 Ga0163162_10010314 3300013306 Bacteria 9080
412 Ga0163162_10163837 3300013306 Bacteria 2346
413 Ga0163162_10204863 3300013306 Bacteria 2102
414 Ga0163162_11396274 3300013306 Bacteria 797
415 Ga0157372_10091285 3300013307 Bacteria 3464
416 Ga0157372_10147443 3300013307 Unclassified 2714
417 Ga0157372_10168201 3300013307 Bacteria 2536
418 Ga0157372_10740095 3300013307 Bacteria 1143
419 Ga0157372_12573778 3300013307 Unclassified 584
420 Ga0157372_12726398 3300013307 Bacteria 567
421 Ga0157375_10011088 3300013308 Bacteria 7946
422 Ga0157375_10098403 3300013308 Bacteria 3002
423 Ga0157375_10212715 3300013308 Bacteria 2091
424 Ga0157375_10263962 3300013308 Unclassified 1883
425 Ga0157375_10389817 3300013308 Bacteria 1560
426 Ga0157375_10469409 3300013308 Bacteria 1424
427 Ga0157375_10619769 3300013308 Bacteria 1240
428 Ga0157375_11360985 3300013308 Bacteria 835
429 Ga0157375_12954439 3300013308 Bacteria 568
430 Ga0163163_10001814 3300014325 Bacteria 18015
431 Ga0163163_10214865 3300014325 Bacteria 1972
432 Ga0163163_10225029 3300014325 Bacteria 1925
433 Ga0163163_10248667 3300014325 Bacteria 1829
434 Ga0163163_10396307 3300014325 Bacteria 1438
435 Ga0157380_10017973 3300014326 Bacteria 5243
436 Ga0157380_10232122 3300014326 Bacteria 1658
437 Ga0157380_11693053 3300014326 Bacteria 690
438 Ga0182008_10353453 3300014497 Bacteria 780
439 Ga0157377_10007117 3300014745 Bacteria 5381
440 Ga0157377_10015204 3300014745 Bacteria 3930
441 Ga0157377_10367134 3300014745 Bacteria 971
442 Ga0157379_10165786 3300014968 Bacteria 1994
443 Ga0157379_10330275 3300014968 Bacteria 1393
444 Ga0157379_10395189 3300014968 Bacteria 1270
445 Ga0157379_11528146 3300014968 Bacteria 650
446 Ga0157379_11592194 3300014968 Bacteria 638
447 Ga0157379_12537537 3300014968 Bacteria 513
448 Ga0157376_10014794 3300014969 Bacteria 5872
449 Ga0157376_10159071 3300014969 Bacteria 2046
450 Ga0157376_10856834 3300014969 Bacteria 924
451 Ga0163161_10004034 3300017792 Bacteria 10275
452 Ga0207697_10024401 3300025315 Unclassified 2476
453 Ga0207697_10353544 3300025315 Unclassified 652
454 Ga0207682_10036998 3300025893 Bacteria 1977
455 Ga0207642_10281702 3300025899 Bacteria 956
456 Ga0207710_10002205 3300025900 Bacteria 9152
457 Ga0207710_10160359 3300025900 Bacteria 1095
458 Ga0207688_10086978 3300025901 Bacteria 1791
459 Ga0207680_10485178 3300025903 Bacteria 879
460 Ga0207680_10840586 3300025903 Unclassified 658
461 Ga0207647_10200945 3300025904 Bacteria 1153
462 Ga0207645_10097238 3300025907 Bacteria 1897
463 Ga0207645_10227312 3300025907 Bacteria 1231
464 Ga0207643_10452751 3300025908 Unclassified 817
465 Ga0207684_10669949 3300025910 Bacteria 883
466 Ga0207654_10051217 3300025911 Bacteria 2376
467 Ga0207654_10201102 3300025911 Bacteria 1312
468 Ga0207654_10242728 3300025911 Bacteria 1204
469 Ga0207654_10854509 3300025911 Bacteria 659
470 Ga0207654_11081523 3300025911 Unclassified 584
471 Ga0207707_10000060 3300025912 Bacteria 108561
472 Ga0207707_10029691 3300025912 Bacteria 4781
473 Ga0207707_10071373 3300025912 Bacteria 3026
474 Ga0207707_10463766 3300025912 Bacteria 1083
475 Ga0207707_11073327 3300025912 Bacteria 657
476 Ga0207671_10058003 3300025914 Unclassified 2870
477 Ga0207671_10080752 3300025914 Bacteria 2438
478 Ga0207663_10947224 3300025916 Unclassified 689
479 Ga0207660_10040686 3300025917 Bacteria 3255
480 Ga0207660_10050528 3300025917 Bacteria 2953
481 Ga0207662_10004426 3300025918 Bacteria 7388
482 Ga0207662_10082121 3300025918 Bacteria 1968
483 Ga0207662_10369240 3300025918 Bacteria 967
484 Ga0207662_10627956 3300025918 Unclassified 749
485 Ga0207662_10900197 3300025918 Bacteria 626
486 Ga0207657_10032308 3300025919 Bacteria 4731
487 Ga0207649_10008384 3300025920 Bacteria 5633
488 Ga0207649_10718681 3300025920 Bacteria 776
489 Ga0207652_10000073 3300025921 Bacteria 108588
490 Ga0207652_10544653 3300025921 Bacteria 1043
491 Ga0207646_10248929 3300025922 Bacteria 1605
492 Ga0207681_10059187 3300025923 Bacteria 2625
493 Ga0207681_10242176 3300025923 Bacteria 1404
494 Ga0207681_10616812 3300025923 Unclassified 897
495 Ga0207694_10064143 3300025924 Bacteria 2863
496 Ga0207650_10334081 3300025925 Bacteria 1243
497 Ga0207650_11093390 3300025925 Unclassified 679
498 Ga0207650_11579140 3300025925 Bacteria 557
499 Ga0207659_10110436 3300025926 Bacteria 2089
500 Ga0207659_10619551 3300025926 Unclassified 923
501 Ga0207687_10294976 3300025927 Bacteria 1304
502 Ga0207687_10642279 3300025927 Bacteria 897
503 Ga0207644_10113128 3300025931 Bacteria 2055
504 Ga0207644_10377009 3300025931 Bacteria 1156
505 Ga0207690_10217495 3300025932 Bacteria 1460
506 Ga0207706_10067076 3300025933 Unclassified 3157
507 Ga0207706_10101040 3300025933 Bacteria 2537
508 Ga0207706_10544621 3300025933 Bacteria 999
509 Ga0207706_10660660 3300025933 Bacteria 895
510 Ga0207706_11121060 3300025933 Unclassified 657
511 Ga0207686_10394227 3300025934 Bacteria 1053
512 Ga0207686_10464415 3300025934 Bacteria 976
513 Ga0207686_10616978 3300025934 Bacteria 855
514 Ga0207709_10344580 3300025935 Bacteria 1123
515 Ga0207709_10561725 3300025935 Bacteria 899
516 Ga0207709_10576871 3300025935 Bacteria 888
517 Ga0207709_11089829 3300025935 Unclassified 655
518 Ga0207670_10779677 3300025936 Unclassified 795
519 Ga0207670_11372502 3300025936 Bacteria 600
520 Ga0207669_10349960 3300025937 Bacteria 1141
521 Ga0207669_10509723 3300025937 Unclassified 964
522 Ga0207669_11687435 3300025937 Bacteria 541
523 Ga0207704_10385358 3300025938 Bacteria 1101
524 Ga0207704_10414309 3300025938 Bacteria 1066
525 Ga0207704_11200972 3300025938 Bacteria 647
526 Ga0207665_10228543 3300025939 Bacteria 1366
527 Ga0207665_10843072 3300025939 Bacteria 725
528 Ga0207691_10008223 3300025940 Bacteria 10021
529 Ga0207711_10089836 3300025941 Unclassified 2699
530 Ga0207711_10101532 3300025941 Bacteria 2545
531 Ga0207711_10122249 3300025941 Bacteria 2325
532 Ga0207711_10229923 3300025941 Unclassified 1698
533 Ga0207711_10408669 3300025941 Bacteria 1262
534 Ga0207711_10522487 3300025941 Bacteria 1107
535 Ga0207711_10636086 3300025941 Bacteria 995
536 Ga0207711_11162703 3300025941 Bacteria 713
537 Ga0207689_10009020 3300025942 Bacteria 8639
538 Ga0207689_10041298 3300025942 Unclassified 3817
539 Ga0207689_10256345 3300025942 Bacteria 1447
540 Ga0207689_10588357 3300025942 Unclassified 936
541 Ga0207689_10651331 3300025942 Bacteria 887
542 Ga0207689_11102455 3300025942 Bacteria 669
543 Ga0207689_11774057 3300025942 Bacteria 510
544 Ga0207679_10057931 3300025945 Bacteria 2868
545 Ga0207679_10353103 3300025945 Bacteria 1282
546 Ga0207679_10487749 3300025945 Bacteria 1098
547 Ga0207679_10504130 3300025945 Bacteria 1080
548 Ga0207679_11691712 3300025945 Unclassified 579
549 Ga0207679_11813559 3300025945 Bacteria 557
550 Ga0207667_11235456 3300025949 Bacteria 726
551 Ga0207667_11306620 3300025949 Bacteria 702
552 Ga0207651_10168388 3300025960 Bacteria 1725
553 Ga0207651_10170561 3300025960 Unclassified 1716
554 Ga0207651_10778453 3300025960 Unclassified 847
555 Ga0207651_11183638 3300025960 Unclassified 686
556 Ga0207651_11755705 3300025960 Unclassified 559
557 Ga0207712_10000209 3300025961 Bacteria 58339
558 Ga0207712_10019734 3300025961 Bacteria 4405
559 Ga0207712_10059173 3300025961 Bacteria 2711
560 Ga0207712_10445828 3300025961 Bacteria 1097
561 Ga0207712_11393577 3300025961 Bacteria 627
562 Ga0207668_10020083 3300025972 Bacteria 4237
563 Ga0207668_12000886 3300025972 Bacteria 522
564 Ga0207640_10127235 3300025981 Bacteria 1836
565 Ga0207640_10169709 3300025981 Bacteria 1624
566 Ga0207640_11166993 3300025981 Unclassified 684
567 Ga0207640_11667716 3300025981 Bacteria 575
568 Ga0207658_10309777 3300025986 Bacteria 1363
569 Ga0207658_10414005 3300025986 Bacteria 1187
570 Ga0207658_10567340 3300025986 Bacteria 1017
571 Ga0207677_10144503 3300026023 Bacteria 1826
572 Ga0207677_10289782 3300026023 Bacteria 1348
573 Ga0207677_10764944 3300026023 Unclassified 862
574 Ga0207677_11429134 3300026023 Unclassified 638
575 Ga0207677_11817659 3300026023 Unclassified 566
576 Ga0207703_10192655 3300026035 Bacteria 1807
577 Ga0207703_10272233 3300026035 Bacteria 1534
578 Ga0207703_10444214 3300026035 Bacteria 1210
579 Ga0207703_10979272 3300026035 Bacteria 811
580 Ga0207703_11025907 3300026035 Bacteria 792
581 Ga0207639_10005370 3300026041 Bacteria 8660
582 Ga0207639_11146663 3300026041 Bacteria 729
583 Ga0207639_11963591 3300026041 Unclassified 546
584 Ga0207639_12144171 3300026041 Bacteria 520
585 Ga0207678_11020068 3300026067 Unclassified 732
586 Ga0207708_10005033 3300026075 Bacteria 9748
587 Ga0207708_10397364 3300026075 Bacteria 1139
588 Ga0207708_10487915 3300026075 Bacteria 1031
589 Ga0207708_11468121 3300026075 Unclassified 599
590 Ga0207702_10040148 3300026078 Unclassified 3923
591 Ga0207702_11596921 3300026078 Unclassified 645
592 Ga0207641_10239173 3300026088 Bacteria 1691
593 Ga0207641_10494539 3300026088 Bacteria 1187
594 Ga0207641_11689308 3300026088 Bacteria 635
595 Ga0207648_10025741 3300026089 Bacteria 5238
596 Ga0207648_10323873 3300026089 Bacteria 1385
597 Ga0207676_10019025 3300026095 Bacteria 5003
598 Ga0207676_10063960 3300026095 Bacteria 2923
599 Ga0207676_10156080 3300026095 Unclassified 1972
600 Ga0207676_10267346 3300026095 Bacteria 1547
601 Ga0207676_10281626 3300026095 Bacteria 1510
602 Ga0207676_12065089 3300026095 Bacteria 568
603 Ga0207674_10000392 3300026116 Bacteria 56723
604 Ga0207674_10088035 3300026116 Bacteria 3098
605 Ga0207674_10478212 3300026116 Bacteria 1204
606 Ga0207674_10764285 3300026116 Bacteria 933
607 Ga0207674_10930837 3300026116 Bacteria 837
608 Ga0207674_11937015 3300026116 Unclassified 555
609 Ga0207675_100005937 3300026118 Bacteria 11647
610 Ga0207675_100044707 3300026118 Bacteria 4139
611 Ga0207675_100116685 3300026118 Bacteria 2523
612 Ga0207675_100516017 3300026118 Bacteria 1191
613 Ga0207675_100635360 3300026118 Bacteria 1073
614 Ga0207675_100740159 3300026118 Bacteria 994
615 Ga0207675_101343406 3300026118 Bacteria 735
616 Ga0207698_10290117 3300026142 Bacteria 1518
617 Ga0207698_11497420 3300026142 Bacteria 690
618 Ga0207428_10158693 3300027907 Bacteria 1718
619 Ga0207428_10219490 3300027907 Bacteria 1426
620 Ga0207428_10244647 3300027907 Bacteria 1339
621 Ga0268266_10537937 3300028379 Bacteria 1118
622 Ga0268265_10048085 3300028380 Unclassified 3200
623 Ga0268265_10141875 3300028380 Bacteria 2012
624 Ga0268265_10541396 3300028380 Bacteria 1104
625 Ga0268264_10208308 3300028381 Bacteria 1793
626 Ga0268264_10215544 3300028381 Bacteria 1765
627 Ga0268264_10380371 3300028381 Bacteria 1352
628 Ga0314311_1168738 3300030733 Unclassified 703
629 Ga0307408_100200732 3300031548 Bacteria 1614
630 Ga0307405_10548239 3300031731 Bacteria 935
631 Ga0307405_10549427 3300031731 Unclassified 934
632 Ga0307413_10122038 3300031824 Bacteria 1767
633 Ga0307413_11741895 3300031824 Unclassified 556
634 Ga0307410_10342361 3300031852 Bacteria 1192
635 Ga0307410_10481474 3300031852 Bacteria 1018
636 Ga0307406_11200964 3300031901 Unclassified 659
637 Ga0307412_10031197 3300031911 Bacteria 3364
638 Ga0307412_10123024 3300031911 Bacteria 1871
639 Ga0307412_10597787 3300031911 Bacteria 934
640 Ga0307409_100338148 3300031995 Unclassified 1415
641 Ga0307416_100139392 3300032002 Bacteria 2201
642 Ga0307416_100157209 3300032002 Bacteria 2095
643 Ga0307416_100184087 3300032002 Bacteria 1961
644 Ga0307416_102761511 3300032002 Bacteria 587
645 Ga0307414_10000777 3300032004 Bacteria 16349
646 Ga0307414_11139583 3300032004 Bacteria 721
647 Ga0307411_10473404 3300032005 Bacteria 1053
648 Ga0307411_10760347 3300032005 Bacteria 850
649 Ga0307415_100009822 3300032126 Bacteria 5389
650 Ga0307415_100064903 3300032126 Bacteria 2542
651 Ga0307415_100178234 3300032126 Bacteria 1665
652 Ga0307507_10419065 3300033179 Bacteria 753
653 Ga0373950_0018643 3300034818 Bacteria 1206
654 Ga0373959_0177862 3300034820 Bacteria 551
655 Ga0373940_0108065 3300035088 Unclassified 851
656 Ga0373951_0144401 3300035091 Bacteria 663
657 Ga0373932_0417774 3300035112 Unclassified 521
658 Ga0373941_0010563 3300035115 Unclassified 2362
659 Ga0373961_0030958 3300035241 Bacteria 1492
660 Ga0373931_0457193 3300035691 Unclassified 817
661 Ga0373925_1015179 3300037068 Bacteria 683
662 Ga0242422_00110 3300038699 Bacteria 4026
663 Ga0242420_012780 3300038996 Bacteria 1425
664 Ga0242420_056452 3300038996 Unclassified 776
665 Ga0439433_0186776 3300041999 Bacteria 544
666 Ga0439457_127620 3300042014 Bacteria 604
667 Ga0439462_0256495 3300042015 Unclassified 503
668 Ga0451576_0876798 3300045051 Unclassified 942
669 Ga0495580_0893899 3300046472 Bacteria 571
670 Ga0495658_0042581 3300046683 Bacteria 2536
671 Ga0496102_0372629 3300048905 Bacteria 1344
672 Ga0496102_0631773 3300048905 Bacteria 994
673 Ga0496102_1976001 3300048905 Unclassified 500
674 Ga0496104_0042663 3300048907 Unclassified 4258
675 Ga0496105_1182273 3300048908 Bacteria 564
676 Ga0496106_0014847 3300048909 Bacteria 5759
677 Ga0496108_0076392 3300048911 Bacteria 2831
678 Ga0496109_0099345 3300048912 Bacteria 2699
679 Ga0496109_0702813 3300048912 Unclassified 948
680 Ga0496109_1510341 3300048912 Bacteria 607
681 Ga0496110_0821938 3300048913 Bacteria 834
682 Ga0496111_0618335 3300048914 Unclassified 792
683 Ga0496112_0259246 3300048915 Unclassified 1688
684 Ga0496112_0564077 3300048915 Bacteria 1072
685 Ga0496112_0906757 3300048915 Bacteria 803
686 Ga0496112_1649217 3300048915 Unclassified 554
687 Ga0501292_119050 3300049515 Bacteria 537
688 Ga0501295_006513 3300049518 Bacteria 1652
689 Ga0501298_019647 3300049521 Unclassified 1253
690 Ga0501299_064351 3300049522 Bacteria 783
691 Ga0501198_030204 3300049649 Unclassified 902
692 Ga0501202_028567 3300049652 Bacteria 1152
693 Ga0501207_020593 3300049654 Unclassified 1054
694 Ga0501216_020622 3300049660 Bacteria 1153
695 Ga0501216_175051 3300049660 Bacteria 521
696 Ga0501217_039414 3300049661 Unclassified 1197
697 Ga0501223_030639 3300049663 Bacteria 1046
698 Ga0501227_095601 3300049665 Bacteria 787
699 Ga0501230_097152 3300049667 Bacteria 632
700 Ga0501233_039556 3300049668 Bacteria 1103
701 Ga0501233_140620 3300049668 Bacteria 666
702 Ga0501235_024126 3300049669 Bacteria 1358
703 Ga0501239_005572 3300049672 Bacteria 1272
704 Ga0501240_006020 3300049673 Bacteria 1477
705 Ga0501247_057226 3300049677 Unclassified 591
706 Ga0501251_049066 3300049681 Bacteria 664
707 Ga0501257_029673 3300049686 Unclassified 1315
708 Ga0501260_014143 3300049689 Bacteria 826
709 Ga0501261_088222 3300049690 Unclassified 572
710 Ga0501221_106923 3300049704 Bacteria 701
711 Ga0501225_0030751 3300049705 Bacteria 1477
712 Ga0501225_0255360 3300049705 Bacteria 578
713 Ga0501229_015650 3300049706 Unclassified 985
714 Ga0501234_015956 3300049707 Bacteria 1184
715 Ga0501241_057201 3300049758 Bacteria 778
716 Ga0501241_062976 3300049758 Bacteria 747
717 Ga0501268_045390 3300049765 Bacteria 838
718 Ga0501268_127500 3300049765 Unclassified 570
719 Ga0501270_103882 3300049767 Bacteria 597
720 Ga0501270_168299 3300049767 Bacteria 511
721 Ga0501212_073033 3300049851 Unclassified 610
722 nmdc:mga05p37_1170419_c1 3300050507 Bacteria 798
723 nmdc:mga05p37_1808207_c1 3300050507 Bacteria 589
724 nmdc:mga05p37_247363_c1 3300050507 Bacteria 2140
725 nmdc:mga05p37_257843_c1 3300050507 Bacteria 2089
726 nmdc:mga05p37_403596_c1 3300050507 Bacteria 1595
727 nmdc:mga05p37_425040_c1 3300050507 Bacteria 1545
728 nmdc:mga05p37_592678_c1 3300050507 Bacteria 1253
729 nmdc:mga09592_217329_c1 3300050508 Bacteria 1656
730 nmdc:mga09592_559462_c1 3300050508 Bacteria 982
731 nmdc:mga09592_57028_c1 3300050508 Bacteria 3300
732 nmdc:mga0qj67_1126451_c1 3300050509 Bacteria 612
733 nmdc:mga0qj67_134048_c1 3300050509 Bacteria 2007
734 nmdc:mga0qj67_277850_c1 3300050509 Bacteria 1358
735 nmdc:mga06r32_1079084_c1 3300050510 Bacteria 753
736 nmdc:mga06r32_113644_c1 3300050510 Bacteria 2665
737 nmdc:mga06r32_926579_c1 3300050510 Bacteria 827
738 nmdc:mga06r32_93319_c1 3300050510 Bacteria 2944
739 nmdc:mga08y16_49386_c1 3300050511 Bacteria 4403
740 nmdc:mga0n895_1502287_c1 3300050512 Bacteria 640
741 nmdc:mga0n895_197692_c1 3300050512 Bacteria 2042
742 nmdc:mga0n895_221524_c1 3300050512 Bacteria 1921
743 nmdc:mga0n895_736163_c1 3300050512 Bacteria 980
744 nmdc:mga0n895_955860_c1 3300050512 Bacteria 840
745 nmdc:mga0rr50_12603_c1 3300050513 Bacteria 5473
746 nmdc:mga0rr50_36970_c1 3300050513 Bacteria 3521
747 nmdc:mga0rr50_689493_c1 3300050513 Bacteria 872
748 nmdc:mga08x19_13_c1 3300050514 Bacteria 366166
749 nmdc:mga08x19_212218_c1 3300050514 Bacteria 1329
750 nmdc:mga0a205_133234_c1 3300050515 Bacteria 2385
751 nmdc:mga0a205_59343_c1 3300050515 Bacteria 3696
752 nmdc:mga0a205_65483_c1 3300050515 Bacteria 3511
753 nmdc:mga0a205_756918_c1 3300050515 Bacteria 820
754 Ga0500616_0001231 3300053153 Bacteria 25700
755 Ga0587072_114042 3300059643 Bacteria 620
756 Ga0105245_11263725
757 SwRhRL2b_contig_1718611
758 MRS1b_contig_2451402
759 MBSR1b_contig_4086223
760 rootL2_10113713
761 rootL2_10297144
762 Ga0065714_10288552
763 Ga0065704_10099938
764 Ga0065704_10109033
765 Ga0065712_10000030
766 Ga0065712_10011438
767 Ga0065712_10069428
768 Ga0065712_10071236
769 Ga0065712_10407166
770 Ga0065715_10071735
771 Ga0065715_10089414
772 Ga0065715_10114553
773 Ga0065715_10129896
774 Ga0065715_10139832
775 Ga0065715_10246355
776 Ga0065715_10434520
777 Ga0065715_10459410
778 Ga0065715_10627764
779 Ga0065707_10010975
780 Ga0065707_10144825
781 Ga0065707_10169903
782 Ga0065707_10206933
783 Ga0065707_10230912
784 Ga0065707_10534226
785 Ga0070676_10516296
786 Ga0070683_102180409
787 Ga0070690_100002388
788 Ga0070690_100106795
789 Ga0070690_100826746
790 Ga0070670_100086225
791 Ga0070677_10091328
792 Ga0068869_100046679
793 Ga0068869_100196140
794 Ga0068869_100439946
795 Ga0068869_100979641
796 Ga0068869_101541982
797 Ga0070666_10053830
798 Ga0070666_10759730
799 Ga0070680_100002130
800 Ga0070680_100028537
801 Ga0070680_100164120
802 Ga0070680_101499428
803 Ga0070680_101928478
804 Ga0068868_100062207
805 Ga0068868_100152282
806 Ga0068868_100330975
807 Ga0068868_100923855
808 Ga0068868_101156727
809 Ga0068868_101519501
810 Ga0070660_100035855
811 Ga0070689_100537205
812 Ga0070689_100552228
813 Ga0070689_100744444
814 Ga0070689_100804457
815 Ga0070691_10223382
816 Ga0070691_10696525
817 Ga0070687_100131293
818 Ga0070687_100546227
819 Ga0070687_100711573
820 Ga0070687_100996801
821 Ga0070687_101091146
822 Ga0070661_100027570
823 Ga0070661_101750170
824 Ga0070692_10474225
825 Ga0070692_10598728
826 Ga0070692_10965887
827 Ga0070692_11086824
828 Ga0070692_11344523
829 Ga0070668_100015648
830 Ga0070668_100478696
831 Ga0070669_100002358
832 Ga0070669_100048097
833 Ga0070669_100100934
834 Ga0070669_101242716
835 Ga0070675_100041500
836 Ga0070675_100069003
837 Ga0070675_101425166
838 Ga0070671_100010018
839 Ga0070671_100032580
840 Ga0070671_100039259
841 Ga0070674_100122214
842 Ga0070674_100341551
843 Ga0070674_102112965
844 Ga0070673_100009372
845 Ga0070673_100348108
846 Ga0070673_100376809
847 Ga0070673_100568710
848 Ga0070673_101417530
849 Ga0070673_101629504
850 Ga0070673_101720620
851 Ga0070673_102110209
852 Ga0070688_100092703
853 Ga0070688_100333299
854 Ga0070659_100002497
855 Ga0070659_101281333
856 Ga0070667_100035855
857 Ga0070667_100171219
858 Ga0070667_102056464
859 Ga0070701_10019721
860 Ga0070701_10032683
861 Ga0070701_10254985
862 Ga0070705_101657967
863 Ga0070700_100000278
864 Ga0070700_100015785
865 Ga0070700_101354298
866 Ga0070694_100047346
867 Ga0070694_100406646
868 Ga0070694_100787546
869 Ga0070694_100855458
870 Ga0070694_101232775
871 Ga0070694_101376451
872 Ga0070708_101053831
873 Ga0070708_101492776
874 Ga0070708_101733818
875 Ga0070678_100422725
876 Ga0070662_100051556
877 Ga0070662_100545599
878 Ga0070662_100725581
879 Ga0070662_101486282
880 Ga0070681_10000125
881 Ga0070681_10002764
882 Ga0070681_10050439
883 Ga0070681_10455966
884 Ga0068867_100172863
885 Ga0068867_100451042
886 Ga0068867_100693578
887 Ga0068867_101192979
888 Ga0068867_102079178
889 Ga0070685_10085696
890 Ga0070685_10118192
891 Ga0070685_11490777
892 Ga0070706_100109299
893 Ga0070707_100256128
894 Ga0070698_100006293
895 Ga0070698_100032523
896 Ga0070698_100219559
897 Ga0070698_100870867
898 Ga0070698_101173898
899 Ga0070699_100116537
900 Ga0070699_100169034
901 Ga0070699_101318643
902 Ga0070699_101382873
903 Ga0070679_100000029
904 Ga0070679_100086293
905 Ga0070684_102376189
906 Ga0070697_100669096
907 Ga0070697_101451764
908 Ga0068853_100820470
909 Ga0068853_101208163
910 Ga0068853_101311520
911 Ga0068853_101446053
912 Ga0068853_101603649
913 Ga0070672_100083084
914 Ga0070672_100221808
915 Ga0070686_100011538
916 Ga0070686_100027584
917 Ga0070686_100231139
918 Ga0070695_100041423
919 Ga0070695_100095456
920 Ga0070695_100281137
921 Ga0070695_100422778
922 Ga0070695_100627061
923 Ga0070695_100730325
924 Ga0070695_101685365
925 Ga0070695_101902563
926 Ga0070696_100181664
927 Ga0070696_100292033
928 Ga0070696_100315426
929 Ga0070696_100642255
930 Ga0070696_100812704
931 Ga0070693_100081651
932 Ga0070693_100146723
933 Ga0070693_100221041
934 Ga0070693_100267905
935 Ga0070693_100651789
936 Ga0070693_100797627
937 Ga0070693_100828297
938 Ga0070693_101032628
939 Ga0070693_101110500
940 Ga0070693_101251283
941 Ga0070693_101377520
942 Ga0070665_100039246
943 Ga0070704_100123323
944 Ga0070704_100129865
945 Ga0070704_100138644
946 Ga0070704_100224558
947 Ga0070704_100277970
948 Ga0070704_100975148
949 Ga0070704_101481023
950 Ga0068855_100233669
951 Ga0068855_101246068
952 Ga0068855_101578878
953 Ga0068855_101803215
954 Ga0070664_100005385
955 Ga0070664_100045465
956 Ga0070664_100331985
957 Ga0070664_100692898
958 Ga0070664_100782264
959 Ga0070664_102246292
960 Ga0068857_100001334
961 Ga0068857_100343671
962 Ga0068857_100895046
963 Ga0068857_100970790
964 Ga0068857_101062611
965 Ga0068854_100302855
966 Ga0068854_100847423
967 Ga0068854_102195890
968 Ga0068856_100004051
969 Ga0068856_100602984
970 Ga0068856_100774164
971 Ga0068856_101445236
972 Ga0070702_100006681
973 Ga0070702_100079051
974 Ga0070702_100147055
975 Ga0070702_101667910
976 Ga0068852_100313787
977 Ga0068852_100439154
978 Ga0068859_100004884
979 Ga0068859_100060217
980 Ga0068859_100120595
981 Ga0068859_100136350
982 Ga0068859_100210290
983 Ga0068859_100440251
984 Ga0068859_100510882
985 Ga0068859_101861792
986 Ga0068859_102436935
987 Ga0068859_102489186
988 Ga0068859_103111535
989 Ga0068864_100023146
990 Ga0068864_100024857
991 Ga0068864_100119323
992 Ga0068864_100517685
993 Ga0068864_100580729
994 Ga0068864_101479519
995 Ga0068864_101938864
996 Ga0068864_102134554
997 Ga0068866_10146065
998 Ga0068866_11064914
999 Ga0068861_100047505
1000 Ga0068861_100096134
1001 Ga0068861_100488694
1002 Ga0068861_100568422
1003 Ga0068861_101785194
1004 Ga0068870_10661505
1005 Ga0068870_10666012
1006 Ga0068870_10752437
1007 Ga0068870_10912249
1008 Ga0068863_100375951
1009 Ga0068863_100507727
1010 Ga0068863_100667677
1011 Ga0068863_101063753
1012 Ga0068863_101121266
1013 Ga0068863_101389505
1014 Ga0068863_102153221
1015 Ga0068863_102472795
1016 Ga0068863_102645595
1017 Ga0068858_100051357
1018 Ga0068858_100068936
1019 Ga0068858_100753974
1020 Ga0068858_101135578
1021 Ga0068860_100013145
1022 Ga0068860_100199398
1023 Ga0068860_100358291
1024 Ga0068860_100560354
1025 Ga0068860_100604710
1026 Ga0068860_101434861
1027 Ga0068860_101504296
1028 Ga0068862_100013360
1029 Ga0068862_100228967
1030 Ga0068862_100703561
1031 Ga0068862_101803732
1032 Ga0068862_102073612
1033 Ga0081539_10002816
1034 Ga0081539_10102455
1035 Ga0070716_100605149
1036 Ga0097621_100017600
1037 Ga0097621_100036233
1038 Ga0097621_100190999
1039 Ga0068871_100001953
1040 Ga0068871_100024399
1041 Ga0068871_100027952
1042 Ga0068871_101301660
1043 Ga0068871_101968887
1044 Ga0075428_100803656
1045 Ga0075428_101249739
1046 Ga0075428_101661432
1047 Ga0075430_100033914
1048 Ga0075430_100165451
1049 Ga0075430_101658881
1050 Ga0075431_100016214
1051 Ga0075431_100103072
1052 Ga0075431_100160745
1053 Ga0075431_100224682
1054 Ga0075431_101051819
1055 Ga0075433_10107338
1056 Ga0075433_10107378
1057 Ga0075433_10371042
1058 Ga0075433_10951351
1059 Ga0075433_11024259
1060 Ga0075433_11080280
1061 Ga0075433_11431374
1062 Ga0075434_100018628
1063 Ga0075434_100238661
1064 Ga0075434_100645716
1065 Ga0075434_101709816
1066 Ga0075429_100060463
1067 Ga0075429_100201545
1068 Ga0075429_100209368
1069 Ga0075429_101156379
1070 Ga0068865_100030282
1071 Ga0068865_101114429
1072 Ga0075436_100233069
1073 Ga0097620_100004884
1074 Ga0097620_100060217
1075 Ga0097620_100120595
1076 Ga0097620_100136344
1077 Ga0097620_100210295
1078 Ga0097620_100440247
1079 Ga0097620_100510911
1080 Ga0097620_101861796
1081 Ga0097620_102437541
1082 Ga0097620_102489363
1083 Ga0097620_103112216
1084 Ga0075435_100570291
1085 Ga0105251_10391949
1086 Ga0105250_10516546
1087 Ga0105240_10335238
1088 Ga0105240_10634224
1089 Ga0111539_10008790
1090 Ga0111539_10085151
1091 Ga0111539_10087198
1092 Ga0105245_10659683
1093 Ga0105245_12124492
1094 Ga0105247_10003890
1095 Ga0105247_10052732
1096 Ga0105247_10230118
1097 Ga0105247_10391597
1098 Ga0114129_10003455
1099 Ga0114129_10012499
1100 Ga0114129_10047889
1101 Ga0114129_10063057
1102 Ga0114129_10226924
1103 Ga0114129_10378622
1104 Ga0114129_11341983
1105 Ga0114129_11925834
1106 Ga0114129_13220520
1107 Ga0105243_10227861
1108 Ga0105243_10428219
1109 Ga0105243_10788653
1110 Ga0105243_10992219
1111 Ga0105243_11180514
1112 Ga0105243_12456626
1113 Ga0105243_12977391
1114 Ga0105241_10206661
1115 Ga0105241_10270462
1116 Ga0105241_10442440
1117 Ga0105241_10623046
1118 Ga0105241_11849207
1119 Ga0105242_10063814
1120 Ga0105242_10218466
1121 Ga0105242_11801095
1122 Ga0105248_10006414
1123 Ga0105248_10033009
1124 Ga0105248_10059409
1125 Ga0105248_10179432
1126 Ga0105248_10330757
1127 Ga0105248_10392776
1128 Ga0105248_10509605
1129 Ga0105248_10538333
1130 Ga0105248_11540977
1131 Ga0105248_12656485
1132 Ga0105237_10460412
1133 Ga0105238_12393153
1134 Ga0105249_10000227
1135 Ga0105249_10007867
1136 Ga0105249_10009771
1137 Ga0105249_12891068
1138 Ga0105239_10099552
1139 Ga0105239_10122040
1140 Ga0105239_10369291
1141 Ga0105239_10621476
1142 Ga0105239_11544197
1143 Ga0105246_10052760
1144 Ga0105246_10957956
1145 Ga0105246_11149050
1146 Ga0105246_12156238
1147 Ga0157325_1033834
1148 Ga0157345_1014828
1149 Ga0157342_1057744
1150 Ga0157373_11040062
1151 Ga0157373_11564850
1152 Ga0157371_10584909
1153 Ga0157374_10029010
1154 Ga0157374_10047830
1155 Ga0157374_10342337
1156 Ga0157374_10431053
1157 Ga0157374_11896900
1158 Ga0157374_11964033
1159 Ga0157378_10061380
1160 Ga0157378_10222880
1161 Ga0157378_10260745
1162 Ga0157378_10950120
1163 Ga0163162_10000047
1164 Ga0163162_10000198
1165 Ga0163162_10010186
1166 Ga0163162_10010314
1167 Ga0163162_10163837
1168 Ga0163162_10204863
1169 Ga0163162_11396274
1170 Ga0157372_10091285
1171 Ga0157372_10147443
1172 Ga0157372_10168201
1173 Ga0157372_10740095
1174 Ga0157372_12573778
1175 Ga0157372_12726398
1176 Ga0157375_10011088
1177 Ga0157375_10098403
1178 Ga0157375_10212715
1179 Ga0157375_10263962
1180 Ga0157375_10389817
1181 Ga0157375_10469409
1182 Ga0157375_10619769
1183 Ga0157375_11360985
1184 Ga0157375_12954439
1185 Ga0163163_10001814
1186 Ga0163163_10214865
1187 Ga0163163_10225029
1188 Ga0163163_10248667
1189 Ga0163163_10396307
1190 Ga0157380_10017973
1191 Ga0157380_10232122
1192 Ga0157380_11693053
1193 Ga0182008_10353453
1194 Ga0157377_10007117
1195 Ga0157377_10015204
1196 Ga0157377_10367134
1197 Ga0157379_10165786
1198 Ga0157379_10330275
1199 Ga0157379_10395189
1200 Ga0157379_11528146
1201 Ga0157379_11592194
1202 Ga0157379_12537537
1203 Ga0157376_10014794
1204 Ga0157376_10159071
1205 Ga0157376_10856834
1206 Ga0163161_10004034
1207 Ga0207697_10024401
1208 Ga0207697_10353544
1209 Ga0207682_10036998
1210 Ga0207642_10281702
1211 Ga0207710_10002205
1212 Ga0207710_10160359
1213 Ga0207688_10086978
1214 Ga0207680_10485178
1215 Ga0207680_10840586
1216 Ga0207647_10200945
1217 Ga0207645_10097238
1218 Ga0207645_10227312
1219 Ga0207643_10452751
1220 Ga0207684_10669949
1221 Ga0207654_10051217
1222 Ga0207654_10201102
1223 Ga0207654_10242728
1224 Ga0207654_10854509
1225 Ga0207654_11081523
1226 Ga0207707_10000060
1227 Ga0207707_10029691
1228 Ga0207707_10071373
1229 Ga0207707_10463766
1230 Ga0207707_11073327
1231 Ga0207671_10058003
1232 Ga0207671_10080752
1233 Ga0207663_10947224
1234 Ga0207660_10040686
1235 Ga0207660_10050528
1236 Ga0207662_10004426
1237 Ga0207662_10082121
1238 Ga0207662_10369240
1239 Ga0207662_10627956
1240 Ga0207662_10900197
1241 Ga0207657_10032308
1242 Ga0207649_10008384
1243 Ga0207649_10718681
1244 Ga0207652_10000073
1245 Ga0207652_10544653
1246 Ga0207646_10248929
1247 Ga0207681_10059187
1248 Ga0207681_10242176
1249 Ga0207681_10616812
1250 Ga0207694_10064143
1251 Ga0207650_10334081
1252 Ga0207650_11093390
1253 Ga0207650_11579140
1254 Ga0207659_10110436
1255 Ga0207659_10619551
1256 Ga0207687_10294976
1257 Ga0207687_10642279
1258 Ga0207644_10113128
1259 Ga0207644_10377009
1260 Ga0207690_10217495
1261 Ga0207706_10067076
1262 Ga0207706_10101040
1263 Ga0207706_10544621
1264 Ga0207706_10660660
1265 Ga0207706_11121060
1266 Ga0207686_10394227
1267 Ga0207686_10464415
1268 Ga0207686_10616978
1269 Ga0207709_10344580
1270 Ga0207709_10561725
1271 Ga0207709_10576871
1272 Ga0207709_11089829
1273 Ga0207670_10779677
1274 Ga0207670_11372502
1275 Ga0207669_10349960
1276 Ga0207669_10509723
1277 Ga0207669_11687435
1278 Ga0207704_10385358
1279 Ga0207704_10414309
1280 Ga0207704_11200972
1281 Ga0207665_10228543
1282 Ga0207665_10843072
1283 Ga0207691_10008223
1284 Ga0207711_10089836
1285 Ga0207711_10101532
1286 Ga0207711_10122249
1287 Ga0207711_10229923
1288 Ga0207711_10408669
1289 Ga0207711_10522487
1290 Ga0207711_10636086
1291 Ga0207711_11162703
1292 Ga0207689_10009020
1293 Ga0207689_10041298
1294 Ga0207689_10256345
1295 Ga0207689_10588357
1296 Ga0207689_10651331
1297 Ga0207689_11102455
1298 Ga0207689_11774057
1299 Ga0207679_10057931
1300 Ga0207679_10353103
1301 Ga0207679_10487749
1302 Ga0207679_10504130
1303 Ga0207679_11691712
1304 Ga0207679_11813559
1305 Ga0207667_11235456
1306 Ga0207667_11306620
1307 Ga0207651_10168388
1308 Ga0207651_10170561
1309 Ga0207651_10778453
1310 Ga0207651_11183638
1311 Ga0207651_11755705
1312 Ga0207712_10000209
1313 Ga0207712_10019734
1314 Ga0207712_10059173
1315 Ga0207712_10445828
1316 Ga0207712_11393577
1317 Ga0207668_10020083
1318 Ga0207668_12000886
1319 Ga0207640_10127235
1320 Ga0207640_10169709
1321 Ga0207640_11166993
1322 Ga0207640_11667716
1323 Ga0207658_10309777
1324 Ga0207658_10414005
1325 Ga0207658_10567340
1326 Ga0207677_10144503
1327 Ga0207677_10289782
1328 Ga0207677_10764944
1329 Ga0207677_11429134
1330 Ga0207677_11817659
1331 Ga0207703_10192655
1332 Ga0207703_10272233
1333 Ga0207703_10444214
1334 Ga0207703_10979272
1335 Ga0207703_11025907
1336 Ga0207639_10005370
1337 Ga0207639_11146663
1338 Ga0207639_11963591
1339 Ga0207639_12144171
1340 Ga0207678_11020068
1341 Ga0207708_10005033
1342 Ga0207708_10397364
1343 Ga0207708_10487915
1344 Ga0207708_11468121
1345 Ga0207702_10040148
1346 Ga0207702_11596921
1347 Ga0207641_10239173
1348 Ga0207641_10494539
1349 Ga0207641_11689308
1350 Ga0207648_10025741
1351 Ga0207648_10323873
1352 Ga0207676_10019025
1353 Ga0207676_10063960
1354 Ga0207676_10156080
1355 Ga0207676_10267346
1356 Ga0207676_10281626
1357 Ga0207676_12065089
1358 Ga0207674_10000392
1359 Ga0207674_10088035
1360 Ga0207674_10478212
1361 Ga0207674_10764285
1362 Ga0207674_10930837
1363 Ga0207674_11937015
1364 Ga0207675_100005937
1365 Ga0207675_100044707
1366 Ga0207675_100116685
1367 Ga0207675_100516017
1368 Ga0207675_100635360
1369 Ga0207675_100740159
1370 Ga0207675_101343406
1371 Ga0207698_10290117
1372 Ga0207698_11497420
1373 Ga0207428_10158693
1374 Ga0207428_10219490
1375 Ga0207428_10244647
1376 Ga0268266_10537937
1377 Ga0268265_10048085
1378 Ga0268265_10141875
1379 Ga0268265_10541396
1380 Ga0268264_10208308
1381 Ga0268264_10215544
1382 Ga0268264_10380371
1383 Ga0314311_1168738
1384 Ga0307408_100200732
1385 Ga0307405_10548239
1386 Ga0307405_10549427
1387 Ga0307413_10122038
1388 Ga0307413_11741895
1389 Ga0307410_10342361
1390 Ga0307410_10481474
1391 Ga0307406_11200964
1392 Ga0307412_10031197
1393 Ga0307412_10123024
1394 Ga0307412_10597787
1395 Ga0307409_100338148
1396 Ga0307416_100139392
1397 Ga0307416_100157209
1398 Ga0307416_100184087
1399 Ga0307416_102761511
1400 Ga0307414_10000777
1401 Ga0307414_11139583
1402 Ga0307411_10473404
1403 Ga0307411_10760347
1404 Ga0307415_100009822
1405 Ga0307415_100064903
1406 Ga0307415_100178234
1407 Ga0307507_10419065
1408 Ga0373950_0018643
1409 Ga0373959_0177862
1410 Ga0373940_0108065
1411 Ga0373951_0144401
1412 Ga0373932_0417774
1413 Ga0373941_0010563
1414 Ga0373961_0030958
1415 Ga0373931_0457193
1416 Ga0373925_1015179
1417 Ga0242422_00110
1418 Ga0242420_012780
1419 Ga0242420_056452
1420 Ga0439433_0186776
1421 Ga0439457_127620
1422 Ga0439462_0256495
1423 Ga0451576_0876798
1424 Ga0495580_0893899
1425 Ga0495658_0042581
1426 Ga0496102_0372629
1427 Ga0496102_0631773
1428 Ga0496102_1976001
1429 Ga0496104_0042663
1430 Ga0496105_1182273
1431 Ga0496106_0014847
1432 Ga0496108_0076392
1433 Ga0496109_0099345
1434 Ga0496109_0702813
1435 Ga0496109_1510341
1436 Ga0496110_0821938
1437 Ga0496111_0618335
1438 Ga0496112_0259246
1439 Ga0496112_0564077
1440 Ga0496112_0906757
1441 Ga0496112_1649217
1442 Ga0501292_119050
1443 Ga0501295_006513
1444 Ga0501298_019647
1445 Ga0501299_064351
1446 Ga0501198_030204
1447 Ga0501202_028567
1448 Ga0501207_020593
1449 Ga0501216_020622
1450 Ga0501216_175051
1451 Ga0501217_039414
1452 Ga0501223_030639
1453 Ga0501227_095601
1454 Ga0501230_097152
1455 Ga0501233_039556
1456 Ga0501233_140620
1457 Ga0501235_024126
1458 Ga0501239_005572
1459 Ga0501240_006020
1460 Ga0501247_057226
1461 Ga0501251_049066
1462 Ga0501257_029673
1463 Ga0501260_014143
1464 Ga0501261_088222
1465 Ga0501221_106923
1466 Ga0501225_0030751
1467 Ga0501225_0255360
1468 Ga0501229_015650
1469 Ga0501234_015956
1470 Ga0501241_057201
1471 Ga0501241_062976
1472 Ga0501268_045390
1473 Ga0501268_127500
1474 Ga0501270_103882
1475 Ga0501270_168299
1476 Ga0501212_073033
1477 nmdc:mga05p37_1170419_c1
1478 nmdc:mga05p37_1808207_c1
1479 nmdc:mga05p37_247363_c1
1480 nmdc:mga05p37_257843_c1
1481 nmdc:mga05p37_403596_c1
1482 nmdc:mga05p37_425040_c1
1483 nmdc:mga05p37_592678_c1
1484 nmdc:mga09592_217329_c1
1485 nmdc:mga09592_559462_c1
1486 nmdc:mga09592_57028_c1
1487 nmdc:mga0qj67_1126451_c1
1488 nmdc:mga0qj67_134048_c1
1489 nmdc:mga0qj67_277850_c1
1490 nmdc:mga06r32_1079084_c1
1491 nmdc:mga06r32_113644_c1
1492 nmdc:mga06r32_926579_c1
1493 nmdc:mga06r32_93319_c1
1494 nmdc:mga08y16_49386_c1
1495 nmdc:mga0n895_1502287_c1
1496 nmdc:mga0n895_197692_c1
1497 nmdc:mga0n895_221524_c1
1498 nmdc:mga0n895_736163_c1
1499 nmdc:mga0n895_955860_c1
1500 nmdc:mga0rr50_12603_c1
1501 nmdc:mga0rr50_36970_c1
1502 nmdc:mga0rr50_689493_c1
1503 nmdc:mga08x19_13_c1
1504 nmdc:mga08x19_212218_c1
1505 nmdc:mga0a205_133234_c1
1506 nmdc:mga0a205_59343_c1
1507 nmdc:mga0a205_65483_c1
1508 nmdc:mga0a205_756918_c1
1509 Ga0500616_0001231
1510 Ga0587072_114042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01192

RNA_pol_Rpb6

RNA polymerase Rpb6

28

80

0.93

Map